F481611

General Info

Members Datasets Scaffolds Average Seq Length
805 395 1610 268

Family's Representative Sequence

Representative Sequence 3300041451|Ga0451791_0563576|Ga0451791_0563576_963_1928
Length 321
Sequence VTYQPLVIASVDCIRQTETEFRGAPTTSRMTEAHIALTRQADQYSTTLVRWDAAMTPPTRPSVVFIHGLWLHATSWAPWVDLFTEQGYSVSAPGWPGEPDTVDEARAQPDTVANVGIDDVVDHYTSIISNLPTAPVLIGHSFGGMIAEKLLGNGVAAAAIAIDAAQIKGVLPLPLSALRSTLPVFKNPANKHRSVSLTAEQFRYGFGNAIPADESDSIWDRWAVPSPGKPLFEAATANFSPHSPAEVNTGNEKRGPLLLMMGGQDHTVPESITKATLKQYRHSDAKTELVEFADRGHSLVVDHGWRDVADGCLSWLKDNDL

Samples

Sample ID Description Type Environment
1 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
110 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
169 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
170 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
171 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
172 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
176 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
177 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
178 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
197 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
198 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
199 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
200 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
201 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
204 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
210 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
228 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
229 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
230 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
231 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
232 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
233 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
234 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
235 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
236 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
237 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
238 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
239 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
240 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
248 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
251 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
256 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
266 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
267 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
270 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
276 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
277 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
278 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
279 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
280 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
286 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
287 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
288 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
289 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
290 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
291 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
294 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
295 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
296 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
297 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
298 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
299 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
300 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
301 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
319 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
320 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
321 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
322 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
325 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
326 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
327 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
328 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
329 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
330 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
331 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
338 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
339 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
340 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
341 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
342 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
343 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
344 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
347 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
348 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
349 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
350 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
351 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
352 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
353 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
354 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
355 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
356 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
357 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
358 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
359 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
360 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
361 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
362 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
363 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
364 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
367 2517572101 Frankia sp. DC12 Isolate Nodule
368 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
369 2643221604 Nocardioides sp. Root190 Isolate Unclassified
370 2643221615 Nocardioides sp. Root224 Isolate Unclassified
371 2643221617 Nocardioides sp. Root79 Isolate Unclassified
372 2643221620 Nocardioides sp. Root240 Isolate Unclassified
373 2643221647 Streptomyces sp. Root369 Isolate Unclassified
374 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
375 2643221711 Terrabacter sp. Root85 Isolate Unclassified
376 2671180195 Frankia sp. CcI49 Isolate Nodule
377 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
378 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
379 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
380 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
381 2738541305 Nocardioides sp. CF167 Isolate Unclassified
382 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
383 2773857922 Frankia sp. CcI49 Isolate Nodule
384 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
385 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
386 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
387 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
388 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
389 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
390 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
391 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
392 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
393 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
394 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
395 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.29
Metatranscriptomes 1.99
Isolates 3.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.6
Nodule 0.75
Rhizoplane 7.33
Rhizosphere 78.63
Stem 0
Stem Tuber 0
Unclassified 3.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451791_0563576 3300041451 Bacteria 2570
2 SwRhRL3b_contig_3075825 2162886006 Bacteria 5127
3 SwRhRL2b_contig_1636080 2162886007 Bacteria 8806
4 SwRhRL2b_contig_263429 2162886007 Bacteria 5459
5 JGI24740J21852_10003178 3300001979 Bacteria 7250
6 JGI24739J22299_10002670 3300001989 Bacteria 6871
7 JGI25406J46586_10004716 3300003203 Bacteria 6342
8 rootH1_10139703 3300003316 Unclassified 2513
9 rootH2_10011879 3300003320 Bacteria 7276
10 rootL2_10022689 3300003322 Bacteria 2286
11 rootH1_10014156 3300003323 Bacteria 5101
12 rootH1_10172323 3300003323 Bacteria 2151
13 Ga0006562J51391_1161591 3300003578 Bacteria 1155
14 Ga0065714_10008505 3300005288 Bacteria 3703
15 Ga0065704_10003330 3300005289 Bacteria 6747
16 Ga0065704_10109781 3300005289 Bacteria 1995
17 Ga0065707_10000955 3300005295 Bacteria 14002
18 Ga0065707_10002453 3300005295 Bacteria 4570
19 Ga0065707_10089187 3300005295 Bacteria 4442
20 Ga0070676_10116388 3300005328 Bacteria 1672
21 Ga0070683_100051887 3300005329 Bacteria 3798
22 Ga0070670_100063801 3300005331 Bacteria 3161
23 Ga0068869_100282712 3300005334 Bacteria 1334
24 Ga0070666_10169282 3300005335 Bacteria 1529
25 Ga0070680_100455500 3300005336 Bacteria 1093
26 Ga0070682_100083667 3300005337 Bacteria 2071
27 Ga0070682_100102920 3300005337 Bacteria 1888
28 Ga0070682_100313164 3300005337 Bacteria 1156
29 Ga0070660_100090204 3300005339 Bacteria 2416
30 Ga0070689_100098226 3300005340 Bacteria 2316
31 Ga0070668_100003833 3300005347 Bacteria 11108
32 Ga0070668_100014010 3300005347 Bacteria 5996
33 Ga0070674_100039761 3300005356 Bacteria 3178
34 Ga0070714_100017801 3300005435 Bacteria 5762
35 Ga0070714_100029035 3300005435 Bacteria 4595
36 Ga0070714_100167878 3300005435 Bacteria 1989
37 Ga0070714_100213293 3300005435 Bacteria 1771
38 Ga0070714_100293043 3300005435 Bacteria 1515
39 Ga0070713_100203338 3300005436 Bacteria 1790
40 Ga0070713_100324233 3300005436 Bacteria 1423
41 Ga0070710_10149008 3300005437 Bacteria 1441
42 Ga0070711_100283618 3300005439 Bacteria 1311
43 Ga0070705_100024665 3300005440 Bacteria 3250
44 Ga0070705_100413040 3300005440 Bacteria 1003
45 Ga0070694_100029932 3300005444 Bacteria 3557
46 Ga0070694_100150345 3300005444 Unclassified 1700
47 Ga0070708_100001186 3300005445 Bacteria 20030
48 Ga0070708_100201539 3300005445 Bacteria 1863
49 Ga0070708_100220819 3300005445 Bacteria 1777
50 Ga0070663_100015359 3300005455 Bacteria 4940
51 Ga0070663_100029422 3300005455 Bacteria 3754
52 Ga0070663_100070056 3300005455 Bacteria 2549
53 Ga0070663_100275918 3300005455 Bacteria 1338
54 Ga0070663_100566234 3300005455 Bacteria 951
55 Ga0070681_10179746 3300005458 Bacteria 2037
56 Ga0070681_10208234 3300005458 Bacteria 1872
57 Ga0070685_10432802 3300005466 Bacteria 918
58 Ga0070706_100024866 3300005467 Bacteria 5513
59 Ga0070706_100160243 3300005467 Bacteria 2101
60 Ga0070706_100223309 3300005467 Bacteria 1758
61 Ga0070707_100045596 3300005468 Bacteria 4195
62 Ga0070707_100050245 3300005468 Bacteria 3996
63 Ga0070707_100056181 3300005468 Bacteria 3775
64 Ga0070707_100077513 3300005468 Bacteria 3207
65 Ga0070707_100346887 3300005468 Unclassified 1442
66 Ga0070698_100021311 3300005471 Bacteria 6789
67 Ga0070698_100036033 3300005471 Bacteria 5114
68 Ga0070698_100047180 3300005471 Bacteria 4403
69 Ga0070698_100070228 3300005471 Bacteria 3515
70 Ga0070698_100092090 3300005471 Bacteria 3012
71 Ga0070698_100143489 3300005471 Unclassified 2338
72 Ga0070698_100237096 3300005471 Unclassified 1757
73 Ga0070698_100332920 3300005471 Bacteria 1449
74 Ga0070698_100584464 3300005471 Bacteria 1057
75 Ga0070699_100024557 3300005518 Bacteria 5195
76 Ga0070699_100068207 3300005518 Bacteria 3088
77 Ga0070699_100221802 3300005518 Unclassified 1685
78 Ga0070699_100376727 3300005518 Bacteria 1281
79 Ga0070679_100129709 3300005530 Bacteria 2503
80 Ga0070679_100153591 3300005530 Bacteria 2278
81 Ga0070684_100292818 3300005535 Bacteria 1493
82 Ga0070697_100003819 3300005536 Bacteria 11568
83 Ga0070697_100008467 3300005536 Bacteria 8026
84 Ga0068853_100101917 3300005539 Bacteria 2540
85 Ga0068853_100439999 3300005539 Bacteria 1225
86 Ga0068853_100488974 3300005539 Bacteria 1161
87 Ga0070695_100005000 3300005545 Bacteria 7815
88 Ga0070695_100096021 3300005545 Bacteria 1988
89 Ga0070693_100015180 3300005547 Bacteria 3962
90 Ga0070693_100028774 3300005547 Bacteria 3024
91 Ga0070665_100047050 3300005548 Bacteria 4330
92 Ga0070665_100097556 3300005548 Bacteria 2944
93 Ga0070665_100223587 3300005548 Bacteria 1883
94 Ga0070665_100397702 3300005548 Bacteria 1385
95 Ga0070665_100496859 3300005548 Bacteria 1231
96 Ga0070704_100161279 3300005549 Bacteria 1774
97 Ga0068855_100001615 3300005563 Bacteria 28292
98 Ga0068855_100005008 3300005563 Bacteria 16169
99 Ga0068855_100032789 3300005563 Bacteria 6201
100 Ga0068855_100283076 3300005563 Bacteria 1840
101 Ga0070664_100223826 3300005564 Bacteria 1684
102 Ga0070664_100420148 3300005564 Bacteria 1224
103 Ga0068857_100104550 3300005577 Bacteria 2542
104 Ga0068854_100086898 3300005578 Bacteria 2319
105 Ga0068856_100047801 3300005614 Bacteria 4216
106 Ga0068856_100135308 3300005614 Bacteria 2469
107 Ga0068856_100669969 3300005614 Bacteria 1058
108 Ga0068852_100011046 3300005616 Bacteria 6779
109 Ga0068852_100045201 3300005616 Bacteria 3744
110 Ga0068852_100595912 3300005616 Bacteria 1109
111 Ga0068859_100146064 3300005617 Bacteria 2440
112 Ga0068859_100236992 3300005617 Bacteria 1914
113 Ga0068864_100062119 3300005618 Bacteria 3236
114 Ga0068861_100156819 3300005719 Bacteria 1874
115 Ga0068861_100292570 3300005719 Bacteria 1407
116 Ga0068870_10284353 3300005840 Bacteria 1038
117 Ga0068863_100119101 3300005841 Bacteria 2516
118 Ga0068863_100306800 3300005841 Bacteria 1540
119 Ga0068858_100263576 3300005842 Bacteria 1638
120 Ga0068860_100566056 3300005843 Bacteria 1139
121 Ga0081540_1007257 3300005983 Bacteria 7937
122 Ga0081540_1016479 3300005983 Bacteria 4621
123 Ga0081539_10000173 3300005985 Bacteria 151356
124 Ga0081539_10000218 3300005985 Bacteria 134538
125 Ga0081539_10007179 3300005985 Bacteria 10266
126 Ga0081539_10013574 3300005985 Bacteria 6126
127 Ga0070717_10013282 3300006028 Bacteria 6304
128 Ga0070717_10141028 3300006028 Bacteria 2079
129 Ga0070717_10220988 3300006028 Bacteria 1665
130 Ga0075365_10060461 3300006038 Bacteria 2528
131 Ga0075365_10272247 3300006038 Bacteria 1191
132 Ga0075368_10004079 3300006042 Bacteria 4915
133 Ga0070715_10093813 3300006163 Bacteria 1386
134 Ga0070715_10117422 3300006163 Bacteria 1263
135 Ga0070716_100277260 3300006173 Bacteria 1155
136 Ga0075367_10002868 3300006178 Bacteria 8020
137 Ga0097621_100293810 3300006237 Bacteria 1433
138 Ga0068871_100137015 3300006358 Bacteria 2079
139 Ga0075428_100027636 3300006844 Bacteria 6276
140 Ga0075428_100638786 3300006844 Bacteria 1136
141 Ga0075430_100164754 3300006846 Bacteria 1845
142 Ga0075431_100567827 3300006847 Bacteria 1121
143 Ga0075433_10037475 3300006852 Bacteria 4184
144 Ga0075433_10258797 3300006852 Bacteria 1543
145 Ga0075434_100235757 3300006871 Bacteria 1850
146 Ga0075429_100104505 3300006880 Bacteria 2474
147 Ga0075429_100106618 3300006880 Bacteria 2448
148 Ga0097620_100146061 3300006931 Bacteria 2440
149 Ga0097620_100236980 3300006931 Bacteria 1914
150 Ga0099826_10041439 3300006948 Bacteria 3194
151 Ga0075435_100542312 3300007076 Bacteria 1007
152 Ga0099794_10000379 3300007265 Bacteria 15234
153 Ga0099794_10005625 3300007265 Bacteria 5042
154 Ga0105240_10056946 3300009093 Bacteria 4888
155 Ga0105240_10117833 3300009093 Bacteria 3201
156 Ga0105240_10119056 3300009093 Bacteria 3182
157 Ga0105240_10398298 3300009093 Bacteria 1551
158 Ga0111539_10141916 3300009094 Bacteria 2812
159 Ga0111539_10536330 3300009094 Bacteria 1363
160 Ga0114129_10028608 3300009147 Bacteria 7896
161 Ga0114129_10030668 3300009147 Bacteria 7606
162 Ga0114129_10046008 3300009147 Bacteria 6133
163 Ga0114129_10125823 3300009147 Bacteria 3524
164 Ga0114129_10224132 3300009147 Bacteria 2535
165 Ga0114129_10256358 3300009147 Bacteria 2346
166 Ga0114129_10314882 3300009147 Unclassified 2082
167 Ga0114129_10346329 3300009147 Bacteria 1969
168 Ga0105243_10005513 3300009148 Bacteria 9864
169 Ga0105243_10541372 3300009148 Bacteria 1111
170 Ga0105241_10053509 3300009174 Bacteria 3087
171 Ga0105241_10402390 3300009174 Bacteria 1201
172 Ga0105242_10074140 3300009176 Bacteria 2831
173 Ga0105248_10091789 3300009177 Bacteria 3420
174 Ga0105237_10052132 3300009545 Bacteria 4108
175 Ga0105237_10055854 3300009545 Bacteria 3954
176 Ga0105237_10164127 3300009545 Bacteria 2220
177 Ga0105238_10007250 3300009551 Bacteria 11101
178 Ga0105238_10059161 3300009551 Bacteria 3839
179 Ga0105238_10261163 3300009551 Bacteria 1711
180 Ga0105238_10864939 3300009551 Bacteria 921
181 Ga0105249_10033201 3300009553 Unclassified 4672
182 Ga0105239_10020514 3300010375 Bacteria 7288
183 Ga0105239_10027480 3300010375 Bacteria 6263
184 Ga0105239_10056718 3300010375 Bacteria 4297
185 Ga0105239_10234395 3300010375 Bacteria 2060
186 Ga0105246_10029860 3300011119 Bacteria 3594
187 Ga0157373_10324354 3300013100 Bacteria 1096
188 Ga0157370_10142755 3300013104 Bacteria 2231
189 Ga0157369_10102253 3300013105 Bacteria 3054
190 Ga0157369_10447667 3300013105 Bacteria 1337
191 Ga0157369_10546483 3300013105 Bacteria 1197
192 Ga0157374_10041693 3300013296 Bacteria 4231
193 Ga0157374_10057979 3300013296 Bacteria 3618
194 Ga0157372_10079592 3300013307 Bacteria 3706
195 Ga0157372_10298963 3300013307 Bacteria 1872
196 Ga0157372_10319806 3300013307 Bacteria 1807
197 Ga0157375_10040826 3300013308 Bacteria 4476
198 Ga0157375_10381002 3300013308 Bacteria 1577
199 Ga0163163_10120759 3300014325 Bacteria 2654
200 Ga0163163_10289516 3300014325 Bacteria 1690
201 Ga0163163_10816851 3300014325 Bacteria 996
202 Ga0182008_10001729 3300014497 Bacteria 14335
203 Ga0157377_10250410 3300014745 Bacteria 1148
204 Ga0157379_10036629 3300014968 Bacteria 4374
205 Ga0157376_10288646 3300014969 Bacteria 1548
206 Ga0182007_10007209 3300015262 Bacteria 4685
207 Ga0183367_1004 3300015688 Bacteria 716880
208 Ga0197907_11300308 3300020069 Bacteria 2187
209 Ga0206356_11149848 3300020070 Bacteria 1181
210 Ga0206349_1979773 3300020075 Bacteria 1984
211 Ga0206355_1239282 3300020076 Bacteria 1604
212 Ga0206351_10315251 3300020077 Bacteria 2505
213 Ga0206352_11125578 3300020078 Bacteria 1256
214 Ga0206350_10016465 3300020080 Bacteria 2358
215 Ga0206350_10555428 3300020080 Bacteria 976
216 Ga0206354_11034032 3300020081 Bacteria 1907
217 Ga0206354_11077463 3300020081 Bacteria 1184
218 Ga0206353_11150681 3300020082 Bacteria 1022
219 Ga0206353_11348600 3300020082 Bacteria 1173
220 Ga0154015_1558468 3300020610 Bacteria 3056
221 Ga0213873_10012688 3300021358 Bacteria 1832
222 Ga0213875_10001136 3300021388 Bacteria 18301
223 Ga0213875_10025499 3300021388 Bacteria 2817
224 Ga0224712_10014297 3300022467 Bacteria 2551
225 Ga0224712_10062840 3300022467 Bacteria 1484
226 Ga0209758_1005093 3300025297 Bacteria 10405
227 Ga0207653_10004255 3300025885 Bacteria 4498
228 Ga0207692_10007533 3300025898 Bacteria 4462
229 Ga0207692_10132031 3300025898 Bacteria 1411
230 Ga0207688_10158084 3300025901 Bacteria 1342
231 Ga0207647_10002020 3300025904 Bacteria 15521
232 Ga0207647_10003293 3300025904 Bacteria 12130
233 Ga0207647_10018266 3300025904 Bacteria 4749
234 Ga0207699_10017074 3300025906 Bacteria 3810
235 Ga0207699_10352449 3300025906 Bacteria 1039
236 Ga0207643_10066625 3300025908 Bacteria 2065
237 Ga0207684_10169966 3300025910 Bacteria 1879
238 Ga0207684_10310947 3300025910 Bacteria 1358
239 Ga0207707_10108337 3300025912 Bacteria 2428
240 Ga0207707_10188710 3300025912 Bacteria 1798
241 Ga0207707_10189415 3300025912 Bacteria 1795
242 Ga0207707_10245884 3300025912 Bacteria 1554
243 Ga0207695_10007827 3300025913 Bacteria 13519
244 Ga0207695_10011119 3300025913 Bacteria 10927
245 Ga0207695_10284850 3300025913 Bacteria 1545
246 Ga0207671_10003792 3300025914 Bacteria 14834
247 Ga0207671_10004981 3300025914 Bacteria 12439
248 Ga0207671_10039693 3300025914 Bacteria 3486
249 Ga0207693_10029588 3300025915 Bacteria 4324
250 Ga0207693_10032134 3300025915 Bacteria 4144
251 Ga0207663_10360218 3300025916 Bacteria 1103
252 Ga0207657_10058253 3300025919 Bacteria 3325
253 Ga0207646_10023471 3300025922 Bacteria 5665
254 Ga0207646_10065981 3300025922 Bacteria 3231
255 Ga0207646_10070215 3300025922 Unclassified 3128
256 Ga0207646_10085834 3300025922 Bacteria 2815
257 Ga0207694_10002783 3300025924 Bacteria 14120
258 Ga0207694_10047018 3300025924 Bacteria 3337
259 Ga0207650_10053041 3300025925 Bacteria 3005
260 Ga0207650_10484242 3300025925 Bacteria 1033
261 Ga0207659_10028415 3300025926 Bacteria 3801
262 Ga0207700_10009251 3300025928 Bacteria 6146
263 Ga0207700_10124867 3300025928 Bacteria 2092
264 Ga0207700_10242308 3300025928 Bacteria 1537
265 Ga0207700_10425078 3300025928 Bacteria 1168
266 Ga0207700_10631329 3300025928 Bacteria 954
267 Ga0207664_10004878 3300025929 Bacteria 9117
268 Ga0207664_10014874 3300025929 Bacteria 5633
269 Ga0207664_10027629 3300025929 Bacteria 4304
270 Ga0207664_10082644 3300025929 Bacteria 2616
271 Ga0207664_10095366 3300025929 Bacteria 2447
272 Ga0207664_10273984 3300025929 Bacteria 1479
273 Ga0207664_10418478 3300025929 Bacteria 1193
274 Ga0207686_10100915 3300025934 Bacteria 1927
275 Ga0207709_10086750 3300025935 Bacteria 2033
276 Ga0207709_10146312 3300025935 Bacteria 1631
277 Ga0207709_10150310 3300025935 Bacteria 1612
278 Ga0207669_10033141 3300025937 Bacteria 2911
279 Ga0207669_10264392 3300025937 Bacteria 1289
280 Ga0207669_10466945 3300025937 Bacteria 1003
281 Ga0207665_10056251 3300025939 Bacteria 2655
282 Ga0207691_10140317 3300025940 Bacteria 2130
283 Ga0207711_10062678 3300025941 Bacteria 3207
284 Ga0207689_10093608 3300025942 Bacteria 2468
285 Ga0207661_10126180 3300025944 Bacteria 2186
286 Ga0207661_10701847 3300025944 Bacteria 931
287 Ga0207679_10192766 3300025945 Bacteria 1696
288 Ga0207679_10288580 3300025945 Bacteria 1410
289 Ga0207667_10006703 3300025949 Bacteria 13918
290 Ga0207667_10073859 3300025949 Bacteria 3543
291 Ga0207712_10011952 3300025961 Bacteria 5538
292 Ga0207668_10004702 3300025972 Bacteria 8033
293 Ga0207668_10016690 3300025972 Bacteria 4587
294 Ga0207668_10040811 3300025972 Bacteria 3133
295 Ga0207640_10019999 3300025981 Bacteria 3967
296 Ga0207640_10235200 3300025981 Bacteria 1412
297 Ga0207639_10038634 3300026041 Bacteria 3551
298 Ga0207639_10264660 3300026041 Bacteria 1505
299 Ga0207639_10377038 3300026041 Bacteria 1273
300 Ga0207678_10002060 3300026067 Bacteria 18229
301 Ga0207678_10012846 3300026067 Bacteria 7351
302 Ga0207678_10106131 3300026067 Bacteria 2396
303 Ga0207708_10132841 3300026075 Bacteria 1947
304 Ga0207702_10028440 3300026078 Bacteria 4646
305 Ga0207702_10370905 3300026078 Bacteria 1374
306 Ga0207641_10100640 3300026088 Bacteria 2546
307 Ga0207641_10210472 3300026088 Bacteria 1798
308 Ga0207676_10381848 3300026095 Bacteria 1312
309 Ga0207674_10092503 3300026116 Bacteria 3014
310 Ga0207674_10416180 3300026116 Bacteria 1299
311 Ga0207675_100153339 3300026118 Bacteria 2194
312 Ga0207675_100511011 3300026118 Bacteria 1197
313 Ga0207683_10002509 3300026121 Bacteria 16016
314 Ga0207698_10020317 3300026142 Bacteria 4569
315 Ga0207698_10468480 3300026142 Bacteria 1219
316 Ga0209371_1041838 3300027312 Bacteria 925
317 Ga0209588_1002430 3300027671 Bacteria 5048
318 Ga0209588_1066879 3300027671 Bacteria 1161
319 Ga0209813_10003614 3300027866 Bacteria 3634
320 Ga0268266_10091363 3300028379 Bacteria 2669
321 Ga0268266_10371048 3300028379 Bacteria 1348
322 Ga0268266_10432896 3300028379 Bacteria 1248
323 Ga0268265_10129262 3300028380 Bacteria 2096
324 Ga0268265_10141091 3300028380 Unclassified 2018
325 Ga0268265_10231276 3300028380 Bacteria 1625
326 Ga0268265_10237875 3300028380 Bacteria 1605
327 Ga0268264_10418906 3300028381 Bacteria 1291
328 Ga0265337_1003592 3300028556 Bacteria 6665
329 Ga0265326_10004837 3300028558 Bacteria 4273
330 Ga0265318_10060858 3300028577 Bacteria 1407
331 Ga0265336_10015575 3300028666 Bacteria 2498
332 Ga0307517_10015716 3300028786 Bacteria 10027
333 Ga0307517_10098017 3300028786 Bacteria 2336
334 Ga0307515_10035516 3300028794 Bacteria 8104
335 Ga0265338_10001125 3300028800 Bacteria 44338
336 Ga0265338_10002141 3300028800 Bacteria 30351
337 Ga0265338_10021555 3300028800 Bacteria 6712
338 Ga0265324_10003209 3300029957 Bacteria 7909
339 Ga0268256_1047437 3300030500 Bacteria 925
340 Ga0307511_10001845 3300030521 Bacteria 22256
341 Ga0307512_10012522 3300030522 Bacteria 8005
342 Ga0265332_10009694 3300031238 Bacteria 4296
343 Ga0265320_10007771 3300031240 Bacteria 6623
344 Ga0265325_10151626 3300031241 Bacteria 1096
345 Ga0265340_10009313 3300031247 Bacteria 5273
346 Ga0307513_10010495 3300031456 Bacteria 11599
347 Ga0307513_10270749 3300031456 Bacteria 1482
348 Ga0307509_10008191 3300031507 Bacteria 13384
349 Ga0307509_10014865 3300031507 Bacteria 9124
350 Ga0307509_10057050 3300031507 Bacteria 4143
351 Ga0307509_10132730 3300031507 Bacteria 2442
352 Ga0307509_10297031 3300031507 Bacteria 1366
353 Ga0307508_10009307 3300031616 Bacteria 9038
354 Ga0307508_10099344 3300031616 Bacteria 2504
355 Ga0265342_10012194 3300031712 Bacteria 5830
356 Ga0307516_10005367 3300031730 Bacteria 15401
357 Ga0307516_10011460 3300031730 Bacteria 9626
358 Ga0307516_10011822 3300031730 Bacteria 9460
359 Ga0307516_10026405 3300031730 Bacteria 5897
360 Ga0307516_10121392 3300031730 Bacteria 2403
361 Ga0307405_10081816 3300031731 Bacteria 2112
362 Ga0307518_10013497 3300031838 Bacteria 5839
363 Ga0307518_10213395 3300031838 Bacteria 1268
364 Ga0307410_10213807 3300031852 Bacteria 1479
365 Ga0307406_10472177 3300031901 Bacteria 1011
366 Ga0307407_10380370 3300031903 Bacteria 1008
367 Ga0307409_100319979 3300031995 Bacteria 1451
368 Ga0307409_100350195 3300031995 Bacteria 1393
369 Ga0307411_10426864 3300032005 Bacteria 1103
370 Ga0307415_100122260 3300032126 Bacteria 1954
371 Ga0307507_10000764 3300033179 Bacteria 70897
372 Ga0307507_10010565 3300033179 Bacteria 11899
373 Ga0307510_10008462 3300033180 Bacteria 12260
374 Ga0373930_0017205 3300034816 Bacteria 1376
375 Ga0373938_0040689 3300034957 Bacteria 1032
376 Ga0373926_0004626 3300035083 Bacteria 4520
377 Ga0373928_0064565 3300035084 Bacteria 892
378 Ga0373934_0037648 3300035086 Bacteria 1904
379 Ga0373944_0000495 3300035089 Bacteria 9161
380 Ga0373944_0004271 3300035089 Bacteria 3714
381 Ga0373951_0000007 3300035091 Bacteria 82975
382 Ga0373923_0004925 3300035111 Bacteria 4485
383 Ga0373923_0032357 3300035111 Bacteria 2112
384 Ga0373936_0000130 3300035113 Bacteria 26133
385 Ga0373936_0000832 3300035113 Bacteria 10967
386 Ga0373936_0006171 3300035113 Bacteria 4516
387 Ga0373945_0000149 3300035116 Bacteria 17816
388 Ga0373945_0008677 3300035116 Bacteria 3315
389 Ga0373954_0138525 3300035118 Unclassified 1186
390 Ga0373956_0011655 3300035119 Bacteria 3625
391 Ga0373956_0020262 3300035119 Bacteria 2828
392 Ga0373957_0002159 3300035120 Bacteria 5546
393 Ga0373957_0115950 3300035120 Bacteria 1081
394 Ga0373943_0000215 3300035170 Bacteria 23592
395 Ga0373943_0000957 3300035170 Bacteria 12812
396 Ga0373946_0000093 3300035171 Bacteria 24751
397 Ga0373946_0024650 3300035171 Bacteria 2359
398 Ga0373946_0095299 3300035171 Bacteria 1326
399 Ga0373955_0226615 3300035172 Bacteria 1117
400 Ga0373924_0003990 3300035410 Bacteria 5124
401 Ga0373924_0009400 3300035410 Bacteria 3581
402 Ga0373924_0099711 3300035410 Bacteria 1248
403 Ga0373935_0003933 3300035692 Bacteria 8676
404 Ga0373935_0038244 3300035692 Bacteria 3003
405 Ga0373927_0003366 3300035695 Bacteria 11501
406 Ga0373933_0150265 3300035724 Unclassified 1474
407 Ga0373947_0000281 3300035725 Bacteria 28827
408 Ga0373947_0001422 3300035725 Bacteria 14726
409 Ga0373937_0365024 3300036401 Bacteria 1369
410 Ga0373937_0368784 3300036401 Bacteria 1361
411 Ga0373937_0707011 3300036401 Bacteria 954
412 Ga0373925_0000938 3300037068 Bacteria 26552
413 Ga0373925_0063645 3300037068 Bacteria 2775
414 Ga0395899_0019364 3300037312 Bacteria 5171
415 Ga0395905_0028163 3300037471 Bacteria 5295
416 Ga0395905_0189242 3300037471 Bacteria 1931
417 Ga0436364_0106543 3300037853 Bacteria 8816
418 Ga0436364_0251595 3300037853 Bacteria 5042
419 Ga0436364_0322086 3300037853 Bacteria 1292
420 Ga0436364_0547435 3300037853 Bacteria 2234
421 Ga0436364_1094297 3300037853 Bacteria 1479
422 Ga0436364_1513258 3300037853 Bacteria 41820
423 Ga0395901_0055031 3300038443 Bacteria 4136
424 Ga0395901_0231231 3300038443 Bacteria 1930
425 Ga0436365_0709127 3300039437 Bacteria 6287
426 Ga0436363_0132265 3300039450 Bacteria 1224
427 Ga0436363_0210186 3300039450 Bacteria 1271
428 Ga0436363_0669568 3300039450 Bacteria 4597
429 Ga0451791_0533426 3300041451 Bacteria 12768
430 Ga0451791_1032133 3300041451 Bacteria 2281
431 Ga0451793_0872584 3300041452 Bacteria 2655
432 Ga0451797_0534996 3300041453 Bacteria 1568
433 Ga0451833_0544441 3300041491 Bacteria 2382
434 Ga0451849_1317838 3300041505 Bacteria 1855
435 Ga0451843_1022444 3300041509 Bacteria 2379
436 Ga0451843_1657210 3300041509 Bacteria 1193
437 Ga0451853_0634586 3300041512 Bacteria 988
438 Ga0451853_1790813 3300041512 Bacteria 3352
439 Ga0450903_000935 3300042138 Bacteria 5601
440 Ga0439458_0001541 3300042157 Bacteria 5758
441 Ga0466972_0003733 3300044658 Bacteria 7572
442 Ga0466972_0047018 3300044658 Bacteria 2088
443 Ga0466965_0059194 3300044683 Bacteria 1911
444 Ga0466963_0022039 3300044694 Bacteria 4029
445 Ga0466963_0033665 3300044694 Bacteria 3329
446 Ga0466963_0067818 3300044694 Bacteria 2395
447 Ga0466963_0095012 3300044694 Bacteria 2034
448 Ga0466963_0452817 3300044694 Bacteria 906
449 Ga0453684_0055272 3300044712 Bacteria 5163
450 Ga0466968_0002819 3300044735 Bacteria 6427
451 Ga0466960_0070191 3300044901 Bacteria 1742
452 Ga0451576_0383906 3300045051 Unclassified 1472
453 Ga0466958_0081307 3300045836 Bacteria 1994
454 Ga0466958_0142051 3300045836 Bacteria 1512
455 Ga0466958_0211069 3300045836 Bacteria 1237
456 Ga0466967_0017599 3300045976 Bacteria 5682
457 Ga0495592_0013236 3300046454 Bacteria 6279
458 Ga0495592_0096503 3300046454 Bacteria 2113
459 Ga0495603_0005209 3300046455 Bacteria 7761
460 Ga0495603_0011279 3300046455 Bacteria 5415
461 Ga0495603_0211718 3300046455 Bacteria 1119
462 Ga0495629_0013616 3300046459 Bacteria 5869
463 Ga0495629_0064455 3300046459 Unclassified 2558
464 Ga0495629_0104900 3300046459 Bacteria 1972
465 Ga0495629_0105539 3300046459 Bacteria 1965
466 Ga0495629_0243420 3300046459 Bacteria 1238
467 Ga0495638_0285927 3300046460 Bacteria 894
468 Ga0495641_0006885 3300046461 Bacteria 7260
469 Ga0495641_0046578 3300046461 Bacteria 1993
470 Ga0495651_0000379 3300046462 Bacteria 34464
471 Ga0495651_0024679 3300046462 Bacteria 4677
472 Ga0495651_0055128 3300046462 Bacteria 3055
473 Ga0495651_0132587 3300046462 Bacteria 1817
474 Ga0495651_0166970 3300046462 Bacteria 1571
475 Ga0495653_0008557 3300046463 Bacteria 8388
476 Ga0495653_0049045 3300046463 Bacteria 3255
477 Ga0495653_0089841 3300046463 Bacteria 2249
478 Ga0495580_0156654 3300046472 Bacteria 1577
479 Ga0495580_0185560 3300046472 Bacteria 1436
480 Ga0495582_0003457 3300046473 Bacteria 8905
481 Ga0495662_0023431 3300046476 Bacteria 2981
482 Ga0495662_0064196 3300046476 Bacteria 1774
483 Ga0495662_0073211 3300046476 Unclassified 1661
484 Ga0495664_0000201 3300046477 Bacteria 28936
485 Ga0495664_0012750 3300046477 Bacteria 4761
486 Ga0495664_0023357 3300046477 Bacteria 3589
487 Ga0495664_0037923 3300046477 Bacteria 2845
488 Ga0495664_0038774 3300046477 Bacteria 2813
489 Ga0495585_0011662 3300046492 Bacteria 5199
490 Ga0495594_0005111 3300046499 Bacteria 6752
491 Ga0495594_0036012 3300046499 Bacteria 2698
492 Ga0495594_0049759 3300046499 Bacteria 2304
493 Ga0495594_0057012 3300046499 Bacteria 2157
494 Ga0495594_0156008 3300046499 Bacteria 1296
495 Ga0495608_0010295 3300046511 Bacteria 6524
496 Ga0495608_0217886 3300046511 Bacteria 1198
497 Ga0495618_0067670 3300046514 Bacteria 2271
498 Ga0495618_0107644 3300046514 Bacteria 1785
499 Ga0495628_0028761 3300046516 Bacteria 4514
500 Ga0495628_0070517 3300046516 Bacteria 2725
501 Ga0495628_0075805 3300046516 Bacteria 2619
502 Ga0495628_0092354 3300046516 Bacteria 2341
503 Ga0495630_0018527 3300046517 Bacteria 5115
504 Ga0495630_0031131 3300046517 Bacteria 3971
505 Ga0495630_0075780 3300046517 Bacteria 2534
506 Ga0495643_0001146 3300046522 Bacteria 25946
507 Ga0495666_0000552 3300046526 Bacteria 16660
508 Ga0495666_0013381 3300046526 Bacteria 4091
509 Ga0495652_0000907 3300046529 Bacteria 34031
510 Ga0495652_0031842 3300046529 Bacteria 4616
511 Ga0495652_0055261 3300046529 Bacteria 3377
512 Ga0495652_0085403 3300046529 Unclassified 2593
513 Ga0495652_0088626 3300046529 Bacteria 2535
514 Ga0495652_0089252 3300046529 Bacteria 2524
515 Ga0495652_0280824 3300046529 Bacteria 1219
516 Ga0495665_0011354 3300046531 Bacteria 4821
517 Ga0495665_0013287 3300046531 Unclassified 4454
518 Ga0495665_0094082 3300046531 Unclassified 1574
519 Ga0495640_0006409 3300046533 Bacteria 9305
520 Ga0495640_0015167 3300046533 Bacteria 5803
521 Ga0495640_0022769 3300046533 Bacteria 4575
522 Ga0495586_0014494 3300046535 Bacteria 4186
523 Ga0495586_0026376 3300046535 Bacteria 3109
524 Ga0495587_0019464 3300046536 Unclassified 4200
525 Ga0495587_0030158 3300046536 Bacteria 3290
526 Ga0495587_0111824 3300046536 Bacteria 1568
527 Ga0495587_0172138 3300046536 Bacteria 1230
528 Ga0495645_0021232 3300046543 Bacteria 4692
529 Ga0495645_0056141 3300046543 Bacteria 2859
530 Ga0495645_0105883 3300046543 Bacteria 1995
531 Ga0495645_0177100 3300046543 Bacteria 1464
532 Ga0495645_0281496 3300046543 Bacteria 1093
533 Ga0495622_0002320 3300046557 Bacteria 9263
534 Ga0495622_0108355 3300046557 Bacteria 1272
535 Ga0495633_0160255 3300046558 Bacteria 1038
536 Ga0495667_0001730 3300046559 Bacteria 14506
537 Ga0495667_0003309 3300046559 Bacteria 10795
538 Ga0495667_0053600 3300046559 Bacteria 2656
539 Ga0495667_0213169 3300046559 Bacteria 1234
540 Ga0495667_0250746 3300046559 Unclassified 1126
541 Ga0495668_0069214 3300046616 Bacteria 1941
542 Ga0495634_0028681 3300046642 Bacteria 3861
543 Ga0495634_0051324 3300046642 Bacteria 2767
544 Ga0495634_0069301 3300046642 Bacteria 2327
545 Ga0495634_0137665 3300046642 Bacteria 1552
546 Ga0495634_0151354 3300046642 Bacteria 1467
547 Ga0495634_0203272 3300046642 Bacteria 1229
548 Ga0495625_0093417 3300046660 Bacteria 2077
549 Ga0495625_0229035 3300046660 Bacteria 1214
550 Ga0495635_0015118 3300046663 Bacteria 5398
551 Ga0495635_0019569 3300046663 Bacteria 4717
552 Ga0495635_0066481 3300046663 Bacteria 2472
553 Ga0495635_0209020 3300046663 Bacteria 1322
554 Ga0495635_0218550 3300046663 Bacteria 1289
555 Ga0495588_0062728 3300046674 Bacteria 1927
556 Ga0495588_0120437 3300046674 Bacteria 1383
557 Ga0495657_0006923 3300046675 Bacteria 8811
558 Ga0495657_0009245 3300046675 Bacteria 7479
559 Ga0495657_0025150 3300046675 Bacteria 4231
560 Ga0495657_0053525 3300046675 Bacteria 2700
561 Ga0495599_0001729 3300046678 Bacteria 12632
562 Ga0495599_0026918 3300046678 Bacteria 3604
563 Ga0495599_0040358 3300046678 Bacteria 2931
564 Ga0495599_0063095 3300046678 Bacteria 2315
565 Ga0495623_0090235 3300046679 Bacteria 1882
566 Ga0495646_0035840 3300046680 Bacteria 3075
567 Ga0495646_0066319 3300046680 Bacteria 2135
568 Ga0495658_0117816 3300046683 Bacteria 1603
569 Ga0495613_0005770 3300046689 Bacteria 9268
570 Ga0495613_0020247 3300046689 Bacteria 4959
571 Ga0495613_0047080 3300046689 Bacteria 3185
572 Ga0495624_0008283 3300046690 Bacteria 7266
573 Ga0495624_0008414 3300046690 Bacteria 7193
574 Ga0495624_0069303 3300046690 Bacteria 2197
575 Ga0495624_0074728 3300046690 Bacteria 2105
576 Ga0495624_0097983 3300046690 Bacteria 1806
577 Ga0495670_0002567 3300046691 Bacteria 8983
578 Ga0495670_0044927 3300046691 Bacteria 2206
579 Ga0495670_0202041 3300046691 Bacteria 1053
580 Ga0495649_0207781 3300046694 Bacteria 1015
581 Ga0495600_0009915 3300046809 Bacteria 5901
582 Ga0495600_0022514 3300046809 Bacteria 4046
583 Ga0495600_0055193 3300046809 Bacteria 2595
584 Ga0495600_0227580 3300046809 Bacteria 1191
585 Ga0495581_0011166 3300047315 Bacteria 5191
586 Ga0495581_0039774 3300047315 Bacteria 2722
587 Ga0495581_0067139 3300047315 Bacteria 2074
588 Ga0495581_0076371 3300047315 Bacteria 1938
589 Ga0495581_0253407 3300047315 Bacteria 1029
590 Ga0495604_0001022 3300047317 Bacteria 23329
591 Ga0495604_0022180 3300047317 Bacteria 5068
592 Ga0495604_0023988 3300047317 Bacteria 4869
593 Ga0495604_0049866 3300047317 Bacteria 3251
594 Ga0495604_0058461 3300047317 Bacteria 2960
595 Ga0495636_0005127 3300047318 Bacteria 5143
596 Ga0495674_0036982 3300047319 Bacteria 4388
597 Ga0495674_0037389 3300047319 Bacteria 4362
598 Ga0495674_0037793 3300047319 Bacteria 4337
599 Ga0495674_0072664 3300047319 Bacteria 2966
600 Ga0495674_0102541 3300047319 Bacteria 2433
601 Ga0495674_0231600 3300047319 Unclassified 1524
602 Ga0495676_0001118 3300047321 Bacteria 22768
603 Ga0495676_0003045 3300047321 Bacteria 15160
604 Ga0495676_0009560 3300047321 Bacteria 8823
605 Ga0495676_0066427 3300047321 Bacteria 2795
606 Ga0495680_0006058 3300047322 Bacteria 11305
607 Ga0495680_0010145 3300047322 Bacteria 8419
608 Ga0495680_0086265 3300047322 Bacteria 2362
609 Ga0495680_0283291 3300047322 Unclassified 1167
610 Ga0495680_0300711 3300047322 Unclassified 1126
611 Ga0495687_011560 3300047443 Bacteria 4735
612 Ga0495675_0014676 3300047444 Bacteria 4950
613 Ga0495675_0019290 3300047444 Bacteria 4332
614 Ga0495675_0026019 3300047444 Bacteria 3729
615 Ga0495675_0135248 3300047444 Bacteria 1531
616 Ga0495675_0335418 3300047444 Bacteria 892
617 Ga0495685_005146 3300047447 Bacteria 4259
618 Ga0495685_017601 3300047447 Bacteria 2448
619 Ga0495681_0019415 3300047470 Bacteria 3712
620 Ga0495684_0003673 3300047471 Bacteria 11961
621 Ga0495684_0020894 3300047471 Bacteria 5044
622 Ga0495684_0134259 3300047471 Unclassified 1857
623 Ga0495686_0159329 3300047472 Bacteria 1320
624 Ga0495593_0006667 3300047673 Bacteria 6756
625 Ga0495593_0017180 3300047673 Bacteria 4072
626 Ga0495593_0032938 3300047673 Bacteria 2823
627 Ga0495593_0077909 3300047673 Bacteria 1717
628 Ga0495602_0329632 3300048088 Bacteria 1107
629 Ga0495614_0013090 3300048089 Bacteria 3639
630 Ga0495614_0040921 3300048089 Bacteria 1988
631 Ga0496100_0066632 3300048903 Bacteria 2389
632 Ga0496100_0491466 3300048903 Bacteria 945
633 Ga0496101_0133285 3300048904 Bacteria 1888
634 Ga0496102_0004687 3300048905 Bacteria 11566
635 Ga0496102_0006047 3300048905 Bacteria 10311
636 Ga0496102_0258960 3300048905 Bacteria 1640
637 Ga0496102_0330452 3300048905 Bacteria 1436
638 Ga0496102_0531909 3300048905 Bacteria 1098
639 Ga0496103_0002730 3300048906 Bacteria 11014
640 Ga0496104_0001017 3300048907 Bacteria 23981
641 Ga0496104_0079887 3300048907 Bacteria 3117
642 Ga0496105_0087210 3300048908 Bacteria 2579
643 Ga0496105_0218790 3300048908 Bacteria 1551
644 Ga0496105_0312350 3300048908 Bacteria 1261
645 Ga0496106_0304688 3300048909 Bacteria 1278
646 Ga0496106_0405562 3300048909 Bacteria 1095
647 Ga0496107_0090067 3300048910 Bacteria 2241
648 Ga0496108_0000860 3300048911 Bacteria 23710
649 Ga0496108_0001445 3300048911 Bacteria 18766
650 Ga0496108_0073174 3300048911 Bacteria 2894
651 Ga0496108_0181913 3300048911 Bacteria 1820
652 Ga0496108_0366814 3300048911 Bacteria 1257
653 Ga0496109_0001156 3300048912 Bacteria 21959
654 Ga0496109_0039494 3300048912 Bacteria 4272
655 Ga0496109_0055275 3300048912 Bacteria 3621
656 Ga0496109_0099741 3300048912 Bacteria 2694
657 Ga0496109_0250297 3300048912 Bacteria 1669
658 Ga0496109_0311231 3300048912 Bacteria 1486
659 Ga0496110_0000206 3300048913 Bacteria 37655
660 Ga0496110_0062295 3300048913 Bacteria 3294
661 Ga0496110_0081026 3300048913 Bacteria 2893
662 Ga0496110_0114315 3300048913 Bacteria 2429
663 Ga0496111_0019784 3300048914 Bacteria 4682
664 Ga0496111_0068376 3300048914 Bacteria 2581
665 Ga0496111_0211138 3300048914 Bacteria 1442
666 Ga0496111_0344544 3300048914 Bacteria 1103
667 Ga0496112_0084159 3300048915 Bacteria 3146
668 Ga0496112_0144656 3300048915 Bacteria 2346
669 Ga0496112_0310629 3300048915 Bacteria 1522
670 Ga0496112_0370431 3300048915 Bacteria 1374
671 Ga0496112_0685449 3300048915 Bacteria 953
672 Ga0496112_0685680 3300048915 Bacteria 953
673 Ga0496113_0113066 3300048916 Bacteria 2116
674 Ga0496113_0486654 3300048916 Bacteria 991
675 Ga0496114_0000292 3300048917 Bacteria 36655
676 Ga0496114_0002729 3300048917 Bacteria 13486
677 Ga0496114_0037117 3300048917 Bacteria 4030
678 Ga0496114_0103317 3300048917 Bacteria 2436
679 Ga0496114_0117091 3300048917 Bacteria 2288
680 Ga0496114_0144812 3300048917 Bacteria 2059
681 Ga0496114_0156372 3300048917 Bacteria 1980
682 Ga0496114_0236688 3300048917 Bacteria 1605
683 Ga0496115_0138814 3300048918 Bacteria 2005
684 Ga0496115_0200192 3300048918 Bacteria 1650
685 Ga0496119_0110312 3300048922 Bacteria 1528
686 Ga0496119_0121033 3300048922 Bacteria 1439
687 Ga0496120_0190671 3300048923 Bacteria 1000
688 Ga0496121_0004272 3300048924 Bacteria 19398
689 Ga0496121_0059427 3300048924 Bacteria 3152
690 Ga0496126_0000040 3300048929 Bacteria 345144
691 Ga0496126_0016459 3300048929 Bacteria 7393
692 Ga0496126_0048568 3300048929 Bacteria 3877
693 Ga0496126_0135536 3300048929 Bacteria 2124
694 Ga0496126_0385011 3300048929 Bacteria 1141
695 Ga0496126_0466102 3300048929 Bacteria 1014
696 Ga0501032_0230633 3300049569 Bacteria 1204
697 Ga0501034_0007279 3300049571 Bacteria 11798
698 Ga0501067_0001178 3300049583 Bacteria 14171
699 Ga0501067_0001965 3300049583 Bacteria 11324
700 Ga0501068_0014197 3300049584 Bacteria 4549
701 Ga0501068_0149097 3300049584 Bacteria 1469
702 Ga0501069_0012187 3300049585 Bacteria 4568
703 Ga0501069_0038668 3300049585 Bacteria 2634
704 Ga0501070_0000294 3300049586 Bacteria 46585
705 Ga0501070_0004742 3300049586 Bacteria 11637
706 Ga0501070_0438982 3300049586 Bacteria 1053
707 Ga0501071_0014240 3300049587 Bacteria 5440
708 Ga0501072_0026093 3300049588 Bacteria 4553
709 Ga0501072_0039055 3300049588 Bacteria 3727
710 Ga0501073_0004400 3300049589 Bacteria 10586
711 Ga0501073_0007206 3300049589 Bacteria 8282
712 Ga0501074_0000481 3300049590 Bacteria 24238
713 Ga0501074_0001446 3300049590 Bacteria 15885
714 Ga0501074_0182820 3300049590 Bacteria 1495
715 Ga0501077_0033356 3300049593 Bacteria 3277
716 Ga0501079_0010264 3300049741 Bacteria 7112
717 Ga0501079_0033289 3300049741 Bacteria 3965
718 Ga0501080_0005158 3300049742 Bacteria 11633
719 Ga0501080_0013603 3300049742 Bacteria 7491
720 Ga0501080_0076070 3300049742 Bacteria 3123
721 Ga0501081_0146894 3300049743 Bacteria 1692
722 Ga0501083_0001026 3300049744 Bacteria 18616
723 Ga0501083_0002383 3300049744 Bacteria 12869
724 Ga0501083_0018747 3300049744 Bacteria 4819
725 Ga0501283_010554 3300049779 Bacteria 1360
726 nmdc:mga0yw44_103533_c1 3300050492 Bacteria 1816
727 nmdc:mga0yw44_45805_c1 3300050492 Bacteria 2624
728 nmdc:mga0yw44_49691_c1 3300050492 Bacteria 2532
729 nmdc:mga06z11_20310_c1 3300050494 Bacteria 3069
730 nmdc:mga04h51_2245_c1 3300050495 Bacteria 4553
731 nmdc:mga05p37_24787_c1 3300050507 Bacteria 7292
732 nmdc:mga05p37_295101_c1 3300050507 Bacteria 1928
733 nmdc:mga05p37_454255_c1 3300050507 Unclassified 1482
734 nmdc:mga05p37_48387_c1 3300050507 Bacteria 5230
735 nmdc:mga05p37_58518_c1 3300050507 Bacteria 4746
736 nmdc:mga05p37_88590_c1 3300050507 Bacteria 3815
737 nmdc:mga09592_104481_c1 3300050508 Bacteria 2427
738 nmdc:mga09592_161821_c1 3300050508 Bacteria 1934
739 nmdc:mga08y16_180778_c1 3300050511 Bacteria 2190
740 nmdc:mga08y16_421934_c1 3300050511 Bacteria 1363
741 nmdc:mga0n895_37505_c1 3300050512 Bacteria 4689
742 nmdc:mga0a205_2973_c1 3300050515 Bacteria 9543
743 Ga0495601_0016121 3300053077 Plasmid 4524
744 Ga0495595_0030522 3300053084 Bacteria 2418
745 Ga0495619_0006597 3300053085 Bacteria 7345
746 Ga0500644_0003410 3300053088 Bacteria 3933
747 Ga0500646_0000063 3300053090 Bacteria 30223
748 Ga0500646_0000157 3300053090 Bacteria 20034
749 Ga0500646_0000781 3300053090 Bacteria 8894
750 Ga0500646_0022291 3300053090 Bacteria 1694
751 Ga0500583_0000034 3300053092 Bacteria 98659
752 Ga0500583_0020019 3300053092 Bacteria 2755
753 Ga0500651_0009281 3300053093 Bacteria 5835
754 Ga0500650_0021053 3300053098 Bacteria 2869
755 Ga0500654_044692 3300053099 Bacteria 2466
756 Ga0500660_024816 3300053100 Bacteria 3170
757 Ga0500660_073869 3300053100 Bacteria 1588
758 Ga0500569_091733 3300053109 Bacteria 985
759 Ga0500642_0015603 3300053130 Bacteria 2862
760 Ga0500561_0000132 3300053137 Bacteria 14306
761 Ga0500561_0009359 3300053137 Bacteria 1986
762 Ga0500573_0078981 3300053140 Bacteria 1872
763 Ga0500579_036911 3300053143 Bacteria 3098
764 Ga0500579_086959 3300053143 Bacteria 1712
765 Ga0500588_0007389 3300053146 Bacteria 2532
766 Ga0500588_0015793 3300053146 Bacteria 1941
767 Ga0500588_0029928 3300053146 Bacteria 1557
768 Ga0500589_000007 3300053147 Bacteria 145453
769 Ga0500600_0008943 3300053149 Bacteria 6041
770 Ga0500616_0000251 3300053153 Bacteria 83237
771 Ga0500616_0026066 3300053153 Bacteria 3239
772 Ga0501084_0108757 3300054114 Bacteria 2329
773 Ga0501084_0256430 3300054114 Bacteria 1476
774 Ga0501082_0000559 3300060353 Bacteria 33071
775 Ga0501082_0057721 3300060353 Bacteria 3343
776 2517760881 2517572101 Bacteria 6884336
777 2616697625 2616644814 Bacteria 11555299
778 2644032982 2643221604 Bacteria 5014917
779 2644089503 2643221615 Bacteria 5487866
780 2644100518 2643221617 Bacteria 5139111
781 2644116926 2643221620 Bacteria 5134593
782 2644270019 2643221647 Bacteria 10741251
783 2644319348 2643221657 Bacteria 5490246
784 2644608516 2643221711 Bacteria 4865335
785 2671837967 2671180195 Bacteria 9757215
786 2676200360 2675902999 Bacteria 9438463
787 2676487376 2675903059 Bacteria 8644972
788 2729907073 2728369276 Bacteria 5610032
789 2731907260 2731639228 Bacteria 4187555
790 2738871902 2738541305 Bacteria 4910150
791 2774844938 2773857921 Bacteria 9435764
792 2774856123 2773857922 Bacteria 9757215
793 2799183823 2799112218 Bacteria 4315149
794 2919449383 2919446982 Bacteria 3994487
795 2929217491 2929212328 Bacteria 7708288
796 2929218736 2929212328 Bacteria 7708288
797 2954700787 2954691527 Bacteria 10720516
798 2954706560 2954701450 Bacteria 10834262
799 2954719425 2954711539 Bacteria 10867210
800 2954729407 2954721474 Bacteria 10456478
801 2954732401 2954731030 Bacteria 10243860
802 2954748310 2954740390 Bacteria 10229294
803 2954751291 2954749733 Bacteria 10366972
804 2954767433 2954759201 Bacteria 9358192
805 3002999272 3002998708 Bacteria 11715108
806 Ga0451791_0563576
807 SwRhRL3b_contig_3075825
808 SwRhRL2b_contig_1636080
809 SwRhRL2b_contig_263429
810 JGI24740J21852_10003178
811 JGI24739J22299_10002670
812 JGI25406J46586_10004716
813 rootH1_10139703
814 rootH2_10011879
815 rootL2_10022689
816 rootH1_10014156
817 rootH1_10172323
818 Ga0006562J51391_1161591
819 Ga0065714_10008505
820 Ga0065704_10003330
821 Ga0065704_10109781
822 Ga0065707_10000955
823 Ga0065707_10002453
824 Ga0065707_10089187
825 Ga0070676_10116388
826 Ga0070683_100051887
827 Ga0070670_100063801
828 Ga0068869_100282712
829 Ga0070666_10169282
830 Ga0070680_100455500
831 Ga0070682_100083667
832 Ga0070682_100102920
833 Ga0070682_100313164
834 Ga0070660_100090204
835 Ga0070689_100098226
836 Ga0070668_100003833
837 Ga0070668_100014010
838 Ga0070674_100039761
839 Ga0070714_100017801
840 Ga0070714_100029035
841 Ga0070714_100167878
842 Ga0070714_100213293
843 Ga0070714_100293043
844 Ga0070713_100203338
845 Ga0070713_100324233
846 Ga0070710_10149008
847 Ga0070711_100283618
848 Ga0070705_100024665
849 Ga0070705_100413040
850 Ga0070694_100029932
851 Ga0070694_100150345
852 Ga0070708_100001186
853 Ga0070708_100201539
854 Ga0070708_100220819
855 Ga0070663_100015359
856 Ga0070663_100029422
857 Ga0070663_100070056
858 Ga0070663_100275918
859 Ga0070663_100566234
860 Ga0070681_10179746
861 Ga0070681_10208234
862 Ga0070685_10432802
863 Ga0070706_100024866
864 Ga0070706_100160243
865 Ga0070706_100223309
866 Ga0070707_100045596
867 Ga0070707_100050245
868 Ga0070707_100056181
869 Ga0070707_100077513
870 Ga0070707_100346887
871 Ga0070698_100021311
872 Ga0070698_100036033
873 Ga0070698_100047180
874 Ga0070698_100070228
875 Ga0070698_100092090
876 Ga0070698_100143489
877 Ga0070698_100237096
878 Ga0070698_100332920
879 Ga0070698_100584464
880 Ga0070699_100024557
881 Ga0070699_100068207
882 Ga0070699_100221802
883 Ga0070699_100376727
884 Ga0070679_100129709
885 Ga0070679_100153591
886 Ga0070684_100292818
887 Ga0070697_100003819
888 Ga0070697_100008467
889 Ga0068853_100101917
890 Ga0068853_100439999
891 Ga0068853_100488974
892 Ga0070695_100005000
893 Ga0070695_100096021
894 Ga0070693_100015180
895 Ga0070693_100028774
896 Ga0070665_100047050
897 Ga0070665_100097556
898 Ga0070665_100223587
899 Ga0070665_100397702
900 Ga0070665_100496859
901 Ga0070704_100161279
902 Ga0068855_100001615
903 Ga0068855_100005008
904 Ga0068855_100032789
905 Ga0068855_100283076
906 Ga0070664_100223826
907 Ga0070664_100420148
908 Ga0068857_100104550
909 Ga0068854_100086898
910 Ga0068856_100047801
911 Ga0068856_100135308
912 Ga0068856_100669969
913 Ga0068852_100011046
914 Ga0068852_100045201
915 Ga0068852_100595912
916 Ga0068859_100146064
917 Ga0068859_100236992
918 Ga0068864_100062119
919 Ga0068861_100156819
920 Ga0068861_100292570
921 Ga0068870_10284353
922 Ga0068863_100119101
923 Ga0068863_100306800
924 Ga0068858_100263576
925 Ga0068860_100566056
926 Ga0081540_1007257
927 Ga0081540_1016479
928 Ga0081539_10000173
929 Ga0081539_10000218
930 Ga0081539_10007179
931 Ga0081539_10013574
932 Ga0070717_10013282
933 Ga0070717_10141028
934 Ga0070717_10220988
935 Ga0075365_10060461
936 Ga0075365_10272247
937 Ga0075368_10004079
938 Ga0070715_10093813
939 Ga0070715_10117422
940 Ga0070716_100277260
941 Ga0075367_10002868
942 Ga0097621_100293810
943 Ga0068871_100137015
944 Ga0075428_100027636
945 Ga0075428_100638786
946 Ga0075430_100164754
947 Ga0075431_100567827
948 Ga0075433_10037475
949 Ga0075433_10258797
950 Ga0075434_100235757
951 Ga0075429_100104505
952 Ga0075429_100106618
953 Ga0097620_100146061
954 Ga0097620_100236980
955 Ga0099826_10041439
956 Ga0075435_100542312
957 Ga0099794_10000379
958 Ga0099794_10005625
959 Ga0105240_10056946
960 Ga0105240_10117833
961 Ga0105240_10119056
962 Ga0105240_10398298
963 Ga0111539_10141916
964 Ga0111539_10536330
965 Ga0114129_10028608
966 Ga0114129_10030668
967 Ga0114129_10046008
968 Ga0114129_10125823
969 Ga0114129_10224132
970 Ga0114129_10256358
971 Ga0114129_10314882
972 Ga0114129_10346329
973 Ga0105243_10005513
974 Ga0105243_10541372
975 Ga0105241_10053509
976 Ga0105241_10402390
977 Ga0105242_10074140
978 Ga0105248_10091789
979 Ga0105237_10052132
980 Ga0105237_10055854
981 Ga0105237_10164127
982 Ga0105238_10007250
983 Ga0105238_10059161
984 Ga0105238_10261163
985 Ga0105238_10864939
986 Ga0105249_10033201
987 Ga0105239_10020514
988 Ga0105239_10027480
989 Ga0105239_10056718
990 Ga0105239_10234395
991 Ga0105246_10029860
992 Ga0157373_10324354
993 Ga0157370_10142755
994 Ga0157369_10102253
995 Ga0157369_10447667
996 Ga0157369_10546483
997 Ga0157374_10041693
998 Ga0157374_10057979
999 Ga0157372_10079592
1000 Ga0157372_10298963
1001 Ga0157372_10319806
1002 Ga0157375_10040826
1003 Ga0157375_10381002
1004 Ga0163163_10120759
1005 Ga0163163_10289516
1006 Ga0163163_10816851
1007 Ga0182008_10001729
1008 Ga0157377_10250410
1009 Ga0157379_10036629
1010 Ga0157376_10288646
1011 Ga0182007_10007209
1012 Ga0183367_1004
1013 Ga0197907_11300308
1014 Ga0206356_11149848
1015 Ga0206349_1979773
1016 Ga0206355_1239282
1017 Ga0206351_10315251
1018 Ga0206352_11125578
1019 Ga0206350_10016465
1020 Ga0206350_10555428
1021 Ga0206354_11034032
1022 Ga0206354_11077463
1023 Ga0206353_11150681
1024 Ga0206353_11348600
1025 Ga0154015_1558468
1026 Ga0213873_10012688
1027 Ga0213875_10001136
1028 Ga0213875_10025499
1029 Ga0224712_10014297
1030 Ga0224712_10062840
1031 Ga0209758_1005093
1032 Ga0207653_10004255
1033 Ga0207692_10007533
1034 Ga0207692_10132031
1035 Ga0207688_10158084
1036 Ga0207647_10002020
1037 Ga0207647_10003293
1038 Ga0207647_10018266
1039 Ga0207699_10017074
1040 Ga0207699_10352449
1041 Ga0207643_10066625
1042 Ga0207684_10169966
1043 Ga0207684_10310947
1044 Ga0207707_10108337
1045 Ga0207707_10188710
1046 Ga0207707_10189415
1047 Ga0207707_10245884
1048 Ga0207695_10007827
1049 Ga0207695_10011119
1050 Ga0207695_10284850
1051 Ga0207671_10003792
1052 Ga0207671_10004981
1053 Ga0207671_10039693
1054 Ga0207693_10029588
1055 Ga0207693_10032134
1056 Ga0207663_10360218
1057 Ga0207657_10058253
1058 Ga0207646_10023471
1059 Ga0207646_10065981
1060 Ga0207646_10070215
1061 Ga0207646_10085834
1062 Ga0207694_10002783
1063 Ga0207694_10047018
1064 Ga0207650_10053041
1065 Ga0207650_10484242
1066 Ga0207659_10028415
1067 Ga0207700_10009251
1068 Ga0207700_10124867
1069 Ga0207700_10242308
1070 Ga0207700_10425078
1071 Ga0207700_10631329
1072 Ga0207664_10004878
1073 Ga0207664_10014874
1074 Ga0207664_10027629
1075 Ga0207664_10082644
1076 Ga0207664_10095366
1077 Ga0207664_10273984
1078 Ga0207664_10418478
1079 Ga0207686_10100915
1080 Ga0207709_10086750
1081 Ga0207709_10146312
1082 Ga0207709_10150310
1083 Ga0207669_10033141
1084 Ga0207669_10264392
1085 Ga0207669_10466945
1086 Ga0207665_10056251
1087 Ga0207691_10140317
1088 Ga0207711_10062678
1089 Ga0207689_10093608
1090 Ga0207661_10126180
1091 Ga0207661_10701847
1092 Ga0207679_10192766
1093 Ga0207679_10288580
1094 Ga0207667_10006703
1095 Ga0207667_10073859
1096 Ga0207712_10011952
1097 Ga0207668_10004702
1098 Ga0207668_10016690
1099 Ga0207668_10040811
1100 Ga0207640_10019999
1101 Ga0207640_10235200
1102 Ga0207639_10038634
1103 Ga0207639_10264660
1104 Ga0207639_10377038
1105 Ga0207678_10002060
1106 Ga0207678_10012846
1107 Ga0207678_10106131
1108 Ga0207708_10132841
1109 Ga0207702_10028440
1110 Ga0207702_10370905
1111 Ga0207641_10100640
1112 Ga0207641_10210472
1113 Ga0207676_10381848
1114 Ga0207674_10092503
1115 Ga0207674_10416180
1116 Ga0207675_100153339
1117 Ga0207675_100511011
1118 Ga0207683_10002509
1119 Ga0207698_10020317
1120 Ga0207698_10468480
1121 Ga0209371_1041838
1122 Ga0209588_1002430
1123 Ga0209588_1066879
1124 Ga0209813_10003614
1125 Ga0268266_10091363
1126 Ga0268266_10371048
1127 Ga0268266_10432896
1128 Ga0268265_10129262
1129 Ga0268265_10141091
1130 Ga0268265_10231276
1131 Ga0268265_10237875
1132 Ga0268264_10418906
1133 Ga0265337_1003592
1134 Ga0265326_10004837
1135 Ga0265318_10060858
1136 Ga0265336_10015575
1137 Ga0307517_10015716
1138 Ga0307517_10098017
1139 Ga0307515_10035516
1140 Ga0265338_10001125
1141 Ga0265338_10002141
1142 Ga0265338_10021555
1143 Ga0265324_10003209
1144 Ga0268256_1047437
1145 Ga0307511_10001845
1146 Ga0307512_10012522
1147 Ga0265332_10009694
1148 Ga0265320_10007771
1149 Ga0265325_10151626
1150 Ga0265340_10009313
1151 Ga0307513_10010495
1152 Ga0307513_10270749
1153 Ga0307509_10008191
1154 Ga0307509_10014865
1155 Ga0307509_10057050
1156 Ga0307509_10132730
1157 Ga0307509_10297031
1158 Ga0307508_10009307
1159 Ga0307508_10099344
1160 Ga0265342_10012194
1161 Ga0307516_10005367
1162 Ga0307516_10011460
1163 Ga0307516_10011822
1164 Ga0307516_10026405
1165 Ga0307516_10121392
1166 Ga0307405_10081816
1167 Ga0307518_10013497
1168 Ga0307518_10213395
1169 Ga0307410_10213807
1170 Ga0307406_10472177
1171 Ga0307407_10380370
1172 Ga0307409_100319979
1173 Ga0307409_100350195
1174 Ga0307411_10426864
1175 Ga0307415_100122260
1176 Ga0307507_10000764
1177 Ga0307507_10010565
1178 Ga0307510_10008462
1179 Ga0373930_0017205
1180 Ga0373938_0040689
1181 Ga0373926_0004626
1182 Ga0373928_0064565
1183 Ga0373934_0037648
1184 Ga0373944_0000495
1185 Ga0373944_0004271
1186 Ga0373951_0000007
1187 Ga0373923_0004925
1188 Ga0373923_0032357
1189 Ga0373936_0000130
1190 Ga0373936_0000832
1191 Ga0373936_0006171
1192 Ga0373945_0000149
1193 Ga0373945_0008677
1194 Ga0373954_0138525
1195 Ga0373956_0011655
1196 Ga0373956_0020262
1197 Ga0373957_0002159
1198 Ga0373957_0115950
1199 Ga0373943_0000215
1200 Ga0373943_0000957
1201 Ga0373946_0000093
1202 Ga0373946_0024650
1203 Ga0373946_0095299
1204 Ga0373955_0226615
1205 Ga0373924_0003990
1206 Ga0373924_0009400
1207 Ga0373924_0099711
1208 Ga0373935_0003933
1209 Ga0373935_0038244
1210 Ga0373927_0003366
1211 Ga0373933_0150265
1212 Ga0373947_0000281
1213 Ga0373947_0001422
1214 Ga0373937_0365024
1215 Ga0373937_0368784
1216 Ga0373937_0707011
1217 Ga0373925_0000938
1218 Ga0373925_0063645
1219 Ga0395899_0019364
1220 Ga0395905_0028163
1221 Ga0395905_0189242
1222 Ga0436364_0106543
1223 Ga0436364_0251595
1224 Ga0436364_0322086
1225 Ga0436364_0547435
1226 Ga0436364_1094297
1227 Ga0436364_1513258
1228 Ga0395901_0055031
1229 Ga0395901_0231231
1230 Ga0436365_0709127
1231 Ga0436363_0132265
1232 Ga0436363_0210186
1233 Ga0436363_0669568
1234 Ga0451791_0533426
1235 Ga0451791_1032133
1236 Ga0451793_0872584
1237 Ga0451797_0534996
1238 Ga0451833_0544441
1239 Ga0451849_1317838
1240 Ga0451843_1022444
1241 Ga0451843_1657210
1242 Ga0451853_0634586
1243 Ga0451853_1790813
1244 Ga0450903_000935
1245 Ga0439458_0001541
1246 Ga0466972_0003733
1247 Ga0466972_0047018
1248 Ga0466965_0059194
1249 Ga0466963_0022039
1250 Ga0466963_0033665
1251 Ga0466963_0067818
1252 Ga0466963_0095012
1253 Ga0466963_0452817
1254 Ga0453684_0055272
1255 Ga0466968_0002819
1256 Ga0466960_0070191
1257 Ga0451576_0383906
1258 Ga0466958_0081307
1259 Ga0466958_0142051
1260 Ga0466958_0211069
1261 Ga0466967_0017599
1262 Ga0495592_0013236
1263 Ga0495592_0096503
1264 Ga0495603_0005209
1265 Ga0495603_0011279
1266 Ga0495603_0211718
1267 Ga0495629_0013616
1268 Ga0495629_0064455
1269 Ga0495629_0104900
1270 Ga0495629_0105539
1271 Ga0495629_0243420
1272 Ga0495638_0285927
1273 Ga0495641_0006885
1274 Ga0495641_0046578
1275 Ga0495651_0000379
1276 Ga0495651_0024679
1277 Ga0495651_0055128
1278 Ga0495651_0132587
1279 Ga0495651_0166970
1280 Ga0495653_0008557
1281 Ga0495653_0049045
1282 Ga0495653_0089841
1283 Ga0495580_0156654
1284 Ga0495580_0185560
1285 Ga0495582_0003457
1286 Ga0495662_0023431
1287 Ga0495662_0064196
1288 Ga0495662_0073211
1289 Ga0495664_0000201
1290 Ga0495664_0012750
1291 Ga0495664_0023357
1292 Ga0495664_0037923
1293 Ga0495664_0038774
1294 Ga0495585_0011662
1295 Ga0495594_0005111
1296 Ga0495594_0036012
1297 Ga0495594_0049759
1298 Ga0495594_0057012
1299 Ga0495594_0156008
1300 Ga0495608_0010295
1301 Ga0495608_0217886
1302 Ga0495618_0067670
1303 Ga0495618_0107644
1304 Ga0495628_0028761
1305 Ga0495628_0070517
1306 Ga0495628_0075805
1307 Ga0495628_0092354
1308 Ga0495630_0018527
1309 Ga0495630_0031131
1310 Ga0495630_0075780
1311 Ga0495643_0001146
1312 Ga0495666_0000552
1313 Ga0495666_0013381
1314 Ga0495652_0000907
1315 Ga0495652_0031842
1316 Ga0495652_0055261
1317 Ga0495652_0085403
1318 Ga0495652_0088626
1319 Ga0495652_0089252
1320 Ga0495652_0280824
1321 Ga0495665_0011354
1322 Ga0495665_0013287
1323 Ga0495665_0094082
1324 Ga0495640_0006409
1325 Ga0495640_0015167
1326 Ga0495640_0022769
1327 Ga0495586_0014494
1328 Ga0495586_0026376
1329 Ga0495587_0019464
1330 Ga0495587_0030158
1331 Ga0495587_0111824
1332 Ga0495587_0172138
1333 Ga0495645_0021232
1334 Ga0495645_0056141
1335 Ga0495645_0105883
1336 Ga0495645_0177100
1337 Ga0495645_0281496
1338 Ga0495622_0002320
1339 Ga0495622_0108355
1340 Ga0495633_0160255
1341 Ga0495667_0001730
1342 Ga0495667_0003309
1343 Ga0495667_0053600
1344 Ga0495667_0213169
1345 Ga0495667_0250746
1346 Ga0495668_0069214
1347 Ga0495634_0028681
1348 Ga0495634_0051324
1349 Ga0495634_0069301
1350 Ga0495634_0137665
1351 Ga0495634_0151354
1352 Ga0495634_0203272
1353 Ga0495625_0093417
1354 Ga0495625_0229035
1355 Ga0495635_0015118
1356 Ga0495635_0019569
1357 Ga0495635_0066481
1358 Ga0495635_0209020
1359 Ga0495635_0218550
1360 Ga0495588_0062728
1361 Ga0495588_0120437
1362 Ga0495657_0006923
1363 Ga0495657_0009245
1364 Ga0495657_0025150
1365 Ga0495657_0053525
1366 Ga0495599_0001729
1367 Ga0495599_0026918
1368 Ga0495599_0040358
1369 Ga0495599_0063095
1370 Ga0495623_0090235
1371 Ga0495646_0035840
1372 Ga0495646_0066319
1373 Ga0495658_0117816
1374 Ga0495613_0005770
1375 Ga0495613_0020247
1376 Ga0495613_0047080
1377 Ga0495624_0008283
1378 Ga0495624_0008414
1379 Ga0495624_0069303
1380 Ga0495624_0074728
1381 Ga0495624_0097983
1382 Ga0495670_0002567
1383 Ga0495670_0044927
1384 Ga0495670_0202041
1385 Ga0495649_0207781
1386 Ga0495600_0009915
1387 Ga0495600_0022514
1388 Ga0495600_0055193
1389 Ga0495600_0227580
1390 Ga0495581_0011166
1391 Ga0495581_0039774
1392 Ga0495581_0067139
1393 Ga0495581_0076371
1394 Ga0495581_0253407
1395 Ga0495604_0001022
1396 Ga0495604_0022180
1397 Ga0495604_0023988
1398 Ga0495604_0049866
1399 Ga0495604_0058461
1400 Ga0495636_0005127
1401 Ga0495674_0036982
1402 Ga0495674_0037389
1403 Ga0495674_0037793
1404 Ga0495674_0072664
1405 Ga0495674_0102541
1406 Ga0495674_0231600
1407 Ga0495676_0001118
1408 Ga0495676_0003045
1409 Ga0495676_0009560
1410 Ga0495676_0066427
1411 Ga0495680_0006058
1412 Ga0495680_0010145
1413 Ga0495680_0086265
1414 Ga0495680_0283291
1415 Ga0495680_0300711
1416 Ga0495687_011560
1417 Ga0495675_0014676
1418 Ga0495675_0019290
1419 Ga0495675_0026019
1420 Ga0495675_0135248
1421 Ga0495675_0335418
1422 Ga0495685_005146
1423 Ga0495685_017601
1424 Ga0495681_0019415
1425 Ga0495684_0003673
1426 Ga0495684_0020894
1427 Ga0495684_0134259
1428 Ga0495686_0159329
1429 Ga0495593_0006667
1430 Ga0495593_0017180
1431 Ga0495593_0032938
1432 Ga0495593_0077909
1433 Ga0495602_0329632
1434 Ga0495614_0013090
1435 Ga0495614_0040921
1436 Ga0496100_0066632
1437 Ga0496100_0491466
1438 Ga0496101_0133285
1439 Ga0496102_0004687
1440 Ga0496102_0006047
1441 Ga0496102_0258960
1442 Ga0496102_0330452
1443 Ga0496102_0531909
1444 Ga0496103_0002730
1445 Ga0496104_0001017
1446 Ga0496104_0079887
1447 Ga0496105_0087210
1448 Ga0496105_0218790
1449 Ga0496105_0312350
1450 Ga0496106_0304688
1451 Ga0496106_0405562
1452 Ga0496107_0090067
1453 Ga0496108_0000860
1454 Ga0496108_0001445
1455 Ga0496108_0073174
1456 Ga0496108_0181913
1457 Ga0496108_0366814
1458 Ga0496109_0001156
1459 Ga0496109_0039494
1460 Ga0496109_0055275
1461 Ga0496109_0099741
1462 Ga0496109_0250297
1463 Ga0496109_0311231
1464 Ga0496110_0000206
1465 Ga0496110_0062295
1466 Ga0496110_0081026
1467 Ga0496110_0114315
1468 Ga0496111_0019784
1469 Ga0496111_0068376
1470 Ga0496111_0211138
1471 Ga0496111_0344544
1472 Ga0496112_0084159
1473 Ga0496112_0144656
1474 Ga0496112_0310629
1475 Ga0496112_0370431
1476 Ga0496112_0685449
1477 Ga0496112_0685680
1478 Ga0496113_0113066
1479 Ga0496113_0486654
1480 Ga0496114_0000292
1481 Ga0496114_0002729
1482 Ga0496114_0037117
1483 Ga0496114_0103317
1484 Ga0496114_0117091
1485 Ga0496114_0144812
1486 Ga0496114_0156372
1487 Ga0496114_0236688
1488 Ga0496115_0138814
1489 Ga0496115_0200192
1490 Ga0496119_0110312
1491 Ga0496119_0121033
1492 Ga0496120_0190671
1493 Ga0496121_0004272
1494 Ga0496121_0059427
1495 Ga0496126_0000040
1496 Ga0496126_0016459
1497 Ga0496126_0048568
1498 Ga0496126_0135536
1499 Ga0496126_0385011
1500 Ga0496126_0466102
1501 Ga0501032_0230633
1502 Ga0501034_0007279
1503 Ga0501067_0001178
1504 Ga0501067_0001965
1505 Ga0501068_0014197
1506 Ga0501068_0149097
1507 Ga0501069_0012187
1508 Ga0501069_0038668
1509 Ga0501070_0000294
1510 Ga0501070_0004742
1511 Ga0501070_0438982
1512 Ga0501071_0014240
1513 Ga0501072_0026093
1514 Ga0501072_0039055
1515 Ga0501073_0004400
1516 Ga0501073_0007206
1517 Ga0501074_0000481
1518 Ga0501074_0001446
1519 Ga0501074_0182820
1520 Ga0501077_0033356
1521 Ga0501079_0010264
1522 Ga0501079_0033289
1523 Ga0501080_0005158
1524 Ga0501080_0013603
1525 Ga0501080_0076070
1526 Ga0501081_0146894
1527 Ga0501083_0001026
1528 Ga0501083_0002383
1529 Ga0501083_0018747
1530 Ga0501283_010554
1531 nmdc:mga0yw44_103533_c1
1532 nmdc:mga0yw44_45805_c1
1533 nmdc:mga0yw44_49691_c1
1534 nmdc:mga06z11_20310_c1
1535 nmdc:mga04h51_2245_c1
1536 nmdc:mga05p37_24787_c1
1537 nmdc:mga05p37_295101_c1
1538 nmdc:mga05p37_454255_c1
1539 nmdc:mga05p37_48387_c1
1540 nmdc:mga05p37_58518_c1
1541 nmdc:mga05p37_88590_c1
1542 nmdc:mga09592_104481_c1
1543 nmdc:mga09592_161821_c1
1544 nmdc:mga08y16_180778_c1
1545 nmdc:mga08y16_421934_c1
1546 nmdc:mga0n895_37505_c1
1547 nmdc:mga0a205_2973_c1
1548 Ga0495601_0016121
1549 Ga0495595_0030522
1550 Ga0495619_0006597
1551 Ga0500644_0003410
1552 Ga0500646_0000063
1553 Ga0500646_0000157
1554 Ga0500646_0000781
1555 Ga0500646_0022291
1556 Ga0500583_0000034
1557 Ga0500583_0020019
1558 Ga0500651_0009281
1559 Ga0500650_0021053
1560 Ga0500654_044692
1561 Ga0500660_024816
1562 Ga0500660_073869
1563 Ga0500569_091733
1564 Ga0500642_0015603
1565 Ga0500561_0000132
1566 Ga0500561_0009359
1567 Ga0500573_0078981
1568 Ga0500579_036911
1569 Ga0500579_086959
1570 Ga0500588_0007389
1571 Ga0500588_0015793
1572 Ga0500588_0029928
1573 Ga0500589_000007
1574 Ga0500600_0008943
1575 Ga0500616_0000251
1576 Ga0500616_0026066
1577 Ga0501084_0108757
1578 Ga0501084_0256430
1579 Ga0501082_0000559
1580 Ga0501082_0057721
1581 2517760881
1582 2616697625
1583 2644032982
1584 2644089503
1585 2644100518
1586 2644116926
1587 2644270019
1588 2644319348
1589 2644608516
1590 2671837967
1591 2676200360
1592 2676487376
1593 2729907073
1594 2731907260
1595 2738871902
1596 2774844938
1597 2774856123
1598 2799183823
1599 2919449383
1600 2929217491
1601 2929218736
1602 2954700787
1603 2954706560
1604 2954719425
1605 2954729407
1606 2954732401
1607 2954748310
1608 2954751291
1609 2954767433
1610 3002999272

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

57

205

0.82

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

61

304

0.8

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

63

311

0.58

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.7736 4 264
4ke6-assembly3.cif.gz_C crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol 0.7721 10 268
4ke6-assembly5.cif.gz_E crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol 0.7718 10 268
4ke6-assembly6.cif.gz_F crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol 0.7711 10 268
5xks-assembly6.cif.gz_F crystal structure of monoacylglycerol lipase from thermophilic geobacillus sp. 12amor 0.7711 10 267
ID Description Score Start End Superfamily
4ke6E00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7718 10 268 3.40.50.1820
5xksF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7711 10 267 3.40.50.1820
af_K7KHX7_124_277_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7654 203 265 3.40.50.1820
af_Q8IL54_9_192_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7468 7 96 3.40.50.1820
5jd6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7409 9 269 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A537IAY5-F1-model_v4 Alpha/beta hydrolase 0.9953 7 269 GO:0016787
AF-A0A543HUW2-F1-model_v4 Alpha-beta hydrolase superfamily lysophospholipase 0.9927 6 269 GO:0016787
AF-A0A7Y5P7X6-F1-model_v4 deleted 0.9914 42 269
AF-A0A6F8YZZ3-F1-model_v4 Alpha/beta hydrolase 0.9909 9 268 GO:0016787
AF-A0A7C1KD27-F1-model_v4 Alpha/beta hydrolase 0.9908 96 269

Map