F481611
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 805 | 395 | 1610 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300041451|Ga0451791_0563576|Ga0451791_0563576_963_1928 |
| Length | 321 |
| Sequence | VTYQPLVIASVDCIRQTETEFRGAPTTSRMTEAHIALTRQADQYSTTLVRWDAAMTPPTRPSVVFIHGLWLHATSWAPWVDLFTEQGYSVSAPGWPGEPDTVDEARAQPDTVANVGIDDVVDHYTSIISNLPTAPVLIGHSFGGMIAEKLLGNGVAAAAIAIDAAQIKGVLPLPLSALRSTLPVFKNPANKHRSVSLTAEQFRYGFGNAIPADESDSIWDRWAVPSPGKPLFEAATANFSPHSPAEVNTGNEKRGPLLLMMGGQDHTVPESITKATLKQYRHSDAKTELVEFADRGHSLVVDHGWRDVADGCLSWLKDNDL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 106 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 110 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 117 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 118 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 170 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 171 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 173 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 178 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 179 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 182 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 183 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 184 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 185 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 186 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 197 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 198 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 199 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 200 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 201 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 227 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 230 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 231 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 232 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 233 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 234 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 235 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 236 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 237 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 238 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 239 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 240 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 241 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 242 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 305 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 319 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 320 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 321 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 322 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 338 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 339 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 340 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 341 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 351 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 352 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 353 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 354 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 356 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 357 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 358 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 359 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 360 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 361 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 362 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 363 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 364 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 365 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 368 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 369 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 370 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 371 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 372 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 373 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 374 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 375 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 376 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 377 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 378 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 379 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 380 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 381 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 382 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 383 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 384 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 385 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 386 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 387 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 388 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 389 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 390 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 391 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 392 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 393 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 394 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 395 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.29 |
| Metatranscriptomes | 1.99 |
| Isolates | 3.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.6 |
| Nodule | 0.75 |
| Rhizoplane | 7.33 |
| Rhizosphere | 78.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451791_0563576 | 3300041451 | Bacteria | 2570 |
| 2 | SwRhRL3b_contig_3075825 | 2162886006 | Bacteria | 5127 |
| 3 | SwRhRL2b_contig_1636080 | 2162886007 | Bacteria | 8806 |
| 4 | SwRhRL2b_contig_263429 | 2162886007 | Bacteria | 5459 |
| 5 | JGI24740J21852_10003178 | 3300001979 | Bacteria | 7250 |
| 6 | JGI24739J22299_10002670 | 3300001989 | Bacteria | 6871 |
| 7 | JGI25406J46586_10004716 | 3300003203 | Bacteria | 6342 |
| 8 | rootH1_10139703 | 3300003316 | Unclassified | 2513 |
| 9 | rootH2_10011879 | 3300003320 | Bacteria | 7276 |
| 10 | rootL2_10022689 | 3300003322 | Bacteria | 2286 |
| 11 | rootH1_10014156 | 3300003323 | Bacteria | 5101 |
| 12 | rootH1_10172323 | 3300003323 | Bacteria | 2151 |
| 13 | Ga0006562J51391_1161591 | 3300003578 | Bacteria | 1155 |
| 14 | Ga0065714_10008505 | 3300005288 | Bacteria | 3703 |
| 15 | Ga0065704_10003330 | 3300005289 | Bacteria | 6747 |
| 16 | Ga0065704_10109781 | 3300005289 | Bacteria | 1995 |
| 17 | Ga0065707_10000955 | 3300005295 | Bacteria | 14002 |
| 18 | Ga0065707_10002453 | 3300005295 | Bacteria | 4570 |
| 19 | Ga0065707_10089187 | 3300005295 | Bacteria | 4442 |
| 20 | Ga0070676_10116388 | 3300005328 | Bacteria | 1672 |
| 21 | Ga0070683_100051887 | 3300005329 | Bacteria | 3798 |
| 22 | Ga0070670_100063801 | 3300005331 | Bacteria | 3161 |
| 23 | Ga0068869_100282712 | 3300005334 | Bacteria | 1334 |
| 24 | Ga0070666_10169282 | 3300005335 | Bacteria | 1529 |
| 25 | Ga0070680_100455500 | 3300005336 | Bacteria | 1093 |
| 26 | Ga0070682_100083667 | 3300005337 | Bacteria | 2071 |
| 27 | Ga0070682_100102920 | 3300005337 | Bacteria | 1888 |
| 28 | Ga0070682_100313164 | 3300005337 | Bacteria | 1156 |
| 29 | Ga0070660_100090204 | 3300005339 | Bacteria | 2416 |
| 30 | Ga0070689_100098226 | 3300005340 | Bacteria | 2316 |
| 31 | Ga0070668_100003833 | 3300005347 | Bacteria | 11108 |
| 32 | Ga0070668_100014010 | 3300005347 | Bacteria | 5996 |
| 33 | Ga0070674_100039761 | 3300005356 | Bacteria | 3178 |
| 34 | Ga0070714_100017801 | 3300005435 | Bacteria | 5762 |
| 35 | Ga0070714_100029035 | 3300005435 | Bacteria | 4595 |
| 36 | Ga0070714_100167878 | 3300005435 | Bacteria | 1989 |
| 37 | Ga0070714_100213293 | 3300005435 | Bacteria | 1771 |
| 38 | Ga0070714_100293043 | 3300005435 | Bacteria | 1515 |
| 39 | Ga0070713_100203338 | 3300005436 | Bacteria | 1790 |
| 40 | Ga0070713_100324233 | 3300005436 | Bacteria | 1423 |
| 41 | Ga0070710_10149008 | 3300005437 | Bacteria | 1441 |
| 42 | Ga0070711_100283618 | 3300005439 | Bacteria | 1311 |
| 43 | Ga0070705_100024665 | 3300005440 | Bacteria | 3250 |
| 44 | Ga0070705_100413040 | 3300005440 | Bacteria | 1003 |
| 45 | Ga0070694_100029932 | 3300005444 | Bacteria | 3557 |
| 46 | Ga0070694_100150345 | 3300005444 | Unclassified | 1700 |
| 47 | Ga0070708_100001186 | 3300005445 | Bacteria | 20030 |
| 48 | Ga0070708_100201539 | 3300005445 | Bacteria | 1863 |
| 49 | Ga0070708_100220819 | 3300005445 | Bacteria | 1777 |
| 50 | Ga0070663_100015359 | 3300005455 | Bacteria | 4940 |
| 51 | Ga0070663_100029422 | 3300005455 | Bacteria | 3754 |
| 52 | Ga0070663_100070056 | 3300005455 | Bacteria | 2549 |
| 53 | Ga0070663_100275918 | 3300005455 | Bacteria | 1338 |
| 54 | Ga0070663_100566234 | 3300005455 | Bacteria | 951 |
| 55 | Ga0070681_10179746 | 3300005458 | Bacteria | 2037 |
| 56 | Ga0070681_10208234 | 3300005458 | Bacteria | 1872 |
| 57 | Ga0070685_10432802 | 3300005466 | Bacteria | 918 |
| 58 | Ga0070706_100024866 | 3300005467 | Bacteria | 5513 |
| 59 | Ga0070706_100160243 | 3300005467 | Bacteria | 2101 |
| 60 | Ga0070706_100223309 | 3300005467 | Bacteria | 1758 |
| 61 | Ga0070707_100045596 | 3300005468 | Bacteria | 4195 |
| 62 | Ga0070707_100050245 | 3300005468 | Bacteria | 3996 |
| 63 | Ga0070707_100056181 | 3300005468 | Bacteria | 3775 |
| 64 | Ga0070707_100077513 | 3300005468 | Bacteria | 3207 |
| 65 | Ga0070707_100346887 | 3300005468 | Unclassified | 1442 |
| 66 | Ga0070698_100021311 | 3300005471 | Bacteria | 6789 |
| 67 | Ga0070698_100036033 | 3300005471 | Bacteria | 5114 |
| 68 | Ga0070698_100047180 | 3300005471 | Bacteria | 4403 |
| 69 | Ga0070698_100070228 | 3300005471 | Bacteria | 3515 |
| 70 | Ga0070698_100092090 | 3300005471 | Bacteria | 3012 |
| 71 | Ga0070698_100143489 | 3300005471 | Unclassified | 2338 |
| 72 | Ga0070698_100237096 | 3300005471 | Unclassified | 1757 |
| 73 | Ga0070698_100332920 | 3300005471 | Bacteria | 1449 |
| 74 | Ga0070698_100584464 | 3300005471 | Bacteria | 1057 |
| 75 | Ga0070699_100024557 | 3300005518 | Bacteria | 5195 |
| 76 | Ga0070699_100068207 | 3300005518 | Bacteria | 3088 |
| 77 | Ga0070699_100221802 | 3300005518 | Unclassified | 1685 |
| 78 | Ga0070699_100376727 | 3300005518 | Bacteria | 1281 |
| 79 | Ga0070679_100129709 | 3300005530 | Bacteria | 2503 |
| 80 | Ga0070679_100153591 | 3300005530 | Bacteria | 2278 |
| 81 | Ga0070684_100292818 | 3300005535 | Bacteria | 1493 |
| 82 | Ga0070697_100003819 | 3300005536 | Bacteria | 11568 |
| 83 | Ga0070697_100008467 | 3300005536 | Bacteria | 8026 |
| 84 | Ga0068853_100101917 | 3300005539 | Bacteria | 2540 |
| 85 | Ga0068853_100439999 | 3300005539 | Bacteria | 1225 |
| 86 | Ga0068853_100488974 | 3300005539 | Bacteria | 1161 |
| 87 | Ga0070695_100005000 | 3300005545 | Bacteria | 7815 |
| 88 | Ga0070695_100096021 | 3300005545 | Bacteria | 1988 |
| 89 | Ga0070693_100015180 | 3300005547 | Bacteria | 3962 |
| 90 | Ga0070693_100028774 | 3300005547 | Bacteria | 3024 |
| 91 | Ga0070665_100047050 | 3300005548 | Bacteria | 4330 |
| 92 | Ga0070665_100097556 | 3300005548 | Bacteria | 2944 |
| 93 | Ga0070665_100223587 | 3300005548 | Bacteria | 1883 |
| 94 | Ga0070665_100397702 | 3300005548 | Bacteria | 1385 |
| 95 | Ga0070665_100496859 | 3300005548 | Bacteria | 1231 |
| 96 | Ga0070704_100161279 | 3300005549 | Bacteria | 1774 |
| 97 | Ga0068855_100001615 | 3300005563 | Bacteria | 28292 |
| 98 | Ga0068855_100005008 | 3300005563 | Bacteria | 16169 |
| 99 | Ga0068855_100032789 | 3300005563 | Bacteria | 6201 |
| 100 | Ga0068855_100283076 | 3300005563 | Bacteria | 1840 |
| 101 | Ga0070664_100223826 | 3300005564 | Bacteria | 1684 |
| 102 | Ga0070664_100420148 | 3300005564 | Bacteria | 1224 |
| 103 | Ga0068857_100104550 | 3300005577 | Bacteria | 2542 |
| 104 | Ga0068854_100086898 | 3300005578 | Bacteria | 2319 |
| 105 | Ga0068856_100047801 | 3300005614 | Bacteria | 4216 |
| 106 | Ga0068856_100135308 | 3300005614 | Bacteria | 2469 |
| 107 | Ga0068856_100669969 | 3300005614 | Bacteria | 1058 |
| 108 | Ga0068852_100011046 | 3300005616 | Bacteria | 6779 |
| 109 | Ga0068852_100045201 | 3300005616 | Bacteria | 3744 |
| 110 | Ga0068852_100595912 | 3300005616 | Bacteria | 1109 |
| 111 | Ga0068859_100146064 | 3300005617 | Bacteria | 2440 |
| 112 | Ga0068859_100236992 | 3300005617 | Bacteria | 1914 |
| 113 | Ga0068864_100062119 | 3300005618 | Bacteria | 3236 |
| 114 | Ga0068861_100156819 | 3300005719 | Bacteria | 1874 |
| 115 | Ga0068861_100292570 | 3300005719 | Bacteria | 1407 |
| 116 | Ga0068870_10284353 | 3300005840 | Bacteria | 1038 |
| 117 | Ga0068863_100119101 | 3300005841 | Bacteria | 2516 |
| 118 | Ga0068863_100306800 | 3300005841 | Bacteria | 1540 |
| 119 | Ga0068858_100263576 | 3300005842 | Bacteria | 1638 |
| 120 | Ga0068860_100566056 | 3300005843 | Bacteria | 1139 |
| 121 | Ga0081540_1007257 | 3300005983 | Bacteria | 7937 |
| 122 | Ga0081540_1016479 | 3300005983 | Bacteria | 4621 |
| 123 | Ga0081539_10000173 | 3300005985 | Bacteria | 151356 |
| 124 | Ga0081539_10000218 | 3300005985 | Bacteria | 134538 |
| 125 | Ga0081539_10007179 | 3300005985 | Bacteria | 10266 |
| 126 | Ga0081539_10013574 | 3300005985 | Bacteria | 6126 |
| 127 | Ga0070717_10013282 | 3300006028 | Bacteria | 6304 |
| 128 | Ga0070717_10141028 | 3300006028 | Bacteria | 2079 |
| 129 | Ga0070717_10220988 | 3300006028 | Bacteria | 1665 |
| 130 | Ga0075365_10060461 | 3300006038 | Bacteria | 2528 |
| 131 | Ga0075365_10272247 | 3300006038 | Bacteria | 1191 |
| 132 | Ga0075368_10004079 | 3300006042 | Bacteria | 4915 |
| 133 | Ga0070715_10093813 | 3300006163 | Bacteria | 1386 |
| 134 | Ga0070715_10117422 | 3300006163 | Bacteria | 1263 |
| 135 | Ga0070716_100277260 | 3300006173 | Bacteria | 1155 |
| 136 | Ga0075367_10002868 | 3300006178 | Bacteria | 8020 |
| 137 | Ga0097621_100293810 | 3300006237 | Bacteria | 1433 |
| 138 | Ga0068871_100137015 | 3300006358 | Bacteria | 2079 |
| 139 | Ga0075428_100027636 | 3300006844 | Bacteria | 6276 |
| 140 | Ga0075428_100638786 | 3300006844 | Bacteria | 1136 |
| 141 | Ga0075430_100164754 | 3300006846 | Bacteria | 1845 |
| 142 | Ga0075431_100567827 | 3300006847 | Bacteria | 1121 |
| 143 | Ga0075433_10037475 | 3300006852 | Bacteria | 4184 |
| 144 | Ga0075433_10258797 | 3300006852 | Bacteria | 1543 |
| 145 | Ga0075434_100235757 | 3300006871 | Bacteria | 1850 |
| 146 | Ga0075429_100104505 | 3300006880 | Bacteria | 2474 |
| 147 | Ga0075429_100106618 | 3300006880 | Bacteria | 2448 |
| 148 | Ga0097620_100146061 | 3300006931 | Bacteria | 2440 |
| 149 | Ga0097620_100236980 | 3300006931 | Bacteria | 1914 |
| 150 | Ga0099826_10041439 | 3300006948 | Bacteria | 3194 |
| 151 | Ga0075435_100542312 | 3300007076 | Bacteria | 1007 |
| 152 | Ga0099794_10000379 | 3300007265 | Bacteria | 15234 |
| 153 | Ga0099794_10005625 | 3300007265 | Bacteria | 5042 |
| 154 | Ga0105240_10056946 | 3300009093 | Bacteria | 4888 |
| 155 | Ga0105240_10117833 | 3300009093 | Bacteria | 3201 |
| 156 | Ga0105240_10119056 | 3300009093 | Bacteria | 3182 |
| 157 | Ga0105240_10398298 | 3300009093 | Bacteria | 1551 |
| 158 | Ga0111539_10141916 | 3300009094 | Bacteria | 2812 |
| 159 | Ga0111539_10536330 | 3300009094 | Bacteria | 1363 |
| 160 | Ga0114129_10028608 | 3300009147 | Bacteria | 7896 |
| 161 | Ga0114129_10030668 | 3300009147 | Bacteria | 7606 |
| 162 | Ga0114129_10046008 | 3300009147 | Bacteria | 6133 |
| 163 | Ga0114129_10125823 | 3300009147 | Bacteria | 3524 |
| 164 | Ga0114129_10224132 | 3300009147 | Bacteria | 2535 |
| 165 | Ga0114129_10256358 | 3300009147 | Bacteria | 2346 |
| 166 | Ga0114129_10314882 | 3300009147 | Unclassified | 2082 |
| 167 | Ga0114129_10346329 | 3300009147 | Bacteria | 1969 |
| 168 | Ga0105243_10005513 | 3300009148 | Bacteria | 9864 |
| 169 | Ga0105243_10541372 | 3300009148 | Bacteria | 1111 |
| 170 | Ga0105241_10053509 | 3300009174 | Bacteria | 3087 |
| 171 | Ga0105241_10402390 | 3300009174 | Bacteria | 1201 |
| 172 | Ga0105242_10074140 | 3300009176 | Bacteria | 2831 |
| 173 | Ga0105248_10091789 | 3300009177 | Bacteria | 3420 |
| 174 | Ga0105237_10052132 | 3300009545 | Bacteria | 4108 |
| 175 | Ga0105237_10055854 | 3300009545 | Bacteria | 3954 |
| 176 | Ga0105237_10164127 | 3300009545 | Bacteria | 2220 |
| 177 | Ga0105238_10007250 | 3300009551 | Bacteria | 11101 |
| 178 | Ga0105238_10059161 | 3300009551 | Bacteria | 3839 |
| 179 | Ga0105238_10261163 | 3300009551 | Bacteria | 1711 |
| 180 | Ga0105238_10864939 | 3300009551 | Bacteria | 921 |
| 181 | Ga0105249_10033201 | 3300009553 | Unclassified | 4672 |
| 182 | Ga0105239_10020514 | 3300010375 | Bacteria | 7288 |
| 183 | Ga0105239_10027480 | 3300010375 | Bacteria | 6263 |
| 184 | Ga0105239_10056718 | 3300010375 | Bacteria | 4297 |
| 185 | Ga0105239_10234395 | 3300010375 | Bacteria | 2060 |
| 186 | Ga0105246_10029860 | 3300011119 | Bacteria | 3594 |
| 187 | Ga0157373_10324354 | 3300013100 | Bacteria | 1096 |
| 188 | Ga0157370_10142755 | 3300013104 | Bacteria | 2231 |
| 189 | Ga0157369_10102253 | 3300013105 | Bacteria | 3054 |
| 190 | Ga0157369_10447667 | 3300013105 | Bacteria | 1337 |
| 191 | Ga0157369_10546483 | 3300013105 | Bacteria | 1197 |
| 192 | Ga0157374_10041693 | 3300013296 | Bacteria | 4231 |
| 193 | Ga0157374_10057979 | 3300013296 | Bacteria | 3618 |
| 194 | Ga0157372_10079592 | 3300013307 | Bacteria | 3706 |
| 195 | Ga0157372_10298963 | 3300013307 | Bacteria | 1872 |
| 196 | Ga0157372_10319806 | 3300013307 | Bacteria | 1807 |
| 197 | Ga0157375_10040826 | 3300013308 | Bacteria | 4476 |
| 198 | Ga0157375_10381002 | 3300013308 | Bacteria | 1577 |
| 199 | Ga0163163_10120759 | 3300014325 | Bacteria | 2654 |
| 200 | Ga0163163_10289516 | 3300014325 | Bacteria | 1690 |
| 201 | Ga0163163_10816851 | 3300014325 | Bacteria | 996 |
| 202 | Ga0182008_10001729 | 3300014497 | Bacteria | 14335 |
| 203 | Ga0157377_10250410 | 3300014745 | Bacteria | 1148 |
| 204 | Ga0157379_10036629 | 3300014968 | Bacteria | 4374 |
| 205 | Ga0157376_10288646 | 3300014969 | Bacteria | 1548 |
| 206 | Ga0182007_10007209 | 3300015262 | Bacteria | 4685 |
| 207 | Ga0183367_1004 | 3300015688 | Bacteria | 716880 |
| 208 | Ga0197907_11300308 | 3300020069 | Bacteria | 2187 |
| 209 | Ga0206356_11149848 | 3300020070 | Bacteria | 1181 |
| 210 | Ga0206349_1979773 | 3300020075 | Bacteria | 1984 |
| 211 | Ga0206355_1239282 | 3300020076 | Bacteria | 1604 |
| 212 | Ga0206351_10315251 | 3300020077 | Bacteria | 2505 |
| 213 | Ga0206352_11125578 | 3300020078 | Bacteria | 1256 |
| 214 | Ga0206350_10016465 | 3300020080 | Bacteria | 2358 |
| 215 | Ga0206350_10555428 | 3300020080 | Bacteria | 976 |
| 216 | Ga0206354_11034032 | 3300020081 | Bacteria | 1907 |
| 217 | Ga0206354_11077463 | 3300020081 | Bacteria | 1184 |
| 218 | Ga0206353_11150681 | 3300020082 | Bacteria | 1022 |
| 219 | Ga0206353_11348600 | 3300020082 | Bacteria | 1173 |
| 220 | Ga0154015_1558468 | 3300020610 | Bacteria | 3056 |
| 221 | Ga0213873_10012688 | 3300021358 | Bacteria | 1832 |
| 222 | Ga0213875_10001136 | 3300021388 | Bacteria | 18301 |
| 223 | Ga0213875_10025499 | 3300021388 | Bacteria | 2817 |
| 224 | Ga0224712_10014297 | 3300022467 | Bacteria | 2551 |
| 225 | Ga0224712_10062840 | 3300022467 | Bacteria | 1484 |
| 226 | Ga0209758_1005093 | 3300025297 | Bacteria | 10405 |
| 227 | Ga0207653_10004255 | 3300025885 | Bacteria | 4498 |
| 228 | Ga0207692_10007533 | 3300025898 | Bacteria | 4462 |
| 229 | Ga0207692_10132031 | 3300025898 | Bacteria | 1411 |
| 230 | Ga0207688_10158084 | 3300025901 | Bacteria | 1342 |
| 231 | Ga0207647_10002020 | 3300025904 | Bacteria | 15521 |
| 232 | Ga0207647_10003293 | 3300025904 | Bacteria | 12130 |
| 233 | Ga0207647_10018266 | 3300025904 | Bacteria | 4749 |
| 234 | Ga0207699_10017074 | 3300025906 | Bacteria | 3810 |
| 235 | Ga0207699_10352449 | 3300025906 | Bacteria | 1039 |
| 236 | Ga0207643_10066625 | 3300025908 | Bacteria | 2065 |
| 237 | Ga0207684_10169966 | 3300025910 | Bacteria | 1879 |
| 238 | Ga0207684_10310947 | 3300025910 | Bacteria | 1358 |
| 239 | Ga0207707_10108337 | 3300025912 | Bacteria | 2428 |
| 240 | Ga0207707_10188710 | 3300025912 | Bacteria | 1798 |
| 241 | Ga0207707_10189415 | 3300025912 | Bacteria | 1795 |
| 242 | Ga0207707_10245884 | 3300025912 | Bacteria | 1554 |
| 243 | Ga0207695_10007827 | 3300025913 | Bacteria | 13519 |
| 244 | Ga0207695_10011119 | 3300025913 | Bacteria | 10927 |
| 245 | Ga0207695_10284850 | 3300025913 | Bacteria | 1545 |
| 246 | Ga0207671_10003792 | 3300025914 | Bacteria | 14834 |
| 247 | Ga0207671_10004981 | 3300025914 | Bacteria | 12439 |
| 248 | Ga0207671_10039693 | 3300025914 | Bacteria | 3486 |
| 249 | Ga0207693_10029588 | 3300025915 | Bacteria | 4324 |
| 250 | Ga0207693_10032134 | 3300025915 | Bacteria | 4144 |
| 251 | Ga0207663_10360218 | 3300025916 | Bacteria | 1103 |
| 252 | Ga0207657_10058253 | 3300025919 | Bacteria | 3325 |
| 253 | Ga0207646_10023471 | 3300025922 | Bacteria | 5665 |
| 254 | Ga0207646_10065981 | 3300025922 | Bacteria | 3231 |
| 255 | Ga0207646_10070215 | 3300025922 | Unclassified | 3128 |
| 256 | Ga0207646_10085834 | 3300025922 | Bacteria | 2815 |
| 257 | Ga0207694_10002783 | 3300025924 | Bacteria | 14120 |
| 258 | Ga0207694_10047018 | 3300025924 | Bacteria | 3337 |
| 259 | Ga0207650_10053041 | 3300025925 | Bacteria | 3005 |
| 260 | Ga0207650_10484242 | 3300025925 | Bacteria | 1033 |
| 261 | Ga0207659_10028415 | 3300025926 | Bacteria | 3801 |
| 262 | Ga0207700_10009251 | 3300025928 | Bacteria | 6146 |
| 263 | Ga0207700_10124867 | 3300025928 | Bacteria | 2092 |
| 264 | Ga0207700_10242308 | 3300025928 | Bacteria | 1537 |
| 265 | Ga0207700_10425078 | 3300025928 | Bacteria | 1168 |
| 266 | Ga0207700_10631329 | 3300025928 | Bacteria | 954 |
| 267 | Ga0207664_10004878 | 3300025929 | Bacteria | 9117 |
| 268 | Ga0207664_10014874 | 3300025929 | Bacteria | 5633 |
| 269 | Ga0207664_10027629 | 3300025929 | Bacteria | 4304 |
| 270 | Ga0207664_10082644 | 3300025929 | Bacteria | 2616 |
| 271 | Ga0207664_10095366 | 3300025929 | Bacteria | 2447 |
| 272 | Ga0207664_10273984 | 3300025929 | Bacteria | 1479 |
| 273 | Ga0207664_10418478 | 3300025929 | Bacteria | 1193 |
| 274 | Ga0207686_10100915 | 3300025934 | Bacteria | 1927 |
| 275 | Ga0207709_10086750 | 3300025935 | Bacteria | 2033 |
| 276 | Ga0207709_10146312 | 3300025935 | Bacteria | 1631 |
| 277 | Ga0207709_10150310 | 3300025935 | Bacteria | 1612 |
| 278 | Ga0207669_10033141 | 3300025937 | Bacteria | 2911 |
| 279 | Ga0207669_10264392 | 3300025937 | Bacteria | 1289 |
| 280 | Ga0207669_10466945 | 3300025937 | Bacteria | 1003 |
| 281 | Ga0207665_10056251 | 3300025939 | Bacteria | 2655 |
| 282 | Ga0207691_10140317 | 3300025940 | Bacteria | 2130 |
| 283 | Ga0207711_10062678 | 3300025941 | Bacteria | 3207 |
| 284 | Ga0207689_10093608 | 3300025942 | Bacteria | 2468 |
| 285 | Ga0207661_10126180 | 3300025944 | Bacteria | 2186 |
| 286 | Ga0207661_10701847 | 3300025944 | Bacteria | 931 |
| 287 | Ga0207679_10192766 | 3300025945 | Bacteria | 1696 |
| 288 | Ga0207679_10288580 | 3300025945 | Bacteria | 1410 |
| 289 | Ga0207667_10006703 | 3300025949 | Bacteria | 13918 |
| 290 | Ga0207667_10073859 | 3300025949 | Bacteria | 3543 |
| 291 | Ga0207712_10011952 | 3300025961 | Bacteria | 5538 |
| 292 | Ga0207668_10004702 | 3300025972 | Bacteria | 8033 |
| 293 | Ga0207668_10016690 | 3300025972 | Bacteria | 4587 |
| 294 | Ga0207668_10040811 | 3300025972 | Bacteria | 3133 |
| 295 | Ga0207640_10019999 | 3300025981 | Bacteria | 3967 |
| 296 | Ga0207640_10235200 | 3300025981 | Bacteria | 1412 |
| 297 | Ga0207639_10038634 | 3300026041 | Bacteria | 3551 |
| 298 | Ga0207639_10264660 | 3300026041 | Bacteria | 1505 |
| 299 | Ga0207639_10377038 | 3300026041 | Bacteria | 1273 |
| 300 | Ga0207678_10002060 | 3300026067 | Bacteria | 18229 |
| 301 | Ga0207678_10012846 | 3300026067 | Bacteria | 7351 |
| 302 | Ga0207678_10106131 | 3300026067 | Bacteria | 2396 |
| 303 | Ga0207708_10132841 | 3300026075 | Bacteria | 1947 |
| 304 | Ga0207702_10028440 | 3300026078 | Bacteria | 4646 |
| 305 | Ga0207702_10370905 | 3300026078 | Bacteria | 1374 |
| 306 | Ga0207641_10100640 | 3300026088 | Bacteria | 2546 |
| 307 | Ga0207641_10210472 | 3300026088 | Bacteria | 1798 |
| 308 | Ga0207676_10381848 | 3300026095 | Bacteria | 1312 |
| 309 | Ga0207674_10092503 | 3300026116 | Bacteria | 3014 |
| 310 | Ga0207674_10416180 | 3300026116 | Bacteria | 1299 |
| 311 | Ga0207675_100153339 | 3300026118 | Bacteria | 2194 |
| 312 | Ga0207675_100511011 | 3300026118 | Bacteria | 1197 |
| 313 | Ga0207683_10002509 | 3300026121 | Bacteria | 16016 |
| 314 | Ga0207698_10020317 | 3300026142 | Bacteria | 4569 |
| 315 | Ga0207698_10468480 | 3300026142 | Bacteria | 1219 |
| 316 | Ga0209371_1041838 | 3300027312 | Bacteria | 925 |
| 317 | Ga0209588_1002430 | 3300027671 | Bacteria | 5048 |
| 318 | Ga0209588_1066879 | 3300027671 | Bacteria | 1161 |
| 319 | Ga0209813_10003614 | 3300027866 | Bacteria | 3634 |
| 320 | Ga0268266_10091363 | 3300028379 | Bacteria | 2669 |
| 321 | Ga0268266_10371048 | 3300028379 | Bacteria | 1348 |
| 322 | Ga0268266_10432896 | 3300028379 | Bacteria | 1248 |
| 323 | Ga0268265_10129262 | 3300028380 | Bacteria | 2096 |
| 324 | Ga0268265_10141091 | 3300028380 | Unclassified | 2018 |
| 325 | Ga0268265_10231276 | 3300028380 | Bacteria | 1625 |
| 326 | Ga0268265_10237875 | 3300028380 | Bacteria | 1605 |
| 327 | Ga0268264_10418906 | 3300028381 | Bacteria | 1291 |
| 328 | Ga0265337_1003592 | 3300028556 | Bacteria | 6665 |
| 329 | Ga0265326_10004837 | 3300028558 | Bacteria | 4273 |
| 330 | Ga0265318_10060858 | 3300028577 | Bacteria | 1407 |
| 331 | Ga0265336_10015575 | 3300028666 | Bacteria | 2498 |
| 332 | Ga0307517_10015716 | 3300028786 | Bacteria | 10027 |
| 333 | Ga0307517_10098017 | 3300028786 | Bacteria | 2336 |
| 334 | Ga0307515_10035516 | 3300028794 | Bacteria | 8104 |
| 335 | Ga0265338_10001125 | 3300028800 | Bacteria | 44338 |
| 336 | Ga0265338_10002141 | 3300028800 | Bacteria | 30351 |
| 337 | Ga0265338_10021555 | 3300028800 | Bacteria | 6712 |
| 338 | Ga0265324_10003209 | 3300029957 | Bacteria | 7909 |
| 339 | Ga0268256_1047437 | 3300030500 | Bacteria | 925 |
| 340 | Ga0307511_10001845 | 3300030521 | Bacteria | 22256 |
| 341 | Ga0307512_10012522 | 3300030522 | Bacteria | 8005 |
| 342 | Ga0265332_10009694 | 3300031238 | Bacteria | 4296 |
| 343 | Ga0265320_10007771 | 3300031240 | Bacteria | 6623 |
| 344 | Ga0265325_10151626 | 3300031241 | Bacteria | 1096 |
| 345 | Ga0265340_10009313 | 3300031247 | Bacteria | 5273 |
| 346 | Ga0307513_10010495 | 3300031456 | Bacteria | 11599 |
| 347 | Ga0307513_10270749 | 3300031456 | Bacteria | 1482 |
| 348 | Ga0307509_10008191 | 3300031507 | Bacteria | 13384 |
| 349 | Ga0307509_10014865 | 3300031507 | Bacteria | 9124 |
| 350 | Ga0307509_10057050 | 3300031507 | Bacteria | 4143 |
| 351 | Ga0307509_10132730 | 3300031507 | Bacteria | 2442 |
| 352 | Ga0307509_10297031 | 3300031507 | Bacteria | 1366 |
| 353 | Ga0307508_10009307 | 3300031616 | Bacteria | 9038 |
| 354 | Ga0307508_10099344 | 3300031616 | Bacteria | 2504 |
| 355 | Ga0265342_10012194 | 3300031712 | Bacteria | 5830 |
| 356 | Ga0307516_10005367 | 3300031730 | Bacteria | 15401 |
| 357 | Ga0307516_10011460 | 3300031730 | Bacteria | 9626 |
| 358 | Ga0307516_10011822 | 3300031730 | Bacteria | 9460 |
| 359 | Ga0307516_10026405 | 3300031730 | Bacteria | 5897 |
| 360 | Ga0307516_10121392 | 3300031730 | Bacteria | 2403 |
| 361 | Ga0307405_10081816 | 3300031731 | Bacteria | 2112 |
| 362 | Ga0307518_10013497 | 3300031838 | Bacteria | 5839 |
| 363 | Ga0307518_10213395 | 3300031838 | Bacteria | 1268 |
| 364 | Ga0307410_10213807 | 3300031852 | Bacteria | 1479 |
| 365 | Ga0307406_10472177 | 3300031901 | Bacteria | 1011 |
| 366 | Ga0307407_10380370 | 3300031903 | Bacteria | 1008 |
| 367 | Ga0307409_100319979 | 3300031995 | Bacteria | 1451 |
| 368 | Ga0307409_100350195 | 3300031995 | Bacteria | 1393 |
| 369 | Ga0307411_10426864 | 3300032005 | Bacteria | 1103 |
| 370 | Ga0307415_100122260 | 3300032126 | Bacteria | 1954 |
| 371 | Ga0307507_10000764 | 3300033179 | Bacteria | 70897 |
| 372 | Ga0307507_10010565 | 3300033179 | Bacteria | 11899 |
| 373 | Ga0307510_10008462 | 3300033180 | Bacteria | 12260 |
| 374 | Ga0373930_0017205 | 3300034816 | Bacteria | 1376 |
| 375 | Ga0373938_0040689 | 3300034957 | Bacteria | 1032 |
| 376 | Ga0373926_0004626 | 3300035083 | Bacteria | 4520 |
| 377 | Ga0373928_0064565 | 3300035084 | Bacteria | 892 |
| 378 | Ga0373934_0037648 | 3300035086 | Bacteria | 1904 |
| 379 | Ga0373944_0000495 | 3300035089 | Bacteria | 9161 |
| 380 | Ga0373944_0004271 | 3300035089 | Bacteria | 3714 |
| 381 | Ga0373951_0000007 | 3300035091 | Bacteria | 82975 |
| 382 | Ga0373923_0004925 | 3300035111 | Bacteria | 4485 |
| 383 | Ga0373923_0032357 | 3300035111 | Bacteria | 2112 |
| 384 | Ga0373936_0000130 | 3300035113 | Bacteria | 26133 |
| 385 | Ga0373936_0000832 | 3300035113 | Bacteria | 10967 |
| 386 | Ga0373936_0006171 | 3300035113 | Bacteria | 4516 |
| 387 | Ga0373945_0000149 | 3300035116 | Bacteria | 17816 |
| 388 | Ga0373945_0008677 | 3300035116 | Bacteria | 3315 |
| 389 | Ga0373954_0138525 | 3300035118 | Unclassified | 1186 |
| 390 | Ga0373956_0011655 | 3300035119 | Bacteria | 3625 |
| 391 | Ga0373956_0020262 | 3300035119 | Bacteria | 2828 |
| 392 | Ga0373957_0002159 | 3300035120 | Bacteria | 5546 |
| 393 | Ga0373957_0115950 | 3300035120 | Bacteria | 1081 |
| 394 | Ga0373943_0000215 | 3300035170 | Bacteria | 23592 |
| 395 | Ga0373943_0000957 | 3300035170 | Bacteria | 12812 |
| 396 | Ga0373946_0000093 | 3300035171 | Bacteria | 24751 |
| 397 | Ga0373946_0024650 | 3300035171 | Bacteria | 2359 |
| 398 | Ga0373946_0095299 | 3300035171 | Bacteria | 1326 |
| 399 | Ga0373955_0226615 | 3300035172 | Bacteria | 1117 |
| 400 | Ga0373924_0003990 | 3300035410 | Bacteria | 5124 |
| 401 | Ga0373924_0009400 | 3300035410 | Bacteria | 3581 |
| 402 | Ga0373924_0099711 | 3300035410 | Bacteria | 1248 |
| 403 | Ga0373935_0003933 | 3300035692 | Bacteria | 8676 |
| 404 | Ga0373935_0038244 | 3300035692 | Bacteria | 3003 |
| 405 | Ga0373927_0003366 | 3300035695 | Bacteria | 11501 |
| 406 | Ga0373933_0150265 | 3300035724 | Unclassified | 1474 |
| 407 | Ga0373947_0000281 | 3300035725 | Bacteria | 28827 |
| 408 | Ga0373947_0001422 | 3300035725 | Bacteria | 14726 |
| 409 | Ga0373937_0365024 | 3300036401 | Bacteria | 1369 |
| 410 | Ga0373937_0368784 | 3300036401 | Bacteria | 1361 |
| 411 | Ga0373937_0707011 | 3300036401 | Bacteria | 954 |
| 412 | Ga0373925_0000938 | 3300037068 | Bacteria | 26552 |
| 413 | Ga0373925_0063645 | 3300037068 | Bacteria | 2775 |
| 414 | Ga0395899_0019364 | 3300037312 | Bacteria | 5171 |
| 415 | Ga0395905_0028163 | 3300037471 | Bacteria | 5295 |
| 416 | Ga0395905_0189242 | 3300037471 | Bacteria | 1931 |
| 417 | Ga0436364_0106543 | 3300037853 | Bacteria | 8816 |
| 418 | Ga0436364_0251595 | 3300037853 | Bacteria | 5042 |
| 419 | Ga0436364_0322086 | 3300037853 | Bacteria | 1292 |
| 420 | Ga0436364_0547435 | 3300037853 | Bacteria | 2234 |
| 421 | Ga0436364_1094297 | 3300037853 | Bacteria | 1479 |
| 422 | Ga0436364_1513258 | 3300037853 | Bacteria | 41820 |
| 423 | Ga0395901_0055031 | 3300038443 | Bacteria | 4136 |
| 424 | Ga0395901_0231231 | 3300038443 | Bacteria | 1930 |
| 425 | Ga0436365_0709127 | 3300039437 | Bacteria | 6287 |
| 426 | Ga0436363_0132265 | 3300039450 | Bacteria | 1224 |
| 427 | Ga0436363_0210186 | 3300039450 | Bacteria | 1271 |
| 428 | Ga0436363_0669568 | 3300039450 | Bacteria | 4597 |
| 429 | Ga0451791_0533426 | 3300041451 | Bacteria | 12768 |
| 430 | Ga0451791_1032133 | 3300041451 | Bacteria | 2281 |
| 431 | Ga0451793_0872584 | 3300041452 | Bacteria | 2655 |
| 432 | Ga0451797_0534996 | 3300041453 | Bacteria | 1568 |
| 433 | Ga0451833_0544441 | 3300041491 | Bacteria | 2382 |
| 434 | Ga0451849_1317838 | 3300041505 | Bacteria | 1855 |
| 435 | Ga0451843_1022444 | 3300041509 | Bacteria | 2379 |
| 436 | Ga0451843_1657210 | 3300041509 | Bacteria | 1193 |
| 437 | Ga0451853_0634586 | 3300041512 | Bacteria | 988 |
| 438 | Ga0451853_1790813 | 3300041512 | Bacteria | 3352 |
| 439 | Ga0450903_000935 | 3300042138 | Bacteria | 5601 |
| 440 | Ga0439458_0001541 | 3300042157 | Bacteria | 5758 |
| 441 | Ga0466972_0003733 | 3300044658 | Bacteria | 7572 |
| 442 | Ga0466972_0047018 | 3300044658 | Bacteria | 2088 |
| 443 | Ga0466965_0059194 | 3300044683 | Bacteria | 1911 |
| 444 | Ga0466963_0022039 | 3300044694 | Bacteria | 4029 |
| 445 | Ga0466963_0033665 | 3300044694 | Bacteria | 3329 |
| 446 | Ga0466963_0067818 | 3300044694 | Bacteria | 2395 |
| 447 | Ga0466963_0095012 | 3300044694 | Bacteria | 2034 |
| 448 | Ga0466963_0452817 | 3300044694 | Bacteria | 906 |
| 449 | Ga0453684_0055272 | 3300044712 | Bacteria | 5163 |
| 450 | Ga0466968_0002819 | 3300044735 | Bacteria | 6427 |
| 451 | Ga0466960_0070191 | 3300044901 | Bacteria | 1742 |
| 452 | Ga0451576_0383906 | 3300045051 | Unclassified | 1472 |
| 453 | Ga0466958_0081307 | 3300045836 | Bacteria | 1994 |
| 454 | Ga0466958_0142051 | 3300045836 | Bacteria | 1512 |
| 455 | Ga0466958_0211069 | 3300045836 | Bacteria | 1237 |
| 456 | Ga0466967_0017599 | 3300045976 | Bacteria | 5682 |
| 457 | Ga0495592_0013236 | 3300046454 | Bacteria | 6279 |
| 458 | Ga0495592_0096503 | 3300046454 | Bacteria | 2113 |
| 459 | Ga0495603_0005209 | 3300046455 | Bacteria | 7761 |
| 460 | Ga0495603_0011279 | 3300046455 | Bacteria | 5415 |
| 461 | Ga0495603_0211718 | 3300046455 | Bacteria | 1119 |
| 462 | Ga0495629_0013616 | 3300046459 | Bacteria | 5869 |
| 463 | Ga0495629_0064455 | 3300046459 | Unclassified | 2558 |
| 464 | Ga0495629_0104900 | 3300046459 | Bacteria | 1972 |
| 465 | Ga0495629_0105539 | 3300046459 | Bacteria | 1965 |
| 466 | Ga0495629_0243420 | 3300046459 | Bacteria | 1238 |
| 467 | Ga0495638_0285927 | 3300046460 | Bacteria | 894 |
| 468 | Ga0495641_0006885 | 3300046461 | Bacteria | 7260 |
| 469 | Ga0495641_0046578 | 3300046461 | Bacteria | 1993 |
| 470 | Ga0495651_0000379 | 3300046462 | Bacteria | 34464 |
| 471 | Ga0495651_0024679 | 3300046462 | Bacteria | 4677 |
| 472 | Ga0495651_0055128 | 3300046462 | Bacteria | 3055 |
| 473 | Ga0495651_0132587 | 3300046462 | Bacteria | 1817 |
| 474 | Ga0495651_0166970 | 3300046462 | Bacteria | 1571 |
| 475 | Ga0495653_0008557 | 3300046463 | Bacteria | 8388 |
| 476 | Ga0495653_0049045 | 3300046463 | Bacteria | 3255 |
| 477 | Ga0495653_0089841 | 3300046463 | Bacteria | 2249 |
| 478 | Ga0495580_0156654 | 3300046472 | Bacteria | 1577 |
| 479 | Ga0495580_0185560 | 3300046472 | Bacteria | 1436 |
| 480 | Ga0495582_0003457 | 3300046473 | Bacteria | 8905 |
| 481 | Ga0495662_0023431 | 3300046476 | Bacteria | 2981 |
| 482 | Ga0495662_0064196 | 3300046476 | Bacteria | 1774 |
| 483 | Ga0495662_0073211 | 3300046476 | Unclassified | 1661 |
| 484 | Ga0495664_0000201 | 3300046477 | Bacteria | 28936 |
| 485 | Ga0495664_0012750 | 3300046477 | Bacteria | 4761 |
| 486 | Ga0495664_0023357 | 3300046477 | Bacteria | 3589 |
| 487 | Ga0495664_0037923 | 3300046477 | Bacteria | 2845 |
| 488 | Ga0495664_0038774 | 3300046477 | Bacteria | 2813 |
| 489 | Ga0495585_0011662 | 3300046492 | Bacteria | 5199 |
| 490 | Ga0495594_0005111 | 3300046499 | Bacteria | 6752 |
| 491 | Ga0495594_0036012 | 3300046499 | Bacteria | 2698 |
| 492 | Ga0495594_0049759 | 3300046499 | Bacteria | 2304 |
| 493 | Ga0495594_0057012 | 3300046499 | Bacteria | 2157 |
| 494 | Ga0495594_0156008 | 3300046499 | Bacteria | 1296 |
| 495 | Ga0495608_0010295 | 3300046511 | Bacteria | 6524 |
| 496 | Ga0495608_0217886 | 3300046511 | Bacteria | 1198 |
| 497 | Ga0495618_0067670 | 3300046514 | Bacteria | 2271 |
| 498 | Ga0495618_0107644 | 3300046514 | Bacteria | 1785 |
| 499 | Ga0495628_0028761 | 3300046516 | Bacteria | 4514 |
| 500 | Ga0495628_0070517 | 3300046516 | Bacteria | 2725 |
| 501 | Ga0495628_0075805 | 3300046516 | Bacteria | 2619 |
| 502 | Ga0495628_0092354 | 3300046516 | Bacteria | 2341 |
| 503 | Ga0495630_0018527 | 3300046517 | Bacteria | 5115 |
| 504 | Ga0495630_0031131 | 3300046517 | Bacteria | 3971 |
| 505 | Ga0495630_0075780 | 3300046517 | Bacteria | 2534 |
| 506 | Ga0495643_0001146 | 3300046522 | Bacteria | 25946 |
| 507 | Ga0495666_0000552 | 3300046526 | Bacteria | 16660 |
| 508 | Ga0495666_0013381 | 3300046526 | Bacteria | 4091 |
| 509 | Ga0495652_0000907 | 3300046529 | Bacteria | 34031 |
| 510 | Ga0495652_0031842 | 3300046529 | Bacteria | 4616 |
| 511 | Ga0495652_0055261 | 3300046529 | Bacteria | 3377 |
| 512 | Ga0495652_0085403 | 3300046529 | Unclassified | 2593 |
| 513 | Ga0495652_0088626 | 3300046529 | Bacteria | 2535 |
| 514 | Ga0495652_0089252 | 3300046529 | Bacteria | 2524 |
| 515 | Ga0495652_0280824 | 3300046529 | Bacteria | 1219 |
| 516 | Ga0495665_0011354 | 3300046531 | Bacteria | 4821 |
| 517 | Ga0495665_0013287 | 3300046531 | Unclassified | 4454 |
| 518 | Ga0495665_0094082 | 3300046531 | Unclassified | 1574 |
| 519 | Ga0495640_0006409 | 3300046533 | Bacteria | 9305 |
| 520 | Ga0495640_0015167 | 3300046533 | Bacteria | 5803 |
| 521 | Ga0495640_0022769 | 3300046533 | Bacteria | 4575 |
| 522 | Ga0495586_0014494 | 3300046535 | Bacteria | 4186 |
| 523 | Ga0495586_0026376 | 3300046535 | Bacteria | 3109 |
| 524 | Ga0495587_0019464 | 3300046536 | Unclassified | 4200 |
| 525 | Ga0495587_0030158 | 3300046536 | Bacteria | 3290 |
| 526 | Ga0495587_0111824 | 3300046536 | Bacteria | 1568 |
| 527 | Ga0495587_0172138 | 3300046536 | Bacteria | 1230 |
| 528 | Ga0495645_0021232 | 3300046543 | Bacteria | 4692 |
| 529 | Ga0495645_0056141 | 3300046543 | Bacteria | 2859 |
| 530 | Ga0495645_0105883 | 3300046543 | Bacteria | 1995 |
| 531 | Ga0495645_0177100 | 3300046543 | Bacteria | 1464 |
| 532 | Ga0495645_0281496 | 3300046543 | Bacteria | 1093 |
| 533 | Ga0495622_0002320 | 3300046557 | Bacteria | 9263 |
| 534 | Ga0495622_0108355 | 3300046557 | Bacteria | 1272 |
| 535 | Ga0495633_0160255 | 3300046558 | Bacteria | 1038 |
| 536 | Ga0495667_0001730 | 3300046559 | Bacteria | 14506 |
| 537 | Ga0495667_0003309 | 3300046559 | Bacteria | 10795 |
| 538 | Ga0495667_0053600 | 3300046559 | Bacteria | 2656 |
| 539 | Ga0495667_0213169 | 3300046559 | Bacteria | 1234 |
| 540 | Ga0495667_0250746 | 3300046559 | Unclassified | 1126 |
| 541 | Ga0495668_0069214 | 3300046616 | Bacteria | 1941 |
| 542 | Ga0495634_0028681 | 3300046642 | Bacteria | 3861 |
| 543 | Ga0495634_0051324 | 3300046642 | Bacteria | 2767 |
| 544 | Ga0495634_0069301 | 3300046642 | Bacteria | 2327 |
| 545 | Ga0495634_0137665 | 3300046642 | Bacteria | 1552 |
| 546 | Ga0495634_0151354 | 3300046642 | Bacteria | 1467 |
| 547 | Ga0495634_0203272 | 3300046642 | Bacteria | 1229 |
| 548 | Ga0495625_0093417 | 3300046660 | Bacteria | 2077 |
| 549 | Ga0495625_0229035 | 3300046660 | Bacteria | 1214 |
| 550 | Ga0495635_0015118 | 3300046663 | Bacteria | 5398 |
| 551 | Ga0495635_0019569 | 3300046663 | Bacteria | 4717 |
| 552 | Ga0495635_0066481 | 3300046663 | Bacteria | 2472 |
| 553 | Ga0495635_0209020 | 3300046663 | Bacteria | 1322 |
| 554 | Ga0495635_0218550 | 3300046663 | Bacteria | 1289 |
| 555 | Ga0495588_0062728 | 3300046674 | Bacteria | 1927 |
| 556 | Ga0495588_0120437 | 3300046674 | Bacteria | 1383 |
| 557 | Ga0495657_0006923 | 3300046675 | Bacteria | 8811 |
| 558 | Ga0495657_0009245 | 3300046675 | Bacteria | 7479 |
| 559 | Ga0495657_0025150 | 3300046675 | Bacteria | 4231 |
| 560 | Ga0495657_0053525 | 3300046675 | Bacteria | 2700 |
| 561 | Ga0495599_0001729 | 3300046678 | Bacteria | 12632 |
| 562 | Ga0495599_0026918 | 3300046678 | Bacteria | 3604 |
| 563 | Ga0495599_0040358 | 3300046678 | Bacteria | 2931 |
| 564 | Ga0495599_0063095 | 3300046678 | Bacteria | 2315 |
| 565 | Ga0495623_0090235 | 3300046679 | Bacteria | 1882 |
| 566 | Ga0495646_0035840 | 3300046680 | Bacteria | 3075 |
| 567 | Ga0495646_0066319 | 3300046680 | Bacteria | 2135 |
| 568 | Ga0495658_0117816 | 3300046683 | Bacteria | 1603 |
| 569 | Ga0495613_0005770 | 3300046689 | Bacteria | 9268 |
| 570 | Ga0495613_0020247 | 3300046689 | Bacteria | 4959 |
| 571 | Ga0495613_0047080 | 3300046689 | Bacteria | 3185 |
| 572 | Ga0495624_0008283 | 3300046690 | Bacteria | 7266 |
| 573 | Ga0495624_0008414 | 3300046690 | Bacteria | 7193 |
| 574 | Ga0495624_0069303 | 3300046690 | Bacteria | 2197 |
| 575 | Ga0495624_0074728 | 3300046690 | Bacteria | 2105 |
| 576 | Ga0495624_0097983 | 3300046690 | Bacteria | 1806 |
| 577 | Ga0495670_0002567 | 3300046691 | Bacteria | 8983 |
| 578 | Ga0495670_0044927 | 3300046691 | Bacteria | 2206 |
| 579 | Ga0495670_0202041 | 3300046691 | Bacteria | 1053 |
| 580 | Ga0495649_0207781 | 3300046694 | Bacteria | 1015 |
| 581 | Ga0495600_0009915 | 3300046809 | Bacteria | 5901 |
| 582 | Ga0495600_0022514 | 3300046809 | Bacteria | 4046 |
| 583 | Ga0495600_0055193 | 3300046809 | Bacteria | 2595 |
| 584 | Ga0495600_0227580 | 3300046809 | Bacteria | 1191 |
| 585 | Ga0495581_0011166 | 3300047315 | Bacteria | 5191 |
| 586 | Ga0495581_0039774 | 3300047315 | Bacteria | 2722 |
| 587 | Ga0495581_0067139 | 3300047315 | Bacteria | 2074 |
| 588 | Ga0495581_0076371 | 3300047315 | Bacteria | 1938 |
| 589 | Ga0495581_0253407 | 3300047315 | Bacteria | 1029 |
| 590 | Ga0495604_0001022 | 3300047317 | Bacteria | 23329 |
| 591 | Ga0495604_0022180 | 3300047317 | Bacteria | 5068 |
| 592 | Ga0495604_0023988 | 3300047317 | Bacteria | 4869 |
| 593 | Ga0495604_0049866 | 3300047317 | Bacteria | 3251 |
| 594 | Ga0495604_0058461 | 3300047317 | Bacteria | 2960 |
| 595 | Ga0495636_0005127 | 3300047318 | Bacteria | 5143 |
| 596 | Ga0495674_0036982 | 3300047319 | Bacteria | 4388 |
| 597 | Ga0495674_0037389 | 3300047319 | Bacteria | 4362 |
| 598 | Ga0495674_0037793 | 3300047319 | Bacteria | 4337 |
| 599 | Ga0495674_0072664 | 3300047319 | Bacteria | 2966 |
| 600 | Ga0495674_0102541 | 3300047319 | Bacteria | 2433 |
| 601 | Ga0495674_0231600 | 3300047319 | Unclassified | 1524 |
| 602 | Ga0495676_0001118 | 3300047321 | Bacteria | 22768 |
| 603 | Ga0495676_0003045 | 3300047321 | Bacteria | 15160 |
| 604 | Ga0495676_0009560 | 3300047321 | Bacteria | 8823 |
| 605 | Ga0495676_0066427 | 3300047321 | Bacteria | 2795 |
| 606 | Ga0495680_0006058 | 3300047322 | Bacteria | 11305 |
| 607 | Ga0495680_0010145 | 3300047322 | Bacteria | 8419 |
| 608 | Ga0495680_0086265 | 3300047322 | Bacteria | 2362 |
| 609 | Ga0495680_0283291 | 3300047322 | Unclassified | 1167 |
| 610 | Ga0495680_0300711 | 3300047322 | Unclassified | 1126 |
| 611 | Ga0495687_011560 | 3300047443 | Bacteria | 4735 |
| 612 | Ga0495675_0014676 | 3300047444 | Bacteria | 4950 |
| 613 | Ga0495675_0019290 | 3300047444 | Bacteria | 4332 |
| 614 | Ga0495675_0026019 | 3300047444 | Bacteria | 3729 |
| 615 | Ga0495675_0135248 | 3300047444 | Bacteria | 1531 |
| 616 | Ga0495675_0335418 | 3300047444 | Bacteria | 892 |
| 617 | Ga0495685_005146 | 3300047447 | Bacteria | 4259 |
| 618 | Ga0495685_017601 | 3300047447 | Bacteria | 2448 |
| 619 | Ga0495681_0019415 | 3300047470 | Bacteria | 3712 |
| 620 | Ga0495684_0003673 | 3300047471 | Bacteria | 11961 |
| 621 | Ga0495684_0020894 | 3300047471 | Bacteria | 5044 |
| 622 | Ga0495684_0134259 | 3300047471 | Unclassified | 1857 |
| 623 | Ga0495686_0159329 | 3300047472 | Bacteria | 1320 |
| 624 | Ga0495593_0006667 | 3300047673 | Bacteria | 6756 |
| 625 | Ga0495593_0017180 | 3300047673 | Bacteria | 4072 |
| 626 | Ga0495593_0032938 | 3300047673 | Bacteria | 2823 |
| 627 | Ga0495593_0077909 | 3300047673 | Bacteria | 1717 |
| 628 | Ga0495602_0329632 | 3300048088 | Bacteria | 1107 |
| 629 | Ga0495614_0013090 | 3300048089 | Bacteria | 3639 |
| 630 | Ga0495614_0040921 | 3300048089 | Bacteria | 1988 |
| 631 | Ga0496100_0066632 | 3300048903 | Bacteria | 2389 |
| 632 | Ga0496100_0491466 | 3300048903 | Bacteria | 945 |
| 633 | Ga0496101_0133285 | 3300048904 | Bacteria | 1888 |
| 634 | Ga0496102_0004687 | 3300048905 | Bacteria | 11566 |
| 635 | Ga0496102_0006047 | 3300048905 | Bacteria | 10311 |
| 636 | Ga0496102_0258960 | 3300048905 | Bacteria | 1640 |
| 637 | Ga0496102_0330452 | 3300048905 | Bacteria | 1436 |
| 638 | Ga0496102_0531909 | 3300048905 | Bacteria | 1098 |
| 639 | Ga0496103_0002730 | 3300048906 | Bacteria | 11014 |
| 640 | Ga0496104_0001017 | 3300048907 | Bacteria | 23981 |
| 641 | Ga0496104_0079887 | 3300048907 | Bacteria | 3117 |
| 642 | Ga0496105_0087210 | 3300048908 | Bacteria | 2579 |
| 643 | Ga0496105_0218790 | 3300048908 | Bacteria | 1551 |
| 644 | Ga0496105_0312350 | 3300048908 | Bacteria | 1261 |
| 645 | Ga0496106_0304688 | 3300048909 | Bacteria | 1278 |
| 646 | Ga0496106_0405562 | 3300048909 | Bacteria | 1095 |
| 647 | Ga0496107_0090067 | 3300048910 | Bacteria | 2241 |
| 648 | Ga0496108_0000860 | 3300048911 | Bacteria | 23710 |
| 649 | Ga0496108_0001445 | 3300048911 | Bacteria | 18766 |
| 650 | Ga0496108_0073174 | 3300048911 | Bacteria | 2894 |
| 651 | Ga0496108_0181913 | 3300048911 | Bacteria | 1820 |
| 652 | Ga0496108_0366814 | 3300048911 | Bacteria | 1257 |
| 653 | Ga0496109_0001156 | 3300048912 | Bacteria | 21959 |
| 654 | Ga0496109_0039494 | 3300048912 | Bacteria | 4272 |
| 655 | Ga0496109_0055275 | 3300048912 | Bacteria | 3621 |
| 656 | Ga0496109_0099741 | 3300048912 | Bacteria | 2694 |
| 657 | Ga0496109_0250297 | 3300048912 | Bacteria | 1669 |
| 658 | Ga0496109_0311231 | 3300048912 | Bacteria | 1486 |
| 659 | Ga0496110_0000206 | 3300048913 | Bacteria | 37655 |
| 660 | Ga0496110_0062295 | 3300048913 | Bacteria | 3294 |
| 661 | Ga0496110_0081026 | 3300048913 | Bacteria | 2893 |
| 662 | Ga0496110_0114315 | 3300048913 | Bacteria | 2429 |
| 663 | Ga0496111_0019784 | 3300048914 | Bacteria | 4682 |
| 664 | Ga0496111_0068376 | 3300048914 | Bacteria | 2581 |
| 665 | Ga0496111_0211138 | 3300048914 | Bacteria | 1442 |
| 666 | Ga0496111_0344544 | 3300048914 | Bacteria | 1103 |
| 667 | Ga0496112_0084159 | 3300048915 | Bacteria | 3146 |
| 668 | Ga0496112_0144656 | 3300048915 | Bacteria | 2346 |
| 669 | Ga0496112_0310629 | 3300048915 | Bacteria | 1522 |
| 670 | Ga0496112_0370431 | 3300048915 | Bacteria | 1374 |
| 671 | Ga0496112_0685449 | 3300048915 | Bacteria | 953 |
| 672 | Ga0496112_0685680 | 3300048915 | Bacteria | 953 |
| 673 | Ga0496113_0113066 | 3300048916 | Bacteria | 2116 |
| 674 | Ga0496113_0486654 | 3300048916 | Bacteria | 991 |
| 675 | Ga0496114_0000292 | 3300048917 | Bacteria | 36655 |
| 676 | Ga0496114_0002729 | 3300048917 | Bacteria | 13486 |
| 677 | Ga0496114_0037117 | 3300048917 | Bacteria | 4030 |
| 678 | Ga0496114_0103317 | 3300048917 | Bacteria | 2436 |
| 679 | Ga0496114_0117091 | 3300048917 | Bacteria | 2288 |
| 680 | Ga0496114_0144812 | 3300048917 | Bacteria | 2059 |
| 681 | Ga0496114_0156372 | 3300048917 | Bacteria | 1980 |
| 682 | Ga0496114_0236688 | 3300048917 | Bacteria | 1605 |
| 683 | Ga0496115_0138814 | 3300048918 | Bacteria | 2005 |
| 684 | Ga0496115_0200192 | 3300048918 | Bacteria | 1650 |
| 685 | Ga0496119_0110312 | 3300048922 | Bacteria | 1528 |
| 686 | Ga0496119_0121033 | 3300048922 | Bacteria | 1439 |
| 687 | Ga0496120_0190671 | 3300048923 | Bacteria | 1000 |
| 688 | Ga0496121_0004272 | 3300048924 | Bacteria | 19398 |
| 689 | Ga0496121_0059427 | 3300048924 | Bacteria | 3152 |
| 690 | Ga0496126_0000040 | 3300048929 | Bacteria | 345144 |
| 691 | Ga0496126_0016459 | 3300048929 | Bacteria | 7393 |
| 692 | Ga0496126_0048568 | 3300048929 | Bacteria | 3877 |
| 693 | Ga0496126_0135536 | 3300048929 | Bacteria | 2124 |
| 694 | Ga0496126_0385011 | 3300048929 | Bacteria | 1141 |
| 695 | Ga0496126_0466102 | 3300048929 | Bacteria | 1014 |
| 696 | Ga0501032_0230633 | 3300049569 | Bacteria | 1204 |
| 697 | Ga0501034_0007279 | 3300049571 | Bacteria | 11798 |
| 698 | Ga0501067_0001178 | 3300049583 | Bacteria | 14171 |
| 699 | Ga0501067_0001965 | 3300049583 | Bacteria | 11324 |
| 700 | Ga0501068_0014197 | 3300049584 | Bacteria | 4549 |
| 701 | Ga0501068_0149097 | 3300049584 | Bacteria | 1469 |
| 702 | Ga0501069_0012187 | 3300049585 | Bacteria | 4568 |
| 703 | Ga0501069_0038668 | 3300049585 | Bacteria | 2634 |
| 704 | Ga0501070_0000294 | 3300049586 | Bacteria | 46585 |
| 705 | Ga0501070_0004742 | 3300049586 | Bacteria | 11637 |
| 706 | Ga0501070_0438982 | 3300049586 | Bacteria | 1053 |
| 707 | Ga0501071_0014240 | 3300049587 | Bacteria | 5440 |
| 708 | Ga0501072_0026093 | 3300049588 | Bacteria | 4553 |
| 709 | Ga0501072_0039055 | 3300049588 | Bacteria | 3727 |
| 710 | Ga0501073_0004400 | 3300049589 | Bacteria | 10586 |
| 711 | Ga0501073_0007206 | 3300049589 | Bacteria | 8282 |
| 712 | Ga0501074_0000481 | 3300049590 | Bacteria | 24238 |
| 713 | Ga0501074_0001446 | 3300049590 | Bacteria | 15885 |
| 714 | Ga0501074_0182820 | 3300049590 | Bacteria | 1495 |
| 715 | Ga0501077_0033356 | 3300049593 | Bacteria | 3277 |
| 716 | Ga0501079_0010264 | 3300049741 | Bacteria | 7112 |
| 717 | Ga0501079_0033289 | 3300049741 | Bacteria | 3965 |
| 718 | Ga0501080_0005158 | 3300049742 | Bacteria | 11633 |
| 719 | Ga0501080_0013603 | 3300049742 | Bacteria | 7491 |
| 720 | Ga0501080_0076070 | 3300049742 | Bacteria | 3123 |
| 721 | Ga0501081_0146894 | 3300049743 | Bacteria | 1692 |
| 722 | Ga0501083_0001026 | 3300049744 | Bacteria | 18616 |
| 723 | Ga0501083_0002383 | 3300049744 | Bacteria | 12869 |
| 724 | Ga0501083_0018747 | 3300049744 | Bacteria | 4819 |
| 725 | Ga0501283_010554 | 3300049779 | Bacteria | 1360 |
| 726 | nmdc:mga0yw44_103533_c1 | 3300050492 | Bacteria | 1816 |
| 727 | nmdc:mga0yw44_45805_c1 | 3300050492 | Bacteria | 2624 |
| 728 | nmdc:mga0yw44_49691_c1 | 3300050492 | Bacteria | 2532 |
| 729 | nmdc:mga06z11_20310_c1 | 3300050494 | Bacteria | 3069 |
| 730 | nmdc:mga04h51_2245_c1 | 3300050495 | Bacteria | 4553 |
| 731 | nmdc:mga05p37_24787_c1 | 3300050507 | Bacteria | 7292 |
| 732 | nmdc:mga05p37_295101_c1 | 3300050507 | Bacteria | 1928 |
| 733 | nmdc:mga05p37_454255_c1 | 3300050507 | Unclassified | 1482 |
| 734 | nmdc:mga05p37_48387_c1 | 3300050507 | Bacteria | 5230 |
| 735 | nmdc:mga05p37_58518_c1 | 3300050507 | Bacteria | 4746 |
| 736 | nmdc:mga05p37_88590_c1 | 3300050507 | Bacteria | 3815 |
| 737 | nmdc:mga09592_104481_c1 | 3300050508 | Bacteria | 2427 |
| 738 | nmdc:mga09592_161821_c1 | 3300050508 | Bacteria | 1934 |
| 739 | nmdc:mga08y16_180778_c1 | 3300050511 | Bacteria | 2190 |
| 740 | nmdc:mga08y16_421934_c1 | 3300050511 | Bacteria | 1363 |
| 741 | nmdc:mga0n895_37505_c1 | 3300050512 | Bacteria | 4689 |
| 742 | nmdc:mga0a205_2973_c1 | 3300050515 | Bacteria | 9543 |
| 743 | Ga0495601_0016121 | 3300053077 | Plasmid | 4524 |
| 744 | Ga0495595_0030522 | 3300053084 | Bacteria | 2418 |
| 745 | Ga0495619_0006597 | 3300053085 | Bacteria | 7345 |
| 746 | Ga0500644_0003410 | 3300053088 | Bacteria | 3933 |
| 747 | Ga0500646_0000063 | 3300053090 | Bacteria | 30223 |
| 748 | Ga0500646_0000157 | 3300053090 | Bacteria | 20034 |
| 749 | Ga0500646_0000781 | 3300053090 | Bacteria | 8894 |
| 750 | Ga0500646_0022291 | 3300053090 | Bacteria | 1694 |
| 751 | Ga0500583_0000034 | 3300053092 | Bacteria | 98659 |
| 752 | Ga0500583_0020019 | 3300053092 | Bacteria | 2755 |
| 753 | Ga0500651_0009281 | 3300053093 | Bacteria | 5835 |
| 754 | Ga0500650_0021053 | 3300053098 | Bacteria | 2869 |
| 755 | Ga0500654_044692 | 3300053099 | Bacteria | 2466 |
| 756 | Ga0500660_024816 | 3300053100 | Bacteria | 3170 |
| 757 | Ga0500660_073869 | 3300053100 | Bacteria | 1588 |
| 758 | Ga0500569_091733 | 3300053109 | Bacteria | 985 |
| 759 | Ga0500642_0015603 | 3300053130 | Bacteria | 2862 |
| 760 | Ga0500561_0000132 | 3300053137 | Bacteria | 14306 |
| 761 | Ga0500561_0009359 | 3300053137 | Bacteria | 1986 |
| 762 | Ga0500573_0078981 | 3300053140 | Bacteria | 1872 |
| 763 | Ga0500579_036911 | 3300053143 | Bacteria | 3098 |
| 764 | Ga0500579_086959 | 3300053143 | Bacteria | 1712 |
| 765 | Ga0500588_0007389 | 3300053146 | Bacteria | 2532 |
| 766 | Ga0500588_0015793 | 3300053146 | Bacteria | 1941 |
| 767 | Ga0500588_0029928 | 3300053146 | Bacteria | 1557 |
| 768 | Ga0500589_000007 | 3300053147 | Bacteria | 145453 |
| 769 | Ga0500600_0008943 | 3300053149 | Bacteria | 6041 |
| 770 | Ga0500616_0000251 | 3300053153 | Bacteria | 83237 |
| 771 | Ga0500616_0026066 | 3300053153 | Bacteria | 3239 |
| 772 | Ga0501084_0108757 | 3300054114 | Bacteria | 2329 |
| 773 | Ga0501084_0256430 | 3300054114 | Bacteria | 1476 |
| 774 | Ga0501082_0000559 | 3300060353 | Bacteria | 33071 |
| 775 | Ga0501082_0057721 | 3300060353 | Bacteria | 3343 |
| 776 | 2517760881 | 2517572101 | Bacteria | 6884336 |
| 777 | 2616697625 | 2616644814 | Bacteria | 11555299 |
| 778 | 2644032982 | 2643221604 | Bacteria | 5014917 |
| 779 | 2644089503 | 2643221615 | Bacteria | 5487866 |
| 780 | 2644100518 | 2643221617 | Bacteria | 5139111 |
| 781 | 2644116926 | 2643221620 | Bacteria | 5134593 |
| 782 | 2644270019 | 2643221647 | Bacteria | 10741251 |
| 783 | 2644319348 | 2643221657 | Bacteria | 5490246 |
| 784 | 2644608516 | 2643221711 | Bacteria | 4865335 |
| 785 | 2671837967 | 2671180195 | Bacteria | 9757215 |
| 786 | 2676200360 | 2675902999 | Bacteria | 9438463 |
| 787 | 2676487376 | 2675903059 | Bacteria | 8644972 |
| 788 | 2729907073 | 2728369276 | Bacteria | 5610032 |
| 789 | 2731907260 | 2731639228 | Bacteria | 4187555 |
| 790 | 2738871902 | 2738541305 | Bacteria | 4910150 |
| 791 | 2774844938 | 2773857921 | Bacteria | 9435764 |
| 792 | 2774856123 | 2773857922 | Bacteria | 9757215 |
| 793 | 2799183823 | 2799112218 | Bacteria | 4315149 |
| 794 | 2919449383 | 2919446982 | Bacteria | 3994487 |
| 795 | 2929217491 | 2929212328 | Bacteria | 7708288 |
| 796 | 2929218736 | 2929212328 | Bacteria | 7708288 |
| 797 | 2954700787 | 2954691527 | Bacteria | 10720516 |
| 798 | 2954706560 | 2954701450 | Bacteria | 10834262 |
| 799 | 2954719425 | 2954711539 | Bacteria | 10867210 |
| 800 | 2954729407 | 2954721474 | Bacteria | 10456478 |
| 801 | 2954732401 | 2954731030 | Bacteria | 10243860 |
| 802 | 2954748310 | 2954740390 | Bacteria | 10229294 |
| 803 | 2954751291 | 2954749733 | Bacteria | 10366972 |
| 804 | 2954767433 | 2954759201 | Bacteria | 9358192 |
| 805 | 3002999272 | 3002998708 | Bacteria | 11715108 |
| 806 | Ga0451791_0563576 | |||
| 807 | SwRhRL3b_contig_3075825 | |||
| 808 | SwRhRL2b_contig_1636080 | |||
| 809 | SwRhRL2b_contig_263429 | |||
| 810 | JGI24740J21852_10003178 | |||
| 811 | JGI24739J22299_10002670 | |||
| 812 | JGI25406J46586_10004716 | |||
| 813 | rootH1_10139703 | |||
| 814 | rootH2_10011879 | |||
| 815 | rootL2_10022689 | |||
| 816 | rootH1_10014156 | |||
| 817 | rootH1_10172323 | |||
| 818 | Ga0006562J51391_1161591 | |||
| 819 | Ga0065714_10008505 | |||
| 820 | Ga0065704_10003330 | |||
| 821 | Ga0065704_10109781 | |||
| 822 | Ga0065707_10000955 | |||
| 823 | Ga0065707_10002453 | |||
| 824 | Ga0065707_10089187 | |||
| 825 | Ga0070676_10116388 | |||
| 826 | Ga0070683_100051887 | |||
| 827 | Ga0070670_100063801 | |||
| 828 | Ga0068869_100282712 | |||
| 829 | Ga0070666_10169282 | |||
| 830 | Ga0070680_100455500 | |||
| 831 | Ga0070682_100083667 | |||
| 832 | Ga0070682_100102920 | |||
| 833 | Ga0070682_100313164 | |||
| 834 | Ga0070660_100090204 | |||
| 835 | Ga0070689_100098226 | |||
| 836 | Ga0070668_100003833 | |||
| 837 | Ga0070668_100014010 | |||
| 838 | Ga0070674_100039761 | |||
| 839 | Ga0070714_100017801 | |||
| 840 | Ga0070714_100029035 | |||
| 841 | Ga0070714_100167878 | |||
| 842 | Ga0070714_100213293 | |||
| 843 | Ga0070714_100293043 | |||
| 844 | Ga0070713_100203338 | |||
| 845 | Ga0070713_100324233 | |||
| 846 | Ga0070710_10149008 | |||
| 847 | Ga0070711_100283618 | |||
| 848 | Ga0070705_100024665 | |||
| 849 | Ga0070705_100413040 | |||
| 850 | Ga0070694_100029932 | |||
| 851 | Ga0070694_100150345 | |||
| 852 | Ga0070708_100001186 | |||
| 853 | Ga0070708_100201539 | |||
| 854 | Ga0070708_100220819 | |||
| 855 | Ga0070663_100015359 | |||
| 856 | Ga0070663_100029422 | |||
| 857 | Ga0070663_100070056 | |||
| 858 | Ga0070663_100275918 | |||
| 859 | Ga0070663_100566234 | |||
| 860 | Ga0070681_10179746 | |||
| 861 | Ga0070681_10208234 | |||
| 862 | Ga0070685_10432802 | |||
| 863 | Ga0070706_100024866 | |||
| 864 | Ga0070706_100160243 | |||
| 865 | Ga0070706_100223309 | |||
| 866 | Ga0070707_100045596 | |||
| 867 | Ga0070707_100050245 | |||
| 868 | Ga0070707_100056181 | |||
| 869 | Ga0070707_100077513 | |||
| 870 | Ga0070707_100346887 | |||
| 871 | Ga0070698_100021311 | |||
| 872 | Ga0070698_100036033 | |||
| 873 | Ga0070698_100047180 | |||
| 874 | Ga0070698_100070228 | |||
| 875 | Ga0070698_100092090 | |||
| 876 | Ga0070698_100143489 | |||
| 877 | Ga0070698_100237096 | |||
| 878 | Ga0070698_100332920 | |||
| 879 | Ga0070698_100584464 | |||
| 880 | Ga0070699_100024557 | |||
| 881 | Ga0070699_100068207 | |||
| 882 | Ga0070699_100221802 | |||
| 883 | Ga0070699_100376727 | |||
| 884 | Ga0070679_100129709 | |||
| 885 | Ga0070679_100153591 | |||
| 886 | Ga0070684_100292818 | |||
| 887 | Ga0070697_100003819 | |||
| 888 | Ga0070697_100008467 | |||
| 889 | Ga0068853_100101917 | |||
| 890 | Ga0068853_100439999 | |||
| 891 | Ga0068853_100488974 | |||
| 892 | Ga0070695_100005000 | |||
| 893 | Ga0070695_100096021 | |||
| 894 | Ga0070693_100015180 | |||
| 895 | Ga0070693_100028774 | |||
| 896 | Ga0070665_100047050 | |||
| 897 | Ga0070665_100097556 | |||
| 898 | Ga0070665_100223587 | |||
| 899 | Ga0070665_100397702 | |||
| 900 | Ga0070665_100496859 | |||
| 901 | Ga0070704_100161279 | |||
| 902 | Ga0068855_100001615 | |||
| 903 | Ga0068855_100005008 | |||
| 904 | Ga0068855_100032789 | |||
| 905 | Ga0068855_100283076 | |||
| 906 | Ga0070664_100223826 | |||
| 907 | Ga0070664_100420148 | |||
| 908 | Ga0068857_100104550 | |||
| 909 | Ga0068854_100086898 | |||
| 910 | Ga0068856_100047801 | |||
| 911 | Ga0068856_100135308 | |||
| 912 | Ga0068856_100669969 | |||
| 913 | Ga0068852_100011046 | |||
| 914 | Ga0068852_100045201 | |||
| 915 | Ga0068852_100595912 | |||
| 916 | Ga0068859_100146064 | |||
| 917 | Ga0068859_100236992 | |||
| 918 | Ga0068864_100062119 | |||
| 919 | Ga0068861_100156819 | |||
| 920 | Ga0068861_100292570 | |||
| 921 | Ga0068870_10284353 | |||
| 922 | Ga0068863_100119101 | |||
| 923 | Ga0068863_100306800 | |||
| 924 | Ga0068858_100263576 | |||
| 925 | Ga0068860_100566056 | |||
| 926 | Ga0081540_1007257 | |||
| 927 | Ga0081540_1016479 | |||
| 928 | Ga0081539_10000173 | |||
| 929 | Ga0081539_10000218 | |||
| 930 | Ga0081539_10007179 | |||
| 931 | Ga0081539_10013574 | |||
| 932 | Ga0070717_10013282 | |||
| 933 | Ga0070717_10141028 | |||
| 934 | Ga0070717_10220988 | |||
| 935 | Ga0075365_10060461 | |||
| 936 | Ga0075365_10272247 | |||
| 937 | Ga0075368_10004079 | |||
| 938 | Ga0070715_10093813 | |||
| 939 | Ga0070715_10117422 | |||
| 940 | Ga0070716_100277260 | |||
| 941 | Ga0075367_10002868 | |||
| 942 | Ga0097621_100293810 | |||
| 943 | Ga0068871_100137015 | |||
| 944 | Ga0075428_100027636 | |||
| 945 | Ga0075428_100638786 | |||
| 946 | Ga0075430_100164754 | |||
| 947 | Ga0075431_100567827 | |||
| 948 | Ga0075433_10037475 | |||
| 949 | Ga0075433_10258797 | |||
| 950 | Ga0075434_100235757 | |||
| 951 | Ga0075429_100104505 | |||
| 952 | Ga0075429_100106618 | |||
| 953 | Ga0097620_100146061 | |||
| 954 | Ga0097620_100236980 | |||
| 955 | Ga0099826_10041439 | |||
| 956 | Ga0075435_100542312 | |||
| 957 | Ga0099794_10000379 | |||
| 958 | Ga0099794_10005625 | |||
| 959 | Ga0105240_10056946 | |||
| 960 | Ga0105240_10117833 | |||
| 961 | Ga0105240_10119056 | |||
| 962 | Ga0105240_10398298 | |||
| 963 | Ga0111539_10141916 | |||
| 964 | Ga0111539_10536330 | |||
| 965 | Ga0114129_10028608 | |||
| 966 | Ga0114129_10030668 | |||
| 967 | Ga0114129_10046008 | |||
| 968 | Ga0114129_10125823 | |||
| 969 | Ga0114129_10224132 | |||
| 970 | Ga0114129_10256358 | |||
| 971 | Ga0114129_10314882 | |||
| 972 | Ga0114129_10346329 | |||
| 973 | Ga0105243_10005513 | |||
| 974 | Ga0105243_10541372 | |||
| 975 | Ga0105241_10053509 | |||
| 976 | Ga0105241_10402390 | |||
| 977 | Ga0105242_10074140 | |||
| 978 | Ga0105248_10091789 | |||
| 979 | Ga0105237_10052132 | |||
| 980 | Ga0105237_10055854 | |||
| 981 | Ga0105237_10164127 | |||
| 982 | Ga0105238_10007250 | |||
| 983 | Ga0105238_10059161 | |||
| 984 | Ga0105238_10261163 | |||
| 985 | Ga0105238_10864939 | |||
| 986 | Ga0105249_10033201 | |||
| 987 | Ga0105239_10020514 | |||
| 988 | Ga0105239_10027480 | |||
| 989 | Ga0105239_10056718 | |||
| 990 | Ga0105239_10234395 | |||
| 991 | Ga0105246_10029860 | |||
| 992 | Ga0157373_10324354 | |||
| 993 | Ga0157370_10142755 | |||
| 994 | Ga0157369_10102253 | |||
| 995 | Ga0157369_10447667 | |||
| 996 | Ga0157369_10546483 | |||
| 997 | Ga0157374_10041693 | |||
| 998 | Ga0157374_10057979 | |||
| 999 | Ga0157372_10079592 | |||
| 1000 | Ga0157372_10298963 | |||
| 1001 | Ga0157372_10319806 | |||
| 1002 | Ga0157375_10040826 | |||
| 1003 | Ga0157375_10381002 | |||
| 1004 | Ga0163163_10120759 | |||
| 1005 | Ga0163163_10289516 | |||
| 1006 | Ga0163163_10816851 | |||
| 1007 | Ga0182008_10001729 | |||
| 1008 | Ga0157377_10250410 | |||
| 1009 | Ga0157379_10036629 | |||
| 1010 | Ga0157376_10288646 | |||
| 1011 | Ga0182007_10007209 | |||
| 1012 | Ga0183367_1004 | |||
| 1013 | Ga0197907_11300308 | |||
| 1014 | Ga0206356_11149848 | |||
| 1015 | Ga0206349_1979773 | |||
| 1016 | Ga0206355_1239282 | |||
| 1017 | Ga0206351_10315251 | |||
| 1018 | Ga0206352_11125578 | |||
| 1019 | Ga0206350_10016465 | |||
| 1020 | Ga0206350_10555428 | |||
| 1021 | Ga0206354_11034032 | |||
| 1022 | Ga0206354_11077463 | |||
| 1023 | Ga0206353_11150681 | |||
| 1024 | Ga0206353_11348600 | |||
| 1025 | Ga0154015_1558468 | |||
| 1026 | Ga0213873_10012688 | |||
| 1027 | Ga0213875_10001136 | |||
| 1028 | Ga0213875_10025499 | |||
| 1029 | Ga0224712_10014297 | |||
| 1030 | Ga0224712_10062840 | |||
| 1031 | Ga0209758_1005093 | |||
| 1032 | Ga0207653_10004255 | |||
| 1033 | Ga0207692_10007533 | |||
| 1034 | Ga0207692_10132031 | |||
| 1035 | Ga0207688_10158084 | |||
| 1036 | Ga0207647_10002020 | |||
| 1037 | Ga0207647_10003293 | |||
| 1038 | Ga0207647_10018266 | |||
| 1039 | Ga0207699_10017074 | |||
| 1040 | Ga0207699_10352449 | |||
| 1041 | Ga0207643_10066625 | |||
| 1042 | Ga0207684_10169966 | |||
| 1043 | Ga0207684_10310947 | |||
| 1044 | Ga0207707_10108337 | |||
| 1045 | Ga0207707_10188710 | |||
| 1046 | Ga0207707_10189415 | |||
| 1047 | Ga0207707_10245884 | |||
| 1048 | Ga0207695_10007827 | |||
| 1049 | Ga0207695_10011119 | |||
| 1050 | Ga0207695_10284850 | |||
| 1051 | Ga0207671_10003792 | |||
| 1052 | Ga0207671_10004981 | |||
| 1053 | Ga0207671_10039693 | |||
| 1054 | Ga0207693_10029588 | |||
| 1055 | Ga0207693_10032134 | |||
| 1056 | Ga0207663_10360218 | |||
| 1057 | Ga0207657_10058253 | |||
| 1058 | Ga0207646_10023471 | |||
| 1059 | Ga0207646_10065981 | |||
| 1060 | Ga0207646_10070215 | |||
| 1061 | Ga0207646_10085834 | |||
| 1062 | Ga0207694_10002783 | |||
| 1063 | Ga0207694_10047018 | |||
| 1064 | Ga0207650_10053041 | |||
| 1065 | Ga0207650_10484242 | |||
| 1066 | Ga0207659_10028415 | |||
| 1067 | Ga0207700_10009251 | |||
| 1068 | Ga0207700_10124867 | |||
| 1069 | Ga0207700_10242308 | |||
| 1070 | Ga0207700_10425078 | |||
| 1071 | Ga0207700_10631329 | |||
| 1072 | Ga0207664_10004878 | |||
| 1073 | Ga0207664_10014874 | |||
| 1074 | Ga0207664_10027629 | |||
| 1075 | Ga0207664_10082644 | |||
| 1076 | Ga0207664_10095366 | |||
| 1077 | Ga0207664_10273984 | |||
| 1078 | Ga0207664_10418478 | |||
| 1079 | Ga0207686_10100915 | |||
| 1080 | Ga0207709_10086750 | |||
| 1081 | Ga0207709_10146312 | |||
| 1082 | Ga0207709_10150310 | |||
| 1083 | Ga0207669_10033141 | |||
| 1084 | Ga0207669_10264392 | |||
| 1085 | Ga0207669_10466945 | |||
| 1086 | Ga0207665_10056251 | |||
| 1087 | Ga0207691_10140317 | |||
| 1088 | Ga0207711_10062678 | |||
| 1089 | Ga0207689_10093608 | |||
| 1090 | Ga0207661_10126180 | |||
| 1091 | Ga0207661_10701847 | |||
| 1092 | Ga0207679_10192766 | |||
| 1093 | Ga0207679_10288580 | |||
| 1094 | Ga0207667_10006703 | |||
| 1095 | Ga0207667_10073859 | |||
| 1096 | Ga0207712_10011952 | |||
| 1097 | Ga0207668_10004702 | |||
| 1098 | Ga0207668_10016690 | |||
| 1099 | Ga0207668_10040811 | |||
| 1100 | Ga0207640_10019999 | |||
| 1101 | Ga0207640_10235200 | |||
| 1102 | Ga0207639_10038634 | |||
| 1103 | Ga0207639_10264660 | |||
| 1104 | Ga0207639_10377038 | |||
| 1105 | Ga0207678_10002060 | |||
| 1106 | Ga0207678_10012846 | |||
| 1107 | Ga0207678_10106131 | |||
| 1108 | Ga0207708_10132841 | |||
| 1109 | Ga0207702_10028440 | |||
| 1110 | Ga0207702_10370905 | |||
| 1111 | Ga0207641_10100640 | |||
| 1112 | Ga0207641_10210472 | |||
| 1113 | Ga0207676_10381848 | |||
| 1114 | Ga0207674_10092503 | |||
| 1115 | Ga0207674_10416180 | |||
| 1116 | Ga0207675_100153339 | |||
| 1117 | Ga0207675_100511011 | |||
| 1118 | Ga0207683_10002509 | |||
| 1119 | Ga0207698_10020317 | |||
| 1120 | Ga0207698_10468480 | |||
| 1121 | Ga0209371_1041838 | |||
| 1122 | Ga0209588_1002430 | |||
| 1123 | Ga0209588_1066879 | |||
| 1124 | Ga0209813_10003614 | |||
| 1125 | Ga0268266_10091363 | |||
| 1126 | Ga0268266_10371048 | |||
| 1127 | Ga0268266_10432896 | |||
| 1128 | Ga0268265_10129262 | |||
| 1129 | Ga0268265_10141091 | |||
| 1130 | Ga0268265_10231276 | |||
| 1131 | Ga0268265_10237875 | |||
| 1132 | Ga0268264_10418906 | |||
| 1133 | Ga0265337_1003592 | |||
| 1134 | Ga0265326_10004837 | |||
| 1135 | Ga0265318_10060858 | |||
| 1136 | Ga0265336_10015575 | |||
| 1137 | Ga0307517_10015716 | |||
| 1138 | Ga0307517_10098017 | |||
| 1139 | Ga0307515_10035516 | |||
| 1140 | Ga0265338_10001125 | |||
| 1141 | Ga0265338_10002141 | |||
| 1142 | Ga0265338_10021555 | |||
| 1143 | Ga0265324_10003209 | |||
| 1144 | Ga0268256_1047437 | |||
| 1145 | Ga0307511_10001845 | |||
| 1146 | Ga0307512_10012522 | |||
| 1147 | Ga0265332_10009694 | |||
| 1148 | Ga0265320_10007771 | |||
| 1149 | Ga0265325_10151626 | |||
| 1150 | Ga0265340_10009313 | |||
| 1151 | Ga0307513_10010495 | |||
| 1152 | Ga0307513_10270749 | |||
| 1153 | Ga0307509_10008191 | |||
| 1154 | Ga0307509_10014865 | |||
| 1155 | Ga0307509_10057050 | |||
| 1156 | Ga0307509_10132730 | |||
| 1157 | Ga0307509_10297031 | |||
| 1158 | Ga0307508_10009307 | |||
| 1159 | Ga0307508_10099344 | |||
| 1160 | Ga0265342_10012194 | |||
| 1161 | Ga0307516_10005367 | |||
| 1162 | Ga0307516_10011460 | |||
| 1163 | Ga0307516_10011822 | |||
| 1164 | Ga0307516_10026405 | |||
| 1165 | Ga0307516_10121392 | |||
| 1166 | Ga0307405_10081816 | |||
| 1167 | Ga0307518_10013497 | |||
| 1168 | Ga0307518_10213395 | |||
| 1169 | Ga0307410_10213807 | |||
| 1170 | Ga0307406_10472177 | |||
| 1171 | Ga0307407_10380370 | |||
| 1172 | Ga0307409_100319979 | |||
| 1173 | Ga0307409_100350195 | |||
| 1174 | Ga0307411_10426864 | |||
| 1175 | Ga0307415_100122260 | |||
| 1176 | Ga0307507_10000764 | |||
| 1177 | Ga0307507_10010565 | |||
| 1178 | Ga0307510_10008462 | |||
| 1179 | Ga0373930_0017205 | |||
| 1180 | Ga0373938_0040689 | |||
| 1181 | Ga0373926_0004626 | |||
| 1182 | Ga0373928_0064565 | |||
| 1183 | Ga0373934_0037648 | |||
| 1184 | Ga0373944_0000495 | |||
| 1185 | Ga0373944_0004271 | |||
| 1186 | Ga0373951_0000007 | |||
| 1187 | Ga0373923_0004925 | |||
| 1188 | Ga0373923_0032357 | |||
| 1189 | Ga0373936_0000130 | |||
| 1190 | Ga0373936_0000832 | |||
| 1191 | Ga0373936_0006171 | |||
| 1192 | Ga0373945_0000149 | |||
| 1193 | Ga0373945_0008677 | |||
| 1194 | Ga0373954_0138525 | |||
| 1195 | Ga0373956_0011655 | |||
| 1196 | Ga0373956_0020262 | |||
| 1197 | Ga0373957_0002159 | |||
| 1198 | Ga0373957_0115950 | |||
| 1199 | Ga0373943_0000215 | |||
| 1200 | Ga0373943_0000957 | |||
| 1201 | Ga0373946_0000093 | |||
| 1202 | Ga0373946_0024650 | |||
| 1203 | Ga0373946_0095299 | |||
| 1204 | Ga0373955_0226615 | |||
| 1205 | Ga0373924_0003990 | |||
| 1206 | Ga0373924_0009400 | |||
| 1207 | Ga0373924_0099711 | |||
| 1208 | Ga0373935_0003933 | |||
| 1209 | Ga0373935_0038244 | |||
| 1210 | Ga0373927_0003366 | |||
| 1211 | Ga0373933_0150265 | |||
| 1212 | Ga0373947_0000281 | |||
| 1213 | Ga0373947_0001422 | |||
| 1214 | Ga0373937_0365024 | |||
| 1215 | Ga0373937_0368784 | |||
| 1216 | Ga0373937_0707011 | |||
| 1217 | Ga0373925_0000938 | |||
| 1218 | Ga0373925_0063645 | |||
| 1219 | Ga0395899_0019364 | |||
| 1220 | Ga0395905_0028163 | |||
| 1221 | Ga0395905_0189242 | |||
| 1222 | Ga0436364_0106543 | |||
| 1223 | Ga0436364_0251595 | |||
| 1224 | Ga0436364_0322086 | |||
| 1225 | Ga0436364_0547435 | |||
| 1226 | Ga0436364_1094297 | |||
| 1227 | Ga0436364_1513258 | |||
| 1228 | Ga0395901_0055031 | |||
| 1229 | Ga0395901_0231231 | |||
| 1230 | Ga0436365_0709127 | |||
| 1231 | Ga0436363_0132265 | |||
| 1232 | Ga0436363_0210186 | |||
| 1233 | Ga0436363_0669568 | |||
| 1234 | Ga0451791_0533426 | |||
| 1235 | Ga0451791_1032133 | |||
| 1236 | Ga0451793_0872584 | |||
| 1237 | Ga0451797_0534996 | |||
| 1238 | Ga0451833_0544441 | |||
| 1239 | Ga0451849_1317838 | |||
| 1240 | Ga0451843_1022444 | |||
| 1241 | Ga0451843_1657210 | |||
| 1242 | Ga0451853_0634586 | |||
| 1243 | Ga0451853_1790813 | |||
| 1244 | Ga0450903_000935 | |||
| 1245 | Ga0439458_0001541 | |||
| 1246 | Ga0466972_0003733 | |||
| 1247 | Ga0466972_0047018 | |||
| 1248 | Ga0466965_0059194 | |||
| 1249 | Ga0466963_0022039 | |||
| 1250 | Ga0466963_0033665 | |||
| 1251 | Ga0466963_0067818 | |||
| 1252 | Ga0466963_0095012 | |||
| 1253 | Ga0466963_0452817 | |||
| 1254 | Ga0453684_0055272 | |||
| 1255 | Ga0466968_0002819 | |||
| 1256 | Ga0466960_0070191 | |||
| 1257 | Ga0451576_0383906 | |||
| 1258 | Ga0466958_0081307 | |||
| 1259 | Ga0466958_0142051 | |||
| 1260 | Ga0466958_0211069 | |||
| 1261 | Ga0466967_0017599 | |||
| 1262 | Ga0495592_0013236 | |||
| 1263 | Ga0495592_0096503 | |||
| 1264 | Ga0495603_0005209 | |||
| 1265 | Ga0495603_0011279 | |||
| 1266 | Ga0495603_0211718 | |||
| 1267 | Ga0495629_0013616 | |||
| 1268 | Ga0495629_0064455 | |||
| 1269 | Ga0495629_0104900 | |||
| 1270 | Ga0495629_0105539 | |||
| 1271 | Ga0495629_0243420 | |||
| 1272 | Ga0495638_0285927 | |||
| 1273 | Ga0495641_0006885 | |||
| 1274 | Ga0495641_0046578 | |||
| 1275 | Ga0495651_0000379 | |||
| 1276 | Ga0495651_0024679 | |||
| 1277 | Ga0495651_0055128 | |||
| 1278 | Ga0495651_0132587 | |||
| 1279 | Ga0495651_0166970 | |||
| 1280 | Ga0495653_0008557 | |||
| 1281 | Ga0495653_0049045 | |||
| 1282 | Ga0495653_0089841 | |||
| 1283 | Ga0495580_0156654 | |||
| 1284 | Ga0495580_0185560 | |||
| 1285 | Ga0495582_0003457 | |||
| 1286 | Ga0495662_0023431 | |||
| 1287 | Ga0495662_0064196 | |||
| 1288 | Ga0495662_0073211 | |||
| 1289 | Ga0495664_0000201 | |||
| 1290 | Ga0495664_0012750 | |||
| 1291 | Ga0495664_0023357 | |||
| 1292 | Ga0495664_0037923 | |||
| 1293 | Ga0495664_0038774 | |||
| 1294 | Ga0495585_0011662 | |||
| 1295 | Ga0495594_0005111 | |||
| 1296 | Ga0495594_0036012 | |||
| 1297 | Ga0495594_0049759 | |||
| 1298 | Ga0495594_0057012 | |||
| 1299 | Ga0495594_0156008 | |||
| 1300 | Ga0495608_0010295 | |||
| 1301 | Ga0495608_0217886 | |||
| 1302 | Ga0495618_0067670 | |||
| 1303 | Ga0495618_0107644 | |||
| 1304 | Ga0495628_0028761 | |||
| 1305 | Ga0495628_0070517 | |||
| 1306 | Ga0495628_0075805 | |||
| 1307 | Ga0495628_0092354 | |||
| 1308 | Ga0495630_0018527 | |||
| 1309 | Ga0495630_0031131 | |||
| 1310 | Ga0495630_0075780 | |||
| 1311 | Ga0495643_0001146 | |||
| 1312 | Ga0495666_0000552 | |||
| 1313 | Ga0495666_0013381 | |||
| 1314 | Ga0495652_0000907 | |||
| 1315 | Ga0495652_0031842 | |||
| 1316 | Ga0495652_0055261 | |||
| 1317 | Ga0495652_0085403 | |||
| 1318 | Ga0495652_0088626 | |||
| 1319 | Ga0495652_0089252 | |||
| 1320 | Ga0495652_0280824 | |||
| 1321 | Ga0495665_0011354 | |||
| 1322 | Ga0495665_0013287 | |||
| 1323 | Ga0495665_0094082 | |||
| 1324 | Ga0495640_0006409 | |||
| 1325 | Ga0495640_0015167 | |||
| 1326 | Ga0495640_0022769 | |||
| 1327 | Ga0495586_0014494 | |||
| 1328 | Ga0495586_0026376 | |||
| 1329 | Ga0495587_0019464 | |||
| 1330 | Ga0495587_0030158 | |||
| 1331 | Ga0495587_0111824 | |||
| 1332 | Ga0495587_0172138 | |||
| 1333 | Ga0495645_0021232 | |||
| 1334 | Ga0495645_0056141 | |||
| 1335 | Ga0495645_0105883 | |||
| 1336 | Ga0495645_0177100 | |||
| 1337 | Ga0495645_0281496 | |||
| 1338 | Ga0495622_0002320 | |||
| 1339 | Ga0495622_0108355 | |||
| 1340 | Ga0495633_0160255 | |||
| 1341 | Ga0495667_0001730 | |||
| 1342 | Ga0495667_0003309 | |||
| 1343 | Ga0495667_0053600 | |||
| 1344 | Ga0495667_0213169 | |||
| 1345 | Ga0495667_0250746 | |||
| 1346 | Ga0495668_0069214 | |||
| 1347 | Ga0495634_0028681 | |||
| 1348 | Ga0495634_0051324 | |||
| 1349 | Ga0495634_0069301 | |||
| 1350 | Ga0495634_0137665 | |||
| 1351 | Ga0495634_0151354 | |||
| 1352 | Ga0495634_0203272 | |||
| 1353 | Ga0495625_0093417 | |||
| 1354 | Ga0495625_0229035 | |||
| 1355 | Ga0495635_0015118 | |||
| 1356 | Ga0495635_0019569 | |||
| 1357 | Ga0495635_0066481 | |||
| 1358 | Ga0495635_0209020 | |||
| 1359 | Ga0495635_0218550 | |||
| 1360 | Ga0495588_0062728 | |||
| 1361 | Ga0495588_0120437 | |||
| 1362 | Ga0495657_0006923 | |||
| 1363 | Ga0495657_0009245 | |||
| 1364 | Ga0495657_0025150 | |||
| 1365 | Ga0495657_0053525 | |||
| 1366 | Ga0495599_0001729 | |||
| 1367 | Ga0495599_0026918 | |||
| 1368 | Ga0495599_0040358 | |||
| 1369 | Ga0495599_0063095 | |||
| 1370 | Ga0495623_0090235 | |||
| 1371 | Ga0495646_0035840 | |||
| 1372 | Ga0495646_0066319 | |||
| 1373 | Ga0495658_0117816 | |||
| 1374 | Ga0495613_0005770 | |||
| 1375 | Ga0495613_0020247 | |||
| 1376 | Ga0495613_0047080 | |||
| 1377 | Ga0495624_0008283 | |||
| 1378 | Ga0495624_0008414 | |||
| 1379 | Ga0495624_0069303 | |||
| 1380 | Ga0495624_0074728 | |||
| 1381 | Ga0495624_0097983 | |||
| 1382 | Ga0495670_0002567 | |||
| 1383 | Ga0495670_0044927 | |||
| 1384 | Ga0495670_0202041 | |||
| 1385 | Ga0495649_0207781 | |||
| 1386 | Ga0495600_0009915 | |||
| 1387 | Ga0495600_0022514 | |||
| 1388 | Ga0495600_0055193 | |||
| 1389 | Ga0495600_0227580 | |||
| 1390 | Ga0495581_0011166 | |||
| 1391 | Ga0495581_0039774 | |||
| 1392 | Ga0495581_0067139 | |||
| 1393 | Ga0495581_0076371 | |||
| 1394 | Ga0495581_0253407 | |||
| 1395 | Ga0495604_0001022 | |||
| 1396 | Ga0495604_0022180 | |||
| 1397 | Ga0495604_0023988 | |||
| 1398 | Ga0495604_0049866 | |||
| 1399 | Ga0495604_0058461 | |||
| 1400 | Ga0495636_0005127 | |||
| 1401 | Ga0495674_0036982 | |||
| 1402 | Ga0495674_0037389 | |||
| 1403 | Ga0495674_0037793 | |||
| 1404 | Ga0495674_0072664 | |||
| 1405 | Ga0495674_0102541 | |||
| 1406 | Ga0495674_0231600 | |||
| 1407 | Ga0495676_0001118 | |||
| 1408 | Ga0495676_0003045 | |||
| 1409 | Ga0495676_0009560 | |||
| 1410 | Ga0495676_0066427 | |||
| 1411 | Ga0495680_0006058 | |||
| 1412 | Ga0495680_0010145 | |||
| 1413 | Ga0495680_0086265 | |||
| 1414 | Ga0495680_0283291 | |||
| 1415 | Ga0495680_0300711 | |||
| 1416 | Ga0495687_011560 | |||
| 1417 | Ga0495675_0014676 | |||
| 1418 | Ga0495675_0019290 | |||
| 1419 | Ga0495675_0026019 | |||
| 1420 | Ga0495675_0135248 | |||
| 1421 | Ga0495675_0335418 | |||
| 1422 | Ga0495685_005146 | |||
| 1423 | Ga0495685_017601 | |||
| 1424 | Ga0495681_0019415 | |||
| 1425 | Ga0495684_0003673 | |||
| 1426 | Ga0495684_0020894 | |||
| 1427 | Ga0495684_0134259 | |||
| 1428 | Ga0495686_0159329 | |||
| 1429 | Ga0495593_0006667 | |||
| 1430 | Ga0495593_0017180 | |||
| 1431 | Ga0495593_0032938 | |||
| 1432 | Ga0495593_0077909 | |||
| 1433 | Ga0495602_0329632 | |||
| 1434 | Ga0495614_0013090 | |||
| 1435 | Ga0495614_0040921 | |||
| 1436 | Ga0496100_0066632 | |||
| 1437 | Ga0496100_0491466 | |||
| 1438 | Ga0496101_0133285 | |||
| 1439 | Ga0496102_0004687 | |||
| 1440 | Ga0496102_0006047 | |||
| 1441 | Ga0496102_0258960 | |||
| 1442 | Ga0496102_0330452 | |||
| 1443 | Ga0496102_0531909 | |||
| 1444 | Ga0496103_0002730 | |||
| 1445 | Ga0496104_0001017 | |||
| 1446 | Ga0496104_0079887 | |||
| 1447 | Ga0496105_0087210 | |||
| 1448 | Ga0496105_0218790 | |||
| 1449 | Ga0496105_0312350 | |||
| 1450 | Ga0496106_0304688 | |||
| 1451 | Ga0496106_0405562 | |||
| 1452 | Ga0496107_0090067 | |||
| 1453 | Ga0496108_0000860 | |||
| 1454 | Ga0496108_0001445 | |||
| 1455 | Ga0496108_0073174 | |||
| 1456 | Ga0496108_0181913 | |||
| 1457 | Ga0496108_0366814 | |||
| 1458 | Ga0496109_0001156 | |||
| 1459 | Ga0496109_0039494 | |||
| 1460 | Ga0496109_0055275 | |||
| 1461 | Ga0496109_0099741 | |||
| 1462 | Ga0496109_0250297 | |||
| 1463 | Ga0496109_0311231 | |||
| 1464 | Ga0496110_0000206 | |||
| 1465 | Ga0496110_0062295 | |||
| 1466 | Ga0496110_0081026 | |||
| 1467 | Ga0496110_0114315 | |||
| 1468 | Ga0496111_0019784 | |||
| 1469 | Ga0496111_0068376 | |||
| 1470 | Ga0496111_0211138 | |||
| 1471 | Ga0496111_0344544 | |||
| 1472 | Ga0496112_0084159 | |||
| 1473 | Ga0496112_0144656 | |||
| 1474 | Ga0496112_0310629 | |||
| 1475 | Ga0496112_0370431 | |||
| 1476 | Ga0496112_0685449 | |||
| 1477 | Ga0496112_0685680 | |||
| 1478 | Ga0496113_0113066 | |||
| 1479 | Ga0496113_0486654 | |||
| 1480 | Ga0496114_0000292 | |||
| 1481 | Ga0496114_0002729 | |||
| 1482 | Ga0496114_0037117 | |||
| 1483 | Ga0496114_0103317 | |||
| 1484 | Ga0496114_0117091 | |||
| 1485 | Ga0496114_0144812 | |||
| 1486 | Ga0496114_0156372 | |||
| 1487 | Ga0496114_0236688 | |||
| 1488 | Ga0496115_0138814 | |||
| 1489 | Ga0496115_0200192 | |||
| 1490 | Ga0496119_0110312 | |||
| 1491 | Ga0496119_0121033 | |||
| 1492 | Ga0496120_0190671 | |||
| 1493 | Ga0496121_0004272 | |||
| 1494 | Ga0496121_0059427 | |||
| 1495 | Ga0496126_0000040 | |||
| 1496 | Ga0496126_0016459 | |||
| 1497 | Ga0496126_0048568 | |||
| 1498 | Ga0496126_0135536 | |||
| 1499 | Ga0496126_0385011 | |||
| 1500 | Ga0496126_0466102 | |||
| 1501 | Ga0501032_0230633 | |||
| 1502 | Ga0501034_0007279 | |||
| 1503 | Ga0501067_0001178 | |||
| 1504 | Ga0501067_0001965 | |||
| 1505 | Ga0501068_0014197 | |||
| 1506 | Ga0501068_0149097 | |||
| 1507 | Ga0501069_0012187 | |||
| 1508 | Ga0501069_0038668 | |||
| 1509 | Ga0501070_0000294 | |||
| 1510 | Ga0501070_0004742 | |||
| 1511 | Ga0501070_0438982 | |||
| 1512 | Ga0501071_0014240 | |||
| 1513 | Ga0501072_0026093 | |||
| 1514 | Ga0501072_0039055 | |||
| 1515 | Ga0501073_0004400 | |||
| 1516 | Ga0501073_0007206 | |||
| 1517 | Ga0501074_0000481 | |||
| 1518 | Ga0501074_0001446 | |||
| 1519 | Ga0501074_0182820 | |||
| 1520 | Ga0501077_0033356 | |||
| 1521 | Ga0501079_0010264 | |||
| 1522 | Ga0501079_0033289 | |||
| 1523 | Ga0501080_0005158 | |||
| 1524 | Ga0501080_0013603 | |||
| 1525 | Ga0501080_0076070 | |||
| 1526 | Ga0501081_0146894 | |||
| 1527 | Ga0501083_0001026 | |||
| 1528 | Ga0501083_0002383 | |||
| 1529 | Ga0501083_0018747 | |||
| 1530 | Ga0501283_010554 | |||
| 1531 | nmdc:mga0yw44_103533_c1 | |||
| 1532 | nmdc:mga0yw44_45805_c1 | |||
| 1533 | nmdc:mga0yw44_49691_c1 | |||
| 1534 | nmdc:mga06z11_20310_c1 | |||
| 1535 | nmdc:mga04h51_2245_c1 | |||
| 1536 | nmdc:mga05p37_24787_c1 | |||
| 1537 | nmdc:mga05p37_295101_c1 | |||
| 1538 | nmdc:mga05p37_454255_c1 | |||
| 1539 | nmdc:mga05p37_48387_c1 | |||
| 1540 | nmdc:mga05p37_58518_c1 | |||
| 1541 | nmdc:mga05p37_88590_c1 | |||
| 1542 | nmdc:mga09592_104481_c1 | |||
| 1543 | nmdc:mga09592_161821_c1 | |||
| 1544 | nmdc:mga08y16_180778_c1 | |||
| 1545 | nmdc:mga08y16_421934_c1 | |||
| 1546 | nmdc:mga0n895_37505_c1 | |||
| 1547 | nmdc:mga0a205_2973_c1 | |||
| 1548 | Ga0495601_0016121 | |||
| 1549 | Ga0495595_0030522 | |||
| 1550 | Ga0495619_0006597 | |||
| 1551 | Ga0500644_0003410 | |||
| 1552 | Ga0500646_0000063 | |||
| 1553 | Ga0500646_0000157 | |||
| 1554 | Ga0500646_0000781 | |||
| 1555 | Ga0500646_0022291 | |||
| 1556 | Ga0500583_0000034 | |||
| 1557 | Ga0500583_0020019 | |||
| 1558 | Ga0500651_0009281 | |||
| 1559 | Ga0500650_0021053 | |||
| 1560 | Ga0500654_044692 | |||
| 1561 | Ga0500660_024816 | |||
| 1562 | Ga0500660_073869 | |||
| 1563 | Ga0500569_091733 | |||
| 1564 | Ga0500642_0015603 | |||
| 1565 | Ga0500561_0000132 | |||
| 1566 | Ga0500561_0009359 | |||
| 1567 | Ga0500573_0078981 | |||
| 1568 | Ga0500579_036911 | |||
| 1569 | Ga0500579_086959 | |||
| 1570 | Ga0500588_0007389 | |||
| 1571 | Ga0500588_0015793 | |||
| 1572 | Ga0500588_0029928 | |||
| 1573 | Ga0500589_000007 | |||
| 1574 | Ga0500600_0008943 | |||
| 1575 | Ga0500616_0000251 | |||
| 1576 | Ga0500616_0026066 | |||
| 1577 | Ga0501084_0108757 | |||
| 1578 | Ga0501084_0256430 | |||
| 1579 | Ga0501082_0000559 | |||
| 1580 | Ga0501082_0057721 | |||
| 1581 | 2517760881 | |||
| 1582 | 2616697625 | |||
| 1583 | 2644032982 | |||
| 1584 | 2644089503 | |||
| 1585 | 2644100518 | |||
| 1586 | 2644116926 | |||
| 1587 | 2644270019 | |||
| 1588 | 2644319348 | |||
| 1589 | 2644608516 | |||
| 1590 | 2671837967 | |||
| 1591 | 2676200360 | |||
| 1592 | 2676487376 | |||
| 1593 | 2729907073 | |||
| 1594 | 2731907260 | |||
| 1595 | 2738871902 | |||
| 1596 | 2774844938 | |||
| 1597 | 2774856123 | |||
| 1598 | 2799183823 | |||
| 1599 | 2919449383 | |||
| 1600 | 2929217491 | |||
| 1601 | 2929218736 | |||
| 1602 | 2954700787 | |||
| 1603 | 2954706560 | |||
| 1604 | 2954719425 | |||
| 1605 | 2954729407 | |||
| 1606 | 2954732401 | |||
| 1607 | 2954748310 | |||
| 1608 | 2954751291 | |||
| 1609 | 2954767433 | |||
| 1610 | 3002999272 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bdi-assembly1.cif.gz_A | crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution | 0.7736 | 4 | 264 |
| 4ke6-assembly3.cif.gz_C | crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol | 0.7721 | 10 | 268 |
| 4ke6-assembly5.cif.gz_E | crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol | 0.7718 | 10 | 268 |
| 4ke6-assembly6.cif.gz_F | crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol | 0.7711 | 10 | 268 |
| 5xks-assembly6.cif.gz_F | crystal structure of monoacylglycerol lipase from thermophilic geobacillus sp. 12amor | 0.7711 | 10 | 267 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ke6E00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7718 | 10 | 268 | 3.40.50.1820 |
| 5xksF00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7711 | 10 | 267 | 3.40.50.1820 |
| af_K7KHX7_124_277_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7654 | 203 | 265 | 3.40.50.1820 |
| af_Q8IL54_9_192_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7468 | 7 | 96 | 3.40.50.1820 |
| 5jd6A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7409 | 9 | 269 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537IAY5-F1-model_v4 | Alpha/beta hydrolase | 0.9953 | 7 | 269 |
GO:0016787
|
| AF-A0A543HUW2-F1-model_v4 | Alpha-beta hydrolase superfamily lysophospholipase | 0.9927 | 6 | 269 |
GO:0016787
|
| AF-A0A7Y5P7X6-F1-model_v4 | deleted | 0.9914 | 42 | 269 |
|
| AF-A0A6F8YZZ3-F1-model_v4 | Alpha/beta hydrolase | 0.9909 | 9 | 268 |
GO:0016787
|
| AF-A0A7C1KD27-F1-model_v4 | Alpha/beta hydrolase | 0.9908 | 96 | 269 |
|