F481317

General Info

Members Datasets Scaffolds Average Seq Length
798 355 789 487

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_19433_c1|nmdc:mga00v17_19433_c1_1652_3844
Length 559
Sequence MPRRKNPTPADDVTPPIAAARRRRTASAGKVAGQPVAPLKPRLVKTKSTTPRLTSDLRVELTADDGRRPLNVLMVASEVLPFAKTGGLADVAAALPSALAQLGHQVVVVMPRYRGVTVSGELLTTFVLDIGPEHLHVQVFRERIGGGASVWLVDIPALYDRDGFYGVGSHDHPDNPRRFAALARAAFEAAILVGFTPDVVHAHDWQGGLAPVYLRTRYATHPVLGGVPSVFTIHNIAYSGLCDAGWLPALDLDWDLYTPQALEYWGQVSLLKAGINFSEKVTTVSRKYAEEILTAEFAYGLEGVLAARRADLVGILNGIDAEVWNPATDRFLPAPYTADALAGKRASKRAVLEAYGLPSDEDALGRPLIGMVSRMVAQKGLDLISSVASELPHLGARFVVLGTGEPAFESMWRRLAAQFPDRVGVRIGFDEGLSHLIEAGSDLFLMPSRFEPCGLNQMYSLRYGTLPLVRATGGLDDTVENYDPYTGRGTGFKFWEASGQAMMETLRWALRVYDHPEVWQRLQRAAMGGDFSWVRSAAAYVDVYEAALARTGRRRAAAR

Samples

Sample ID Description Type Environment
1 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
2 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
3 2738543010 Bacillus sp. YR335 Isolate Unclassified
4 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
5 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
6 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
7 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
8 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
9 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
10 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
126 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
127 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
185 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
186 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
187 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
188 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
189 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
190 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
191 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
194 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
198 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
199 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
200 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
201 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
202 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
203 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
204 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
209 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
212 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
224 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
225 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
234 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
235 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
236 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
237 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
243 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
244 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
245 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
246 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
247 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
250 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
251 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
261 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
262 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
263 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
264 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
271 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
272 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
275 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
276 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
277 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
282 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
283 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
284 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
285 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
286 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
287 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
319 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
320 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
321 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
330 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
333 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
334 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
335 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
336 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
337 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
338 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
339 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
340 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
341 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
342 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
343 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
344 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
345 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
346 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
347 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
348 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
349 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
352 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
355 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 0.88
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 5.39
Rhizosphere 91.1
Stem 0
Stem Tuber 0
Unclassified 1.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000797 3300000546 Bacteria 5248
2 Ga0055538_1000080 3300003751 Bacteria 85194
3 Ga0065712_10001774 3300005290 Bacteria 6450
4 Ga0065712_10085300 3300005290 Bacteria 2705
5 Ga0065712_10094144 3300005290 Bacteria 2266
6 Ga0065715_10089407 3300005293 Bacteria 10476
7 Ga0065707_10100972 3300005295 Bacteria 2893
8 Ga0070658_10131017 3300005327 Bacteria 2090
9 Ga0070676_10003362 3300005328 Bacteria 8325
10 Ga0070676_10080166 3300005328 Bacteria 1978
11 Ga0070683_100009361 3300005329 Bacteria 8375
12 Ga0070683_100212620 3300005329 Bacteria 1837
13 Ga0070690_100016718 3300005330 Bacteria 4400
14 Ga0070690_100018063 3300005330 Unclassified 4253
15 Ga0070670_100001920 3300005331 Bacteria 17013
16 Ga0070670_100007560 3300005331 Bacteria 9222
17 Ga0070670_100019868 3300005331 Bacteria 5768
18 Ga0070670_100038930 3300005331 Bacteria 4088
19 Ga0068869_100092340 3300005334 Unclassified 2278
20 Ga0070666_10017961 3300005335 Bacteria 4540
21 Ga0070680_100041435 3300005336 Bacteria 3734
22 Ga0070682_100016065 3300005337 Unclassified 4348
23 Ga0068868_100003218 3300005338 Bacteria 11366
24 Ga0068868_100005467 3300005338 Bacteria 8931
25 Ga0068868_100007890 3300005338 Bacteria 7603
26 Ga0068868_100059186 3300005338 Bacteria 3030
27 Ga0068868_100073162 3300005338 Bacteria 2736
28 Ga0070689_100015247 3300005340 Bacteria 5601
29 Ga0070691_10053018 3300005341 Bacteria 1940
30 Ga0070687_100029783 3300005343 Bacteria 2662
31 Ga0070661_100000349 3300005344 Bacteria 36558
32 Ga0070661_100013918 3300005344 Bacteria 5654
33 Ga0070661_100060577 3300005344 Bacteria 2777
34 Ga0070661_100081001 3300005344 Bacteria 2396
35 Ga0070661_100116047 3300005344 Unclassified 2002
36 Ga0070692_10018091 3300005345 Bacteria 3382
37 Ga0070668_100018335 3300005347 Bacteria 5254
38 Ga0070669_100003108 3300005353 Bacteria 11951
39 Ga0070675_100000181 3300005354 Bacteria 39301
40 Ga0070675_100006104 3300005354 Bacteria 9240
41 Ga0070675_100019910 3300005354 Bacteria 5353
42 Ga0070675_100105287 3300005354 Bacteria 2380
43 Ga0070671_100000218 3300005355 Bacteria 38347
44 Ga0070674_100001864 3300005356 Bacteria 11435
45 Ga0070674_100073466 3300005356 Bacteria 2424
46 Ga0070674_100113064 3300005356 Unclassified 1997
47 Ga0070673_100001419 3300005364 Bacteria 14003
48 Ga0070673_100006113 3300005364 Bacteria 7803
49 Ga0070673_100083665 3300005364 Bacteria 2593
50 Ga0070688_100025395 3300005365 Bacteria 3507
51 Ga0070688_100049225 3300005365 Bacteria 2622
52 Ga0070659_100004597 3300005366 Bacteria 9870
53 Ga0070667_100004110 3300005367 Bacteria 12322
54 Ga0070667_100026465 3300005367 Bacteria 4826
55 Ga0070667_100034813 3300005367 Bacteria 4216
56 Ga0070667_100222436 3300005367 Bacteria 1681
57 Ga0070709_10016589 3300005434 Bacteria 4207
58 Ga0070709_10020223 3300005434 Unclassified 3859
59 Ga0070709_10024126 3300005434 Unclassified 3578
60 Ga0070713_100028284 3300005436 Bacteria 4426
61 Ga0070710_10055473 3300005437 Bacteria 2239
62 Ga0070701_10027557 3300005438 Bacteria 2784
63 Ga0070711_100029520 3300005439 Unclassified 3619
64 Ga0070711_100114354 3300005439 Unclassified 1986
65 Ga0070705_100000756 3300005440 Bacteria 18330
66 Ga0070705_100014673 3300005440 Bacteria 4036
67 Ga0070705_100056792 3300005440 Bacteria 2306
68 Ga0070700_100004623 3300005441 Bacteria 7208
69 Ga0070700_100079966 3300005441 Bacteria 2108
70 Ga0070694_100007401 3300005444 Bacteria 6695
71 Ga0070694_100019076 3300005444 Bacteria 4359
72 Ga0070694_100051176 3300005444 Bacteria 2787
73 Ga0070708_100000298 3300005445 Bacteria 37307
74 Ga0070708_100002919 3300005445 Bacteria 13293
75 Ga0070708_100005303 3300005445 Bacteria 10217
76 Ga0070708_100017425 3300005445 Bacteria 5991
77 Ga0070663_100072156 3300005455 Unclassified 2514
78 Ga0070678_100000972 3300005456 Bacteria 14793
79 Ga0070678_100011558 3300005456 Bacteria 5453
80 Ga0070678_100054903 3300005456 Bacteria 2906
81 Ga0070662_100012018 3300005457 Bacteria 5731
82 Ga0070662_100039019 3300005457 Bacteria 3376
83 Ga0070662_100077476 3300005457 Bacteria 2467
84 Ga0070681_10000281 3300005458 Bacteria 40930
85 Ga0070681_10038239 3300005458 Bacteria 4811
86 Ga0070681_10075385 3300005458 Bacteria 3333
87 Ga0070681_10080321 3300005458 Bacteria 3217
88 Ga0070681_10171230 3300005458 Bacteria 2093
89 Ga0068867_100007526 3300005459 Bacteria 7702
90 Ga0068867_100025146 3300005459 Bacteria 4271
91 Ga0070706_100000257 3300005467 Bacteria 64534
92 Ga0070706_100000529 3300005467 Bacteria 44433
93 Ga0070706_100065172 3300005467 Bacteria 3369
94 Ga0070706_100092316 3300005467 Bacteria 2808
95 Ga0070706_100130894 3300005467 Unclassified 2341
96 Ga0070707_100051602 3300005468 Bacteria 3943
97 Ga0070707_100058073 3300005468 Bacteria 3711
98 Ga0070707_100070380 3300005468 Bacteria 3370
99 Ga0070707_100076535 3300005468 Bacteria 3228
100 Ga0070698_100000171 3300005471 Bacteria 60242
101 Ga0070698_100015249 3300005471 Bacteria 8126
102 Ga0070698_100025140 3300005471 Bacteria 6207
103 Ga0070699_100000386 3300005518 Bacteria 42744
104 Ga0070699_100003167 3300005518 Bacteria 14567
105 Ga0070699_100006186 3300005518 Bacteria 10458
106 Ga0070699_100011772 3300005518 Bacteria 7549
107 Ga0070699_100020718 3300005518 Bacteria 5671
108 Ga0070699_100077324 3300005518 Unclassified 2897
109 Ga0070699_100148638 3300005518 Bacteria 2071
110 Ga0070679_100010668 3300005530 Bacteria 8718
111 Ga0070679_100223135 3300005530 Bacteria 1845
112 Ga0070684_100044443 3300005535 Bacteria 3842
113 Ga0070684_100047883 3300005535 Bacteria 3707
114 Ga0070684_100070000 3300005535 Bacteria 3086
115 Ga0070684_100073592 3300005535 Bacteria 3011
116 Ga0070697_100000054 3300005536 Bacteria 88022
117 Ga0070697_100001040 3300005536 Bacteria 20964
118 Ga0070697_100028044 3300005536 Bacteria 4507
119 Ga0070697_100066843 3300005536 Bacteria 2939
120 Ga0070697_100073967 3300005536 Bacteria 2798
121 Ga0068853_100180292 3300005539 Unclassified 1915
122 Ga0068853_100289774 3300005539 Bacteria 1511
123 Ga0070672_100002438 3300005543 Bacteria 11797
124 Ga0070672_100002533 3300005543 Bacteria 11639
125 Ga0070672_100004226 3300005543 Bacteria 9389
126 Ga0070672_100030643 3300005543 Bacteria 4043
127 Ga0070686_100033883 3300005544 Bacteria 3142
128 Ga0070695_100000247 3300005545 Bacteria 26996
129 Ga0070695_100054983 3300005545 Bacteria 2565
130 Ga0070695_100087338 3300005545 Bacteria 2074
131 Ga0070696_100001143 3300005546 Bacteria 17208
132 Ga0070696_100026985 3300005546 Bacteria 3910
133 Ga0070696_100037141 3300005546 Bacteria 3359
134 Ga0070696_100043420 3300005546 Bacteria 3110
135 Ga0070665_100046559 3300005548 Bacteria 4356
136 Ga0070665_100191137 3300005548 Bacteria 2048
137 Ga0070704_100003993 3300005549 Bacteria 8507
138 Ga0070704_100005018 3300005549 Bacteria 7691
139 Ga0070704_100006063 3300005549 Bacteria 7090
140 Ga0070704_100028365 3300005549 Bacteria 3723
141 Ga0070704_100037916 3300005549 Bacteria 3297
142 Ga0068855_100008313 3300005563 Bacteria 12542
143 Ga0068855_100036443 3300005563 Bacteria 5854
144 Ga0068855_100097073 3300005563 Bacteria 3394
145 Ga0068855_100323382 3300005563 Bacteria 1704
146 Ga0070664_100001855 3300005564 Bacteria 16921
147 Ga0070664_100002592 3300005564 Bacteria 14585
148 Ga0070664_100067583 3300005564 Unclassified 3054
149 Ga0068857_100001887 3300005577 Bacteria 16893
150 Ga0068857_100012663 3300005577 Bacteria 7348
151 Ga0068857_100060235 3300005577 Bacteria 3372
152 Ga0068857_100192182 3300005577 Bacteria 1859
153 Ga0068854_100001333 3300005578 Bacteria 14896
154 Ga0068854_100010834 3300005578 Bacteria 5916
155 Ga0068854_100031544 3300005578 Bacteria 3684
156 Ga0068854_100080099 3300005578 Unclassified 2409
157 Ga0068856_100002155 3300005614 Bacteria 20392
158 Ga0068856_100003339 3300005614 Bacteria 16300
159 Ga0070702_100035525 3300005615 Bacteria 2754
160 Ga0068852_100000256 3300005616 Bacteria 35991
161 Ga0068852_100078159 3300005616 Unclassified 2927
162 Ga0068859_100002081 3300005617 Bacteria 20395
163 Ga0068859_100005436 3300005617 Bacteria 12955
164 Ga0068859_100015676 3300005617 Bacteria 7615
165 Ga0068859_100115711 3300005617 Bacteria 2746
166 Ga0068859_100117305 3300005617 Bacteria 2727
167 Ga0068864_100002540 3300005618 Bacteria 15071
168 Ga0068864_100005475 3300005618 Bacteria 10411
169 Ga0068864_100005740 3300005618 Bacteria 10179
170 Ga0068864_100037779 3300005618 Bacteria 4122
171 Ga0068864_100066290 3300005618 Unclassified 3134
172 Ga0068866_10019161 3300005718 Unclassified 3109
173 Ga0068861_100001989 3300005719 Bacteria 13206
174 Ga0068861_100037692 3300005719 Bacteria 3595
175 Ga0068851_10024963 3300005834 Bacteria 2929
176 Ga0068870_10003674 3300005840 Bacteria 6517
177 Ga0068870_10027197 3300005840 Unclassified 2859
178 Ga0068870_10050018 3300005840 Bacteria 2207
179 Ga0068863_100019006 3300005841 Bacteria 6576
180 Ga0068863_100087281 3300005841 Bacteria 2956
181 Ga0068863_100163660 3300005841 Unclassified 2133
182 Ga0068858_100001136 3300005842 Bacteria 27546
183 Ga0068858_100008296 3300005842 Bacteria 9989
184 Ga0068860_100001188 3300005843 Bacteria 28462
185 Ga0068860_100009175 3300005843 Bacteria 9833
186 Ga0068860_100010389 3300005843 Bacteria 9209
187 Ga0068862_100001000 3300005844 Bacteria 27052
188 Ga0068862_100147953 3300005844 Bacteria 2089
189 Ga0070717_10003073 3300006028 Bacteria 11898
190 Ga0070717_10014404 3300006028 Bacteria 6083
191 Ga0070717_10015938 3300006028 Bacteria 5817
192 Ga0070717_10017657 3300006028 Bacteria 5555
193 Ga0070717_10228724 3300006028 Bacteria 1637
194 Ga0070716_100014738 3300006173 Unclassified 4011
195 Ga0070716_100040172 3300006173 Unclassified 2602
196 Ga0070716_100060782 3300006173 Bacteria 2184
197 Ga0070712_100000624 3300006175 Bacteria 20825
198 Ga0070712_100016216 3300006175 Bacteria 4810
199 Ga0097621_100067469 3300006237 Unclassified 2948
200 Ga0097621_100123215 3300006237 Bacteria 2200
201 Ga0068871_100018677 3300006358 Bacteria 5278
202 Ga0068871_100057802 3300006358 Bacteria 3157
203 Ga0075428_100004439 3300006844 Bacteria 15493
204 Ga0075428_100007047 3300006844 Bacteria 12457
205 Ga0075428_100011674 3300006844 Bacteria 9777
206 Ga0075428_100017990 3300006844 Bacteria 7809
207 Ga0075428_100018233 3300006844 Bacteria 7757
208 Ga0075428_100024526 3300006844 Bacteria 6674
209 Ga0075433_10015146 3300006852 Bacteria 6317
210 Ga0075433_10081420 3300006852 Bacteria 2854
211 Ga0075434_100001538 3300006871 Bacteria 19521
212 Ga0075434_100003880 3300006871 Bacteria 13384
213 Ga0075434_100011335 3300006871 Bacteria 8402
214 Ga0075434_100017175 3300006871 Bacteria 6967
215 Ga0075434_100065887 3300006871 Bacteria 3608
216 Ga0075434_100098674 3300006871 Bacteria 2926
217 Ga0075429_100010629 3300006880 Bacteria 7963
218 Ga0075429_100016395 3300006880 Bacteria 6422
219 Ga0075429_100178283 3300006880 Bacteria 1862
220 Ga0075436_100001527 3300006914 Bacteria 15807
221 Ga0075436_100002992 3300006914 Bacteria 11573
222 Ga0075436_100011060 3300006914 Bacteria 6191
223 Ga0075436_100038731 3300006914 Bacteria 3290
224 Ga0075436_100157798 3300006914 Bacteria 1598
225 Ga0097620_100002081 3300006931 Bacteria 20395
226 Ga0097620_100005436 3300006931 Bacteria 12955
227 Ga0097620_100015676 3300006931 Bacteria 7615
228 Ga0097620_100115710 3300006931 Bacteria 2746
229 Ga0097620_100117309 3300006931 Bacteria 2727
230 Ga0075435_100000357 3300007076 Bacteria 27987
231 Ga0075435_100007984 3300007076 Bacteria 7575
232 Ga0075435_100012719 3300007076 Bacteria 6235
233 Ga0099795_10000013 3300007788 Bacteria 69893
234 Ga0105240_10006066 3300009093 Bacteria 17852
235 Ga0105240_10045158 3300009093 Bacteria 5592
236 Ga0105240_10105790 3300009093 Bacteria 3415
237 Ga0105240_10203431 3300009093 Bacteria 2319
238 Ga0105240_10332337 3300009093 Bacteria 1729
239 Ga0111539_10000563 3300009094 Bacteria 47501
240 Ga0111539_10001769 3300009094 Bacteria 28709
241 Ga0111539_10004174 3300009094 Bacteria 18954
242 Ga0111539_10017744 3300009094 Bacteria 8811
243 Ga0111539_10041043 3300009094 Bacteria 5566
244 Ga0111539_10073633 3300009094 Bacteria 4027
245 Ga0111539_10074542 3300009094 Bacteria 3998
246 Ga0111539_10133207 3300009094 Bacteria 2910
247 Ga0111539_10286417 3300009094 Bacteria 1917
248 Ga0105245_10143724 3300009098 Unclassified 2249
249 Ga0105247_10042469 3300009101 Bacteria 2785
250 Ga0114129_10001102 3300009147 Bacteria 35507
251 Ga0114129_10003827 3300009147 Bacteria 21202
252 Ga0114129_10007052 3300009147 Bacteria 15997
253 Ga0114129_10041164 3300009147 Bacteria 6512
254 Ga0114129_10084404 3300009147 Bacteria 4410
255 Ga0114129_10084789 3300009147 Bacteria 4398
256 Ga0114129_10177944 3300009147 Bacteria 2896
257 Ga0114129_10235483 3300009147 Bacteria 2464
258 Ga0114129_10283104 3300009147 Bacteria 2215
259 Ga0105243_10007773 3300009148 Bacteria 8243
260 Ga0105243_10028025 3300009148 Bacteria 4321
261 Ga0105243_10051889 3300009148 Bacteria 3246
262 Ga0105241_10237417 3300009174 Bacteria 1539
263 Ga0105242_10036893 3300009176 Bacteria 3924
264 Ga0105242_10058176 3300009176 Bacteria 3168
265 Ga0105242_10093509 3300009176 Bacteria 2535
266 Ga0105248_10006415 3300009177 Bacteria 12905
267 Ga0105248_10029958 3300009177 Bacteria 6073
268 Ga0105248_10030894 3300009177 Bacteria 5984
269 Ga0105248_10032810 3300009177 Bacteria 5801
270 Ga0105237_10001318 3300009545 Bacteria 32923
271 Ga0105237_10034493 3300009545 Bacteria 5123
272 Ga0105238_10047858 3300009551 Bacteria 4310
273 Ga0105249_10006074 3300009553 Bacteria 10466
274 Ga0105249_10135072 3300009553 Bacteria 2359
275 Ga0099796_10003190 3300010159 Bacteria 3756
276 Ga0105239_10207070 3300010375 Bacteria 2198
277 Ga0105246_10107642 3300011119 Bacteria 2042
278 Ga0157371_10015522 3300013102 Bacteria 5712
279 Ga0157370_10050083 3300013104 Unclassified 3994
280 Ga0157369_10000176 3300013105 Bacteria 89387
281 Ga0157369_10019633 3300013105 Bacteria 7563
282 Ga0157369_10043083 3300013105 Bacteria 4921
283 Ga0157374_10102908 3300013296 Bacteria 2739
284 Ga0157374_10106790 3300013296 Bacteria 2690
285 Ga0157378_10000057 3300013297 Bacteria 96589
286 Ga0157378_10001428 3300013297 Bacteria 21504
287 Ga0157378_10002432 3300013297 Bacteria 16560
288 Ga0157378_10003159 3300013297 Bacteria 14647
289 Ga0157378_10125593 3300013297 Unclassified 2369
290 Ga0157378_10163797 3300013297 Bacteria 2081
291 Ga0157378_10193359 3300013297 Bacteria 1920
292 Ga0163162_10011524 3300013306 Bacteria 8623
293 Ga0163162_10021711 3300013306 Bacteria 6323
294 Ga0163162_10063330 3300013306 Bacteria 3740
295 Ga0163162_10195582 3300013306 Bacteria 2151
296 Ga0163162_10234479 3300013306 Bacteria 1966
297 Ga0157372_10000471 3300013307 Bacteria 44441
298 Ga0157375_10003261 3300013308 Bacteria 14084
299 Ga0157375_10008985 3300013308 Bacteria 8745
300 Ga0157375_10059425 3300013308 Bacteria 3788
301 Ga0163163_10002199 3300014325 Bacteria 16414
302 Ga0163163_10022035 3300014325 Bacteria 6024
303 Ga0163163_10039284 3300014325 Unclassified 4619
304 Ga0163163_10172581 3300014325 Bacteria 2209
305 Ga0157380_10028769 3300014326 Bacteria 4241
306 Ga0157379_10005147 3300014968 Bacteria 11224
307 Ga0157379_10040559 3300014968 Bacteria 4156
308 Ga0157379_10092885 3300014968 Unclassified 2707
309 Ga0157376_10001578 3300014969 Bacteria 15061
310 Ga0157376_10030349 3300014969 Bacteria 4317
311 Ga0157376_10148196 3300014969 Bacteria 2113
312 Ga0213872_10003228 3300021361 Bacteria 9107
313 Ga0213871_10001966 3300021441 Bacteria 3648
314 Ga0228598_1000117 3300024227 Bacteria 13477
315 Ga0209784_100077 3300025224 Bacteria 139569
316 Ga0209437_100324 3300025233 Bacteria 61046
317 Ga0207697_10003472 3300025315 Bacteria 7780
318 Ga0207688_10046191 3300025901 Bacteria 2431
319 Ga0207680_10013655 3300025903 Bacteria 4179
320 Ga0207680_10083104 3300025903 Bacteria 2017
321 Ga0207645_10062694 3300025907 Bacteria 2375
322 Ga0207645_10095284 3300025907 Bacteria 1916
323 Ga0207643_10009824 3300025908 Bacteria 5139
324 Ga0207684_10000702 3300025910 Bacteria 39479
325 Ga0207684_10002463 3300025910 Bacteria 18645
326 Ga0207707_10004695 3300025912 Bacteria 11993
327 Ga0207707_10008801 3300025912 Bacteria 8760
328 Ga0207707_10009521 3300025912 Bacteria 8428
329 Ga0207707_10048103 3300025912 Bacteria 3714
330 Ga0207695_10004005 3300025913 Bacteria 20286
331 Ga0207695_10036329 3300025913 Bacteria 5328
332 Ga0207695_10090874 3300025913 Unclassified 3068
333 Ga0207695_10093936 3300025913 Bacteria 3008
334 Ga0207695_10194628 3300025913 Bacteria 1944
335 Ga0207693_10000173 3300025915 Bacteria 58862
336 Ga0207693_10014694 3300025915 Bacteria 6290
337 Ga0207693_10016874 3300025915 Bacteria 5830
338 Ga0207693_10018122 3300025915 Bacteria 5611
339 Ga0207693_10087387 3300025915 Bacteria 2443
340 Ga0207663_10003624 3300025916 Bacteria 7579
341 Ga0207660_10028785 3300025917 Bacteria 3804
342 Ga0207662_10013731 3300025918 Bacteria 4533
343 Ga0207657_10012381 3300025919 Bacteria 8427
344 Ga0207652_10011594 3300025921 Bacteria 7111
345 Ga0207646_10022810 3300025922 Bacteria 5756
346 Ga0207646_10074212 3300025922 Bacteria 3039
347 Ga0207646_10119393 3300025922 Bacteria 2368
348 Ga0207646_10121421 3300025922 Bacteria 2347
349 Ga0207681_10005692 3300025923 Bacteria 7653
350 Ga0207694_10013768 3300025924 Bacteria 6097
351 Ga0207650_10001433 3300025925 Bacteria 17197
352 Ga0207650_10006792 3300025925 Bacteria 7804
353 Ga0207650_10036967 3300025925 Bacteria 3555
354 Ga0207659_10000547 3300025926 Bacteria 22456
355 Ga0207659_10003019 3300025926 Bacteria 10036
356 Ga0207659_10014217 3300025926 Bacteria 5124
357 Ga0207687_10007320 3300025927 Bacteria 7278
358 Ga0207700_10014118 3300025928 Bacteria 5224
359 Ga0207700_10096097 3300025928 Unclassified 2352
360 Ga0207664_10050007 3300025929 Bacteria 3294
361 Ga0207644_10002517 3300025931 Bacteria 11780
362 Ga0207706_10003473 3300025933 Bacteria 15041
363 Ga0207706_10006013 3300025933 Bacteria 11288
364 Ga0207706_10048241 3300025933 Bacteria 3766
365 Ga0207706_10078262 3300025933 Bacteria 2908
366 Ga0207706_10130753 3300025933 Bacteria 2208
367 Ga0207686_10028325 3300025934 Bacteria 3292
368 Ga0207686_10045431 3300025934 Bacteria 2702
369 Ga0207709_10033163 3300025935 Bacteria 3029
370 Ga0207670_10003124 3300025936 Bacteria 8763
371 Ga0207670_10008107 3300025936 Bacteria 5911
372 Ga0207670_10100693 3300025936 Bacteria 2063
373 Ga0207669_10003145 3300025937 Bacteria 7121
374 Ga0207704_10042233 3300025938 Unclassified 2682
375 Ga0207704_10054000 3300025938 Bacteria 2446
376 Ga0207665_10002707 3300025939 Bacteria 11886
377 Ga0207665_10007285 3300025939 Bacteria 7319
378 Ga0207665_10035777 3300025939 Unclassified 3298
379 Ga0207691_10000071 3300025940 Bacteria 83980
380 Ga0207691_10006497 3300025940 Bacteria 11290
381 Ga0207691_10014961 3300025940 Bacteria 7390
382 Ga0207691_10025047 3300025940 Bacteria 5606
383 Ga0207711_10014596 3300025941 Bacteria 6528
384 Ga0207711_10149066 3300025941 Bacteria 2110
385 Ga0207689_10038924 3300025942 Unclassified 3937
386 Ga0207661_10004972 3300025944 Bacteria 9326
387 Ga0207679_10009368 3300025945 Bacteria 6272
388 Ga0207667_10006069 3300025949 Bacteria 14691
389 Ga0207667_10049431 3300025949 Bacteria 4441
390 Ga0207667_10064160 3300025949 Bacteria 3836
391 Ga0207667_10274294 3300025949 Bacteria 1724
392 Ga0207651_10000346 3300025960 Bacteria 19732
393 Ga0207651_10039398 3300025960 Bacteria 3116
394 Ga0207640_10002629 3300025981 Bacteria 9626
395 Ga0207640_10007488 3300025981 Bacteria 6031
396 Ga0207640_10122549 3300025981 Unclassified 1866
397 Ga0207677_10016898 3300026023 Bacteria 4334
398 Ga0207677_10027424 3300026023 Bacteria 3587
399 Ga0207677_10060882 3300026023 Bacteria 2612
400 Ga0207677_10086348 3300026023 Bacteria 2268
401 Ga0207703_10001910 3300026035 Bacteria 18464
402 Ga0207703_10029451 3300026035 Bacteria 4332
403 Ga0207678_10000874 3300026067 Bacteria 27662
404 Ga0207678_10134065 3300026067 Bacteria 2113
405 Ga0207708_10012471 3300026075 Bacteria 6335
406 Ga0207702_10005378 3300026078 Bacteria 11216
407 Ga0207641_10055387 3300026088 Bacteria 3367
408 Ga0207648_10001255 3300026089 Bacteria 28363
409 Ga0207648_10034527 3300026089 Bacteria 4457
410 Ga0207648_10095760 3300026089 Bacteria 2597
411 Ga0207676_10002505 3300026095 Bacteria 13088
412 Ga0207676_10008322 3300026095 Bacteria 7373
413 Ga0207676_10020204 3300026095 Bacteria 4869
414 Ga0207676_10102311 3300026095 Unclassified 2378
415 Ga0207674_10007174 3300026116 Bacteria 13015
416 Ga0207674_10038394 3300026116 Bacteria 4971
417 Ga0207674_10055814 3300026116 Bacteria 4014
418 Ga0207674_10075303 3300026116 Bacteria 3385
419 Ga0207675_100006796 3300026118 Bacteria 10827
420 Ga0207675_100023243 3300026118 Bacteria 5765
421 Ga0207683_10000573 3300026121 Bacteria 34080
422 Ga0207683_10000607 3300026121 Bacteria 33032
423 Ga0207683_10025245 3300026121 Bacteria 5125
424 Ga0207683_10176671 3300026121 Bacteria 1935
425 Ga0207698_10001341 3300026142 Bacteria 14333
426 Ga0209179_1000086 3300027512 Bacteria 14025
427 Ga0207428_10000442 3300027907 Bacteria 50837
428 Ga0207428_10002086 3300027907 Bacteria 20130
429 Ga0207428_10003307 3300027907 Bacteria 15678
430 Ga0207428_10009261 3300027907 Bacteria 8841
431 Ga0268266_10114429 3300028379 Bacteria 2394
432 Ga0268266_10155923 3300028379 Bacteria 2062
433 Ga0268265_10000237 3300028380 Bacteria 62935
434 Ga0268264_10001084 3300028381 Bacteria 26936
435 Ga0268264_10018583 3300028381 Bacteria 5684
436 Ga0268264_10029004 3300028381 Bacteria 4531
437 Ga0268264_10077994 3300028381 Unclassified 2823
438 Ga0265337_1000441 3300028556 Bacteria 22052
439 Ga0265326_10002006 3300028558 Bacteria 6959
440 Ga0265319_1004110 3300028563 Bacteria 7323
441 Ga0265319_1005369 3300028563 Bacteria 6145
442 Ga0265319_1030511 3300028563 Bacteria 1885
443 Ga0265334_10007200 3300028573 Bacteria 4775
444 Ga0265318_10000389 3300028577 Bacteria 34282
445 Ga0265318_10007501 3300028577 Bacteria 4927
446 Ga0265323_10000508 3300028653 Bacteria 21758
447 Ga0265323_10006216 3300028653 Bacteria 5029
448 Ga0265322_10001506 3300028654 Bacteria 7565
449 Ga0265336_10001214 3300028666 Bacteria 12222
450 Ga0265338_10000257 3300028800 Bacteria 96951
451 Ga0265338_10003601 3300028800 Bacteria 21624
452 Ga0265338_10006415 3300028800 Bacteria 14995
453 Ga0265338_10008539 3300028800 Bacteria 12405
454 Ga0265338_10023649 3300028800 Bacteria 6306
455 Ga0265338_10026728 3300028800 Bacteria 5808
456 Ga0265338_10066956 3300028800 Unclassified 3105
457 Ga0265324_10002503 3300029957 Bacteria 9331
458 Ga0265324_10016792 3300029957 Bacteria 2665
459 Ga0265760_10002408 3300031090 Bacteria 5463
460 Ga0265760_10007428 3300031090 Bacteria 3133
461 Ga0265760_10022377 3300031090 Bacteria 1831
462 Ga0265330_10001184 3300031235 Bacteria 15470
463 Ga0265330_10004502 3300031235 Bacteria 7067
464 Ga0265330_10008012 3300031235 Bacteria 5117
465 Ga0265330_10049061 3300031235 Bacteria 1856
466 Ga0265332_10000044 3300031238 Bacteria 114444
467 Ga0265332_10000361 3300031238 Bacteria 33818
468 Ga0265332_10001310 3300031238 Bacteria 14172
469 Ga0265332_10046701 3300031238 Bacteria 1865
470 Ga0265328_10013000 3300031239 Bacteria 3301
471 Ga0265328_10013091 3300031239 Bacteria 3290
472 Ga0265320_10000444 3300031240 Bacteria 32390
473 Ga0265325_10003182 3300031241 Bacteria 10800
474 Ga0265325_10004663 3300031241 Bacteria 8602
475 Ga0265325_10011487 3300031241 Bacteria 5085
476 Ga0265325_10012362 3300031241 Bacteria 4885
477 Ga0265325_10014433 3300031241 Bacteria 4465
478 Ga0265329_10000898 3300031242 Bacteria 14917
479 Ga0265329_10004863 3300031242 Bacteria 5508
480 Ga0265329_10028508 3300031242 Bacteria 1830
481 Ga0265340_10015605 3300031247 Bacteria 3945
482 Ga0265340_10034337 3300031247 Bacteria 2523
483 Ga0265339_10000245 3300031249 Bacteria 43619
484 Ga0265339_10012897 3300031249 Bacteria 5082
485 Ga0265339_10032574 3300031249 Bacteria 2939
486 Ga0265331_10000076 3300031250 Bacteria 145884
487 Ga0265331_10001532 3300031250 Bacteria 17026
488 Ga0265331_10005198 3300031250 Bacteria 7905
489 Ga0265327_10034465 3300031251 Bacteria 2809
490 Ga0265316_10000006 3300031344 Bacteria 289686
491 Ga0265316_10001703 3300031344 Bacteria 23319
492 Ga0265316_10004811 3300031344 Bacteria 13322
493 Ga0307509_10000488 3300031507 Bacteria 67229
494 Ga0307408_100008217 3300031548 Bacteria 6889
495 Ga0265313_10002783 3300031595 Bacteria 14749
496 Ga0265313_10036627 3300031595 Bacteria 2461
497 Ga0316579_10001211 3300031691 Bacteria 9250
498 Ga0265314_10000056 3300031711 Bacteria 171647
499 Ga0265314_10000378 3300031711 Bacteria 60930
500 Ga0265314_10001444 3300031711 Bacteria 26575
501 Ga0265314_10002399 3300031711 Bacteria 19261
502 Ga0265342_10001152 3300031712 Bacteria 25203
503 Ga0265342_10003673 3300031712 Bacteria 12454
504 Ga0265342_10075626 3300031712 Bacteria 1953
505 Ga0307516_10019164 3300031730 Bacteria 7092
506 Ga0307405_10007998 3300031731 Bacteria 5332
507 Ga0307405_10010309 3300031731 Bacteria 4833
508 Ga0307405_10018167 3300031731 Bacteria 3875
509 Ga0316577_10024381 3300031733 Bacteria 3363
510 Ga0307410_10011774 3300031852 Bacteria 5021
511 Ga0307410_10015761 3300031852 Bacteria 4491
512 Ga0307407_10006608 3300031903 Bacteria 5176
513 Ga0307407_10011965 3300031903 Bacteria 4154
514 Ga0307412_10058418 3300031911 Bacteria 2580
515 Ga0307409_100030573 3300031995 Bacteria 3871
516 Ga0307416_100001676 3300032002 Bacteria 12247
517 Ga0307416_100008926 3300032002 Bacteria 6515
518 Ga0307416_100011349 3300032002 Bacteria 5933
519 Ga0307416_100014111 3300032002 Bacteria 5457
520 Ga0307416_100198985 3300032002 Bacteria 1899
521 Ga0307411_10003321 3300032005 Bacteria 7442
522 Ga0307411_10029795 3300032005 Bacteria 3339
523 Ga0307411_10064631 3300032005 Bacteria 2451
524 Ga0307411_10088312 3300032005 Bacteria 2156
525 Ga0307415_100006569 3300032126 Bacteria 6287
526 Ga0307415_100016964 3300032126 Bacteria 4355
527 Ga0307415_100021232 3300032126 Bacteria 3986
528 Ga0316593_10038238 3300032168 Bacteria 1588
529 Ga0373930_0002470 3300034816 Unclassified 2859
530 Ga0373929_0011324 3300035085 Unclassified 1680
531 Ga0373934_0006571 3300035086 Bacteria 4312
532 Ga0373934_0038249 3300035086 Bacteria 1889
533 Ga0373934_0057453 3300035086 Bacteria 1548
534 Ga0373936_0010113 3300035113 Unclassified 3564
535 Ga0373953_0004534 3300035117 Bacteria 4434
536 Ga0373956_0002137 3300035119 Bacteria 8180
537 Ga0373956_0014257 3300035119 Bacteria 3318
538 Ga0373943_0069875 3300035170 Bacteria 1776
539 Ga0373955_0002881 3300035172 Bacteria 7543
540 Ga0316574_0010097 3300035398 Bacteria 5317
541 Ga0373931_0021193 3300035691 Bacteria 3260
542 Ga0373931_0047740 3300035691 Bacteria 2267
543 Ga0373927_0005509 3300035695 Bacteria 8721
544 Ga0373927_0022499 3300035695 Bacteria 4129
545 Ga0373927_0048489 3300035695 Bacteria 2748
546 Ga0373927_0051072 3300035695 Bacteria 2674
547 Ga0373933_0000430 3300035724 Bacteria 26421
548 Ga0373933_0002012 3300035724 Bacteria 11723
549 Ga0373933_0025244 3300035724 Bacteria 3407
550 Ga0373947_0027787 3300035725 Bacteria 3313
551 Ga0373947_0041277 3300035725 Bacteria 2750
552 Ga0373937_0000559 3300036401 Bacteria 33006
553 Ga0373937_0026218 3300036401 Bacteria 5266
554 Ga0373937_0040267 3300036401 Bacteria 4259
555 Ga0373937_0047014 3300036401 Bacteria 3948
556 Ga0316584_0019264 3300036712 Bacteria 4932
557 Ga0373925_0001264 3300037068 Bacteria 22304
558 Ga0373925_0012759 3300037068 Bacteria 6087
559 Ga0373925_0012943 3300037068 Bacteria 6044
560 Ga0373925_0107244 3300037068 Bacteria 2154
561 Ga0395905_0039280 3300037471 Bacteria 4440
562 Ga0395905_0040991 3300037471 Bacteria 4344
563 Ga0395905_0138296 3300037471 Unclassified 2292
564 Ga0436364_0398603 3300037853 Bacteria 3909
565 Ga0436364_1070510 3300037853 Bacteria 12704
566 Ga0436365_1746299 3300039437 Unclassified 1635
567 Ga0436365_1778402 3300039437 Bacteria 3215
568 Ga0436360_1040293 3300039438 Bacteria 9682
569 Ga0436360_1294278 3300039438 Bacteria 6107
570 Ga0436361_0533922 3300039447 Bacteria 24051
571 Ga0436361_0550373 3300039447 Bacteria 8540
572 Ga0436361_1111084 3300039447 Bacteria 8152
573 Ga0451849_1129382 3300041505 Bacteria 3043
574 Ga0451853_0598962 3300041512 Bacteria 1924
575 Ga0450896_000020 3300042133 Bacteria 8737
576 Ga0450908_009935 3300042184 Bacteria 1761
577 Ga0451577_0000102 3300042876 Bacteria 188094
578 Ga0451577_0000109 3300042876 Bacteria 183296
579 Ga0451577_0000158 3300042876 Bacteria 151857
580 Ga0451577_0030087 3300042876 Bacteria 4907
581 Ga0451577_0082264 3300042876 Bacteria 2872
582 Ga0451577_0093061 3300042876 Bacteria 2692
583 Ga0451577_0132810 3300042876 Bacteria 2234
584 Ga0451577_0211197 3300042876 Bacteria 1753
585 Ga0453683_0006726 3300044673 Bacteria 7860
586 Ga0466963_0010778 3300044694 Bacteria 5549
587 Ga0466963_0012505 3300044694 Bacteria 5199
588 Ga0466963_0024022 3300044694 Bacteria 3877
589 Ga0453684_0000004 3300044712 Bacteria 1469893
590 Ga0453684_0000089 3300044712 Bacteria 395064
591 Ga0453684_0000249 3300044712 Bacteria 232232
592 Ga0453684_0062536 3300044712 Bacteria 4767
593 Ga0453684_0112915 3300044712 Bacteria 3297
594 Ga0453684_0180712 3300044712 Bacteria 2477
595 Ga0453684_0286335 3300044712 Bacteria 1877
596 Ga0451576_0033144 3300045051 Bacteria 5491
597 Ga0451576_0053960 3300045051 Bacteria 4208
598 Ga0451576_0076045 3300045051 Bacteria 3494
599 Ga0495592_0057597 3300046454 Bacteria 2868
600 Ga0495592_0120756 3300046454 Bacteria 1844
601 Ga0495603_0114710 3300046455 Bacteria 1571
602 Ga0495653_0018444 3300046463 Bacteria 5665
603 Ga0495580_0051758 3300046472 Bacteria 2902
604 Ga0495580_0059731 3300046472 Bacteria 2679
605 Ga0495580_0062866 3300046472 Unclassified 2604
606 Ga0495580_0131040 3300046472 Bacteria 1739
607 Ga0495582_0005957 3300046473 Bacteria 6796
608 Ga0495584_0048033 3300046491 Bacteria 2152
609 Ga0495594_0002079 3300046499 Bacteria 10426
610 Ga0495608_0040191 3300046511 Bacteria 3134
611 Ga0495608_0062993 3300046511 Bacteria 2435
612 Ga0495628_0013834 3300046516 Bacteria 6780
613 Ga0495628_0127524 3300046516 Bacteria 1948
614 Ga0495666_0016631 3300046526 Bacteria 3663
615 Ga0495587_0001108 3300046536 Bacteria 17717
616 Ga0495587_0005236 3300046536 Bacteria 8478
617 Ga0495609_0045151 3300046538 Bacteria 1975
618 Ga0495621_0006236 3300046539 Bacteria 3468
619 Ga0495645_0036742 3300046543 Bacteria 3570
620 Ga0495633_0045297 3300046558 Bacteria 2083
621 Ga0495667_0022547 3300046559 Bacteria 4242
622 Ga0495656_0025467 3300046615 Bacteria 2346
623 Ga0495635_0144151 3300046663 Bacteria 1622
624 Ga0495588_0004739 3300046674 Bacteria 6014
625 Ga0495657_0005190 3300046675 Bacteria 10314
626 Ga0495657_0044161 3300046675 Bacteria 3033
627 Ga0495657_0054749 3300046675 Bacteria 2664
628 Ga0495599_0034933 3300046678 Bacteria 3156
629 Ga0495599_0079049 3300046678 Bacteria 2054
630 Ga0495623_0005481 3300046679 Bacteria 8295
631 Ga0495623_0027249 3300046679 Bacteria 3675
632 Ga0495658_0053040 3300046683 Bacteria 2302
633 Ga0495669_0011319 3300046684 Bacteria 3787
634 Ga0495624_0042324 3300046690 Bacteria 2910
635 Ga0495604_0022619 3300047317 Bacteria 5019
636 Ga0495604_0037431 3300047317 Bacteria 3821
637 Ga0495636_0000406 3300047318 Bacteria 16124
638 Ga0495674_0037716 3300047319 Bacteria 4342
639 Ga0495674_0064218 3300047319 Bacteria 3192
640 Ga0495674_0184286 3300047319 Bacteria 1737
641 Ga0495672_0003359 3300047320 Bacteria 13780
642 Ga0495677_0016693 3300047445 Bacteria 2663
643 Ga0495685_034142 3300047447 Bacteria 1748
644 Ga0495684_0003665 3300047471 Bacteria 11972
645 Ga0495684_0024704 3300047471 Bacteria 4623
646 Ga0495684_0063353 3300047471 Bacteria 2811
647 Ga0495593_0007862 3300047673 Bacteria 6210
648 Ga0495602_0000224 3300048088 Bacteria 52889
649 Ga0495602_0048875 3300048088 Bacteria 3795
650 Ga0495614_0020467 3300048089 Bacteria 2861
651 Ga0496101_0007379 3300048904 Bacteria 7121
652 Ga0496102_0005869 3300048905 Bacteria 10453
653 Ga0496102_0047284 3300048905 Bacteria 3909
654 Ga0496102_0192801 3300048905 Bacteria 1920
655 Ga0496103_0004547 3300048906 Bacteria 8397
656 Ga0496103_0020642 3300048906 Bacteria 3958
657 Ga0496103_0090834 3300048906 Bacteria 1927
658 Ga0496104_0004986 3300048907 Bacteria 11589
659 Ga0496104_0053014 3300048907 Bacteria 3832
660 Ga0496104_0066908 3300048907 Bacteria 3412
661 Ga0496104_0068324 3300048907 Bacteria 3377
662 Ga0496104_0086402 3300048907 Bacteria 2994
663 Ga0496104_0130566 3300048907 Bacteria 2413
664 Ga0496104_0154594 3300048907 Bacteria 2202
665 Ga0496104_0234036 3300048907 Bacteria 1749
666 Ga0496105_0017162 3300048908 Bacteria 5798
667 Ga0496105_0116732 3300048908 Bacteria 2201
668 Ga0496106_0051023 3300048909 Bacteria 3119
669 Ga0496106_0086181 3300048909 Bacteria 2419
670 Ga0496106_0117371 3300048909 Bacteria 2077
671 Ga0496107_0175745 3300048910 Bacteria 1590
672 Ga0496108_0006000 3300048911 Bacteria 9839
673 Ga0496108_0017528 3300048911 Bacteria 5860
674 Ga0496108_0030209 3300048911 Bacteria 4491
675 Ga0496108_0064446 3300048911 Bacteria 3087
676 Ga0496108_0187089 3300048911 Bacteria 1794
677 Ga0496109_0036399 3300048912 Bacteria 4442
678 Ga0496109_0071646 3300048912 Bacteria 3182
679 Ga0496109_0189177 3300048912 Bacteria 1934
680 Ga0496109_0210804 3300048912 Bacteria 1827
681 Ga0496110_0025238 3300048913 Bacteria 5077
682 Ga0496110_0067830 3300048913 Bacteria 3157
683 Ga0496110_0080295 3300048913 Bacteria 2906
684 Ga0496111_0008000 3300048914 Bacteria 6973
685 Ga0496112_0140827 3300048915 Bacteria 2381
686 Ga0496112_0174969 3300048915 Unclassified 2111
687 Ga0496113_0036162 3300048916 Bacteria 3617
688 Ga0496113_0060786 3300048916 Bacteria 2849
689 Ga0496114_0015698 3300048917 Bacteria 6094
690 Ga0496114_0017198 3300048917 Bacteria 5832
691 Ga0496114_0101444 3300048917 Bacteria 2457
692 Ga0496115_0065835 3300048918 Bacteria 2927
693 Ga0496115_0180398 3300048918 Bacteria 1746
694 Ga0496126_0002019 3300048929 Bacteria 28695
695 Ga0501305_001597 3300049161 Bacteria 2258
696 Ga0501312_000200 3300049528 Bacteria 4089
697 Ga0501316_000560 3300049532 Bacteria 2645
698 Ga0501031_0004849 3300049568 Bacteria 8744
699 Ga0501031_0160870 3300049568 Bacteria 1468
700 Ga0501032_0009137 3300049569 Bacteria 7192
701 Ga0501033_0008182 3300049570 Bacteria 8099
702 Ga0501034_0006699 3300049571 Bacteria 12352
703 Ga0501034_0125183 3300049571 Bacteria 2555
704 Ga0501036_0007251 3300049572 Bacteria 9028
705 Ga0501037_0001533 3300049573 Bacteria 16839
706 Ga0501038_0023730 3300049574 Bacteria 5480
707 Ga0501039_0000786 3300049575 Bacteria 22808
708 Ga0501046_0003375 3300049580 Bacteria 14657
709 Ga0501047_0017702 3300049581 Bacteria 6825
710 Ga0501048_0009039 3300049582 Bacteria 7499
711 Ga0501067_0005842 3300049583 Bacteria 6825
712 Ga0501067_0034245 3300049583 Bacteria 2819
713 Ga0501068_0000590 3300049584 Bacteria 18437
714 Ga0501068_0025595 3300049584 Bacteria 3471
715 Ga0501069_0009057 3300049585 Bacteria 5254
716 Ga0501070_0073897 3300049586 Bacteria 2821
717 Ga0501072_0010906 3300049588 Bacteria 6932
718 Ga0501072_0120618 3300049588 Bacteria 2089
719 Ga0501073_0001480 3300049589 Bacteria 17400
720 Ga0501075_0010511 3300049591 Bacteria 6505
721 Ga0501075_0024904 3300049591 Bacteria 4393
722 Ga0501075_0104506 3300049591 Bacteria 2153
723 Ga0501076_0005325 3300049592 Bacteria 9235
724 Ga0501076_0006632 3300049592 Bacteria 8397
725 Ga0501076_0011377 3300049592 Bacteria 6624
726 Ga0501077_0041991 3300049593 Bacteria 2910
727 Ga0501079_0007454 3300049741 Bacteria 8274
728 Ga0501079_0028221 3300049741 Bacteria 4306
729 Ga0501079_0176754 3300049741 Bacteria 1665
730 Ga0501080_0000482 3300049742 Bacteria 30997
731 Ga0501080_0071677 3300049742 Bacteria 3223
732 Ga0501081_0020439 3300049743 Bacteria 4413
733 Ga0501081_0061225 3300049743 Bacteria 2609
734 Ga0501083_0026806 3300049744 Bacteria 3981
735 Ga0501044_0047477 3300049823 Bacteria 4440
736 nmdc:mga00v17_19433_c1 3300050491 Bacteria 3878
737 nmdc:mga0k408_2628_c1 3300050493 Bacteria 9547
738 nmdc:mga0k408_9107_c1 3300050493 Bacteria 5346
739 nmdc:mga0k408_91323_c1 3300050493 Bacteria 1789
740 nmdc:mga07m45_22076_c1 3300050496 Bacteria 3473
741 nmdc:mga05p37_105628_c1 3300050507 Bacteria 3464
742 nmdc:mga05p37_121253_c1 3300050507 Bacteria 3212
743 nmdc:mga05p37_175596_c1 3300050507 Bacteria 2610
744 nmdc:mga05p37_212581_c1 3300050507 Bacteria 2337
745 nmdc:mga05p37_2349_c1 3300050507 Bacteria 22009
746 nmdc:mga05p37_306690_c1 3300050507 Bacteria 1883
747 nmdc:mga05p37_47559_c1 3300050507 Bacteria 5275
748 nmdc:mga05p37_5343_c1 3300050507 Bacteria 15087
749 nmdc:mga09592_19340_c1 3300050508 Bacteria 5591
750 nmdc:mga09592_2431_c1 3300050508 Bacteria 15020
751 nmdc:mga09592_55768_c1 3300050508 Bacteria 3339
752 nmdc:mga09592_95968_c1 3300050508 Bacteria 2536
753 nmdc:mga08y16_101662_c1 3300050511 Bacteria 2993
754 nmdc:mga08y16_1680_c1 3300050511 Bacteria 19401
755 nmdc:mga08y16_522_c1 3300050511 Bacteria 35470
756 nmdc:mga08y16_5506_c1 3300050511 Bacteria 13244
757 nmdc:mga08y16_59693_c1 3300050511 Bacteria 3984
758 nmdc:mga0n895_105864_c1 3300050512 Bacteria 2826
759 nmdc:mga0n895_1794_c1 3300050512 Bacteria 16309
760 nmdc:mga0n895_22667_c1 3300050512 Bacteria 5889
761 nmdc:mga0n895_2718_c1 3300050512 Bacteria 13953
762 nmdc:mga0n895_41240_c1 3300050512 Bacteria 4486
763 nmdc:mga0n895_57853_c1 3300050512 Unclassified 3822
764 nmdc:mga0n895_80237_c1 3300050512 Bacteria 3251
765 nmdc:mga0rr50_136040_c1 3300050513 Bacteria 1972
766 nmdc:mga08x19_43853_c1 3300050514 Bacteria 2854
767 nmdc:mga08x19_65863_c1 3300050514 Bacteria 2354
768 nmdc:mga0a205_12899_c1 3300050515 Bacteria 7752
769 nmdc:mga0a205_147706_c1 3300050515 Bacteria 2251
770 Ga0495601_0001879 3300053077 Bacteria 11721
771 Ga0495601_0007359 3300053077 Bacteria 6456
772 Ga0495601_0059367 3300053077 Bacteria 2425
773 Ga0495612_0002105 3300053078 Bacteria 8176
774 Ga0500635_0002341 3300053080 Bacteria 4681
775 Ga0500566_0001395 3300053094 Bacteria 14131
776 Ga0500641_0010892 3300053096 Bacteria 3296
777 Ga0500568_0001372 3300053139 Bacteria 15819
778 Ga0500603_000517 3300053150 Bacteria 9791
779 Ga0500616_0047208 3300053153 Bacteria 2287
780 Ga0501084_0003880 3300054114 Bacteria 12170
781 Ga0501084_0054775 3300054114 Bacteria 3336
782 Ga0501084_0055812 3300054114 Bacteria 3305
783 Ga0590071_007783 3300059421 Bacteria 2533
784 Ga0590077_000129 3300059426 Bacteria 20394
785 Ga0501082_0009933 3300060353 Bacteria 8206
786 Ga0466962_0016740 3300061719 Bacteria 3534
787 Ga0530510_0004512 3300061734 Bacteria 9639
788 Ga0530510_0015379 3300061734 Bacteria 5407
789 Ga0530510_0072776 3300061734 Bacteria 2495

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_1040293 Ga0436360_1040293_8468_9664 396
2 3300048911 Ga0496108_0030209 Ga0496108_0030209_21_1280 405
3 3300037068 Ga0373925_0107244 Ga0373925_0107244_23_1255 409
4 3300048909 Ga0496106_0117371 Ga0496106_0117371_36_1322 410
5 3300035113 Ga0373936_0010113 Ga0373936_0010113_128_1390 413
6 3300046663 Ga0495635_0144151 Ga0495635_0144151_281_1603 415
7 3300046516 Ga0495628_0013834 Ga0495628_0013834_25_1380 419
8 3300006871 Ga0075434_100003880 Ga0075434_1000038806 427
9 3300007076 Ga0075435_100007984 Ga0075435_1000079844 427
10 3300031691 Ga0316579_10001211 Ga0316579_100012114 432
11 3300031733 Ga0316577_10024381 Ga0316577_100243812 432
12 3300032168 Ga0316593_10038238 Ga0316593_100382381 432
13 3300036712 Ga0316584_0019264 Ga0316584_0019264_775_2214 432
14 3300009094 Ga0111539_10000563 Ga0111539_1000056321 433
15 3300009147 Ga0114129_10177944 Ga0114129_101779443 433
16 3300013102 Ga0157371_10015522 Ga0157371_100155223 433
17 3300013297 Ga0157378_10001428 Ga0157378_1000142817 433
18 3300014969 Ga0157376_10001578 Ga0157376_1000157811 433
19 3300048908 Ga0496105_0116732 Ga0496105_0116732_16_1380 433
20 3300048909 Ga0496106_0051023 Ga0496106_0051023_1500_2864 433
21 3300048912 Ga0496109_0189177 Ga0496109_0189177_340_1704 433
22 3300048913 Ga0496110_0080295 Ga0496110_0080295_1586_2887 433
23 3300048917 Ga0496114_0015698 Ga0496114_0015698_474_1838 433
24 3300048918 Ga0496115_0180398 Ga0496115_0180398_283_1647 433
25 3300050511 nmdc:mga08y16_1680_c1 nmdc:mga08y16_1680_c1_14381_15745 433
26 3300050515 nmdc:mga0a205_147706_c1 nmdc:mga0a205_147706_c1_670_1998 433
27 3300042184 Ga0450908_009935 Ga0450908_009935_313_1695 440
28 3300049591 Ga0501075_0010511 Ga0501075_0010511_4317_5699 441
29 3300049592 Ga0501076_0006632 Ga0501076_0006632_5229_6611 441
30 3300049743 Ga0501081_0061225 Ga0501081_0061225_896_2278 441
31 3300054114 Ga0501084_0054775 Ga0501084_0054775_672_2054 441
32 3300061734 Ga0530510_0004512 Ga0530510_0004512_4637_6019 441
33 3300009094 Ga0111539_10073633 Ga0111539_100736333 443
34 3300006914 Ga0075436_100002992 Ga0075436_1000029928 445
35 3300035086 Ga0373934_0006571 Ga0373934_0006571_182_1654 445
36 3300035117 Ga0373953_0004534 Ga0373953_0004534_740_2212 445
37 3300035119 Ga0373956_0002137 Ga0373956_0002137_2483_3955 445
38 3300035172 Ga0373955_0002881 Ga0373955_0002881_1485_2957 445
39 3300035724 Ga0373933_0002012 Ga0373933_0002012_8917_10389 445
40 3300036401 Ga0373937_0026218 Ga0373937_0026218_553_2025 445
41 3300046454 Ga0495592_0057597 Ga0495592_0057597_1107_2579 445
42 3300046511 Ga0495608_0062993 Ga0495608_0062993_543_2015 445
43 3300046536 Ga0495587_0005236 Ga0495587_0005236_897_2369 445
44 3300046675 Ga0495657_0054749 Ga0495657_0054749_695_2167 445
45 3300047317 Ga0495604_0022619 Ga0495604_0022619_3531_5003 445
46 3300047471 Ga0495684_0024704 Ga0495684_0024704_2237_3709 445
47 3300048088 Ga0495602_0048875 Ga0495602_0048875_1219_2691 445
48 3300009094 Ga0111539_10001769 Ga0111539_1000176910 446
49 3300027907 Ga0207428_10003307 Ga0207428_100033079 446
50 3300047318 Ga0495636_0000406 Ga0495636_0000406_5584_6996 446
51 3300048911 Ga0496108_0064446 Ga0496108_0064446_1115_2494 446
52 3300050511 nmdc:mga08y16_5506_c1 nmdc:mga08y16_5506_c1_1400_2800 446
53 3300042876 Ga0451577_0093061 Ga0451577_0093061_1308_2681 447
54 3300049161 Ga0501305_001597 Ga0501305_001597_226_1686 448
55 3300061734 Ga0530510_0015379 Ga0530510_0015379_2770_4197 449
56 3300032002 Ga0307416_100198985 Ga0307416_1001989852 451
57 3300032005 Ga0307411_10088312 Ga0307411_100883122 451
58 3300042876 Ga0451577_0211197 Ga0451577_0211197_44_1450 451
59 3300025915 Ga0207693_10087387 Ga0207693_100873872 452
60 3300041512 Ga0451853_0598962 Ga0451853_0598962_270_1844 454
61 3300005437 Ga0070710_10055473 Ga0070710_100554731 455
62 3300005444 Ga0070694_100051176 Ga0070694_1000511762 455
63 3300005467 Ga0070706_100065172 Ga0070706_1000651723 455
64 3300005536 Ga0070697_100066843 Ga0070697_1000668432 455
65 3300005546 Ga0070696_100037141 Ga0070696_1000371413 455
66 3300025915 Ga0207693_10018122 Ga0207693_100181222 455
67 3300050514 nmdc:mga08x19_43853_c1 nmdc:mga08x19_43853_c1_43_1443 455
68 3300006852 Ga0075433_10081420 Ga0075433_100814203 457
69 3300006871 Ga0075434_100098674 Ga0075434_1000986742 457
70 3300006914 Ga0075436_100038731 Ga0075436_1000387312 457
71 3300006914 Ga0075436_100157798 Ga0075436_1001577981 457
72 3300042876 Ga0451577_0000102 Ga0451577_0000102_39076_40548 457
73 3300044712 Ga0453684_0000249 Ga0453684_0000249_191608_193080 457
74 3300050512 nmdc:mga0n895_22667_c1 nmdc:mga0n895_22667_c1_181_1581 457
75 3300050515 nmdc:mga0a205_12899_c1 nmdc:mga0a205_12899_c1_1135_2535 457
76 3300006844 Ga0075428_100004439 Ga0075428_10000443913 458
77 3300006880 Ga0075429_100016395 Ga0075429_1000163955 458
78 3300009093 Ga0105240_10203431 Ga0105240_102034311 458
79 3300005458 Ga0070681_10000281 Ga0070681_1000028118 459
80 3300025912 Ga0207707_10009521 Ga0207707_1000952111 459
81 3300035691 Ga0373931_0021193 Ga0373931_0021193_403_1806 459
82 3300049568 Ga0501031_0160870 Ga0501031_0160870_49_1455 459
83 3300049591 Ga0501075_0104506 Ga0501075_0104506_75_1481 459
84 3300054114 Ga0501084_0055812 Ga0501084_0055812_1250_2656 459
85 3300005456 Ga0070678_100054903 Ga0070678_1000549032 460
86 3300005548 Ga0070665_100046559 Ga0070665_1000465592 460
87 3300005617 Ga0068859_100117305 Ga0068859_1001173052 460
88 3300006931 Ga0097620_100117309 Ga0097620_1001173093 460
89 3300009147 Ga0114129_10084789 Ga0114129_100847892 460
90 3300026121 Ga0207683_10176671 Ga0207683_101766711 460
91 3300028379 Ga0268266_10114429 Ga0268266_101144292 460
92 3300044712 Ga0453684_0180712 Ga0453684_0180712_180_1646 460
93 3300005290 Ga0065712_10085300 Ga0065712_100853002 461
94 3300005293 Ga0065715_10089407 Ga0065715_100894077 461
95 3300005338 Ga0068868_100059186 Ga0068868_1000591862 461
96 3300005367 Ga0070667_100222436 Ga0070667_1002224362 461
97 3300005457 Ga0070662_100039019 Ga0070662_1000390194 461
98 3300005539 Ga0068853_100289774 Ga0068853_1002897741 461
99 3300005543 Ga0070672_100004226 Ga0070672_1000042266 461
100 3300005548 Ga0070665_100191137 Ga0070665_1001911372 461
101 3300005563 Ga0068855_100036443 Ga0068855_1000364432 461
102 3300005616 Ga0068852_100078159 Ga0068852_1000781592 461
103 3300005618 Ga0068864_100002540 Ga0068864_1000025402 461
104 3300005719 Ga0068861_100037692 Ga0068861_1000376923 461
105 3300005844 Ga0068862_100147953 Ga0068862_1001479532 461
106 3300006237 Ga0097621_100123215 Ga0097621_1001232152 461
107 3300006358 Ga0068871_100057802 Ga0068871_1000578023 461
108 3300006844 Ga0075428_100017990 Ga0075428_1000179904 461
109 3300006880 Ga0075429_100178283 Ga0075429_1001782832 461
110 3300009148 Ga0105243_10028025 Ga0105243_100280251 461
111 3300009176 Ga0105242_10036893 Ga0105242_100368932 461
112 3300009176 Ga0105242_10058176 Ga0105242_100581763 461
113 3300009177 Ga0105248_10029958 Ga0105248_100299584 461
114 3300009177 Ga0105248_10032810 Ga0105248_100328102 461
115 3300009553 Ga0105249_10135072 Ga0105249_101350722 461
116 3300010375 Ga0105239_10207070 Ga0105239_102070701 461
117 3300013306 Ga0163162_10234479 Ga0163162_102344791 461
118 3300014325 Ga0163163_10172581 Ga0163163_101725812 461
119 3300025903 Ga0207680_10083104 Ga0207680_100831042 461
120 3300025907 Ga0207645_10062694 Ga0207645_100626941 461
121 3300025933 Ga0207706_10048241 Ga0207706_100482412 461
122 3300025934 Ga0207686_10045431 Ga0207686_100454312 461
123 3300025938 Ga0207704_10054000 Ga0207704_100540002 461
124 3300025940 Ga0207691_10014961 Ga0207691_100149612 461
125 3300025981 Ga0207640_10122549 Ga0207640_101225491 461
126 3300026095 Ga0207676_10020204 Ga0207676_100202045 461
127 3300028379 Ga0268266_10155923 Ga0268266_101559232 461
128 3300032126 Ga0307415_100006569 Ga0307415_1000065692 461
129 3300035170 Ga0373943_0069875 Ga0373943_0069875_66_1457 461
130 3300035695 Ga0373927_0051072 Ga0373927_0051072_638_2029 461
131 3300035725 Ga0373947_0041277 Ga0373947_0041277_646_2037 461
132 3300036401 Ga0373937_0047014 Ga0373937_0047014_2312_3703 461
133 3300042133 Ga0450896_000020 Ga0450896_000020_885_2330 461
134 3300046472 Ga0495580_0131040 Ga0495580_0131040_157_1548 461
135 3300046683 Ga0495658_0053040 Ga0495658_0053040_190_1635 461
136 3300047319 Ga0495674_0184286 Ga0495674_0184286_282_1673 461
137 3300047471 Ga0495684_0063353 Ga0495684_0063353_46_1491 461
138 3300048905 Ga0496102_0192801 Ga0496102_0192801_62_1507 461
139 3300048906 Ga0496103_0090834 Ga0496103_0090834_389_1834 461
140 3300048907 Ga0496104_0004986 Ga0496104_0004986_4598_6043 461
141 3300048907 Ga0496104_0086402 Ga0496104_0086402_933_2378 461
142 3300048910 Ga0496107_0175745 Ga0496107_0175745_34_1479 461
143 3300048912 Ga0496109_0071646 Ga0496109_0071646_1342_2787 461
144 3300048916 Ga0496113_0060786 Ga0496113_0060786_1146_2591 461
145 3300048917 Ga0496114_0017198 Ga0496114_0017198_594_2039 461
146 3300048917 Ga0496114_0101444 Ga0496114_0101444_557_2002 461
147 3300053077 Ga0495601_0059367 Ga0495601_0059367_637_2082 461
148 3300005436 Ga0070713_100028284 Ga0070713_1000282843 462
149 3300009147 Ga0114129_10007052 Ga0114129_1000705213 462
150 3300025928 Ga0207700_10014118 Ga0207700_100141184 462
151 3300031731 Ga0307405_10018167 Ga0307405_100181672 462
152 3300031911 Ga0307412_10058418 Ga0307412_100584182 462
153 3300032002 Ga0307416_100008926 Ga0307416_1000089262 462
154 3300050508 nmdc:mga09592_19340_c1 nmdc:mga09592_19340_c1_726_2156 462
155 3300050511 nmdc:mga08y16_101662_c1 nmdc:mga08y16_101662_c1_54_1499 462
156 3300014326 Ga0157380_10028769 Ga0157380_100287693 463
157 3300046539 Ga0495621_0006236 Ga0495621_0006236_925_2358 463
158 3300047445 Ga0495677_0016693 Ga0495677_0016693_193_1623 463
159 3300049571 Ga0501034_0006699 Ga0501034_0006699_1077_2585 463
160 iso_pu_bacteria 2554235469 2556064712 463
161 3300031548 Ga0307408_100008217 Ga0307408_1000082173 464
162 3300031731 Ga0307405_10010309 Ga0307405_100103093 464
163 3300031852 Ga0307410_10015761 Ga0307410_100157613 464
164 3300032002 Ga0307416_100014111 Ga0307416_1000141113 464
165 3300032005 Ga0307411_10029795 Ga0307411_100297952 464
166 3300032126 Ga0307415_100021232 Ga0307415_1000212323 464
167 3300037471 Ga0395905_0040991 Ga0395905_0040991_609_2048 464
168 3300050508 nmdc:mga09592_95968_c1 nmdc:mga09592_95968_c1_852_2381 464
169 3300059421 Ga0590071_007783 Ga0590071_007783_691_2127 464
170 3300059426 Ga0590077_000129 Ga0590077_000129_13077_14513 464
171 3300005546 Ga0070696_100043420 Ga0070696_1000434202 465
172 3300006844 Ga0075428_100024526 Ga0075428_1000245264 465
173 3300009094 Ga0111539_10133207 Ga0111539_101332073 465
174 3300013297 Ga0157378_10193359 Ga0157378_101933592 465
175 iso_pu_bacteria 2738543010 2739234575 465
176 iso_pu_bacteria 3006826541 3006831424 465
177 iso_pu_bacteria 3006973921 3006975425 465
178 3300009093 Ga0105240_10045158 Ga0105240_100451584 466
179 3300009094 Ga0111539_10004174 Ga0111539_100041743 466
180 3300009551 Ga0105238_10047858 Ga0105238_100478584 466
181 3300027907 Ga0207428_10002086 Ga0207428_100020863 466
182 3300031731 Ga0307405_10007998 Ga0307405_100079985 466
183 3300031903 Ga0307407_10006608 Ga0307407_100066085 466
184 3300032002 Ga0307416_100001676 Ga0307416_1000016765 466
185 3300032005 Ga0307411_10003321 Ga0307411_100033216 466
186 3300032126 Ga0307415_100016964 Ga0307415_1000169643 466
187 3300036401 Ga0373937_0040267 Ga0373937_0040267_1503_2939 466
188 3300046491 Ga0495584_0048033 Ga0495584_0048033_25_1467 466
189 3300046538 Ga0495609_0045151 Ga0495609_0045151_411_1853 466
190 3300048912 Ga0496109_0210804 Ga0496109_0210804_48_1487 466
191 3300049568 Ga0501031_0004849 Ga0501031_0004849_5379_6785 466
192 3300049569 Ga0501032_0009137 Ga0501032_0009137_2200_3606 466
193 3300049570 Ga0501033_0008182 Ga0501033_0008182_4687_6093 466
194 3300049571 Ga0501034_0125183 Ga0501034_0125183_310_1716 466
195 3300049572 Ga0501036_0007251 Ga0501036_0007251_3820_5226 466
196 3300049573 Ga0501037_0001533 Ga0501037_0001533_13106_14512 466
197 3300049574 Ga0501038_0023730 Ga0501038_0023730_1988_3394 466
198 3300049575 Ga0501039_0000786 Ga0501039_0000786_3612_5018 466
199 3300049580 Ga0501046_0003375 Ga0501046_0003375_12512_13918 466
200 3300049581 Ga0501047_0017702 Ga0501047_0017702_4716_6122 466
201 3300049582 Ga0501048_0009039 Ga0501048_0009039_5111_6517 466
202 3300049583 Ga0501067_0005842 Ga0501067_0005842_4844_6250 466
203 3300049584 Ga0501068_0000590 Ga0501068_0000590_8362_9768 466
204 3300049585 Ga0501069_0009057 Ga0501069_0009057_2969_4375 466
205 3300049586 Ga0501070_0073897 Ga0501070_0073897_576_1982 466
206 3300049588 Ga0501072_0010906 Ga0501072_0010906_4687_6093 466
207 3300049589 Ga0501073_0001480 Ga0501073_0001480_7458_8864 466
208 3300049592 Ga0501076_0005325 Ga0501076_0005325_5596_7002 466
209 3300049741 Ga0501079_0007454 Ga0501079_0007454_4559_5965 466
210 3300049742 Ga0501080_0000482 Ga0501080_0000482_13992_15398 466
211 3300049744 Ga0501083_0026806 Ga0501083_0026806_840_2246 466
212 3300049823 Ga0501044_0047477 Ga0501044_0047477_840_2246 466
213 3300053096 Ga0500641_0010892 Ga0500641_0010892_1622_3088 466
214 3300054114 Ga0501084_0003880 Ga0501084_0003880_8810_10216 466
215 3300060353 Ga0501082_0009933 Ga0501082_0009933_3455_4861 466
216 iso_pu_bacteria 2643221543 2643735637 466
217 iso_pu_bacteria 2816332295 2817481336 466
218 iso_pu_bacteria 3006858327 3006861760 466
219 3300003751 Ga0055538_1000080 Ga0055538_100008060 467
220 3300005330 Ga0070690_100016718 Ga0070690_1000167182 467
221 3300005468 Ga0070707_100051602 Ga0070707_1000516022 467
222 3300005518 Ga0070699_100148638 Ga0070699_1001486381 467
223 3300005535 Ga0070684_100044443 Ga0070684_1000444435 467
224 3300009093 Ga0105240_10006066 Ga0105240_100060662 467
225 3300009094 Ga0111539_10074542 Ga0111539_100745423 467
226 3300009174 Ga0105241_10237417 Ga0105241_102374171 467
227 3300009545 Ga0105237_10001318 Ga0105237_1000131811 467
228 3300009545 Ga0105237_10034493 Ga0105237_100344932 467
229 3300025224 Ga0209784_100077 Ga0209784_10007774 467
230 3300025913 Ga0207695_10036329 Ga0207695_100363293 467
231 3300025922 Ga0207646_10074212 Ga0207646_100742123 467
232 3300031852 Ga0307410_10011774 Ga0307410_100117744 467
233 3300031903 Ga0307407_10011965 Ga0307407_100119654 467
234 3300031995 Ga0307409_100030573 Ga0307409_1000305734 467
235 3300032002 Ga0307416_100011349 Ga0307416_1000113492 467
236 3300035398 Ga0316574_0010097 Ga0316574_0010097_3712_5196 467
237 3300037853 Ga0436364_0398603 Ga0436364_0398603_1652_3118 467
238 3300037853 Ga0436364_1070510 Ga0436364_1070510_4338_5744 467
239 3300042876 Ga0451577_0000158 Ga0451577_0000158_62187_63665 467
240 3300044712 Ga0453684_0000089 Ga0453684_0000089_213433_214911 467
241 3300045051 Ga0451576_0053960 Ga0451576_0053960_2387_3835 467
242 3300048906 Ga0496103_0020642 Ga0496103_0020642_2368_3855 467
243 3300050511 nmdc:mga08y16_59693_c1 nmdc:mga08y16_59693_c1_766_2343 467
244 3300050512 nmdc:mga0n895_41240_c1 nmdc:mga0n895_41240_c1_273_1721 467
245 iso_pu_bacteria 2885526491 2885531603 467
246 iso_pu_bacteria 2904162308 2904163863 467
247 3300005545 Ga0070695_100087338 Ga0070695_1000873381 468
248 3300048913 Ga0496110_0067830 Ga0496110_0067830_44_1492 468
249 3300050507 nmdc:mga05p37_306690_c1 nmdc:mga05p37_306690_c1_14_1429 468
250 3300005290 Ga0065712_10001774 Ga0065712_100017742 469
251 3300005327 Ga0070658_10131017 Ga0070658_101310172 469
252 3300005328 Ga0070676_10080166 Ga0070676_100801662 469
253 3300005329 Ga0070683_100009361 Ga0070683_1000093614 469
254 3300005331 Ga0070670_100001920 Ga0070670_1000019205 469
255 3300005331 Ga0070670_100038930 Ga0070670_1000389303 469
256 3300005335 Ga0070666_10017961 Ga0070666_100179612 469
257 3300005338 Ga0068868_100005467 Ga0068868_1000054674 469
258 3300005344 Ga0070661_100000349 Ga0070661_1000003499 469
259 3300005354 Ga0070675_100006104 Ga0070675_1000061042 469
260 3300005355 Ga0070671_100000218 Ga0070671_1000002184 469
261 3300005356 Ga0070674_100073466 Ga0070674_1000734662 469
262 3300005364 Ga0070673_100001419 Ga0070673_1000014194 469
263 3300005367 Ga0070667_100026465 Ga0070667_1000264652 469
264 3300005456 Ga0070678_100000972 Ga0070678_1000009726 469
265 3300005457 Ga0070662_100077476 Ga0070662_1000774761 469
266 3300005459 Ga0068867_100025146 Ga0068867_1000251462 469
267 3300005518 Ga0070699_100000386 Ga0070699_10000038612 469
268 3300005535 Ga0070684_100070000 Ga0070684_1000700002 469
269 3300005543 Ga0070672_100002533 Ga0070672_1000025334 469
270 3300005564 Ga0070664_100002592 Ga0070664_1000025924 469
271 3300005578 Ga0068854_100010834 Ga0068854_1000108342 469
272 3300005616 Ga0068852_100000256 Ga0068852_10000025626 469
273 3300005834 Ga0068851_10024963 Ga0068851_100249632 469
274 3300009177 Ga0105248_10030894 Ga0105248_100308943 469
275 3300013297 Ga0157378_10003159 Ga0157378_1000315911 469
276 3300013306 Ga0163162_10011524 Ga0163162_100115245 469
277 3300013308 Ga0157375_10003261 Ga0157375_100032612 469
278 3300014969 Ga0157376_10030349 Ga0157376_100303494 469
279 3300025903 Ga0207680_10013655 Ga0207680_100136554 469
280 3300025907 Ga0207645_10095284 Ga0207645_100952842 469
281 3300025925 Ga0207650_10001433 Ga0207650_1000143311 469
282 3300025931 Ga0207644_10002517 Ga0207644_1000251710 469
283 3300025933 Ga0207706_10130753 Ga0207706_101307532 469
284 3300025940 Ga0207691_10006497 Ga0207691_100064978 469
285 3300025944 Ga0207661_10004972 Ga0207661_100049723 469
286 3300025981 Ga0207640_10007488 Ga0207640_100074883 469
287 3300026067 Ga0207678_10134065 Ga0207678_101340651 469
288 3300026121 Ga0207683_10000573 Ga0207683_100005733 469
289 3300026142 Ga0207698_10001341 Ga0207698_100013411 469
290 3300044712 Ga0453684_0062536 Ga0453684_0062536_168_1610 469
291 3300044712 Ga0453684_0286335 Ga0453684_0286335_323_1765 469
292 3300048907 Ga0496104_0068324 Ga0496104_0068324_1367_2833 469
293 3300048907 Ga0496104_0130566 Ga0496104_0130566_563_2011 469
294 3300048911 Ga0496108_0006000 Ga0496108_0006000_1908_3374 469
295 3300049528 Ga0501312_000200 Ga0501312_000200_414_1898 469
296 3300049532 Ga0501316_000560 Ga0501316_000560_726_2210 469
297 3300053153 Ga0500616_0047208 Ga0500616_0047208_121_1578 469
298 3300005295 Ga0065707_10100972 Ga0065707_101009723 470
299 3300005345 Ga0070692_10018091 Ga0070692_100180912 470
300 3300005353 Ga0070669_100003108 Ga0070669_1000031087 470
301 3300005354 Ga0070675_100019910 Ga0070675_1000199103 470
302 3300005364 Ga0070673_100083665 Ga0070673_1000836652 470
303 3300005365 Ga0070688_100049225 Ga0070688_1000492252 470
304 3300005440 Ga0070705_100000756 Ga0070705_1000007563 470
305 3300005440 Ga0070705_100014673 Ga0070705_1000146733 470
306 3300005441 Ga0070700_100004623 Ga0070700_1000046236 470
307 3300005444 Ga0070694_100007401 Ga0070694_1000074014 470
308 3300005444 Ga0070694_100019076 Ga0070694_1000190762 470
309 3300005457 Ga0070662_100012018 Ga0070662_1000120182 470
310 3300005459 Ga0068867_100007526 Ga0068867_1000075263 470
311 3300005471 Ga0070698_100015249 Ga0070698_1000152498 470
312 3300005471 Ga0070698_100025140 Ga0070698_1000251406 470
313 3300005518 Ga0070699_100011772 Ga0070699_1000117726 470
314 3300005543 Ga0070672_100030643 Ga0070672_1000306432 470
315 3300005544 Ga0070686_100033883 Ga0070686_1000338833 470
316 3300005545 Ga0070695_100000247 Ga0070695_10000024722 470
317 3300005546 Ga0070696_100001143 Ga0070696_1000011439 470
318 3300005546 Ga0070696_100026985 Ga0070696_1000269854 470
319 3300005549 Ga0070704_100003993 Ga0070704_1000039939 470
320 3300005549 Ga0070704_100006063 Ga0070704_1000060632 470
321 3300005549 Ga0070704_100037916 Ga0070704_1000379162 470
322 3300005577 Ga0068857_100012663 Ga0068857_1000126633 470
323 3300005578 Ga0068854_100031544 Ga0068854_1000315442 470
324 3300005617 Ga0068859_100002081 Ga0068859_10000208117 470
325 3300005618 Ga0068864_100005475 Ga0068864_1000054757 470
326 3300005719 Ga0068861_100001989 Ga0068861_1000019898 470
327 3300005840 Ga0068870_10003674 Ga0068870_100036744 470
328 3300005844 Ga0068862_100001000 Ga0068862_10000100011 470
329 3300006028 Ga0070717_10015938 Ga0070717_100159385 470
330 3300006028 Ga0070717_10228724 Ga0070717_102287241 470
331 3300006871 Ga0075434_100011335 Ga0075434_1000113353 470
332 3300006931 Ga0097620_100002081 Ga0097620_1000020817 470
333 3300009094 Ga0111539_10017744 Ga0111539_100177443 470
334 3300009148 Ga0105243_10007773 Ga0105243_100077734 470
335 3300009148 Ga0105243_10051889 Ga0105243_100518891 470
336 3300009176 Ga0105242_10093509 Ga0105242_100935091 470
337 3300009553 Ga0105249_10006074 Ga0105249_100060745 470
338 3300025908 Ga0207643_10009824 Ga0207643_100098243 470
339 3300025913 Ga0207695_10093936 Ga0207695_100939363 470
340 3300025918 Ga0207662_10013731 Ga0207662_100137313 470
341 3300025923 Ga0207681_10005692 Ga0207681_100056922 470
342 3300025924 Ga0207694_10013768 Ga0207694_100137684 470
343 3300025926 Ga0207659_10003019 Ga0207659_100030192 470
344 3300025934 Ga0207686_10028325 Ga0207686_100283252 470
345 3300025935 Ga0207709_10033163 Ga0207709_100331632 470
346 3300025936 Ga0207670_10003124 Ga0207670_100031244 470
347 3300025936 Ga0207670_10100693 Ga0207670_101006932 470
348 3300025940 Ga0207691_10025047 Ga0207691_100250475 470
349 3300025960 Ga0207651_10039398 Ga0207651_100393983 470
350 3300026023 Ga0207677_10086348 Ga0207677_100863482 470
351 3300026075 Ga0207708_10012471 Ga0207708_100124713 470
352 3300026089 Ga0207648_10001255 Ga0207648_1000125512 470
353 3300026095 Ga0207676_10008322 Ga0207676_100083222 470
354 3300026116 Ga0207674_10038394 Ga0207674_100383943 470
355 3300026118 Ga0207675_100006796 Ga0207675_1000067968 470
356 3300027907 Ga0207428_10000442 Ga0207428_1000044228 470
357 3300028380 Ga0268265_10000237 Ga0268265_1000023719 470
358 3300031090 Ga0265760_10002408 Ga0265760_100024082 470
359 3300031730 Ga0307516_10019164 Ga0307516_100191642 470
360 3300039437 Ga0436365_1778402 Ga0436365_1778402_568_1986 470
361 3300042876 Ga0451577_0132810 Ga0451577_0132810_43_1467 470
362 3300046615 Ga0495656_0025467 Ga0495656_0025467_374_1828 470
363 3300047447 Ga0495685_034142 Ga0495685_034142_43_1497 470
364 3300050507 nmdc:mga05p37_175596_c1 nmdc:mga05p37_175596_c1_1092_2513 470
365 3300050511 nmdc:mga08y16_522_c1 nmdc:mga08y16_522_c1_21096_22565 470
366 3300050512 nmdc:mga0n895_80237_c1 nmdc:mga0n895_80237_c1_950_2404 470
367 3300053080 Ga0500635_0002341 Ga0500635_0002341_1670_3115 470
368 3300053094 Ga0500566_0001395 Ga0500566_0001395_3907_5352 470
369 3300053150 Ga0500603_000517 Ga0500603_000517_6809_8254 470
370 3300005340 Ga0070689_100015247 Ga0070689_1000152472 471
371 3300005364 Ga0070673_100006113 Ga0070673_1000061133 471
372 3300005438 Ga0070701_10027557 Ga0070701_100275572 471
373 3300005440 Ga0070705_100056792 Ga0070705_1000567923 471
374 3300005458 Ga0070681_10075385 Ga0070681_100753851 471
375 3300005518 Ga0070699_100006186 Ga0070699_1000061866 471
376 3300005615 Ga0070702_100035525 Ga0070702_1000355252 471
377 3300005843 Ga0068860_100001188 Ga0068860_10000118820 471
378 3300006844 Ga0075428_100007047 Ga0075428_1000070475 471
379 3300007788 Ga0099795_10000013 Ga0099795_1000001373 471
380 3300009094 Ga0111539_10286417 Ga0111539_102864172 471
381 3300009147 Ga0114129_10041164 Ga0114129_100411644 471
382 3300010159 Ga0099796_10003190 Ga0099796_100031902 471
383 3300025233 Ga0209437_100324 Ga0209437_10032450 471
384 3300025912 Ga0207707_10048103 Ga0207707_100481033 471
385 3300025922 Ga0207646_10119393 Ga0207646_101193933 471
386 3300027512 Ga0209179_1000086 Ga0209179_10000863 471
387 3300028381 Ga0268264_10001084 Ga0268264_1000108422 471
388 3300031507 Ga0307509_10000488 Ga0307509_100004885 471
389 3300032005 Ga0307411_10064631 Ga0307411_100646311 471
390 3300041505 Ga0451849_1129382 Ga0451849_1129382_342_1802 471
391 3300045051 Ga0451576_0076045 Ga0451576_0076045_1056_2516 471
392 3300046559 Ga0495667_0022547 Ga0495667_0022547_1473_3008 471
393 3300046675 Ga0495657_0005190 Ga0495657_0005190_327_1862 471
394 3300047471 Ga0495684_0003665 Ga0495684_0003665_5884_7419 471
395 3300049584 Ga0501068_0025595 Ga0501068_0025595_1228_2688 471
396 3300050507 nmdc:mga05p37_47559_c1 nmdc:mga05p37_47559_c1_3462_4901 471
397 3300005331 Ga0070670_100007560 Ga0070670_1000075602 472
398 3300005331 Ga0070670_100019868 Ga0070670_1000198684 472
399 3300005338 Ga0068868_100007890 Ga0068868_1000078904 472
400 3300005338 Ga0068868_100073162 Ga0068868_1000731623 472
401 3300005343 Ga0070687_100029783 Ga0070687_1000297832 472
402 3300005344 Ga0070661_100060577 Ga0070661_1000605773 472
403 3300005354 Ga0070675_100000181 Ga0070675_10000018134 472
404 3300005365 Ga0070688_100025395 Ga0070688_1000253953 472
405 3300005441 Ga0070700_100079966 Ga0070700_1000799662 472
406 3300005456 Ga0070678_100011558 Ga0070678_1000115582 472
407 3300005530 Ga0070679_100223135 Ga0070679_1002231352 472
408 3300005549 Ga0070704_100028365 Ga0070704_1000283652 472
409 3300005577 Ga0068857_100060235 Ga0068857_1000602353 472
410 3300005617 Ga0068859_100015676 Ga0068859_1000156764 472
411 3300005841 Ga0068863_100019006 Ga0068863_1000190063 472
412 3300005842 Ga0068858_100008296 Ga0068858_1000082968 472
413 3300006844 Ga0075428_100018233 Ga0075428_1000182337 472
414 3300006852 Ga0075433_10015146 Ga0075433_100151463 472
415 3300006931 Ga0097620_100015676 Ga0097620_1000156766 472
416 3300009147 Ga0114129_10003827 Ga0114129_100038276 472
417 3300009147 Ga0114129_10235483 Ga0114129_102354832 472
418 3300013296 Ga0157374_10106790 Ga0157374_101067903 472
419 3300014969 Ga0157376_10148196 Ga0157376_101481963 472
420 3300025315 Ga0207697_10003472 Ga0207697_100034725 472
421 3300025901 Ga0207688_10046191 Ga0207688_100461912 472
422 3300025925 Ga0207650_10006792 Ga0207650_100067926 472
423 3300025926 Ga0207659_10000547 Ga0207659_100005477 472
424 3300025933 Ga0207706_10078262 Ga0207706_100782623 472
425 3300025936 Ga0207670_10008107 Ga0207670_100081074 472
426 3300026035 Ga0207703_10029451 Ga0207703_100294513 472
427 3300026116 Ga0207674_10075303 Ga0207674_100753032 472
428 3300026121 Ga0207683_10025245 Ga0207683_100252454 472
429 3300028381 Ga0268264_10018583 Ga0268264_100185833 472
430 3300028577 Ga0265318_10000389 Ga0265318_1000038924 472
431 3300031235 Ga0265330_10004502 Ga0265330_100045023 472
432 3300031238 Ga0265332_10001310 Ga0265332_100013102 472
433 3300031239 Ga0265328_10013091 Ga0265328_100130912 472
434 3300031241 Ga0265325_10011487 Ga0265325_100114874 472
435 3300031595 Ga0265313_10036627 Ga0265313_100366273 472
436 3300031711 Ga0265314_10002399 Ga0265314_100023997 472
437 3300031712 Ga0265342_10003673 Ga0265342_100036739 472
438 3300035695 Ga0373927_0005509 Ga0373927_0005509_3612_5081 472
439 3300037068 Ga0373925_0012759 Ga0373925_0012759_3636_5105 472
440 3300042876 Ga0451577_0082264 Ga0451577_0082264_1111_2577 472
441 3300044712 Ga0453684_0112915 Ga0453684_0112915_1468_2952 472
442 3300045051 Ga0451576_0033144 Ga0451576_0033144_15_1499 472
443 3300046455 Ga0495603_0114710 Ga0495603_0114710_35_1519 472
444 3300046499 Ga0495594_0002079 Ga0495594_0002079_5688_7172 472
445 3300046558 Ga0495633_0045297 Ga0495633_0045297_144_1628 472
446 3300046674 Ga0495588_0004739 Ga0495588_0004739_1261_2745 472
447 3300046684 Ga0495669_0011319 Ga0495669_0011319_2181_3656 472
448 3300048905 Ga0496102_0047284 Ga0496102_0047284_2233_3747 472
449 3300048907 Ga0496104_0066908 Ga0496104_0066908_65_1576 472
450 3300048908 Ga0496105_0017162 Ga0496105_0017162_3748_5259 472
451 3300048909 Ga0496106_0086181 Ga0496106_0086181_55_1569 472
452 3300048911 Ga0496108_0187089 Ga0496108_0187089_156_1670 472
453 3300048915 Ga0496112_0140827 Ga0496112_0140827_453_1967 472
454 3300048916 Ga0496113_0036162 Ga0496113_0036162_390_1904 472
455 3300049583 Ga0501067_0034245 Ga0501067_0034245_1178_2737 472
456 3300050507 nmdc:mga05p37_105628_c1 nmdc:mga05p37_105628_c1_271_1743 472
457 3300050507 nmdc:mga05p37_212581_c1 nmdc:mga05p37_212581_c1_843_2318 472
458 3300050507 nmdc:mga05p37_2349_c1 nmdc:mga05p37_2349_c1_10221_11726 472
459 3300050508 nmdc:mga09592_55768_c1 nmdc:mga09592_55768_c1_28_1533 472
460 3300050512 nmdc:mga0n895_105864_c1 nmdc:mga0n895_105864_c1_1201_2673 472
461 3300050512 nmdc:mga0n895_2718_c1 nmdc:mga0n895_2718_c1_4705_6213 472
462 3300050513 nmdc:mga0rr50_136040_c1 nmdc:mga0rr50_136040_c1_198_1691 472
463 3300053139 Ga0500568_0001372 Ga0500568_0001372_9121_11895 472
464 3300005549 Ga0070704_100005018 Ga0070704_1000050184 473
465 3300006844 Ga0075428_100011674 Ga0075428_1000116747 473
466 3300009094 Ga0111539_10041043 Ga0111539_100410435 473
467 3300009147 Ga0114129_10084404 Ga0114129_100844042 473
468 3300013306 Ga0163162_10195582 Ga0163162_101955822 473
469 3300013308 Ga0157375_10008985 Ga0157375_1000898510 473
470 3300025960 Ga0207651_10000346 Ga0207651_1000034611 473
471 3300048907 Ga0496104_0154594 Ga0496104_0154594_624_2108 473
472 3300048913 Ga0496110_0025238 Ga0496110_0025238_69_1553 473
473 3300050507 nmdc:mga05p37_121253_c1 nmdc:mga05p37_121253_c1_1363_2811 473
474 3300005617 Ga0068859_100115711 Ga0068859_1001157113 474
475 3300006931 Ga0097620_100115710 Ga0097620_1001157103 474
476 3300050491 nmdc:mga00v17_19433_c1 nmdc:mga00v17_19433_c1_1652_3844 474
477 3300050493 nmdc:mga0k408_2628_c1 nmdc:mga0k408_2628_c1_21_1760 474
478 3300050493 nmdc:mga0k408_9107_c1 nmdc:mga0k408_9107_c1_188_1789 474
479 3300050493 nmdc:mga0k408_91323_c1 nmdc:mga0k408_91323_c1_64_1773 474
480 3300050496 nmdc:mga07m45_22076_c1 nmdc:mga07m45_22076_c1_427_2028 474
481 3300035695 Ga0373927_0022499 Ga0373927_0022499_1769_3241 475
482 3300037471 Ga0395905_0039280 Ga0395905_0039280_1757_3217 475
483 3300005563 Ga0068855_100097073 Ga0068855_1000970732 476
484 3300009147 Ga0114129_10001102 Ga0114129_1000110212 476
485 3300025913 Ga0207695_10004005 Ga0207695_100040052 476
486 3300025949 Ga0207667_10064160 Ga0207667_100641601 476
487 3300050507 nmdc:mga05p37_5343_c1 nmdc:mga05p37_5343_c1_1314_2825 476
488 3300005468 Ga0070707_100070380 Ga0070707_1000703802 477
489 3300005545 Ga0070695_100054983 Ga0070695_1000549832 477
490 3300006871 Ga0075434_100065887 Ga0075434_1000658871 477
491 3300007076 Ga0075435_100012719 Ga0075435_1000127192 477
492 3300009147 Ga0114129_10283104 Ga0114129_102831042 477
493 3300028556 Ga0265337_1000441 Ga0265337_10004414 477
494 3300028558 Ga0265326_10002006 Ga0265326_100020063 477
495 3300028563 Ga0265319_1004110 Ga0265319_10041103 477
496 3300028563 Ga0265319_1005369 Ga0265319_10053692 477
497 3300028563 Ga0265319_1030511 Ga0265319_10305111 477
498 3300028573 Ga0265334_10007200 Ga0265334_100072002 477
499 3300028577 Ga0265318_10007501 Ga0265318_100075013 477
500 3300028653 Ga0265323_10000508 Ga0265323_1000050811 477
501 3300028654 Ga0265322_10001506 Ga0265322_100015063 477
502 3300028666 Ga0265336_10001214 Ga0265336_100012142 477
503 3300028800 Ga0265338_10000257 Ga0265338_1000025752 477
504 3300028800 Ga0265338_10003601 Ga0265338_100036018 477
505 3300028800 Ga0265338_10008539 Ga0265338_100085392 477
506 3300028800 Ga0265338_10023649 Ga0265338_100236494 477
507 3300029957 Ga0265324_10002503 Ga0265324_100025032 477
508 3300029957 Ga0265324_10016792 Ga0265324_100167922 477
509 3300031235 Ga0265330_10001184 Ga0265330_100011845 477
510 3300031235 Ga0265330_10049061 Ga0265330_100490611 477
511 3300031238 Ga0265332_10000361 Ga0265332_1000036118 477
512 3300031239 Ga0265328_10013000 Ga0265328_100130002 477
513 3300031240 Ga0265320_10000444 Ga0265320_1000044415 477
514 3300031241 Ga0265325_10003182 Ga0265325_100031824 477
515 3300031241 Ga0265325_10014433 Ga0265325_100144334 477
516 3300031242 Ga0265329_10000898 Ga0265329_1000089811 477
517 3300031247 Ga0265340_10015605 Ga0265340_100156053 477
518 3300031247 Ga0265340_10034337 Ga0265340_100343372 477
519 3300031249 Ga0265339_10000245 Ga0265339_1000024521 477
520 3300031250 Ga0265331_10001532 Ga0265331_100015324 477
521 3300031344 Ga0265316_10001703 Ga0265316_1000170319 477
522 3300031595 Ga0265313_10002783 Ga0265313_1000278313 477
523 3300031711 Ga0265314_10000378 Ga0265314_1000037812 477
524 3300031711 Ga0265314_10001444 Ga0265314_100014447 477
525 3300031712 Ga0265342_10001152 Ga0265342_100011522 477
526 3300031712 Ga0265342_10075626 Ga0265342_100756262 477
527 3300042876 Ga0451577_0000109 Ga0451577_0000109_52101_53579 477
528 3300044712 Ga0453684_0000004 Ga0453684_0000004_1178376_1179854 477
529 3300047320 Ga0495672_0003359 Ga0495672_0003359_9899_11353 477
530 3300049588 Ga0501072_0120618 Ga0501072_0120618_371_1849 477
531 3300049591 Ga0501075_0024904 Ga0501075_0024904_654_2132 477
532 3300049592 Ga0501076_0011377 Ga0501076_0011377_4454_5932 477
533 3300049593 Ga0501077_0041991 Ga0501077_0041991_604_2082 477
534 3300049741 Ga0501079_0028221 Ga0501079_0028221_1256_2734 477
535 3300049741 Ga0501079_0176754 Ga0501079_0176754_183_1637 477
536 3300049742 Ga0501080_0071677 Ga0501080_0071677_997_2475 477
537 3300049743 Ga0501081_0020439 Ga0501081_0020439_563_2041 477
538 3300061734 Ga0530510_0072776 Ga0530510_0072776_655_2133 477
539 3300005344 Ga0070661_100081001 Ga0070661_1000810012 478
540 3300005354 Ga0070675_100105287 Ga0070675_1001052872 478
541 3300005356 Ga0070674_100001864 Ga0070674_1000018649 478
542 3300005367 Ga0070667_100034813 Ga0070667_1000348134 478
543 3300005445 Ga0070708_100005303 Ga0070708_1000053031 478
544 3300005467 Ga0070706_100000257 Ga0070706_10000025731 478
545 3300005518 Ga0070699_100077324 Ga0070699_1000773242 478
546 3300005543 Ga0070672_100002438 Ga0070672_1000024386 478
547 3300006358 Ga0068871_100018677 Ga0068871_1000186777 478
548 3300013297 Ga0157378_10163797 Ga0157378_101637972 478
549 3300025910 Ga0207684_10002463 Ga0207684_100024635 478
550 3300025925 Ga0207650_10036967 Ga0207650_100369674 478
551 3300025926 Ga0207659_10014217 Ga0207659_100142172 478
552 3300025933 Ga0207706_10006013 Ga0207706_1000601311 478
553 3300025937 Ga0207669_10003145 Ga0207669_100031458 478
554 3300025940 Ga0207691_10000071 Ga0207691_1000007141 478
555 3300026023 Ga0207677_10060882 Ga0207677_100608822 478
556 3300026121 Ga0207683_10000607 Ga0207683_1000060731 478
557 3300027907 Ga0207428_10009261 Ga0207428_100092614 478
558 3300042876 Ga0451577_0030087 Ga0451577_0030087_2273_3730 478
559 3300006880 Ga0075429_100010629 Ga0075429_1000106298 479
560 3300013297 Ga0157378_10002432 Ga0157378_1000243216 479
561 3300031090 Ga0265760_10022377 Ga0265760_100223772 479
562 3300031235 Ga0265330_10008012 Ga0265330_100080122 479
563 3300031238 Ga0265332_10000044 Ga0265332_1000004434 479
564 3300031241 Ga0265325_10004663 Ga0265325_100046638 479
565 3300031241 Ga0265325_10012362 Ga0265325_100123624 479
566 3300031242 Ga0265329_10004863 Ga0265329_100048634 479
567 3300031249 Ga0265339_10032574 Ga0265339_100325742 479
568 3300031250 Ga0265331_10000076 Ga0265331_1000007699 479
569 3300031250 Ga0265331_10005198 Ga0265331_100051987 479
570 3300031251 Ga0265327_10034465 Ga0265327_100344652 479
571 3300031344 Ga0265316_10000006 Ga0265316_10000006147 479
572 3300031344 Ga0265316_10004811 Ga0265316_1000481113 479
573 3300031711 Ga0265314_10000056 Ga0265314_1000005663 479
574 3300035086 Ga0373934_0038249 Ga0373934_0038249_56_1522 479
575 3300035119 Ga0373956_0014257 Ga0373956_0014257_1510_2976 479
576 3300035724 Ga0373933_0000430 Ga0373933_0000430_509_1975 479
577 3300035724 Ga0373933_0025244 Ga0373933_0025244_580_2178 479
578 3300035725 Ga0373947_0027787 Ga0373947_0027787_921_2519 479
579 3300044673 Ga0453683_0006726 Ga0453683_0006726_2098_3594 479
580 3300046454 Ga0495592_0120756 Ga0495592_0120756_21_1619 479
581 3300046463 Ga0495653_0018444 Ga0495653_0018444_3481_5079 479
582 3300046511 Ga0495608_0040191 Ga0495608_0040191_1006_2604 479
583 3300046516 Ga0495628_0127524 Ga0495628_0127524_19_1617 479
584 3300046526 Ga0495666_0016631 Ga0495666_0016631_1220_2818 479
585 3300046536 Ga0495587_0001108 Ga0495587_0001108_11930_13396 479
586 3300046543 Ga0495645_0036742 Ga0495645_0036742_318_1916 479
587 3300046675 Ga0495657_0044161 Ga0495657_0044161_708_2306 479
588 3300046678 Ga0495599_0034933 Ga0495599_0034933_712_2244 479
589 3300046678 Ga0495599_0079049 Ga0495599_0079049_392_1990 479
590 3300046679 Ga0495623_0005481 Ga0495623_0005481_971_2569 479
591 3300046679 Ga0495623_0027249 Ga0495623_0027249_737_2203 479
592 3300046690 Ga0495624_0042324 Ga0495624_0042324_207_1805 479
593 3300047317 Ga0495604_0037431 Ga0495604_0037431_2074_3609 479
594 3300047319 Ga0495674_0037716 Ga0495674_0037716_1178_2713 479
595 3300047673 Ga0495593_0007862 Ga0495593_0007862_2930_4528 479
596 3300048088 Ga0495602_0000224 Ga0495602_0000224_1027_2493 479
597 3300048089 Ga0495614_0020467 Ga0495614_0020467_331_1929 479
598 3300050508 nmdc:mga09592_2431_c1 nmdc:mga09592_2431_c1_13101_14663 479
599 3300053078 Ga0495612_0002105 Ga0495612_0002105_977_2575 479
600 3300005434 Ga0070709_10020223 Ga0070709_100202234 480
601 3300005439 Ga0070711_100114354 Ga0070711_1001143542 480
602 3300005458 Ga0070681_10080321 Ga0070681_100803212 480
603 3300005467 Ga0070706_100130894 Ga0070706_1001308942 480
604 3300005535 Ga0070684_100073592 Ga0070684_1000735922 480
605 3300005618 Ga0068864_100037779 Ga0068864_1000377792 480
606 3300006028 Ga0070717_10017657 Ga0070717_100176573 480
607 3300006871 Ga0075434_100001538 Ga0075434_1000015389 480
608 3300014325 Ga0163163_10002199 Ga0163163_100021993 480
609 3300014325 Ga0163163_10022035 Ga0163163_100220352 480
610 3300025941 Ga0207711_10149066 Ga0207711_101490662 480
611 3300025949 Ga0207667_10274294 Ga0207667_102742941 480
612 3300026088 Ga0207641_10055387 Ga0207641_100553872 480
613 3300028653 Ga0265323_10006216 Ga0265323_100062162 480
614 3300028800 Ga0265338_10006415 Ga0265338_100064154 480
615 3300031242 Ga0265329_10028508 Ga0265329_100285081 480
616 3300037068 Ga0373925_0012943 Ga0373925_0012943_84_1544 480
617 3300048912 Ga0496109_0036399 Ga0496109_0036399_962_2431 480
618 3300005290 Ga0065712_10094144 Ga0065712_100941442 481
619 3300005328 Ga0070676_10003362 Ga0070676_100033623 481
620 3300005330 Ga0070690_100018063 Ga0070690_1000180633 481
621 3300005334 Ga0068869_100092340 Ga0068869_1000923401 481
622 3300005337 Ga0070682_100016065 Ga0070682_1000160653 481
623 3300005338 Ga0068868_100003218 Ga0068868_10000321813 481
624 3300005341 Ga0070691_10053018 Ga0070691_100530181 481
625 3300005344 Ga0070661_100013918 Ga0070661_1000139181 481
626 3300005344 Ga0070661_100116047 Ga0070661_1001160472 481
627 3300005347 Ga0070668_100018335 Ga0070668_1000183351 481
628 3300005356 Ga0070674_100113064 Ga0070674_1001130641 481
629 3300005366 Ga0070659_100004597 Ga0070659_1000045977 481
630 3300005367 Ga0070667_100004110 Ga0070667_1000041104 481
631 3300005434 Ga0070709_10016589 Ga0070709_100165893 481
632 3300005434 Ga0070709_10024126 Ga0070709_100241262 481
633 3300005439 Ga0070711_100029520 Ga0070711_1000295203 481
634 3300005445 Ga0070708_100000298 Ga0070708_10000029814 481
635 3300005445 Ga0070708_100002919 Ga0070708_1000029193 481
636 3300005445 Ga0070708_100017425 Ga0070708_1000174255 481
637 3300005455 Ga0070663_100072156 Ga0070663_1000721562 481
638 3300005458 Ga0070681_10038239 Ga0070681_100382393 481
639 3300005458 Ga0070681_10171230 Ga0070681_101712302 481
640 3300005467 Ga0070706_100000529 Ga0070706_10000052933 481
641 3300005467 Ga0070706_100092316 Ga0070706_1000923162 481
642 3300005468 Ga0070707_100058073 Ga0070707_1000580733 481
643 3300005468 Ga0070707_100076535 Ga0070707_1000765352 481
644 3300005471 Ga0070698_100000171 Ga0070698_10000017115 481
645 3300005518 Ga0070699_100003167 Ga0070699_1000031673 481
646 3300005518 Ga0070699_100020718 Ga0070699_1000207185 481
647 3300005535 Ga0070684_100047883 Ga0070684_1000478832 481
648 3300005536 Ga0070697_100000054 Ga0070697_10000005422 481
649 3300005536 Ga0070697_100001040 Ga0070697_1000010406 481
650 3300005536 Ga0070697_100028044 Ga0070697_1000280444 481
651 3300005536 Ga0070697_100073967 Ga0070697_1000739672 481
652 3300005539 Ga0068853_100180292 Ga0068853_1001802921 481
653 3300005563 Ga0068855_100008313 Ga0068855_1000083136 481
654 3300005563 Ga0068855_100323382 Ga0068855_1003233821 481
655 3300005564 Ga0070664_100001855 Ga0070664_1000018553 481
656 3300005564 Ga0070664_100067583 Ga0070664_1000675832 481
657 3300005577 Ga0068857_100001887 Ga0068857_10000188711 481
658 3300005578 Ga0068854_100001333 Ga0068854_1000013337 481
659 3300005578 Ga0068854_100080099 Ga0068854_1000800991 481
660 3300005614 Ga0068856_100002155 Ga0068856_10000215515 481
661 3300005614 Ga0068856_100003339 Ga0068856_10000333910 481
662 3300005617 Ga0068859_100005436 Ga0068859_10000543613 481
663 3300005618 Ga0068864_100005740 Ga0068864_10000574010 481
664 3300005618 Ga0068864_100066290 Ga0068864_1000662902 481
665 3300005718 Ga0068866_10019161 Ga0068866_100191612 481
666 3300005840 Ga0068870_10027197 Ga0068870_100271972 481
667 3300005840 Ga0068870_10050018 Ga0068870_100500182 481
668 3300005841 Ga0068863_100087281 Ga0068863_1000872811 481
669 3300005841 Ga0068863_100163660 Ga0068863_1001636602 481
670 3300005842 Ga0068858_100001136 Ga0068858_10000113614 481
671 3300005843 Ga0068860_100009175 Ga0068860_1000091753 481
672 3300005843 Ga0068860_100010389 Ga0068860_1000103893 481
673 3300006028 Ga0070717_10003073 Ga0070717_100030738 481
674 3300006028 Ga0070717_10014404 Ga0070717_100144042 481
675 3300006173 Ga0070716_100014738 Ga0070716_1000147382 481
676 3300006173 Ga0070716_100040172 Ga0070716_1000401722 481
677 3300006173 Ga0070716_100060782 Ga0070716_1000607822 481
678 3300006175 Ga0070712_100000624 Ga0070712_10000062421 481
679 3300006175 Ga0070712_100016216 Ga0070712_1000162163 481
680 3300006237 Ga0097621_100067469 Ga0097621_1000674692 481
681 3300006871 Ga0075434_100017175 Ga0075434_1000171754 481
682 3300006914 Ga0075436_100001527 Ga0075436_1000015273 481
683 3300006914 Ga0075436_100011060 Ga0075436_1000110603 481
684 3300006931 Ga0097620_100005436 Ga0097620_10000543613 481
685 3300007076 Ga0075435_100000357 Ga0075435_10000035715 481
686 3300009093 Ga0105240_10105790 Ga0105240_101057901 481
687 3300009093 Ga0105240_10332337 Ga0105240_103323371 481
688 3300009098 Ga0105245_10143724 Ga0105245_101437242 481
689 3300009101 Ga0105247_10042469 Ga0105247_100424693 481
690 3300009177 Ga0105248_10006415 Ga0105248_1000641510 481
691 3300011119 Ga0105246_10107642 Ga0105246_101076421 481
692 3300013104 Ga0157370_10050083 Ga0157370_100500833 481
693 3300013105 Ga0157369_10000176 Ga0157369_1000017676 481
694 3300013105 Ga0157369_10019633 Ga0157369_100196335 481
695 3300013296 Ga0157374_10102908 Ga0157374_101029082 481
696 3300013297 Ga0157378_10000057 Ga0157378_1000005716 481
697 3300013297 Ga0157378_10125593 Ga0157378_101255932 481
698 3300013306 Ga0163162_10021711 Ga0163162_100217114 481
699 3300013306 Ga0163162_10063330 Ga0163162_100633302 481
700 3300013307 Ga0157372_10000471 Ga0157372_1000047125 481
701 3300013308 Ga0157375_10059425 Ga0157375_100594253 481
702 3300014325 Ga0163163_10039284 Ga0163163_100392843 481
703 3300014968 Ga0157379_10005147 Ga0157379_100051472 481
704 3300014968 Ga0157379_10040559 Ga0157379_100405593 481
705 3300014968 Ga0157379_10092885 Ga0157379_100928852 481
706 3300024227 Ga0228598_1000117 Ga0228598_10001175 481
707 3300025910 Ga0207684_10000702 Ga0207684_1000070230 481
708 3300025912 Ga0207707_10004695 Ga0207707_100046958 481
709 3300025912 Ga0207707_10008801 Ga0207707_100088017 481
710 3300025913 Ga0207695_10090874 Ga0207695_100908742 481
711 3300025913 Ga0207695_10194628 Ga0207695_101946281 481
712 3300025915 Ga0207693_10000173 Ga0207693_1000017336 481
713 3300025915 Ga0207693_10014694 Ga0207693_100146945 481
714 3300025915 Ga0207693_10016874 Ga0207693_100168743 481
715 3300025916 Ga0207663_10003624 Ga0207663_100036246 481
716 3300025919 Ga0207657_10012381 Ga0207657_100123812 481
717 3300025922 Ga0207646_10022810 Ga0207646_100228102 481
718 3300025922 Ga0207646_10121421 Ga0207646_101214211 481
719 3300025927 Ga0207687_10007320 Ga0207687_100073205 481
720 3300025928 Ga0207700_10096097 Ga0207700_100960973 481
721 3300025929 Ga0207664_10050007 Ga0207664_100500073 481
722 3300025933 Ga0207706_10003473 Ga0207706_100034732 481
723 3300025938 Ga0207704_10042233 Ga0207704_100422331 481
724 3300025939 Ga0207665_10002707 Ga0207665_1000270711 481
725 3300025939 Ga0207665_10007285 Ga0207665_100072852 481
726 3300025939 Ga0207665_10035777 Ga0207665_100357772 481
727 3300025941 Ga0207711_10014596 Ga0207711_100145965 481
728 3300025942 Ga0207689_10038924 Ga0207689_100389242 481
729 3300025945 Ga0207679_10009368 Ga0207679_100093683 481
730 3300025949 Ga0207667_10006069 Ga0207667_100060692 481
731 3300025949 Ga0207667_10049431 Ga0207667_100494312 481
732 3300025981 Ga0207640_10002629 Ga0207640_100026295 481
733 3300026023 Ga0207677_10016898 Ga0207677_100168982 481
734 3300026023 Ga0207677_10027424 Ga0207677_100274242 481
735 3300026035 Ga0207703_10001910 Ga0207703_100019107 481
736 3300026067 Ga0207678_10000874 Ga0207678_1000087421 481
737 3300026078 Ga0207702_10005378 Ga0207702_100053785 481
738 3300026089 Ga0207648_10034527 Ga0207648_100345273 481
739 3300026089 Ga0207648_10095760 Ga0207648_100957602 481
740 3300026095 Ga0207676_10002505 Ga0207676_100025053 481
741 3300026095 Ga0207676_10102311 Ga0207676_101023111 481
742 3300026116 Ga0207674_10007174 Ga0207674_100071745 481
743 3300026116 Ga0207674_10055814 Ga0207674_100558142 481
744 3300026118 Ga0207675_100023243 Ga0207675_1000232432 481
745 3300028381 Ga0268264_10029004 Ga0268264_100290043 481
746 3300028381 Ga0268264_10077994 Ga0268264_100779942 481
747 3300028800 Ga0265338_10026728 Ga0265338_100267282 481
748 3300031090 Ga0265760_10007428 Ga0265760_100074283 481
749 3300031249 Ga0265339_10012897 Ga0265339_100128972 481
750 3300034816 Ga0373930_0002470 Ga0373930_0002470_71_1612 481
751 3300035085 Ga0373929_0011324 Ga0373929_0011324_99_1640 481
752 3300035086 Ga0373934_0057453 Ga0373934_0057453_40_1527 481
753 3300035691 Ga0373931_0047740 Ga0373931_0047740_748_2211 481
754 3300035695 Ga0373927_0048489 Ga0373927_0048489_544_2043 481
755 3300036401 Ga0373937_0000559 Ga0373937_0000559_17999_19483 481
756 3300037068 Ga0373925_0001264 Ga0373925_0001264_544_2007 481
757 3300037471 Ga0395905_0138296 Ga0395905_0138296_47_1510 481
758 3300039437 Ga0436365_1746299 Ga0436365_1746299_53_1537 481
759 3300044694 Ga0466963_0010778 Ga0466963_0010778_394_1857 481
760 3300044694 Ga0466963_0012505 Ga0466963_0012505_382_1845 481
761 3300044694 Ga0466963_0024022 Ga0466963_0024022_458_1921 481
762 3300046472 Ga0495580_0051758 Ga0495580_0051758_1072_2568 481
763 3300046472 Ga0495580_0059731 Ga0495580_0059731_218_1723 481
764 3300046472 Ga0495580_0062866 Ga0495580_0062866_675_2138 481
765 3300046473 Ga0495582_0005957 Ga0495582_0005957_1820_3283 481
766 3300047319 Ga0495674_0064218 Ga0495674_0064218_852_2351 481
767 3300048904 Ga0496101_0007379 Ga0496101_0007379_1381_2880 481
768 3300048905 Ga0496102_0005869 Ga0496102_0005869_3666_5165 481
769 3300048906 Ga0496103_0004547 Ga0496103_0004547_1146_2645 481
770 3300048907 Ga0496104_0053014 Ga0496104_0053014_772_2277 481
771 3300048907 Ga0496104_0234036 Ga0496104_0234036_242_1705 481
772 3300048914 Ga0496111_0008000 Ga0496111_0008000_52_1539 481
773 3300048915 Ga0496112_0174969 Ga0496112_0174969_78_1619 481
774 3300048918 Ga0496115_0065835 Ga0496115_0065835_1005_2504 481
775 3300050512 nmdc:mga0n895_1794_c1 nmdc:mga0n895_1794_c1_2222_3727 481
776 3300050512 nmdc:mga0n895_57853_c1 nmdc:mga0n895_57853_c1_868_2409 481
777 3300050514 nmdc:mga08x19_65863_c1 nmdc:mga08x19_65863_c1_283_1746 481
778 3300053077 Ga0495601_0001879 Ga0495601_0001879_2391_3875 481
779 3300061719 Ga0466962_0016740 Ga0466962_0016740_1458_2921 481
780 3300005329 Ga0070683_100212620 Ga0070683_1002126202 482
781 3300005336 Ga0070680_100041435 Ga0070680_1000414351 482
782 3300005530 Ga0070679_100010668 Ga0070679_1000106687 482
783 3300005577 Ga0068857_100192182 Ga0068857_1001921822 482
784 3300025917 Ga0207660_10028785 Ga0207660_100287852 482
785 3300025921 Ga0207652_10011594 Ga0207652_100115946 482
786 3300000546 LJNas_1000797 LJNas_10007974 483
787 3300013105 Ga0157369_10043083 Ga0157369_100430833 483
788 3300021361 Ga0213872_10003228 Ga0213872_100032289 483
789 3300021441 Ga0213871_10001966 Ga0213871_100019664 483
790 3300028800 Ga0265338_10066956 Ga0265338_100669563 483
791 3300031238 Ga0265332_10046701 Ga0265332_100467011 483
792 3300039438 Ga0436360_1294278 Ga0436360_1294278_1285_2742 483
793 3300039447 Ga0436361_0533922 Ga0436361_0533922_2516_3973 483
794 3300039447 Ga0436361_0550373 Ga0436361_0550373_6289_7746 483
795 3300039447 Ga0436361_1111084 Ga0436361_1111084_709_2166 483
796 3300048911 Ga0496108_0017528 Ga0496108_0017528_2930_4381 483
797 3300048929 Ga0496126_0002019 Ga0496126_0002019_5059_6513 483
798 3300053077 Ga0495601_0007359 Ga0495601_0007359_2342_3835 483

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08323

Glyco_transf_5

Starch synthase catalytic domain

71

307

0.94

PF00534

Glycos_transf_1

Glycosyl transferases group 1

359

525

0.86

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

85

322

0.81

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

86

313

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cx4-assembly1.cif.gz_A crystal structure of e.coli gs mutant e377a in complex with adp and oligosaccharides 0.9468 1 477
2r4t-assembly1.cif.gz_A crystal structure of wild-type e.coli gs in complex with adp and glucose(wtgsc) 0.9464 1 477
3cx4-assembly1.cif.gz_A crystal structure of e.coli gs mutant e377a in complex with adp and oligosaccharides 0.943 1 477
2r4t-assembly1.cif.gz_A crystal structure of wild-type e.coli gs in complex with adp and glucose(wtgsc) 0.9406 1 477
6gne-assembly1.cif.gz_A catalytic domain of starch synthase iv from arabidopsis thaliana bound to adp and acarbose 0.921 2 480
ID Description Score Start End Superfamily
af_Q0DEC8_405_613_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9768 254 457 3.40.50.2000
3copA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9693 254 460 3.40.50.2000
af_Q59001_288_450_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9584 291 442 3.40.50.2000
1rzvB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9514 254 457 3.40.50.2000
3copA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9514 254 460 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7W0J5G2-F1-model_v4 starch synthase (EC 2.4.1.21) 0.9796 53 482 GO:0004373
GO:0005978
GO:0009011
AF-A0A3D4Z1U1-F1-model_v4 Glycogen synthase (EC 2.4.1.21) (Starch [bacterial glycogen] synthase) 0.9728 1 480 GO:0004373
GO:0005978
GO:0009011
AF-A0A534M3C6-F1-model_v4 Glycogen synthase 0.9708 1 412 GO:0004373
AF-A0A3D5ZNV8-F1-model_v4 Glycogen synthase (EC 2.4.1.21) (Starch [bacterial glycogen] synthase) 0.9684 2 475 GO:0004373
GO:0005978
GO:0009011
AF-A0A0S8K904-F1-model_v4 Glycogen synthase (EC 2.4.1.21) (Starch [bacterial glycogen] synthase) 0.9681 1 480 GO:0004373
GO:0005829
GO:0005978
GO:0009011

Feature Viewer

pLDDT pTM Quality
96 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map