F481317
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 798 | 355 | 789 | 487 |
Family's Representative Sequence
| Representative Sequence | 3300050491|nmdc:mga00v17_19433_c1|nmdc:mga00v17_19433_c1_1652_3844 |
| Length | 559 |
| Sequence | MPRRKNPTPADDVTPPIAAARRRRTASAGKVAGQPVAPLKPRLVKTKSTTPRLTSDLRVELTADDGRRPLNVLMVASEVLPFAKTGGLADVAAALPSALAQLGHQVVVVMPRYRGVTVSGELLTTFVLDIGPEHLHVQVFRERIGGGASVWLVDIPALYDRDGFYGVGSHDHPDNPRRFAALARAAFEAAILVGFTPDVVHAHDWQGGLAPVYLRTRYATHPVLGGVPSVFTIHNIAYSGLCDAGWLPALDLDWDLYTPQALEYWGQVSLLKAGINFSEKVTTVSRKYAEEILTAEFAYGLEGVLAARRADLVGILNGIDAEVWNPATDRFLPAPYTADALAGKRASKRAVLEAYGLPSDEDALGRPLIGMVSRMVAQKGLDLISSVASELPHLGARFVVLGTGEPAFESMWRRLAAQFPDRVGVRIGFDEGLSHLIEAGSDLFLMPSRFEPCGLNQMYSLRYGTLPLVRATGGLDDTVENYDPYTGRGTGFKFWEASGQAMMETLRWALRVYDHPEVWQRLQRAAMGGDFSWVRSAAAYVDVYEAALARTGRRRAAAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 2 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 3 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 4 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 5 | 2885526491 | Paenibacillus sp. LK1 | Isolate | Rhizosphere |
| 6 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 7 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 8 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 9 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 10 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 11 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 126 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 127 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 187 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 198 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 200 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 202 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 210 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 213 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 215 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 216 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 217 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 221 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 222 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 224 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 225 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 234 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 236 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 240 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 243 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 244 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 245 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 246 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 247 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 248 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 249 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 250 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 251 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 252 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 253 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 333 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 334 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 335 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 345 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 346 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 347 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 348 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 349 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 350 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 352 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 353 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 355 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.99 |
| Metatranscriptomes | 0.88 |
| Isolates | 1.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.75 |
| Nodule | 0 |
| Rhizoplane | 5.39 |
| Rhizosphere | 91.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000797 | 3300000546 | Bacteria | 5248 |
| 2 | Ga0055538_1000080 | 3300003751 | Bacteria | 85194 |
| 3 | Ga0065712_10001774 | 3300005290 | Bacteria | 6450 |
| 4 | Ga0065712_10085300 | 3300005290 | Bacteria | 2705 |
| 5 | Ga0065712_10094144 | 3300005290 | Bacteria | 2266 |
| 6 | Ga0065715_10089407 | 3300005293 | Bacteria | 10476 |
| 7 | Ga0065707_10100972 | 3300005295 | Bacteria | 2893 |
| 8 | Ga0070658_10131017 | 3300005327 | Bacteria | 2090 |
| 9 | Ga0070676_10003362 | 3300005328 | Bacteria | 8325 |
| 10 | Ga0070676_10080166 | 3300005328 | Bacteria | 1978 |
| 11 | Ga0070683_100009361 | 3300005329 | Bacteria | 8375 |
| 12 | Ga0070683_100212620 | 3300005329 | Bacteria | 1837 |
| 13 | Ga0070690_100016718 | 3300005330 | Bacteria | 4400 |
| 14 | Ga0070690_100018063 | 3300005330 | Unclassified | 4253 |
| 15 | Ga0070670_100001920 | 3300005331 | Bacteria | 17013 |
| 16 | Ga0070670_100007560 | 3300005331 | Bacteria | 9222 |
| 17 | Ga0070670_100019868 | 3300005331 | Bacteria | 5768 |
| 18 | Ga0070670_100038930 | 3300005331 | Bacteria | 4088 |
| 19 | Ga0068869_100092340 | 3300005334 | Unclassified | 2278 |
| 20 | Ga0070666_10017961 | 3300005335 | Bacteria | 4540 |
| 21 | Ga0070680_100041435 | 3300005336 | Bacteria | 3734 |
| 22 | Ga0070682_100016065 | 3300005337 | Unclassified | 4348 |
| 23 | Ga0068868_100003218 | 3300005338 | Bacteria | 11366 |
| 24 | Ga0068868_100005467 | 3300005338 | Bacteria | 8931 |
| 25 | Ga0068868_100007890 | 3300005338 | Bacteria | 7603 |
| 26 | Ga0068868_100059186 | 3300005338 | Bacteria | 3030 |
| 27 | Ga0068868_100073162 | 3300005338 | Bacteria | 2736 |
| 28 | Ga0070689_100015247 | 3300005340 | Bacteria | 5601 |
| 29 | Ga0070691_10053018 | 3300005341 | Bacteria | 1940 |
| 30 | Ga0070687_100029783 | 3300005343 | Bacteria | 2662 |
| 31 | Ga0070661_100000349 | 3300005344 | Bacteria | 36558 |
| 32 | Ga0070661_100013918 | 3300005344 | Bacteria | 5654 |
| 33 | Ga0070661_100060577 | 3300005344 | Bacteria | 2777 |
| 34 | Ga0070661_100081001 | 3300005344 | Bacteria | 2396 |
| 35 | Ga0070661_100116047 | 3300005344 | Unclassified | 2002 |
| 36 | Ga0070692_10018091 | 3300005345 | Bacteria | 3382 |
| 37 | Ga0070668_100018335 | 3300005347 | Bacteria | 5254 |
| 38 | Ga0070669_100003108 | 3300005353 | Bacteria | 11951 |
| 39 | Ga0070675_100000181 | 3300005354 | Bacteria | 39301 |
| 40 | Ga0070675_100006104 | 3300005354 | Bacteria | 9240 |
| 41 | Ga0070675_100019910 | 3300005354 | Bacteria | 5353 |
| 42 | Ga0070675_100105287 | 3300005354 | Bacteria | 2380 |
| 43 | Ga0070671_100000218 | 3300005355 | Bacteria | 38347 |
| 44 | Ga0070674_100001864 | 3300005356 | Bacteria | 11435 |
| 45 | Ga0070674_100073466 | 3300005356 | Bacteria | 2424 |
| 46 | Ga0070674_100113064 | 3300005356 | Unclassified | 1997 |
| 47 | Ga0070673_100001419 | 3300005364 | Bacteria | 14003 |
| 48 | Ga0070673_100006113 | 3300005364 | Bacteria | 7803 |
| 49 | Ga0070673_100083665 | 3300005364 | Bacteria | 2593 |
| 50 | Ga0070688_100025395 | 3300005365 | Bacteria | 3507 |
| 51 | Ga0070688_100049225 | 3300005365 | Bacteria | 2622 |
| 52 | Ga0070659_100004597 | 3300005366 | Bacteria | 9870 |
| 53 | Ga0070667_100004110 | 3300005367 | Bacteria | 12322 |
| 54 | Ga0070667_100026465 | 3300005367 | Bacteria | 4826 |
| 55 | Ga0070667_100034813 | 3300005367 | Bacteria | 4216 |
| 56 | Ga0070667_100222436 | 3300005367 | Bacteria | 1681 |
| 57 | Ga0070709_10016589 | 3300005434 | Bacteria | 4207 |
| 58 | Ga0070709_10020223 | 3300005434 | Unclassified | 3859 |
| 59 | Ga0070709_10024126 | 3300005434 | Unclassified | 3578 |
| 60 | Ga0070713_100028284 | 3300005436 | Bacteria | 4426 |
| 61 | Ga0070710_10055473 | 3300005437 | Bacteria | 2239 |
| 62 | Ga0070701_10027557 | 3300005438 | Bacteria | 2784 |
| 63 | Ga0070711_100029520 | 3300005439 | Unclassified | 3619 |
| 64 | Ga0070711_100114354 | 3300005439 | Unclassified | 1986 |
| 65 | Ga0070705_100000756 | 3300005440 | Bacteria | 18330 |
| 66 | Ga0070705_100014673 | 3300005440 | Bacteria | 4036 |
| 67 | Ga0070705_100056792 | 3300005440 | Bacteria | 2306 |
| 68 | Ga0070700_100004623 | 3300005441 | Bacteria | 7208 |
| 69 | Ga0070700_100079966 | 3300005441 | Bacteria | 2108 |
| 70 | Ga0070694_100007401 | 3300005444 | Bacteria | 6695 |
| 71 | Ga0070694_100019076 | 3300005444 | Bacteria | 4359 |
| 72 | Ga0070694_100051176 | 3300005444 | Bacteria | 2787 |
| 73 | Ga0070708_100000298 | 3300005445 | Bacteria | 37307 |
| 74 | Ga0070708_100002919 | 3300005445 | Bacteria | 13293 |
| 75 | Ga0070708_100005303 | 3300005445 | Bacteria | 10217 |
| 76 | Ga0070708_100017425 | 3300005445 | Bacteria | 5991 |
| 77 | Ga0070663_100072156 | 3300005455 | Unclassified | 2514 |
| 78 | Ga0070678_100000972 | 3300005456 | Bacteria | 14793 |
| 79 | Ga0070678_100011558 | 3300005456 | Bacteria | 5453 |
| 80 | Ga0070678_100054903 | 3300005456 | Bacteria | 2906 |
| 81 | Ga0070662_100012018 | 3300005457 | Bacteria | 5731 |
| 82 | Ga0070662_100039019 | 3300005457 | Bacteria | 3376 |
| 83 | Ga0070662_100077476 | 3300005457 | Bacteria | 2467 |
| 84 | Ga0070681_10000281 | 3300005458 | Bacteria | 40930 |
| 85 | Ga0070681_10038239 | 3300005458 | Bacteria | 4811 |
| 86 | Ga0070681_10075385 | 3300005458 | Bacteria | 3333 |
| 87 | Ga0070681_10080321 | 3300005458 | Bacteria | 3217 |
| 88 | Ga0070681_10171230 | 3300005458 | Bacteria | 2093 |
| 89 | Ga0068867_100007526 | 3300005459 | Bacteria | 7702 |
| 90 | Ga0068867_100025146 | 3300005459 | Bacteria | 4271 |
| 91 | Ga0070706_100000257 | 3300005467 | Bacteria | 64534 |
| 92 | Ga0070706_100000529 | 3300005467 | Bacteria | 44433 |
| 93 | Ga0070706_100065172 | 3300005467 | Bacteria | 3369 |
| 94 | Ga0070706_100092316 | 3300005467 | Bacteria | 2808 |
| 95 | Ga0070706_100130894 | 3300005467 | Unclassified | 2341 |
| 96 | Ga0070707_100051602 | 3300005468 | Bacteria | 3943 |
| 97 | Ga0070707_100058073 | 3300005468 | Bacteria | 3711 |
| 98 | Ga0070707_100070380 | 3300005468 | Bacteria | 3370 |
| 99 | Ga0070707_100076535 | 3300005468 | Bacteria | 3228 |
| 100 | Ga0070698_100000171 | 3300005471 | Bacteria | 60242 |
| 101 | Ga0070698_100015249 | 3300005471 | Bacteria | 8126 |
| 102 | Ga0070698_100025140 | 3300005471 | Bacteria | 6207 |
| 103 | Ga0070699_100000386 | 3300005518 | Bacteria | 42744 |
| 104 | Ga0070699_100003167 | 3300005518 | Bacteria | 14567 |
| 105 | Ga0070699_100006186 | 3300005518 | Bacteria | 10458 |
| 106 | Ga0070699_100011772 | 3300005518 | Bacteria | 7549 |
| 107 | Ga0070699_100020718 | 3300005518 | Bacteria | 5671 |
| 108 | Ga0070699_100077324 | 3300005518 | Unclassified | 2897 |
| 109 | Ga0070699_100148638 | 3300005518 | Bacteria | 2071 |
| 110 | Ga0070679_100010668 | 3300005530 | Bacteria | 8718 |
| 111 | Ga0070679_100223135 | 3300005530 | Bacteria | 1845 |
| 112 | Ga0070684_100044443 | 3300005535 | Bacteria | 3842 |
| 113 | Ga0070684_100047883 | 3300005535 | Bacteria | 3707 |
| 114 | Ga0070684_100070000 | 3300005535 | Bacteria | 3086 |
| 115 | Ga0070684_100073592 | 3300005535 | Bacteria | 3011 |
| 116 | Ga0070697_100000054 | 3300005536 | Bacteria | 88022 |
| 117 | Ga0070697_100001040 | 3300005536 | Bacteria | 20964 |
| 118 | Ga0070697_100028044 | 3300005536 | Bacteria | 4507 |
| 119 | Ga0070697_100066843 | 3300005536 | Bacteria | 2939 |
| 120 | Ga0070697_100073967 | 3300005536 | Bacteria | 2798 |
| 121 | Ga0068853_100180292 | 3300005539 | Unclassified | 1915 |
| 122 | Ga0068853_100289774 | 3300005539 | Bacteria | 1511 |
| 123 | Ga0070672_100002438 | 3300005543 | Bacteria | 11797 |
| 124 | Ga0070672_100002533 | 3300005543 | Bacteria | 11639 |
| 125 | Ga0070672_100004226 | 3300005543 | Bacteria | 9389 |
| 126 | Ga0070672_100030643 | 3300005543 | Bacteria | 4043 |
| 127 | Ga0070686_100033883 | 3300005544 | Bacteria | 3142 |
| 128 | Ga0070695_100000247 | 3300005545 | Bacteria | 26996 |
| 129 | Ga0070695_100054983 | 3300005545 | Bacteria | 2565 |
| 130 | Ga0070695_100087338 | 3300005545 | Bacteria | 2074 |
| 131 | Ga0070696_100001143 | 3300005546 | Bacteria | 17208 |
| 132 | Ga0070696_100026985 | 3300005546 | Bacteria | 3910 |
| 133 | Ga0070696_100037141 | 3300005546 | Bacteria | 3359 |
| 134 | Ga0070696_100043420 | 3300005546 | Bacteria | 3110 |
| 135 | Ga0070665_100046559 | 3300005548 | Bacteria | 4356 |
| 136 | Ga0070665_100191137 | 3300005548 | Bacteria | 2048 |
| 137 | Ga0070704_100003993 | 3300005549 | Bacteria | 8507 |
| 138 | Ga0070704_100005018 | 3300005549 | Bacteria | 7691 |
| 139 | Ga0070704_100006063 | 3300005549 | Bacteria | 7090 |
| 140 | Ga0070704_100028365 | 3300005549 | Bacteria | 3723 |
| 141 | Ga0070704_100037916 | 3300005549 | Bacteria | 3297 |
| 142 | Ga0068855_100008313 | 3300005563 | Bacteria | 12542 |
| 143 | Ga0068855_100036443 | 3300005563 | Bacteria | 5854 |
| 144 | Ga0068855_100097073 | 3300005563 | Bacteria | 3394 |
| 145 | Ga0068855_100323382 | 3300005563 | Bacteria | 1704 |
| 146 | Ga0070664_100001855 | 3300005564 | Bacteria | 16921 |
| 147 | Ga0070664_100002592 | 3300005564 | Bacteria | 14585 |
| 148 | Ga0070664_100067583 | 3300005564 | Unclassified | 3054 |
| 149 | Ga0068857_100001887 | 3300005577 | Bacteria | 16893 |
| 150 | Ga0068857_100012663 | 3300005577 | Bacteria | 7348 |
| 151 | Ga0068857_100060235 | 3300005577 | Bacteria | 3372 |
| 152 | Ga0068857_100192182 | 3300005577 | Bacteria | 1859 |
| 153 | Ga0068854_100001333 | 3300005578 | Bacteria | 14896 |
| 154 | Ga0068854_100010834 | 3300005578 | Bacteria | 5916 |
| 155 | Ga0068854_100031544 | 3300005578 | Bacteria | 3684 |
| 156 | Ga0068854_100080099 | 3300005578 | Unclassified | 2409 |
| 157 | Ga0068856_100002155 | 3300005614 | Bacteria | 20392 |
| 158 | Ga0068856_100003339 | 3300005614 | Bacteria | 16300 |
| 159 | Ga0070702_100035525 | 3300005615 | Bacteria | 2754 |
| 160 | Ga0068852_100000256 | 3300005616 | Bacteria | 35991 |
| 161 | Ga0068852_100078159 | 3300005616 | Unclassified | 2927 |
| 162 | Ga0068859_100002081 | 3300005617 | Bacteria | 20395 |
| 163 | Ga0068859_100005436 | 3300005617 | Bacteria | 12955 |
| 164 | Ga0068859_100015676 | 3300005617 | Bacteria | 7615 |
| 165 | Ga0068859_100115711 | 3300005617 | Bacteria | 2746 |
| 166 | Ga0068859_100117305 | 3300005617 | Bacteria | 2727 |
| 167 | Ga0068864_100002540 | 3300005618 | Bacteria | 15071 |
| 168 | Ga0068864_100005475 | 3300005618 | Bacteria | 10411 |
| 169 | Ga0068864_100005740 | 3300005618 | Bacteria | 10179 |
| 170 | Ga0068864_100037779 | 3300005618 | Bacteria | 4122 |
| 171 | Ga0068864_100066290 | 3300005618 | Unclassified | 3134 |
| 172 | Ga0068866_10019161 | 3300005718 | Unclassified | 3109 |
| 173 | Ga0068861_100001989 | 3300005719 | Bacteria | 13206 |
| 174 | Ga0068861_100037692 | 3300005719 | Bacteria | 3595 |
| 175 | Ga0068851_10024963 | 3300005834 | Bacteria | 2929 |
| 176 | Ga0068870_10003674 | 3300005840 | Bacteria | 6517 |
| 177 | Ga0068870_10027197 | 3300005840 | Unclassified | 2859 |
| 178 | Ga0068870_10050018 | 3300005840 | Bacteria | 2207 |
| 179 | Ga0068863_100019006 | 3300005841 | Bacteria | 6576 |
| 180 | Ga0068863_100087281 | 3300005841 | Bacteria | 2956 |
| 181 | Ga0068863_100163660 | 3300005841 | Unclassified | 2133 |
| 182 | Ga0068858_100001136 | 3300005842 | Bacteria | 27546 |
| 183 | Ga0068858_100008296 | 3300005842 | Bacteria | 9989 |
| 184 | Ga0068860_100001188 | 3300005843 | Bacteria | 28462 |
| 185 | Ga0068860_100009175 | 3300005843 | Bacteria | 9833 |
| 186 | Ga0068860_100010389 | 3300005843 | Bacteria | 9209 |
| 187 | Ga0068862_100001000 | 3300005844 | Bacteria | 27052 |
| 188 | Ga0068862_100147953 | 3300005844 | Bacteria | 2089 |
| 189 | Ga0070717_10003073 | 3300006028 | Bacteria | 11898 |
| 190 | Ga0070717_10014404 | 3300006028 | Bacteria | 6083 |
| 191 | Ga0070717_10015938 | 3300006028 | Bacteria | 5817 |
| 192 | Ga0070717_10017657 | 3300006028 | Bacteria | 5555 |
| 193 | Ga0070717_10228724 | 3300006028 | Bacteria | 1637 |
| 194 | Ga0070716_100014738 | 3300006173 | Unclassified | 4011 |
| 195 | Ga0070716_100040172 | 3300006173 | Unclassified | 2602 |
| 196 | Ga0070716_100060782 | 3300006173 | Bacteria | 2184 |
| 197 | Ga0070712_100000624 | 3300006175 | Bacteria | 20825 |
| 198 | Ga0070712_100016216 | 3300006175 | Bacteria | 4810 |
| 199 | Ga0097621_100067469 | 3300006237 | Unclassified | 2948 |
| 200 | Ga0097621_100123215 | 3300006237 | Bacteria | 2200 |
| 201 | Ga0068871_100018677 | 3300006358 | Bacteria | 5278 |
| 202 | Ga0068871_100057802 | 3300006358 | Bacteria | 3157 |
| 203 | Ga0075428_100004439 | 3300006844 | Bacteria | 15493 |
| 204 | Ga0075428_100007047 | 3300006844 | Bacteria | 12457 |
| 205 | Ga0075428_100011674 | 3300006844 | Bacteria | 9777 |
| 206 | Ga0075428_100017990 | 3300006844 | Bacteria | 7809 |
| 207 | Ga0075428_100018233 | 3300006844 | Bacteria | 7757 |
| 208 | Ga0075428_100024526 | 3300006844 | Bacteria | 6674 |
| 209 | Ga0075433_10015146 | 3300006852 | Bacteria | 6317 |
| 210 | Ga0075433_10081420 | 3300006852 | Bacteria | 2854 |
| 211 | Ga0075434_100001538 | 3300006871 | Bacteria | 19521 |
| 212 | Ga0075434_100003880 | 3300006871 | Bacteria | 13384 |
| 213 | Ga0075434_100011335 | 3300006871 | Bacteria | 8402 |
| 214 | Ga0075434_100017175 | 3300006871 | Bacteria | 6967 |
| 215 | Ga0075434_100065887 | 3300006871 | Bacteria | 3608 |
| 216 | Ga0075434_100098674 | 3300006871 | Bacteria | 2926 |
| 217 | Ga0075429_100010629 | 3300006880 | Bacteria | 7963 |
| 218 | Ga0075429_100016395 | 3300006880 | Bacteria | 6422 |
| 219 | Ga0075429_100178283 | 3300006880 | Bacteria | 1862 |
| 220 | Ga0075436_100001527 | 3300006914 | Bacteria | 15807 |
| 221 | Ga0075436_100002992 | 3300006914 | Bacteria | 11573 |
| 222 | Ga0075436_100011060 | 3300006914 | Bacteria | 6191 |
| 223 | Ga0075436_100038731 | 3300006914 | Bacteria | 3290 |
| 224 | Ga0075436_100157798 | 3300006914 | Bacteria | 1598 |
| 225 | Ga0097620_100002081 | 3300006931 | Bacteria | 20395 |
| 226 | Ga0097620_100005436 | 3300006931 | Bacteria | 12955 |
| 227 | Ga0097620_100015676 | 3300006931 | Bacteria | 7615 |
| 228 | Ga0097620_100115710 | 3300006931 | Bacteria | 2746 |
| 229 | Ga0097620_100117309 | 3300006931 | Bacteria | 2727 |
| 230 | Ga0075435_100000357 | 3300007076 | Bacteria | 27987 |
| 231 | Ga0075435_100007984 | 3300007076 | Bacteria | 7575 |
| 232 | Ga0075435_100012719 | 3300007076 | Bacteria | 6235 |
| 233 | Ga0099795_10000013 | 3300007788 | Bacteria | 69893 |
| 234 | Ga0105240_10006066 | 3300009093 | Bacteria | 17852 |
| 235 | Ga0105240_10045158 | 3300009093 | Bacteria | 5592 |
| 236 | Ga0105240_10105790 | 3300009093 | Bacteria | 3415 |
| 237 | Ga0105240_10203431 | 3300009093 | Bacteria | 2319 |
| 238 | Ga0105240_10332337 | 3300009093 | Bacteria | 1729 |
| 239 | Ga0111539_10000563 | 3300009094 | Bacteria | 47501 |
| 240 | Ga0111539_10001769 | 3300009094 | Bacteria | 28709 |
| 241 | Ga0111539_10004174 | 3300009094 | Bacteria | 18954 |
| 242 | Ga0111539_10017744 | 3300009094 | Bacteria | 8811 |
| 243 | Ga0111539_10041043 | 3300009094 | Bacteria | 5566 |
| 244 | Ga0111539_10073633 | 3300009094 | Bacteria | 4027 |
| 245 | Ga0111539_10074542 | 3300009094 | Bacteria | 3998 |
| 246 | Ga0111539_10133207 | 3300009094 | Bacteria | 2910 |
| 247 | Ga0111539_10286417 | 3300009094 | Bacteria | 1917 |
| 248 | Ga0105245_10143724 | 3300009098 | Unclassified | 2249 |
| 249 | Ga0105247_10042469 | 3300009101 | Bacteria | 2785 |
| 250 | Ga0114129_10001102 | 3300009147 | Bacteria | 35507 |
| 251 | Ga0114129_10003827 | 3300009147 | Bacteria | 21202 |
| 252 | Ga0114129_10007052 | 3300009147 | Bacteria | 15997 |
| 253 | Ga0114129_10041164 | 3300009147 | Bacteria | 6512 |
| 254 | Ga0114129_10084404 | 3300009147 | Bacteria | 4410 |
| 255 | Ga0114129_10084789 | 3300009147 | Bacteria | 4398 |
| 256 | Ga0114129_10177944 | 3300009147 | Bacteria | 2896 |
| 257 | Ga0114129_10235483 | 3300009147 | Bacteria | 2464 |
| 258 | Ga0114129_10283104 | 3300009147 | Bacteria | 2215 |
| 259 | Ga0105243_10007773 | 3300009148 | Bacteria | 8243 |
| 260 | Ga0105243_10028025 | 3300009148 | Bacteria | 4321 |
| 261 | Ga0105243_10051889 | 3300009148 | Bacteria | 3246 |
| 262 | Ga0105241_10237417 | 3300009174 | Bacteria | 1539 |
| 263 | Ga0105242_10036893 | 3300009176 | Bacteria | 3924 |
| 264 | Ga0105242_10058176 | 3300009176 | Bacteria | 3168 |
| 265 | Ga0105242_10093509 | 3300009176 | Bacteria | 2535 |
| 266 | Ga0105248_10006415 | 3300009177 | Bacteria | 12905 |
| 267 | Ga0105248_10029958 | 3300009177 | Bacteria | 6073 |
| 268 | Ga0105248_10030894 | 3300009177 | Bacteria | 5984 |
| 269 | Ga0105248_10032810 | 3300009177 | Bacteria | 5801 |
| 270 | Ga0105237_10001318 | 3300009545 | Bacteria | 32923 |
| 271 | Ga0105237_10034493 | 3300009545 | Bacteria | 5123 |
| 272 | Ga0105238_10047858 | 3300009551 | Bacteria | 4310 |
| 273 | Ga0105249_10006074 | 3300009553 | Bacteria | 10466 |
| 274 | Ga0105249_10135072 | 3300009553 | Bacteria | 2359 |
| 275 | Ga0099796_10003190 | 3300010159 | Bacteria | 3756 |
| 276 | Ga0105239_10207070 | 3300010375 | Bacteria | 2198 |
| 277 | Ga0105246_10107642 | 3300011119 | Bacteria | 2042 |
| 278 | Ga0157371_10015522 | 3300013102 | Bacteria | 5712 |
| 279 | Ga0157370_10050083 | 3300013104 | Unclassified | 3994 |
| 280 | Ga0157369_10000176 | 3300013105 | Bacteria | 89387 |
| 281 | Ga0157369_10019633 | 3300013105 | Bacteria | 7563 |
| 282 | Ga0157369_10043083 | 3300013105 | Bacteria | 4921 |
| 283 | Ga0157374_10102908 | 3300013296 | Bacteria | 2739 |
| 284 | Ga0157374_10106790 | 3300013296 | Bacteria | 2690 |
| 285 | Ga0157378_10000057 | 3300013297 | Bacteria | 96589 |
| 286 | Ga0157378_10001428 | 3300013297 | Bacteria | 21504 |
| 287 | Ga0157378_10002432 | 3300013297 | Bacteria | 16560 |
| 288 | Ga0157378_10003159 | 3300013297 | Bacteria | 14647 |
| 289 | Ga0157378_10125593 | 3300013297 | Unclassified | 2369 |
| 290 | Ga0157378_10163797 | 3300013297 | Bacteria | 2081 |
| 291 | Ga0157378_10193359 | 3300013297 | Bacteria | 1920 |
| 292 | Ga0163162_10011524 | 3300013306 | Bacteria | 8623 |
| 293 | Ga0163162_10021711 | 3300013306 | Bacteria | 6323 |
| 294 | Ga0163162_10063330 | 3300013306 | Bacteria | 3740 |
| 295 | Ga0163162_10195582 | 3300013306 | Bacteria | 2151 |
| 296 | Ga0163162_10234479 | 3300013306 | Bacteria | 1966 |
| 297 | Ga0157372_10000471 | 3300013307 | Bacteria | 44441 |
| 298 | Ga0157375_10003261 | 3300013308 | Bacteria | 14084 |
| 299 | Ga0157375_10008985 | 3300013308 | Bacteria | 8745 |
| 300 | Ga0157375_10059425 | 3300013308 | Bacteria | 3788 |
| 301 | Ga0163163_10002199 | 3300014325 | Bacteria | 16414 |
| 302 | Ga0163163_10022035 | 3300014325 | Bacteria | 6024 |
| 303 | Ga0163163_10039284 | 3300014325 | Unclassified | 4619 |
| 304 | Ga0163163_10172581 | 3300014325 | Bacteria | 2209 |
| 305 | Ga0157380_10028769 | 3300014326 | Bacteria | 4241 |
| 306 | Ga0157379_10005147 | 3300014968 | Bacteria | 11224 |
| 307 | Ga0157379_10040559 | 3300014968 | Bacteria | 4156 |
| 308 | Ga0157379_10092885 | 3300014968 | Unclassified | 2707 |
| 309 | Ga0157376_10001578 | 3300014969 | Bacteria | 15061 |
| 310 | Ga0157376_10030349 | 3300014969 | Bacteria | 4317 |
| 311 | Ga0157376_10148196 | 3300014969 | Bacteria | 2113 |
| 312 | Ga0213872_10003228 | 3300021361 | Bacteria | 9107 |
| 313 | Ga0213871_10001966 | 3300021441 | Bacteria | 3648 |
| 314 | Ga0228598_1000117 | 3300024227 | Bacteria | 13477 |
| 315 | Ga0209784_100077 | 3300025224 | Bacteria | 139569 |
| 316 | Ga0209437_100324 | 3300025233 | Bacteria | 61046 |
| 317 | Ga0207697_10003472 | 3300025315 | Bacteria | 7780 |
| 318 | Ga0207688_10046191 | 3300025901 | Bacteria | 2431 |
| 319 | Ga0207680_10013655 | 3300025903 | Bacteria | 4179 |
| 320 | Ga0207680_10083104 | 3300025903 | Bacteria | 2017 |
| 321 | Ga0207645_10062694 | 3300025907 | Bacteria | 2375 |
| 322 | Ga0207645_10095284 | 3300025907 | Bacteria | 1916 |
| 323 | Ga0207643_10009824 | 3300025908 | Bacteria | 5139 |
| 324 | Ga0207684_10000702 | 3300025910 | Bacteria | 39479 |
| 325 | Ga0207684_10002463 | 3300025910 | Bacteria | 18645 |
| 326 | Ga0207707_10004695 | 3300025912 | Bacteria | 11993 |
| 327 | Ga0207707_10008801 | 3300025912 | Bacteria | 8760 |
| 328 | Ga0207707_10009521 | 3300025912 | Bacteria | 8428 |
| 329 | Ga0207707_10048103 | 3300025912 | Bacteria | 3714 |
| 330 | Ga0207695_10004005 | 3300025913 | Bacteria | 20286 |
| 331 | Ga0207695_10036329 | 3300025913 | Bacteria | 5328 |
| 332 | Ga0207695_10090874 | 3300025913 | Unclassified | 3068 |
| 333 | Ga0207695_10093936 | 3300025913 | Bacteria | 3008 |
| 334 | Ga0207695_10194628 | 3300025913 | Bacteria | 1944 |
| 335 | Ga0207693_10000173 | 3300025915 | Bacteria | 58862 |
| 336 | Ga0207693_10014694 | 3300025915 | Bacteria | 6290 |
| 337 | Ga0207693_10016874 | 3300025915 | Bacteria | 5830 |
| 338 | Ga0207693_10018122 | 3300025915 | Bacteria | 5611 |
| 339 | Ga0207693_10087387 | 3300025915 | Bacteria | 2443 |
| 340 | Ga0207663_10003624 | 3300025916 | Bacteria | 7579 |
| 341 | Ga0207660_10028785 | 3300025917 | Bacteria | 3804 |
| 342 | Ga0207662_10013731 | 3300025918 | Bacteria | 4533 |
| 343 | Ga0207657_10012381 | 3300025919 | Bacteria | 8427 |
| 344 | Ga0207652_10011594 | 3300025921 | Bacteria | 7111 |
| 345 | Ga0207646_10022810 | 3300025922 | Bacteria | 5756 |
| 346 | Ga0207646_10074212 | 3300025922 | Bacteria | 3039 |
| 347 | Ga0207646_10119393 | 3300025922 | Bacteria | 2368 |
| 348 | Ga0207646_10121421 | 3300025922 | Bacteria | 2347 |
| 349 | Ga0207681_10005692 | 3300025923 | Bacteria | 7653 |
| 350 | Ga0207694_10013768 | 3300025924 | Bacteria | 6097 |
| 351 | Ga0207650_10001433 | 3300025925 | Bacteria | 17197 |
| 352 | Ga0207650_10006792 | 3300025925 | Bacteria | 7804 |
| 353 | Ga0207650_10036967 | 3300025925 | Bacteria | 3555 |
| 354 | Ga0207659_10000547 | 3300025926 | Bacteria | 22456 |
| 355 | Ga0207659_10003019 | 3300025926 | Bacteria | 10036 |
| 356 | Ga0207659_10014217 | 3300025926 | Bacteria | 5124 |
| 357 | Ga0207687_10007320 | 3300025927 | Bacteria | 7278 |
| 358 | Ga0207700_10014118 | 3300025928 | Bacteria | 5224 |
| 359 | Ga0207700_10096097 | 3300025928 | Unclassified | 2352 |
| 360 | Ga0207664_10050007 | 3300025929 | Bacteria | 3294 |
| 361 | Ga0207644_10002517 | 3300025931 | Bacteria | 11780 |
| 362 | Ga0207706_10003473 | 3300025933 | Bacteria | 15041 |
| 363 | Ga0207706_10006013 | 3300025933 | Bacteria | 11288 |
| 364 | Ga0207706_10048241 | 3300025933 | Bacteria | 3766 |
| 365 | Ga0207706_10078262 | 3300025933 | Bacteria | 2908 |
| 366 | Ga0207706_10130753 | 3300025933 | Bacteria | 2208 |
| 367 | Ga0207686_10028325 | 3300025934 | Bacteria | 3292 |
| 368 | Ga0207686_10045431 | 3300025934 | Bacteria | 2702 |
| 369 | Ga0207709_10033163 | 3300025935 | Bacteria | 3029 |
| 370 | Ga0207670_10003124 | 3300025936 | Bacteria | 8763 |
| 371 | Ga0207670_10008107 | 3300025936 | Bacteria | 5911 |
| 372 | Ga0207670_10100693 | 3300025936 | Bacteria | 2063 |
| 373 | Ga0207669_10003145 | 3300025937 | Bacteria | 7121 |
| 374 | Ga0207704_10042233 | 3300025938 | Unclassified | 2682 |
| 375 | Ga0207704_10054000 | 3300025938 | Bacteria | 2446 |
| 376 | Ga0207665_10002707 | 3300025939 | Bacteria | 11886 |
| 377 | Ga0207665_10007285 | 3300025939 | Bacteria | 7319 |
| 378 | Ga0207665_10035777 | 3300025939 | Unclassified | 3298 |
| 379 | Ga0207691_10000071 | 3300025940 | Bacteria | 83980 |
| 380 | Ga0207691_10006497 | 3300025940 | Bacteria | 11290 |
| 381 | Ga0207691_10014961 | 3300025940 | Bacteria | 7390 |
| 382 | Ga0207691_10025047 | 3300025940 | Bacteria | 5606 |
| 383 | Ga0207711_10014596 | 3300025941 | Bacteria | 6528 |
| 384 | Ga0207711_10149066 | 3300025941 | Bacteria | 2110 |
| 385 | Ga0207689_10038924 | 3300025942 | Unclassified | 3937 |
| 386 | Ga0207661_10004972 | 3300025944 | Bacteria | 9326 |
| 387 | Ga0207679_10009368 | 3300025945 | Bacteria | 6272 |
| 388 | Ga0207667_10006069 | 3300025949 | Bacteria | 14691 |
| 389 | Ga0207667_10049431 | 3300025949 | Bacteria | 4441 |
| 390 | Ga0207667_10064160 | 3300025949 | Bacteria | 3836 |
| 391 | Ga0207667_10274294 | 3300025949 | Bacteria | 1724 |
| 392 | Ga0207651_10000346 | 3300025960 | Bacteria | 19732 |
| 393 | Ga0207651_10039398 | 3300025960 | Bacteria | 3116 |
| 394 | Ga0207640_10002629 | 3300025981 | Bacteria | 9626 |
| 395 | Ga0207640_10007488 | 3300025981 | Bacteria | 6031 |
| 396 | Ga0207640_10122549 | 3300025981 | Unclassified | 1866 |
| 397 | Ga0207677_10016898 | 3300026023 | Bacteria | 4334 |
| 398 | Ga0207677_10027424 | 3300026023 | Bacteria | 3587 |
| 399 | Ga0207677_10060882 | 3300026023 | Bacteria | 2612 |
| 400 | Ga0207677_10086348 | 3300026023 | Bacteria | 2268 |
| 401 | Ga0207703_10001910 | 3300026035 | Bacteria | 18464 |
| 402 | Ga0207703_10029451 | 3300026035 | Bacteria | 4332 |
| 403 | Ga0207678_10000874 | 3300026067 | Bacteria | 27662 |
| 404 | Ga0207678_10134065 | 3300026067 | Bacteria | 2113 |
| 405 | Ga0207708_10012471 | 3300026075 | Bacteria | 6335 |
| 406 | Ga0207702_10005378 | 3300026078 | Bacteria | 11216 |
| 407 | Ga0207641_10055387 | 3300026088 | Bacteria | 3367 |
| 408 | Ga0207648_10001255 | 3300026089 | Bacteria | 28363 |
| 409 | Ga0207648_10034527 | 3300026089 | Bacteria | 4457 |
| 410 | Ga0207648_10095760 | 3300026089 | Bacteria | 2597 |
| 411 | Ga0207676_10002505 | 3300026095 | Bacteria | 13088 |
| 412 | Ga0207676_10008322 | 3300026095 | Bacteria | 7373 |
| 413 | Ga0207676_10020204 | 3300026095 | Bacteria | 4869 |
| 414 | Ga0207676_10102311 | 3300026095 | Unclassified | 2378 |
| 415 | Ga0207674_10007174 | 3300026116 | Bacteria | 13015 |
| 416 | Ga0207674_10038394 | 3300026116 | Bacteria | 4971 |
| 417 | Ga0207674_10055814 | 3300026116 | Bacteria | 4014 |
| 418 | Ga0207674_10075303 | 3300026116 | Bacteria | 3385 |
| 419 | Ga0207675_100006796 | 3300026118 | Bacteria | 10827 |
| 420 | Ga0207675_100023243 | 3300026118 | Bacteria | 5765 |
| 421 | Ga0207683_10000573 | 3300026121 | Bacteria | 34080 |
| 422 | Ga0207683_10000607 | 3300026121 | Bacteria | 33032 |
| 423 | Ga0207683_10025245 | 3300026121 | Bacteria | 5125 |
| 424 | Ga0207683_10176671 | 3300026121 | Bacteria | 1935 |
| 425 | Ga0207698_10001341 | 3300026142 | Bacteria | 14333 |
| 426 | Ga0209179_1000086 | 3300027512 | Bacteria | 14025 |
| 427 | Ga0207428_10000442 | 3300027907 | Bacteria | 50837 |
| 428 | Ga0207428_10002086 | 3300027907 | Bacteria | 20130 |
| 429 | Ga0207428_10003307 | 3300027907 | Bacteria | 15678 |
| 430 | Ga0207428_10009261 | 3300027907 | Bacteria | 8841 |
| 431 | Ga0268266_10114429 | 3300028379 | Bacteria | 2394 |
| 432 | Ga0268266_10155923 | 3300028379 | Bacteria | 2062 |
| 433 | Ga0268265_10000237 | 3300028380 | Bacteria | 62935 |
| 434 | Ga0268264_10001084 | 3300028381 | Bacteria | 26936 |
| 435 | Ga0268264_10018583 | 3300028381 | Bacteria | 5684 |
| 436 | Ga0268264_10029004 | 3300028381 | Bacteria | 4531 |
| 437 | Ga0268264_10077994 | 3300028381 | Unclassified | 2823 |
| 438 | Ga0265337_1000441 | 3300028556 | Bacteria | 22052 |
| 439 | Ga0265326_10002006 | 3300028558 | Bacteria | 6959 |
| 440 | Ga0265319_1004110 | 3300028563 | Bacteria | 7323 |
| 441 | Ga0265319_1005369 | 3300028563 | Bacteria | 6145 |
| 442 | Ga0265319_1030511 | 3300028563 | Bacteria | 1885 |
| 443 | Ga0265334_10007200 | 3300028573 | Bacteria | 4775 |
| 444 | Ga0265318_10000389 | 3300028577 | Bacteria | 34282 |
| 445 | Ga0265318_10007501 | 3300028577 | Bacteria | 4927 |
| 446 | Ga0265323_10000508 | 3300028653 | Bacteria | 21758 |
| 447 | Ga0265323_10006216 | 3300028653 | Bacteria | 5029 |
| 448 | Ga0265322_10001506 | 3300028654 | Bacteria | 7565 |
| 449 | Ga0265336_10001214 | 3300028666 | Bacteria | 12222 |
| 450 | Ga0265338_10000257 | 3300028800 | Bacteria | 96951 |
| 451 | Ga0265338_10003601 | 3300028800 | Bacteria | 21624 |
| 452 | Ga0265338_10006415 | 3300028800 | Bacteria | 14995 |
| 453 | Ga0265338_10008539 | 3300028800 | Bacteria | 12405 |
| 454 | Ga0265338_10023649 | 3300028800 | Bacteria | 6306 |
| 455 | Ga0265338_10026728 | 3300028800 | Bacteria | 5808 |
| 456 | Ga0265338_10066956 | 3300028800 | Unclassified | 3105 |
| 457 | Ga0265324_10002503 | 3300029957 | Bacteria | 9331 |
| 458 | Ga0265324_10016792 | 3300029957 | Bacteria | 2665 |
| 459 | Ga0265760_10002408 | 3300031090 | Bacteria | 5463 |
| 460 | Ga0265760_10007428 | 3300031090 | Bacteria | 3133 |
| 461 | Ga0265760_10022377 | 3300031090 | Bacteria | 1831 |
| 462 | Ga0265330_10001184 | 3300031235 | Bacteria | 15470 |
| 463 | Ga0265330_10004502 | 3300031235 | Bacteria | 7067 |
| 464 | Ga0265330_10008012 | 3300031235 | Bacteria | 5117 |
| 465 | Ga0265330_10049061 | 3300031235 | Bacteria | 1856 |
| 466 | Ga0265332_10000044 | 3300031238 | Bacteria | 114444 |
| 467 | Ga0265332_10000361 | 3300031238 | Bacteria | 33818 |
| 468 | Ga0265332_10001310 | 3300031238 | Bacteria | 14172 |
| 469 | Ga0265332_10046701 | 3300031238 | Bacteria | 1865 |
| 470 | Ga0265328_10013000 | 3300031239 | Bacteria | 3301 |
| 471 | Ga0265328_10013091 | 3300031239 | Bacteria | 3290 |
| 472 | Ga0265320_10000444 | 3300031240 | Bacteria | 32390 |
| 473 | Ga0265325_10003182 | 3300031241 | Bacteria | 10800 |
| 474 | Ga0265325_10004663 | 3300031241 | Bacteria | 8602 |
| 475 | Ga0265325_10011487 | 3300031241 | Bacteria | 5085 |
| 476 | Ga0265325_10012362 | 3300031241 | Bacteria | 4885 |
| 477 | Ga0265325_10014433 | 3300031241 | Bacteria | 4465 |
| 478 | Ga0265329_10000898 | 3300031242 | Bacteria | 14917 |
| 479 | Ga0265329_10004863 | 3300031242 | Bacteria | 5508 |
| 480 | Ga0265329_10028508 | 3300031242 | Bacteria | 1830 |
| 481 | Ga0265340_10015605 | 3300031247 | Bacteria | 3945 |
| 482 | Ga0265340_10034337 | 3300031247 | Bacteria | 2523 |
| 483 | Ga0265339_10000245 | 3300031249 | Bacteria | 43619 |
| 484 | Ga0265339_10012897 | 3300031249 | Bacteria | 5082 |
| 485 | Ga0265339_10032574 | 3300031249 | Bacteria | 2939 |
| 486 | Ga0265331_10000076 | 3300031250 | Bacteria | 145884 |
| 487 | Ga0265331_10001532 | 3300031250 | Bacteria | 17026 |
| 488 | Ga0265331_10005198 | 3300031250 | Bacteria | 7905 |
| 489 | Ga0265327_10034465 | 3300031251 | Bacteria | 2809 |
| 490 | Ga0265316_10000006 | 3300031344 | Bacteria | 289686 |
| 491 | Ga0265316_10001703 | 3300031344 | Bacteria | 23319 |
| 492 | Ga0265316_10004811 | 3300031344 | Bacteria | 13322 |
| 493 | Ga0307509_10000488 | 3300031507 | Bacteria | 67229 |
| 494 | Ga0307408_100008217 | 3300031548 | Bacteria | 6889 |
| 495 | Ga0265313_10002783 | 3300031595 | Bacteria | 14749 |
| 496 | Ga0265313_10036627 | 3300031595 | Bacteria | 2461 |
| 497 | Ga0316579_10001211 | 3300031691 | Bacteria | 9250 |
| 498 | Ga0265314_10000056 | 3300031711 | Bacteria | 171647 |
| 499 | Ga0265314_10000378 | 3300031711 | Bacteria | 60930 |
| 500 | Ga0265314_10001444 | 3300031711 | Bacteria | 26575 |
| 501 | Ga0265314_10002399 | 3300031711 | Bacteria | 19261 |
| 502 | Ga0265342_10001152 | 3300031712 | Bacteria | 25203 |
| 503 | Ga0265342_10003673 | 3300031712 | Bacteria | 12454 |
| 504 | Ga0265342_10075626 | 3300031712 | Bacteria | 1953 |
| 505 | Ga0307516_10019164 | 3300031730 | Bacteria | 7092 |
| 506 | Ga0307405_10007998 | 3300031731 | Bacteria | 5332 |
| 507 | Ga0307405_10010309 | 3300031731 | Bacteria | 4833 |
| 508 | Ga0307405_10018167 | 3300031731 | Bacteria | 3875 |
| 509 | Ga0316577_10024381 | 3300031733 | Bacteria | 3363 |
| 510 | Ga0307410_10011774 | 3300031852 | Bacteria | 5021 |
| 511 | Ga0307410_10015761 | 3300031852 | Bacteria | 4491 |
| 512 | Ga0307407_10006608 | 3300031903 | Bacteria | 5176 |
| 513 | Ga0307407_10011965 | 3300031903 | Bacteria | 4154 |
| 514 | Ga0307412_10058418 | 3300031911 | Bacteria | 2580 |
| 515 | Ga0307409_100030573 | 3300031995 | Bacteria | 3871 |
| 516 | Ga0307416_100001676 | 3300032002 | Bacteria | 12247 |
| 517 | Ga0307416_100008926 | 3300032002 | Bacteria | 6515 |
| 518 | Ga0307416_100011349 | 3300032002 | Bacteria | 5933 |
| 519 | Ga0307416_100014111 | 3300032002 | Bacteria | 5457 |
| 520 | Ga0307416_100198985 | 3300032002 | Bacteria | 1899 |
| 521 | Ga0307411_10003321 | 3300032005 | Bacteria | 7442 |
| 522 | Ga0307411_10029795 | 3300032005 | Bacteria | 3339 |
| 523 | Ga0307411_10064631 | 3300032005 | Bacteria | 2451 |
| 524 | Ga0307411_10088312 | 3300032005 | Bacteria | 2156 |
| 525 | Ga0307415_100006569 | 3300032126 | Bacteria | 6287 |
| 526 | Ga0307415_100016964 | 3300032126 | Bacteria | 4355 |
| 527 | Ga0307415_100021232 | 3300032126 | Bacteria | 3986 |
| 528 | Ga0316593_10038238 | 3300032168 | Bacteria | 1588 |
| 529 | Ga0373930_0002470 | 3300034816 | Unclassified | 2859 |
| 530 | Ga0373929_0011324 | 3300035085 | Unclassified | 1680 |
| 531 | Ga0373934_0006571 | 3300035086 | Bacteria | 4312 |
| 532 | Ga0373934_0038249 | 3300035086 | Bacteria | 1889 |
| 533 | Ga0373934_0057453 | 3300035086 | Bacteria | 1548 |
| 534 | Ga0373936_0010113 | 3300035113 | Unclassified | 3564 |
| 535 | Ga0373953_0004534 | 3300035117 | Bacteria | 4434 |
| 536 | Ga0373956_0002137 | 3300035119 | Bacteria | 8180 |
| 537 | Ga0373956_0014257 | 3300035119 | Bacteria | 3318 |
| 538 | Ga0373943_0069875 | 3300035170 | Bacteria | 1776 |
| 539 | Ga0373955_0002881 | 3300035172 | Bacteria | 7543 |
| 540 | Ga0316574_0010097 | 3300035398 | Bacteria | 5317 |
| 541 | Ga0373931_0021193 | 3300035691 | Bacteria | 3260 |
| 542 | Ga0373931_0047740 | 3300035691 | Bacteria | 2267 |
| 543 | Ga0373927_0005509 | 3300035695 | Bacteria | 8721 |
| 544 | Ga0373927_0022499 | 3300035695 | Bacteria | 4129 |
| 545 | Ga0373927_0048489 | 3300035695 | Bacteria | 2748 |
| 546 | Ga0373927_0051072 | 3300035695 | Bacteria | 2674 |
| 547 | Ga0373933_0000430 | 3300035724 | Bacteria | 26421 |
| 548 | Ga0373933_0002012 | 3300035724 | Bacteria | 11723 |
| 549 | Ga0373933_0025244 | 3300035724 | Bacteria | 3407 |
| 550 | Ga0373947_0027787 | 3300035725 | Bacteria | 3313 |
| 551 | Ga0373947_0041277 | 3300035725 | Bacteria | 2750 |
| 552 | Ga0373937_0000559 | 3300036401 | Bacteria | 33006 |
| 553 | Ga0373937_0026218 | 3300036401 | Bacteria | 5266 |
| 554 | Ga0373937_0040267 | 3300036401 | Bacteria | 4259 |
| 555 | Ga0373937_0047014 | 3300036401 | Bacteria | 3948 |
| 556 | Ga0316584_0019264 | 3300036712 | Bacteria | 4932 |
| 557 | Ga0373925_0001264 | 3300037068 | Bacteria | 22304 |
| 558 | Ga0373925_0012759 | 3300037068 | Bacteria | 6087 |
| 559 | Ga0373925_0012943 | 3300037068 | Bacteria | 6044 |
| 560 | Ga0373925_0107244 | 3300037068 | Bacteria | 2154 |
| 561 | Ga0395905_0039280 | 3300037471 | Bacteria | 4440 |
| 562 | Ga0395905_0040991 | 3300037471 | Bacteria | 4344 |
| 563 | Ga0395905_0138296 | 3300037471 | Unclassified | 2292 |
| 564 | Ga0436364_0398603 | 3300037853 | Bacteria | 3909 |
| 565 | Ga0436364_1070510 | 3300037853 | Bacteria | 12704 |
| 566 | Ga0436365_1746299 | 3300039437 | Unclassified | 1635 |
| 567 | Ga0436365_1778402 | 3300039437 | Bacteria | 3215 |
| 568 | Ga0436360_1040293 | 3300039438 | Bacteria | 9682 |
| 569 | Ga0436360_1294278 | 3300039438 | Bacteria | 6107 |
| 570 | Ga0436361_0533922 | 3300039447 | Bacteria | 24051 |
| 571 | Ga0436361_0550373 | 3300039447 | Bacteria | 8540 |
| 572 | Ga0436361_1111084 | 3300039447 | Bacteria | 8152 |
| 573 | Ga0451849_1129382 | 3300041505 | Bacteria | 3043 |
| 574 | Ga0451853_0598962 | 3300041512 | Bacteria | 1924 |
| 575 | Ga0450896_000020 | 3300042133 | Bacteria | 8737 |
| 576 | Ga0450908_009935 | 3300042184 | Bacteria | 1761 |
| 577 | Ga0451577_0000102 | 3300042876 | Bacteria | 188094 |
| 578 | Ga0451577_0000109 | 3300042876 | Bacteria | 183296 |
| 579 | Ga0451577_0000158 | 3300042876 | Bacteria | 151857 |
| 580 | Ga0451577_0030087 | 3300042876 | Bacteria | 4907 |
| 581 | Ga0451577_0082264 | 3300042876 | Bacteria | 2872 |
| 582 | Ga0451577_0093061 | 3300042876 | Bacteria | 2692 |
| 583 | Ga0451577_0132810 | 3300042876 | Bacteria | 2234 |
| 584 | Ga0451577_0211197 | 3300042876 | Bacteria | 1753 |
| 585 | Ga0453683_0006726 | 3300044673 | Bacteria | 7860 |
| 586 | Ga0466963_0010778 | 3300044694 | Bacteria | 5549 |
| 587 | Ga0466963_0012505 | 3300044694 | Bacteria | 5199 |
| 588 | Ga0466963_0024022 | 3300044694 | Bacteria | 3877 |
| 589 | Ga0453684_0000004 | 3300044712 | Bacteria | 1469893 |
| 590 | Ga0453684_0000089 | 3300044712 | Bacteria | 395064 |
| 591 | Ga0453684_0000249 | 3300044712 | Bacteria | 232232 |
| 592 | Ga0453684_0062536 | 3300044712 | Bacteria | 4767 |
| 593 | Ga0453684_0112915 | 3300044712 | Bacteria | 3297 |
| 594 | Ga0453684_0180712 | 3300044712 | Bacteria | 2477 |
| 595 | Ga0453684_0286335 | 3300044712 | Bacteria | 1877 |
| 596 | Ga0451576_0033144 | 3300045051 | Bacteria | 5491 |
| 597 | Ga0451576_0053960 | 3300045051 | Bacteria | 4208 |
| 598 | Ga0451576_0076045 | 3300045051 | Bacteria | 3494 |
| 599 | Ga0495592_0057597 | 3300046454 | Bacteria | 2868 |
| 600 | Ga0495592_0120756 | 3300046454 | Bacteria | 1844 |
| 601 | Ga0495603_0114710 | 3300046455 | Bacteria | 1571 |
| 602 | Ga0495653_0018444 | 3300046463 | Bacteria | 5665 |
| 603 | Ga0495580_0051758 | 3300046472 | Bacteria | 2902 |
| 604 | Ga0495580_0059731 | 3300046472 | Bacteria | 2679 |
| 605 | Ga0495580_0062866 | 3300046472 | Unclassified | 2604 |
| 606 | Ga0495580_0131040 | 3300046472 | Bacteria | 1739 |
| 607 | Ga0495582_0005957 | 3300046473 | Bacteria | 6796 |
| 608 | Ga0495584_0048033 | 3300046491 | Bacteria | 2152 |
| 609 | Ga0495594_0002079 | 3300046499 | Bacteria | 10426 |
| 610 | Ga0495608_0040191 | 3300046511 | Bacteria | 3134 |
| 611 | Ga0495608_0062993 | 3300046511 | Bacteria | 2435 |
| 612 | Ga0495628_0013834 | 3300046516 | Bacteria | 6780 |
| 613 | Ga0495628_0127524 | 3300046516 | Bacteria | 1948 |
| 614 | Ga0495666_0016631 | 3300046526 | Bacteria | 3663 |
| 615 | Ga0495587_0001108 | 3300046536 | Bacteria | 17717 |
| 616 | Ga0495587_0005236 | 3300046536 | Bacteria | 8478 |
| 617 | Ga0495609_0045151 | 3300046538 | Bacteria | 1975 |
| 618 | Ga0495621_0006236 | 3300046539 | Bacteria | 3468 |
| 619 | Ga0495645_0036742 | 3300046543 | Bacteria | 3570 |
| 620 | Ga0495633_0045297 | 3300046558 | Bacteria | 2083 |
| 621 | Ga0495667_0022547 | 3300046559 | Bacteria | 4242 |
| 622 | Ga0495656_0025467 | 3300046615 | Bacteria | 2346 |
| 623 | Ga0495635_0144151 | 3300046663 | Bacteria | 1622 |
| 624 | Ga0495588_0004739 | 3300046674 | Bacteria | 6014 |
| 625 | Ga0495657_0005190 | 3300046675 | Bacteria | 10314 |
| 626 | Ga0495657_0044161 | 3300046675 | Bacteria | 3033 |
| 627 | Ga0495657_0054749 | 3300046675 | Bacteria | 2664 |
| 628 | Ga0495599_0034933 | 3300046678 | Bacteria | 3156 |
| 629 | Ga0495599_0079049 | 3300046678 | Bacteria | 2054 |
| 630 | Ga0495623_0005481 | 3300046679 | Bacteria | 8295 |
| 631 | Ga0495623_0027249 | 3300046679 | Bacteria | 3675 |
| 632 | Ga0495658_0053040 | 3300046683 | Bacteria | 2302 |
| 633 | Ga0495669_0011319 | 3300046684 | Bacteria | 3787 |
| 634 | Ga0495624_0042324 | 3300046690 | Bacteria | 2910 |
| 635 | Ga0495604_0022619 | 3300047317 | Bacteria | 5019 |
| 636 | Ga0495604_0037431 | 3300047317 | Bacteria | 3821 |
| 637 | Ga0495636_0000406 | 3300047318 | Bacteria | 16124 |
| 638 | Ga0495674_0037716 | 3300047319 | Bacteria | 4342 |
| 639 | Ga0495674_0064218 | 3300047319 | Bacteria | 3192 |
| 640 | Ga0495674_0184286 | 3300047319 | Bacteria | 1737 |
| 641 | Ga0495672_0003359 | 3300047320 | Bacteria | 13780 |
| 642 | Ga0495677_0016693 | 3300047445 | Bacteria | 2663 |
| 643 | Ga0495685_034142 | 3300047447 | Bacteria | 1748 |
| 644 | Ga0495684_0003665 | 3300047471 | Bacteria | 11972 |
| 645 | Ga0495684_0024704 | 3300047471 | Bacteria | 4623 |
| 646 | Ga0495684_0063353 | 3300047471 | Bacteria | 2811 |
| 647 | Ga0495593_0007862 | 3300047673 | Bacteria | 6210 |
| 648 | Ga0495602_0000224 | 3300048088 | Bacteria | 52889 |
| 649 | Ga0495602_0048875 | 3300048088 | Bacteria | 3795 |
| 650 | Ga0495614_0020467 | 3300048089 | Bacteria | 2861 |
| 651 | Ga0496101_0007379 | 3300048904 | Bacteria | 7121 |
| 652 | Ga0496102_0005869 | 3300048905 | Bacteria | 10453 |
| 653 | Ga0496102_0047284 | 3300048905 | Bacteria | 3909 |
| 654 | Ga0496102_0192801 | 3300048905 | Bacteria | 1920 |
| 655 | Ga0496103_0004547 | 3300048906 | Bacteria | 8397 |
| 656 | Ga0496103_0020642 | 3300048906 | Bacteria | 3958 |
| 657 | Ga0496103_0090834 | 3300048906 | Bacteria | 1927 |
| 658 | Ga0496104_0004986 | 3300048907 | Bacteria | 11589 |
| 659 | Ga0496104_0053014 | 3300048907 | Bacteria | 3832 |
| 660 | Ga0496104_0066908 | 3300048907 | Bacteria | 3412 |
| 661 | Ga0496104_0068324 | 3300048907 | Bacteria | 3377 |
| 662 | Ga0496104_0086402 | 3300048907 | Bacteria | 2994 |
| 663 | Ga0496104_0130566 | 3300048907 | Bacteria | 2413 |
| 664 | Ga0496104_0154594 | 3300048907 | Bacteria | 2202 |
| 665 | Ga0496104_0234036 | 3300048907 | Bacteria | 1749 |
| 666 | Ga0496105_0017162 | 3300048908 | Bacteria | 5798 |
| 667 | Ga0496105_0116732 | 3300048908 | Bacteria | 2201 |
| 668 | Ga0496106_0051023 | 3300048909 | Bacteria | 3119 |
| 669 | Ga0496106_0086181 | 3300048909 | Bacteria | 2419 |
| 670 | Ga0496106_0117371 | 3300048909 | Bacteria | 2077 |
| 671 | Ga0496107_0175745 | 3300048910 | Bacteria | 1590 |
| 672 | Ga0496108_0006000 | 3300048911 | Bacteria | 9839 |
| 673 | Ga0496108_0017528 | 3300048911 | Bacteria | 5860 |
| 674 | Ga0496108_0030209 | 3300048911 | Bacteria | 4491 |
| 675 | Ga0496108_0064446 | 3300048911 | Bacteria | 3087 |
| 676 | Ga0496108_0187089 | 3300048911 | Bacteria | 1794 |
| 677 | Ga0496109_0036399 | 3300048912 | Bacteria | 4442 |
| 678 | Ga0496109_0071646 | 3300048912 | Bacteria | 3182 |
| 679 | Ga0496109_0189177 | 3300048912 | Bacteria | 1934 |
| 680 | Ga0496109_0210804 | 3300048912 | Bacteria | 1827 |
| 681 | Ga0496110_0025238 | 3300048913 | Bacteria | 5077 |
| 682 | Ga0496110_0067830 | 3300048913 | Bacteria | 3157 |
| 683 | Ga0496110_0080295 | 3300048913 | Bacteria | 2906 |
| 684 | Ga0496111_0008000 | 3300048914 | Bacteria | 6973 |
| 685 | Ga0496112_0140827 | 3300048915 | Bacteria | 2381 |
| 686 | Ga0496112_0174969 | 3300048915 | Unclassified | 2111 |
| 687 | Ga0496113_0036162 | 3300048916 | Bacteria | 3617 |
| 688 | Ga0496113_0060786 | 3300048916 | Bacteria | 2849 |
| 689 | Ga0496114_0015698 | 3300048917 | Bacteria | 6094 |
| 690 | Ga0496114_0017198 | 3300048917 | Bacteria | 5832 |
| 691 | Ga0496114_0101444 | 3300048917 | Bacteria | 2457 |
| 692 | Ga0496115_0065835 | 3300048918 | Bacteria | 2927 |
| 693 | Ga0496115_0180398 | 3300048918 | Bacteria | 1746 |
| 694 | Ga0496126_0002019 | 3300048929 | Bacteria | 28695 |
| 695 | Ga0501305_001597 | 3300049161 | Bacteria | 2258 |
| 696 | Ga0501312_000200 | 3300049528 | Bacteria | 4089 |
| 697 | Ga0501316_000560 | 3300049532 | Bacteria | 2645 |
| 698 | Ga0501031_0004849 | 3300049568 | Bacteria | 8744 |
| 699 | Ga0501031_0160870 | 3300049568 | Bacteria | 1468 |
| 700 | Ga0501032_0009137 | 3300049569 | Bacteria | 7192 |
| 701 | Ga0501033_0008182 | 3300049570 | Bacteria | 8099 |
| 702 | Ga0501034_0006699 | 3300049571 | Bacteria | 12352 |
| 703 | Ga0501034_0125183 | 3300049571 | Bacteria | 2555 |
| 704 | Ga0501036_0007251 | 3300049572 | Bacteria | 9028 |
| 705 | Ga0501037_0001533 | 3300049573 | Bacteria | 16839 |
| 706 | Ga0501038_0023730 | 3300049574 | Bacteria | 5480 |
| 707 | Ga0501039_0000786 | 3300049575 | Bacteria | 22808 |
| 708 | Ga0501046_0003375 | 3300049580 | Bacteria | 14657 |
| 709 | Ga0501047_0017702 | 3300049581 | Bacteria | 6825 |
| 710 | Ga0501048_0009039 | 3300049582 | Bacteria | 7499 |
| 711 | Ga0501067_0005842 | 3300049583 | Bacteria | 6825 |
| 712 | Ga0501067_0034245 | 3300049583 | Bacteria | 2819 |
| 713 | Ga0501068_0000590 | 3300049584 | Bacteria | 18437 |
| 714 | Ga0501068_0025595 | 3300049584 | Bacteria | 3471 |
| 715 | Ga0501069_0009057 | 3300049585 | Bacteria | 5254 |
| 716 | Ga0501070_0073897 | 3300049586 | Bacteria | 2821 |
| 717 | Ga0501072_0010906 | 3300049588 | Bacteria | 6932 |
| 718 | Ga0501072_0120618 | 3300049588 | Bacteria | 2089 |
| 719 | Ga0501073_0001480 | 3300049589 | Bacteria | 17400 |
| 720 | Ga0501075_0010511 | 3300049591 | Bacteria | 6505 |
| 721 | Ga0501075_0024904 | 3300049591 | Bacteria | 4393 |
| 722 | Ga0501075_0104506 | 3300049591 | Bacteria | 2153 |
| 723 | Ga0501076_0005325 | 3300049592 | Bacteria | 9235 |
| 724 | Ga0501076_0006632 | 3300049592 | Bacteria | 8397 |
| 725 | Ga0501076_0011377 | 3300049592 | Bacteria | 6624 |
| 726 | Ga0501077_0041991 | 3300049593 | Bacteria | 2910 |
| 727 | Ga0501079_0007454 | 3300049741 | Bacteria | 8274 |
| 728 | Ga0501079_0028221 | 3300049741 | Bacteria | 4306 |
| 729 | Ga0501079_0176754 | 3300049741 | Bacteria | 1665 |
| 730 | Ga0501080_0000482 | 3300049742 | Bacteria | 30997 |
| 731 | Ga0501080_0071677 | 3300049742 | Bacteria | 3223 |
| 732 | Ga0501081_0020439 | 3300049743 | Bacteria | 4413 |
| 733 | Ga0501081_0061225 | 3300049743 | Bacteria | 2609 |
| 734 | Ga0501083_0026806 | 3300049744 | Bacteria | 3981 |
| 735 | Ga0501044_0047477 | 3300049823 | Bacteria | 4440 |
| 736 | nmdc:mga00v17_19433_c1 | 3300050491 | Bacteria | 3878 |
| 737 | nmdc:mga0k408_2628_c1 | 3300050493 | Bacteria | 9547 |
| 738 | nmdc:mga0k408_9107_c1 | 3300050493 | Bacteria | 5346 |
| 739 | nmdc:mga0k408_91323_c1 | 3300050493 | Bacteria | 1789 |
| 740 | nmdc:mga07m45_22076_c1 | 3300050496 | Bacteria | 3473 |
| 741 | nmdc:mga05p37_105628_c1 | 3300050507 | Bacteria | 3464 |
| 742 | nmdc:mga05p37_121253_c1 | 3300050507 | Bacteria | 3212 |
| 743 | nmdc:mga05p37_175596_c1 | 3300050507 | Bacteria | 2610 |
| 744 | nmdc:mga05p37_212581_c1 | 3300050507 | Bacteria | 2337 |
| 745 | nmdc:mga05p37_2349_c1 | 3300050507 | Bacteria | 22009 |
| 746 | nmdc:mga05p37_306690_c1 | 3300050507 | Bacteria | 1883 |
| 747 | nmdc:mga05p37_47559_c1 | 3300050507 | Bacteria | 5275 |
| 748 | nmdc:mga05p37_5343_c1 | 3300050507 | Bacteria | 15087 |
| 749 | nmdc:mga09592_19340_c1 | 3300050508 | Bacteria | 5591 |
| 750 | nmdc:mga09592_2431_c1 | 3300050508 | Bacteria | 15020 |
| 751 | nmdc:mga09592_55768_c1 | 3300050508 | Bacteria | 3339 |
| 752 | nmdc:mga09592_95968_c1 | 3300050508 | Bacteria | 2536 |
| 753 | nmdc:mga08y16_101662_c1 | 3300050511 | Bacteria | 2993 |
| 754 | nmdc:mga08y16_1680_c1 | 3300050511 | Bacteria | 19401 |
| 755 | nmdc:mga08y16_522_c1 | 3300050511 | Bacteria | 35470 |
| 756 | nmdc:mga08y16_5506_c1 | 3300050511 | Bacteria | 13244 |
| 757 | nmdc:mga08y16_59693_c1 | 3300050511 | Bacteria | 3984 |
| 758 | nmdc:mga0n895_105864_c1 | 3300050512 | Bacteria | 2826 |
| 759 | nmdc:mga0n895_1794_c1 | 3300050512 | Bacteria | 16309 |
| 760 | nmdc:mga0n895_22667_c1 | 3300050512 | Bacteria | 5889 |
| 761 | nmdc:mga0n895_2718_c1 | 3300050512 | Bacteria | 13953 |
| 762 | nmdc:mga0n895_41240_c1 | 3300050512 | Bacteria | 4486 |
| 763 | nmdc:mga0n895_57853_c1 | 3300050512 | Unclassified | 3822 |
| 764 | nmdc:mga0n895_80237_c1 | 3300050512 | Bacteria | 3251 |
| 765 | nmdc:mga0rr50_136040_c1 | 3300050513 | Bacteria | 1972 |
| 766 | nmdc:mga08x19_43853_c1 | 3300050514 | Bacteria | 2854 |
| 767 | nmdc:mga08x19_65863_c1 | 3300050514 | Bacteria | 2354 |
| 768 | nmdc:mga0a205_12899_c1 | 3300050515 | Bacteria | 7752 |
| 769 | nmdc:mga0a205_147706_c1 | 3300050515 | Bacteria | 2251 |
| 770 | Ga0495601_0001879 | 3300053077 | Bacteria | 11721 |
| 771 | Ga0495601_0007359 | 3300053077 | Bacteria | 6456 |
| 772 | Ga0495601_0059367 | 3300053077 | Bacteria | 2425 |
| 773 | Ga0495612_0002105 | 3300053078 | Bacteria | 8176 |
| 774 | Ga0500635_0002341 | 3300053080 | Bacteria | 4681 |
| 775 | Ga0500566_0001395 | 3300053094 | Bacteria | 14131 |
| 776 | Ga0500641_0010892 | 3300053096 | Bacteria | 3296 |
| 777 | Ga0500568_0001372 | 3300053139 | Bacteria | 15819 |
| 778 | Ga0500603_000517 | 3300053150 | Bacteria | 9791 |
| 779 | Ga0500616_0047208 | 3300053153 | Bacteria | 2287 |
| 780 | Ga0501084_0003880 | 3300054114 | Bacteria | 12170 |
| 781 | Ga0501084_0054775 | 3300054114 | Bacteria | 3336 |
| 782 | Ga0501084_0055812 | 3300054114 | Bacteria | 3305 |
| 783 | Ga0590071_007783 | 3300059421 | Bacteria | 2533 |
| 784 | Ga0590077_000129 | 3300059426 | Bacteria | 20394 |
| 785 | Ga0501082_0009933 | 3300060353 | Bacteria | 8206 |
| 786 | Ga0466962_0016740 | 3300061719 | Bacteria | 3534 |
| 787 | Ga0530510_0004512 | 3300061734 | Bacteria | 9639 |
| 788 | Ga0530510_0015379 | 3300061734 | Bacteria | 5407 |
| 789 | Ga0530510_0072776 | 3300061734 | Bacteria | 2495 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039438 | Ga0436360_1040293 | Ga0436360_1040293_8468_9664 | 396 |
| 2 | 3300048911 | Ga0496108_0030209 | Ga0496108_0030209_21_1280 | 405 |
| 3 | 3300037068 | Ga0373925_0107244 | Ga0373925_0107244_23_1255 | 409 |
| 4 | 3300048909 | Ga0496106_0117371 | Ga0496106_0117371_36_1322 | 410 |
| 5 | 3300035113 | Ga0373936_0010113 | Ga0373936_0010113_128_1390 | 413 |
| 6 | 3300046663 | Ga0495635_0144151 | Ga0495635_0144151_281_1603 | 415 |
| 7 | 3300046516 | Ga0495628_0013834 | Ga0495628_0013834_25_1380 | 419 |
| 8 | 3300006871 | Ga0075434_100003880 | Ga0075434_1000038806 | 427 |
| 9 | 3300007076 | Ga0075435_100007984 | Ga0075435_1000079844 | 427 |
| 10 | 3300031691 | Ga0316579_10001211 | Ga0316579_100012114 | 432 |
| 11 | 3300031733 | Ga0316577_10024381 | Ga0316577_100243812 | 432 |
| 12 | 3300032168 | Ga0316593_10038238 | Ga0316593_100382381 | 432 |
| 13 | 3300036712 | Ga0316584_0019264 | Ga0316584_0019264_775_2214 | 432 |
| 14 | 3300009094 | Ga0111539_10000563 | Ga0111539_1000056321 | 433 |
| 15 | 3300009147 | Ga0114129_10177944 | Ga0114129_101779443 | 433 |
| 16 | 3300013102 | Ga0157371_10015522 | Ga0157371_100155223 | 433 |
| 17 | 3300013297 | Ga0157378_10001428 | Ga0157378_1000142817 | 433 |
| 18 | 3300014969 | Ga0157376_10001578 | Ga0157376_1000157811 | 433 |
| 19 | 3300048908 | Ga0496105_0116732 | Ga0496105_0116732_16_1380 | 433 |
| 20 | 3300048909 | Ga0496106_0051023 | Ga0496106_0051023_1500_2864 | 433 |
| 21 | 3300048912 | Ga0496109_0189177 | Ga0496109_0189177_340_1704 | 433 |
| 22 | 3300048913 | Ga0496110_0080295 | Ga0496110_0080295_1586_2887 | 433 |
| 23 | 3300048917 | Ga0496114_0015698 | Ga0496114_0015698_474_1838 | 433 |
| 24 | 3300048918 | Ga0496115_0180398 | Ga0496115_0180398_283_1647 | 433 |
| 25 | 3300050511 | nmdc:mga08y16_1680_c1 | nmdc:mga08y16_1680_c1_14381_15745 | 433 |
| 26 | 3300050515 | nmdc:mga0a205_147706_c1 | nmdc:mga0a205_147706_c1_670_1998 | 433 |
| 27 | 3300042184 | Ga0450908_009935 | Ga0450908_009935_313_1695 | 440 |
| 28 | 3300049591 | Ga0501075_0010511 | Ga0501075_0010511_4317_5699 | 441 |
| 29 | 3300049592 | Ga0501076_0006632 | Ga0501076_0006632_5229_6611 | 441 |
| 30 | 3300049743 | Ga0501081_0061225 | Ga0501081_0061225_896_2278 | 441 |
| 31 | 3300054114 | Ga0501084_0054775 | Ga0501084_0054775_672_2054 | 441 |
| 32 | 3300061734 | Ga0530510_0004512 | Ga0530510_0004512_4637_6019 | 441 |
| 33 | 3300009094 | Ga0111539_10073633 | Ga0111539_100736333 | 443 |
| 34 | 3300006914 | Ga0075436_100002992 | Ga0075436_1000029928 | 445 |
| 35 | 3300035086 | Ga0373934_0006571 | Ga0373934_0006571_182_1654 | 445 |
| 36 | 3300035117 | Ga0373953_0004534 | Ga0373953_0004534_740_2212 | 445 |
| 37 | 3300035119 | Ga0373956_0002137 | Ga0373956_0002137_2483_3955 | 445 |
| 38 | 3300035172 | Ga0373955_0002881 | Ga0373955_0002881_1485_2957 | 445 |
| 39 | 3300035724 | Ga0373933_0002012 | Ga0373933_0002012_8917_10389 | 445 |
| 40 | 3300036401 | Ga0373937_0026218 | Ga0373937_0026218_553_2025 | 445 |
| 41 | 3300046454 | Ga0495592_0057597 | Ga0495592_0057597_1107_2579 | 445 |
| 42 | 3300046511 | Ga0495608_0062993 | Ga0495608_0062993_543_2015 | 445 |
| 43 | 3300046536 | Ga0495587_0005236 | Ga0495587_0005236_897_2369 | 445 |
| 44 | 3300046675 | Ga0495657_0054749 | Ga0495657_0054749_695_2167 | 445 |
| 45 | 3300047317 | Ga0495604_0022619 | Ga0495604_0022619_3531_5003 | 445 |
| 46 | 3300047471 | Ga0495684_0024704 | Ga0495684_0024704_2237_3709 | 445 |
| 47 | 3300048088 | Ga0495602_0048875 | Ga0495602_0048875_1219_2691 | 445 |
| 48 | 3300009094 | Ga0111539_10001769 | Ga0111539_1000176910 | 446 |
| 49 | 3300027907 | Ga0207428_10003307 | Ga0207428_100033079 | 446 |
| 50 | 3300047318 | Ga0495636_0000406 | Ga0495636_0000406_5584_6996 | 446 |
| 51 | 3300048911 | Ga0496108_0064446 | Ga0496108_0064446_1115_2494 | 446 |
| 52 | 3300050511 | nmdc:mga08y16_5506_c1 | nmdc:mga08y16_5506_c1_1400_2800 | 446 |
| 53 | 3300042876 | Ga0451577_0093061 | Ga0451577_0093061_1308_2681 | 447 |
| 54 | 3300049161 | Ga0501305_001597 | Ga0501305_001597_226_1686 | 448 |
| 55 | 3300061734 | Ga0530510_0015379 | Ga0530510_0015379_2770_4197 | 449 |
| 56 | 3300032002 | Ga0307416_100198985 | Ga0307416_1001989852 | 451 |
| 57 | 3300032005 | Ga0307411_10088312 | Ga0307411_100883122 | 451 |
| 58 | 3300042876 | Ga0451577_0211197 | Ga0451577_0211197_44_1450 | 451 |
| 59 | 3300025915 | Ga0207693_10087387 | Ga0207693_100873872 | 452 |
| 60 | 3300041512 | Ga0451853_0598962 | Ga0451853_0598962_270_1844 | 454 |
| 61 | 3300005437 | Ga0070710_10055473 | Ga0070710_100554731 | 455 |
| 62 | 3300005444 | Ga0070694_100051176 | Ga0070694_1000511762 | 455 |
| 63 | 3300005467 | Ga0070706_100065172 | Ga0070706_1000651723 | 455 |
| 64 | 3300005536 | Ga0070697_100066843 | Ga0070697_1000668432 | 455 |
| 65 | 3300005546 | Ga0070696_100037141 | Ga0070696_1000371413 | 455 |
| 66 | 3300025915 | Ga0207693_10018122 | Ga0207693_100181222 | 455 |
| 67 | 3300050514 | nmdc:mga08x19_43853_c1 | nmdc:mga08x19_43853_c1_43_1443 | 455 |
| 68 | 3300006852 | Ga0075433_10081420 | Ga0075433_100814203 | 457 |
| 69 | 3300006871 | Ga0075434_100098674 | Ga0075434_1000986742 | 457 |
| 70 | 3300006914 | Ga0075436_100038731 | Ga0075436_1000387312 | 457 |
| 71 | 3300006914 | Ga0075436_100157798 | Ga0075436_1001577981 | 457 |
| 72 | 3300042876 | Ga0451577_0000102 | Ga0451577_0000102_39076_40548 | 457 |
| 73 | 3300044712 | Ga0453684_0000249 | Ga0453684_0000249_191608_193080 | 457 |
| 74 | 3300050512 | nmdc:mga0n895_22667_c1 | nmdc:mga0n895_22667_c1_181_1581 | 457 |
| 75 | 3300050515 | nmdc:mga0a205_12899_c1 | nmdc:mga0a205_12899_c1_1135_2535 | 457 |
| 76 | 3300006844 | Ga0075428_100004439 | Ga0075428_10000443913 | 458 |
| 77 | 3300006880 | Ga0075429_100016395 | Ga0075429_1000163955 | 458 |
| 78 | 3300009093 | Ga0105240_10203431 | Ga0105240_102034311 | 458 |
| 79 | 3300005458 | Ga0070681_10000281 | Ga0070681_1000028118 | 459 |
| 80 | 3300025912 | Ga0207707_10009521 | Ga0207707_1000952111 | 459 |
| 81 | 3300035691 | Ga0373931_0021193 | Ga0373931_0021193_403_1806 | 459 |
| 82 | 3300049568 | Ga0501031_0160870 | Ga0501031_0160870_49_1455 | 459 |
| 83 | 3300049591 | Ga0501075_0104506 | Ga0501075_0104506_75_1481 | 459 |
| 84 | 3300054114 | Ga0501084_0055812 | Ga0501084_0055812_1250_2656 | 459 |
| 85 | 3300005456 | Ga0070678_100054903 | Ga0070678_1000549032 | 460 |
| 86 | 3300005548 | Ga0070665_100046559 | Ga0070665_1000465592 | 460 |
| 87 | 3300005617 | Ga0068859_100117305 | Ga0068859_1001173052 | 460 |
| 88 | 3300006931 | Ga0097620_100117309 | Ga0097620_1001173093 | 460 |
| 89 | 3300009147 | Ga0114129_10084789 | Ga0114129_100847892 | 460 |
| 90 | 3300026121 | Ga0207683_10176671 | Ga0207683_101766711 | 460 |
| 91 | 3300028379 | Ga0268266_10114429 | Ga0268266_101144292 | 460 |
| 92 | 3300044712 | Ga0453684_0180712 | Ga0453684_0180712_180_1646 | 460 |
| 93 | 3300005290 | Ga0065712_10085300 | Ga0065712_100853002 | 461 |
| 94 | 3300005293 | Ga0065715_10089407 | Ga0065715_100894077 | 461 |
| 95 | 3300005338 | Ga0068868_100059186 | Ga0068868_1000591862 | 461 |
| 96 | 3300005367 | Ga0070667_100222436 | Ga0070667_1002224362 | 461 |
| 97 | 3300005457 | Ga0070662_100039019 | Ga0070662_1000390194 | 461 |
| 98 | 3300005539 | Ga0068853_100289774 | Ga0068853_1002897741 | 461 |
| 99 | 3300005543 | Ga0070672_100004226 | Ga0070672_1000042266 | 461 |
| 100 | 3300005548 | Ga0070665_100191137 | Ga0070665_1001911372 | 461 |
| 101 | 3300005563 | Ga0068855_100036443 | Ga0068855_1000364432 | 461 |
| 102 | 3300005616 | Ga0068852_100078159 | Ga0068852_1000781592 | 461 |
| 103 | 3300005618 | Ga0068864_100002540 | Ga0068864_1000025402 | 461 |
| 104 | 3300005719 | Ga0068861_100037692 | Ga0068861_1000376923 | 461 |
| 105 | 3300005844 | Ga0068862_100147953 | Ga0068862_1001479532 | 461 |
| 106 | 3300006237 | Ga0097621_100123215 | Ga0097621_1001232152 | 461 |
| 107 | 3300006358 | Ga0068871_100057802 | Ga0068871_1000578023 | 461 |
| 108 | 3300006844 | Ga0075428_100017990 | Ga0075428_1000179904 | 461 |
| 109 | 3300006880 | Ga0075429_100178283 | Ga0075429_1001782832 | 461 |
| 110 | 3300009148 | Ga0105243_10028025 | Ga0105243_100280251 | 461 |
| 111 | 3300009176 | Ga0105242_10036893 | Ga0105242_100368932 | 461 |
| 112 | 3300009176 | Ga0105242_10058176 | Ga0105242_100581763 | 461 |
| 113 | 3300009177 | Ga0105248_10029958 | Ga0105248_100299584 | 461 |
| 114 | 3300009177 | Ga0105248_10032810 | Ga0105248_100328102 | 461 |
| 115 | 3300009553 | Ga0105249_10135072 | Ga0105249_101350722 | 461 |
| 116 | 3300010375 | Ga0105239_10207070 | Ga0105239_102070701 | 461 |
| 117 | 3300013306 | Ga0163162_10234479 | Ga0163162_102344791 | 461 |
| 118 | 3300014325 | Ga0163163_10172581 | Ga0163163_101725812 | 461 |
| 119 | 3300025903 | Ga0207680_10083104 | Ga0207680_100831042 | 461 |
| 120 | 3300025907 | Ga0207645_10062694 | Ga0207645_100626941 | 461 |
| 121 | 3300025933 | Ga0207706_10048241 | Ga0207706_100482412 | 461 |
| 122 | 3300025934 | Ga0207686_10045431 | Ga0207686_100454312 | 461 |
| 123 | 3300025938 | Ga0207704_10054000 | Ga0207704_100540002 | 461 |
| 124 | 3300025940 | Ga0207691_10014961 | Ga0207691_100149612 | 461 |
| 125 | 3300025981 | Ga0207640_10122549 | Ga0207640_101225491 | 461 |
| 126 | 3300026095 | Ga0207676_10020204 | Ga0207676_100202045 | 461 |
| 127 | 3300028379 | Ga0268266_10155923 | Ga0268266_101559232 | 461 |
| 128 | 3300032126 | Ga0307415_100006569 | Ga0307415_1000065692 | 461 |
| 129 | 3300035170 | Ga0373943_0069875 | Ga0373943_0069875_66_1457 | 461 |
| 130 | 3300035695 | Ga0373927_0051072 | Ga0373927_0051072_638_2029 | 461 |
| 131 | 3300035725 | Ga0373947_0041277 | Ga0373947_0041277_646_2037 | 461 |
| 132 | 3300036401 | Ga0373937_0047014 | Ga0373937_0047014_2312_3703 | 461 |
| 133 | 3300042133 | Ga0450896_000020 | Ga0450896_000020_885_2330 | 461 |
| 134 | 3300046472 | Ga0495580_0131040 | Ga0495580_0131040_157_1548 | 461 |
| 135 | 3300046683 | Ga0495658_0053040 | Ga0495658_0053040_190_1635 | 461 |
| 136 | 3300047319 | Ga0495674_0184286 | Ga0495674_0184286_282_1673 | 461 |
| 137 | 3300047471 | Ga0495684_0063353 | Ga0495684_0063353_46_1491 | 461 |
| 138 | 3300048905 | Ga0496102_0192801 | Ga0496102_0192801_62_1507 | 461 |
| 139 | 3300048906 | Ga0496103_0090834 | Ga0496103_0090834_389_1834 | 461 |
| 140 | 3300048907 | Ga0496104_0004986 | Ga0496104_0004986_4598_6043 | 461 |
| 141 | 3300048907 | Ga0496104_0086402 | Ga0496104_0086402_933_2378 | 461 |
| 142 | 3300048910 | Ga0496107_0175745 | Ga0496107_0175745_34_1479 | 461 |
| 143 | 3300048912 | Ga0496109_0071646 | Ga0496109_0071646_1342_2787 | 461 |
| 144 | 3300048916 | Ga0496113_0060786 | Ga0496113_0060786_1146_2591 | 461 |
| 145 | 3300048917 | Ga0496114_0017198 | Ga0496114_0017198_594_2039 | 461 |
| 146 | 3300048917 | Ga0496114_0101444 | Ga0496114_0101444_557_2002 | 461 |
| 147 | 3300053077 | Ga0495601_0059367 | Ga0495601_0059367_637_2082 | 461 |
| 148 | 3300005436 | Ga0070713_100028284 | Ga0070713_1000282843 | 462 |
| 149 | 3300009147 | Ga0114129_10007052 | Ga0114129_1000705213 | 462 |
| 150 | 3300025928 | Ga0207700_10014118 | Ga0207700_100141184 | 462 |
| 151 | 3300031731 | Ga0307405_10018167 | Ga0307405_100181672 | 462 |
| 152 | 3300031911 | Ga0307412_10058418 | Ga0307412_100584182 | 462 |
| 153 | 3300032002 | Ga0307416_100008926 | Ga0307416_1000089262 | 462 |
| 154 | 3300050508 | nmdc:mga09592_19340_c1 | nmdc:mga09592_19340_c1_726_2156 | 462 |
| 155 | 3300050511 | nmdc:mga08y16_101662_c1 | nmdc:mga08y16_101662_c1_54_1499 | 462 |
| 156 | 3300014326 | Ga0157380_10028769 | Ga0157380_100287693 | 463 |
| 157 | 3300046539 | Ga0495621_0006236 | Ga0495621_0006236_925_2358 | 463 |
| 158 | 3300047445 | Ga0495677_0016693 | Ga0495677_0016693_193_1623 | 463 |
| 159 | 3300049571 | Ga0501034_0006699 | Ga0501034_0006699_1077_2585 | 463 |
| 160 | iso_pu_bacteria | 2554235469 | 2556064712 | 463 |
| 161 | 3300031548 | Ga0307408_100008217 | Ga0307408_1000082173 | 464 |
| 162 | 3300031731 | Ga0307405_10010309 | Ga0307405_100103093 | 464 |
| 163 | 3300031852 | Ga0307410_10015761 | Ga0307410_100157613 | 464 |
| 164 | 3300032002 | Ga0307416_100014111 | Ga0307416_1000141113 | 464 |
| 165 | 3300032005 | Ga0307411_10029795 | Ga0307411_100297952 | 464 |
| 166 | 3300032126 | Ga0307415_100021232 | Ga0307415_1000212323 | 464 |
| 167 | 3300037471 | Ga0395905_0040991 | Ga0395905_0040991_609_2048 | 464 |
| 168 | 3300050508 | nmdc:mga09592_95968_c1 | nmdc:mga09592_95968_c1_852_2381 | 464 |
| 169 | 3300059421 | Ga0590071_007783 | Ga0590071_007783_691_2127 | 464 |
| 170 | 3300059426 | Ga0590077_000129 | Ga0590077_000129_13077_14513 | 464 |
| 171 | 3300005546 | Ga0070696_100043420 | Ga0070696_1000434202 | 465 |
| 172 | 3300006844 | Ga0075428_100024526 | Ga0075428_1000245264 | 465 |
| 173 | 3300009094 | Ga0111539_10133207 | Ga0111539_101332073 | 465 |
| 174 | 3300013297 | Ga0157378_10193359 | Ga0157378_101933592 | 465 |
| 175 | iso_pu_bacteria | 2738543010 | 2739234575 | 465 |
| 176 | iso_pu_bacteria | 3006826541 | 3006831424 | 465 |
| 177 | iso_pu_bacteria | 3006973921 | 3006975425 | 465 |
| 178 | 3300009093 | Ga0105240_10045158 | Ga0105240_100451584 | 466 |
| 179 | 3300009094 | Ga0111539_10004174 | Ga0111539_100041743 | 466 |
| 180 | 3300009551 | Ga0105238_10047858 | Ga0105238_100478584 | 466 |
| 181 | 3300027907 | Ga0207428_10002086 | Ga0207428_100020863 | 466 |
| 182 | 3300031731 | Ga0307405_10007998 | Ga0307405_100079985 | 466 |
| 183 | 3300031903 | Ga0307407_10006608 | Ga0307407_100066085 | 466 |
| 184 | 3300032002 | Ga0307416_100001676 | Ga0307416_1000016765 | 466 |
| 185 | 3300032005 | Ga0307411_10003321 | Ga0307411_100033216 | 466 |
| 186 | 3300032126 | Ga0307415_100016964 | Ga0307415_1000169643 | 466 |
| 187 | 3300036401 | Ga0373937_0040267 | Ga0373937_0040267_1503_2939 | 466 |
| 188 | 3300046491 | Ga0495584_0048033 | Ga0495584_0048033_25_1467 | 466 |
| 189 | 3300046538 | Ga0495609_0045151 | Ga0495609_0045151_411_1853 | 466 |
| 190 | 3300048912 | Ga0496109_0210804 | Ga0496109_0210804_48_1487 | 466 |
| 191 | 3300049568 | Ga0501031_0004849 | Ga0501031_0004849_5379_6785 | 466 |
| 192 | 3300049569 | Ga0501032_0009137 | Ga0501032_0009137_2200_3606 | 466 |
| 193 | 3300049570 | Ga0501033_0008182 | Ga0501033_0008182_4687_6093 | 466 |
| 194 | 3300049571 | Ga0501034_0125183 | Ga0501034_0125183_310_1716 | 466 |
| 195 | 3300049572 | Ga0501036_0007251 | Ga0501036_0007251_3820_5226 | 466 |
| 196 | 3300049573 | Ga0501037_0001533 | Ga0501037_0001533_13106_14512 | 466 |
| 197 | 3300049574 | Ga0501038_0023730 | Ga0501038_0023730_1988_3394 | 466 |
| 198 | 3300049575 | Ga0501039_0000786 | Ga0501039_0000786_3612_5018 | 466 |
| 199 | 3300049580 | Ga0501046_0003375 | Ga0501046_0003375_12512_13918 | 466 |
| 200 | 3300049581 | Ga0501047_0017702 | Ga0501047_0017702_4716_6122 | 466 |
| 201 | 3300049582 | Ga0501048_0009039 | Ga0501048_0009039_5111_6517 | 466 |
| 202 | 3300049583 | Ga0501067_0005842 | Ga0501067_0005842_4844_6250 | 466 |
| 203 | 3300049584 | Ga0501068_0000590 | Ga0501068_0000590_8362_9768 | 466 |
| 204 | 3300049585 | Ga0501069_0009057 | Ga0501069_0009057_2969_4375 | 466 |
| 205 | 3300049586 | Ga0501070_0073897 | Ga0501070_0073897_576_1982 | 466 |
| 206 | 3300049588 | Ga0501072_0010906 | Ga0501072_0010906_4687_6093 | 466 |
| 207 | 3300049589 | Ga0501073_0001480 | Ga0501073_0001480_7458_8864 | 466 |
| 208 | 3300049592 | Ga0501076_0005325 | Ga0501076_0005325_5596_7002 | 466 |
| 209 | 3300049741 | Ga0501079_0007454 | Ga0501079_0007454_4559_5965 | 466 |
| 210 | 3300049742 | Ga0501080_0000482 | Ga0501080_0000482_13992_15398 | 466 |
| 211 | 3300049744 | Ga0501083_0026806 | Ga0501083_0026806_840_2246 | 466 |
| 212 | 3300049823 | Ga0501044_0047477 | Ga0501044_0047477_840_2246 | 466 |
| 213 | 3300053096 | Ga0500641_0010892 | Ga0500641_0010892_1622_3088 | 466 |
| 214 | 3300054114 | Ga0501084_0003880 | Ga0501084_0003880_8810_10216 | 466 |
| 215 | 3300060353 | Ga0501082_0009933 | Ga0501082_0009933_3455_4861 | 466 |
| 216 | iso_pu_bacteria | 2643221543 | 2643735637 | 466 |
| 217 | iso_pu_bacteria | 2816332295 | 2817481336 | 466 |
| 218 | iso_pu_bacteria | 3006858327 | 3006861760 | 466 |
| 219 | 3300003751 | Ga0055538_1000080 | Ga0055538_100008060 | 467 |
| 220 | 3300005330 | Ga0070690_100016718 | Ga0070690_1000167182 | 467 |
| 221 | 3300005468 | Ga0070707_100051602 | Ga0070707_1000516022 | 467 |
| 222 | 3300005518 | Ga0070699_100148638 | Ga0070699_1001486381 | 467 |
| 223 | 3300005535 | Ga0070684_100044443 | Ga0070684_1000444435 | 467 |
| 224 | 3300009093 | Ga0105240_10006066 | Ga0105240_100060662 | 467 |
| 225 | 3300009094 | Ga0111539_10074542 | Ga0111539_100745423 | 467 |
| 226 | 3300009174 | Ga0105241_10237417 | Ga0105241_102374171 | 467 |
| 227 | 3300009545 | Ga0105237_10001318 | Ga0105237_1000131811 | 467 |
| 228 | 3300009545 | Ga0105237_10034493 | Ga0105237_100344932 | 467 |
| 229 | 3300025224 | Ga0209784_100077 | Ga0209784_10007774 | 467 |
| 230 | 3300025913 | Ga0207695_10036329 | Ga0207695_100363293 | 467 |
| 231 | 3300025922 | Ga0207646_10074212 | Ga0207646_100742123 | 467 |
| 232 | 3300031852 | Ga0307410_10011774 | Ga0307410_100117744 | 467 |
| 233 | 3300031903 | Ga0307407_10011965 | Ga0307407_100119654 | 467 |
| 234 | 3300031995 | Ga0307409_100030573 | Ga0307409_1000305734 | 467 |
| 235 | 3300032002 | Ga0307416_100011349 | Ga0307416_1000113492 | 467 |
| 236 | 3300035398 | Ga0316574_0010097 | Ga0316574_0010097_3712_5196 | 467 |
| 237 | 3300037853 | Ga0436364_0398603 | Ga0436364_0398603_1652_3118 | 467 |
| 238 | 3300037853 | Ga0436364_1070510 | Ga0436364_1070510_4338_5744 | 467 |
| 239 | 3300042876 | Ga0451577_0000158 | Ga0451577_0000158_62187_63665 | 467 |
| 240 | 3300044712 | Ga0453684_0000089 | Ga0453684_0000089_213433_214911 | 467 |
| 241 | 3300045051 | Ga0451576_0053960 | Ga0451576_0053960_2387_3835 | 467 |
| 242 | 3300048906 | Ga0496103_0020642 | Ga0496103_0020642_2368_3855 | 467 |
| 243 | 3300050511 | nmdc:mga08y16_59693_c1 | nmdc:mga08y16_59693_c1_766_2343 | 467 |
| 244 | 3300050512 | nmdc:mga0n895_41240_c1 | nmdc:mga0n895_41240_c1_273_1721 | 467 |
| 245 | iso_pu_bacteria | 2885526491 | 2885531603 | 467 |
| 246 | iso_pu_bacteria | 2904162308 | 2904163863 | 467 |
| 247 | 3300005545 | Ga0070695_100087338 | Ga0070695_1000873381 | 468 |
| 248 | 3300048913 | Ga0496110_0067830 | Ga0496110_0067830_44_1492 | 468 |
| 249 | 3300050507 | nmdc:mga05p37_306690_c1 | nmdc:mga05p37_306690_c1_14_1429 | 468 |
| 250 | 3300005290 | Ga0065712_10001774 | Ga0065712_100017742 | 469 |
| 251 | 3300005327 | Ga0070658_10131017 | Ga0070658_101310172 | 469 |
| 252 | 3300005328 | Ga0070676_10080166 | Ga0070676_100801662 | 469 |
| 253 | 3300005329 | Ga0070683_100009361 | Ga0070683_1000093614 | 469 |
| 254 | 3300005331 | Ga0070670_100001920 | Ga0070670_1000019205 | 469 |
| 255 | 3300005331 | Ga0070670_100038930 | Ga0070670_1000389303 | 469 |
| 256 | 3300005335 | Ga0070666_10017961 | Ga0070666_100179612 | 469 |
| 257 | 3300005338 | Ga0068868_100005467 | Ga0068868_1000054674 | 469 |
| 258 | 3300005344 | Ga0070661_100000349 | Ga0070661_1000003499 | 469 |
| 259 | 3300005354 | Ga0070675_100006104 | Ga0070675_1000061042 | 469 |
| 260 | 3300005355 | Ga0070671_100000218 | Ga0070671_1000002184 | 469 |
| 261 | 3300005356 | Ga0070674_100073466 | Ga0070674_1000734662 | 469 |
| 262 | 3300005364 | Ga0070673_100001419 | Ga0070673_1000014194 | 469 |
| 263 | 3300005367 | Ga0070667_100026465 | Ga0070667_1000264652 | 469 |
| 264 | 3300005456 | Ga0070678_100000972 | Ga0070678_1000009726 | 469 |
| 265 | 3300005457 | Ga0070662_100077476 | Ga0070662_1000774761 | 469 |
| 266 | 3300005459 | Ga0068867_100025146 | Ga0068867_1000251462 | 469 |
| 267 | 3300005518 | Ga0070699_100000386 | Ga0070699_10000038612 | 469 |
| 268 | 3300005535 | Ga0070684_100070000 | Ga0070684_1000700002 | 469 |
| 269 | 3300005543 | Ga0070672_100002533 | Ga0070672_1000025334 | 469 |
| 270 | 3300005564 | Ga0070664_100002592 | Ga0070664_1000025924 | 469 |
| 271 | 3300005578 | Ga0068854_100010834 | Ga0068854_1000108342 | 469 |
| 272 | 3300005616 | Ga0068852_100000256 | Ga0068852_10000025626 | 469 |
| 273 | 3300005834 | Ga0068851_10024963 | Ga0068851_100249632 | 469 |
| 274 | 3300009177 | Ga0105248_10030894 | Ga0105248_100308943 | 469 |
| 275 | 3300013297 | Ga0157378_10003159 | Ga0157378_1000315911 | 469 |
| 276 | 3300013306 | Ga0163162_10011524 | Ga0163162_100115245 | 469 |
| 277 | 3300013308 | Ga0157375_10003261 | Ga0157375_100032612 | 469 |
| 278 | 3300014969 | Ga0157376_10030349 | Ga0157376_100303494 | 469 |
| 279 | 3300025903 | Ga0207680_10013655 | Ga0207680_100136554 | 469 |
| 280 | 3300025907 | Ga0207645_10095284 | Ga0207645_100952842 | 469 |
| 281 | 3300025925 | Ga0207650_10001433 | Ga0207650_1000143311 | 469 |
| 282 | 3300025931 | Ga0207644_10002517 | Ga0207644_1000251710 | 469 |
| 283 | 3300025933 | Ga0207706_10130753 | Ga0207706_101307532 | 469 |
| 284 | 3300025940 | Ga0207691_10006497 | Ga0207691_100064978 | 469 |
| 285 | 3300025944 | Ga0207661_10004972 | Ga0207661_100049723 | 469 |
| 286 | 3300025981 | Ga0207640_10007488 | Ga0207640_100074883 | 469 |
| 287 | 3300026067 | Ga0207678_10134065 | Ga0207678_101340651 | 469 |
| 288 | 3300026121 | Ga0207683_10000573 | Ga0207683_100005733 | 469 |
| 289 | 3300026142 | Ga0207698_10001341 | Ga0207698_100013411 | 469 |
| 290 | 3300044712 | Ga0453684_0062536 | Ga0453684_0062536_168_1610 | 469 |
| 291 | 3300044712 | Ga0453684_0286335 | Ga0453684_0286335_323_1765 | 469 |
| 292 | 3300048907 | Ga0496104_0068324 | Ga0496104_0068324_1367_2833 | 469 |
| 293 | 3300048907 | Ga0496104_0130566 | Ga0496104_0130566_563_2011 | 469 |
| 294 | 3300048911 | Ga0496108_0006000 | Ga0496108_0006000_1908_3374 | 469 |
| 295 | 3300049528 | Ga0501312_000200 | Ga0501312_000200_414_1898 | 469 |
| 296 | 3300049532 | Ga0501316_000560 | Ga0501316_000560_726_2210 | 469 |
| 297 | 3300053153 | Ga0500616_0047208 | Ga0500616_0047208_121_1578 | 469 |
| 298 | 3300005295 | Ga0065707_10100972 | Ga0065707_101009723 | 470 |
| 299 | 3300005345 | Ga0070692_10018091 | Ga0070692_100180912 | 470 |
| 300 | 3300005353 | Ga0070669_100003108 | Ga0070669_1000031087 | 470 |
| 301 | 3300005354 | Ga0070675_100019910 | Ga0070675_1000199103 | 470 |
| 302 | 3300005364 | Ga0070673_100083665 | Ga0070673_1000836652 | 470 |
| 303 | 3300005365 | Ga0070688_100049225 | Ga0070688_1000492252 | 470 |
| 304 | 3300005440 | Ga0070705_100000756 | Ga0070705_1000007563 | 470 |
| 305 | 3300005440 | Ga0070705_100014673 | Ga0070705_1000146733 | 470 |
| 306 | 3300005441 | Ga0070700_100004623 | Ga0070700_1000046236 | 470 |
| 307 | 3300005444 | Ga0070694_100007401 | Ga0070694_1000074014 | 470 |
| 308 | 3300005444 | Ga0070694_100019076 | Ga0070694_1000190762 | 470 |
| 309 | 3300005457 | Ga0070662_100012018 | Ga0070662_1000120182 | 470 |
| 310 | 3300005459 | Ga0068867_100007526 | Ga0068867_1000075263 | 470 |
| 311 | 3300005471 | Ga0070698_100015249 | Ga0070698_1000152498 | 470 |
| 312 | 3300005471 | Ga0070698_100025140 | Ga0070698_1000251406 | 470 |
| 313 | 3300005518 | Ga0070699_100011772 | Ga0070699_1000117726 | 470 |
| 314 | 3300005543 | Ga0070672_100030643 | Ga0070672_1000306432 | 470 |
| 315 | 3300005544 | Ga0070686_100033883 | Ga0070686_1000338833 | 470 |
| 316 | 3300005545 | Ga0070695_100000247 | Ga0070695_10000024722 | 470 |
| 317 | 3300005546 | Ga0070696_100001143 | Ga0070696_1000011439 | 470 |
| 318 | 3300005546 | Ga0070696_100026985 | Ga0070696_1000269854 | 470 |
| 319 | 3300005549 | Ga0070704_100003993 | Ga0070704_1000039939 | 470 |
| 320 | 3300005549 | Ga0070704_100006063 | Ga0070704_1000060632 | 470 |
| 321 | 3300005549 | Ga0070704_100037916 | Ga0070704_1000379162 | 470 |
| 322 | 3300005577 | Ga0068857_100012663 | Ga0068857_1000126633 | 470 |
| 323 | 3300005578 | Ga0068854_100031544 | Ga0068854_1000315442 | 470 |
| 324 | 3300005617 | Ga0068859_100002081 | Ga0068859_10000208117 | 470 |
| 325 | 3300005618 | Ga0068864_100005475 | Ga0068864_1000054757 | 470 |
| 326 | 3300005719 | Ga0068861_100001989 | Ga0068861_1000019898 | 470 |
| 327 | 3300005840 | Ga0068870_10003674 | Ga0068870_100036744 | 470 |
| 328 | 3300005844 | Ga0068862_100001000 | Ga0068862_10000100011 | 470 |
| 329 | 3300006028 | Ga0070717_10015938 | Ga0070717_100159385 | 470 |
| 330 | 3300006028 | Ga0070717_10228724 | Ga0070717_102287241 | 470 |
| 331 | 3300006871 | Ga0075434_100011335 | Ga0075434_1000113353 | 470 |
| 332 | 3300006931 | Ga0097620_100002081 | Ga0097620_1000020817 | 470 |
| 333 | 3300009094 | Ga0111539_10017744 | Ga0111539_100177443 | 470 |
| 334 | 3300009148 | Ga0105243_10007773 | Ga0105243_100077734 | 470 |
| 335 | 3300009148 | Ga0105243_10051889 | Ga0105243_100518891 | 470 |
| 336 | 3300009176 | Ga0105242_10093509 | Ga0105242_100935091 | 470 |
| 337 | 3300009553 | Ga0105249_10006074 | Ga0105249_100060745 | 470 |
| 338 | 3300025908 | Ga0207643_10009824 | Ga0207643_100098243 | 470 |
| 339 | 3300025913 | Ga0207695_10093936 | Ga0207695_100939363 | 470 |
| 340 | 3300025918 | Ga0207662_10013731 | Ga0207662_100137313 | 470 |
| 341 | 3300025923 | Ga0207681_10005692 | Ga0207681_100056922 | 470 |
| 342 | 3300025924 | Ga0207694_10013768 | Ga0207694_100137684 | 470 |
| 343 | 3300025926 | Ga0207659_10003019 | Ga0207659_100030192 | 470 |
| 344 | 3300025934 | Ga0207686_10028325 | Ga0207686_100283252 | 470 |
| 345 | 3300025935 | Ga0207709_10033163 | Ga0207709_100331632 | 470 |
| 346 | 3300025936 | Ga0207670_10003124 | Ga0207670_100031244 | 470 |
| 347 | 3300025936 | Ga0207670_10100693 | Ga0207670_101006932 | 470 |
| 348 | 3300025940 | Ga0207691_10025047 | Ga0207691_100250475 | 470 |
| 349 | 3300025960 | Ga0207651_10039398 | Ga0207651_100393983 | 470 |
| 350 | 3300026023 | Ga0207677_10086348 | Ga0207677_100863482 | 470 |
| 351 | 3300026075 | Ga0207708_10012471 | Ga0207708_100124713 | 470 |
| 352 | 3300026089 | Ga0207648_10001255 | Ga0207648_1000125512 | 470 |
| 353 | 3300026095 | Ga0207676_10008322 | Ga0207676_100083222 | 470 |
| 354 | 3300026116 | Ga0207674_10038394 | Ga0207674_100383943 | 470 |
| 355 | 3300026118 | Ga0207675_100006796 | Ga0207675_1000067968 | 470 |
| 356 | 3300027907 | Ga0207428_10000442 | Ga0207428_1000044228 | 470 |
| 357 | 3300028380 | Ga0268265_10000237 | Ga0268265_1000023719 | 470 |
| 358 | 3300031090 | Ga0265760_10002408 | Ga0265760_100024082 | 470 |
| 359 | 3300031730 | Ga0307516_10019164 | Ga0307516_100191642 | 470 |
| 360 | 3300039437 | Ga0436365_1778402 | Ga0436365_1778402_568_1986 | 470 |
| 361 | 3300042876 | Ga0451577_0132810 | Ga0451577_0132810_43_1467 | 470 |
| 362 | 3300046615 | Ga0495656_0025467 | Ga0495656_0025467_374_1828 | 470 |
| 363 | 3300047447 | Ga0495685_034142 | Ga0495685_034142_43_1497 | 470 |
| 364 | 3300050507 | nmdc:mga05p37_175596_c1 | nmdc:mga05p37_175596_c1_1092_2513 | 470 |
| 365 | 3300050511 | nmdc:mga08y16_522_c1 | nmdc:mga08y16_522_c1_21096_22565 | 470 |
| 366 | 3300050512 | nmdc:mga0n895_80237_c1 | nmdc:mga0n895_80237_c1_950_2404 | 470 |
| 367 | 3300053080 | Ga0500635_0002341 | Ga0500635_0002341_1670_3115 | 470 |
| 368 | 3300053094 | Ga0500566_0001395 | Ga0500566_0001395_3907_5352 | 470 |
| 369 | 3300053150 | Ga0500603_000517 | Ga0500603_000517_6809_8254 | 470 |
| 370 | 3300005340 | Ga0070689_100015247 | Ga0070689_1000152472 | 471 |
| 371 | 3300005364 | Ga0070673_100006113 | Ga0070673_1000061133 | 471 |
| 372 | 3300005438 | Ga0070701_10027557 | Ga0070701_100275572 | 471 |
| 373 | 3300005440 | Ga0070705_100056792 | Ga0070705_1000567923 | 471 |
| 374 | 3300005458 | Ga0070681_10075385 | Ga0070681_100753851 | 471 |
| 375 | 3300005518 | Ga0070699_100006186 | Ga0070699_1000061866 | 471 |
| 376 | 3300005615 | Ga0070702_100035525 | Ga0070702_1000355252 | 471 |
| 377 | 3300005843 | Ga0068860_100001188 | Ga0068860_10000118820 | 471 |
| 378 | 3300006844 | Ga0075428_100007047 | Ga0075428_1000070475 | 471 |
| 379 | 3300007788 | Ga0099795_10000013 | Ga0099795_1000001373 | 471 |
| 380 | 3300009094 | Ga0111539_10286417 | Ga0111539_102864172 | 471 |
| 381 | 3300009147 | Ga0114129_10041164 | Ga0114129_100411644 | 471 |
| 382 | 3300010159 | Ga0099796_10003190 | Ga0099796_100031902 | 471 |
| 383 | 3300025233 | Ga0209437_100324 | Ga0209437_10032450 | 471 |
| 384 | 3300025912 | Ga0207707_10048103 | Ga0207707_100481033 | 471 |
| 385 | 3300025922 | Ga0207646_10119393 | Ga0207646_101193933 | 471 |
| 386 | 3300027512 | Ga0209179_1000086 | Ga0209179_10000863 | 471 |
| 387 | 3300028381 | Ga0268264_10001084 | Ga0268264_1000108422 | 471 |
| 388 | 3300031507 | Ga0307509_10000488 | Ga0307509_100004885 | 471 |
| 389 | 3300032005 | Ga0307411_10064631 | Ga0307411_100646311 | 471 |
| 390 | 3300041505 | Ga0451849_1129382 | Ga0451849_1129382_342_1802 | 471 |
| 391 | 3300045051 | Ga0451576_0076045 | Ga0451576_0076045_1056_2516 | 471 |
| 392 | 3300046559 | Ga0495667_0022547 | Ga0495667_0022547_1473_3008 | 471 |
| 393 | 3300046675 | Ga0495657_0005190 | Ga0495657_0005190_327_1862 | 471 |
| 394 | 3300047471 | Ga0495684_0003665 | Ga0495684_0003665_5884_7419 | 471 |
| 395 | 3300049584 | Ga0501068_0025595 | Ga0501068_0025595_1228_2688 | 471 |
| 396 | 3300050507 | nmdc:mga05p37_47559_c1 | nmdc:mga05p37_47559_c1_3462_4901 | 471 |
| 397 | 3300005331 | Ga0070670_100007560 | Ga0070670_1000075602 | 472 |
| 398 | 3300005331 | Ga0070670_100019868 | Ga0070670_1000198684 | 472 |
| 399 | 3300005338 | Ga0068868_100007890 | Ga0068868_1000078904 | 472 |
| 400 | 3300005338 | Ga0068868_100073162 | Ga0068868_1000731623 | 472 |
| 401 | 3300005343 | Ga0070687_100029783 | Ga0070687_1000297832 | 472 |
| 402 | 3300005344 | Ga0070661_100060577 | Ga0070661_1000605773 | 472 |
| 403 | 3300005354 | Ga0070675_100000181 | Ga0070675_10000018134 | 472 |
| 404 | 3300005365 | Ga0070688_100025395 | Ga0070688_1000253953 | 472 |
| 405 | 3300005441 | Ga0070700_100079966 | Ga0070700_1000799662 | 472 |
| 406 | 3300005456 | Ga0070678_100011558 | Ga0070678_1000115582 | 472 |
| 407 | 3300005530 | Ga0070679_100223135 | Ga0070679_1002231352 | 472 |
| 408 | 3300005549 | Ga0070704_100028365 | Ga0070704_1000283652 | 472 |
| 409 | 3300005577 | Ga0068857_100060235 | Ga0068857_1000602353 | 472 |
| 410 | 3300005617 | Ga0068859_100015676 | Ga0068859_1000156764 | 472 |
| 411 | 3300005841 | Ga0068863_100019006 | Ga0068863_1000190063 | 472 |
| 412 | 3300005842 | Ga0068858_100008296 | Ga0068858_1000082968 | 472 |
| 413 | 3300006844 | Ga0075428_100018233 | Ga0075428_1000182337 | 472 |
| 414 | 3300006852 | Ga0075433_10015146 | Ga0075433_100151463 | 472 |
| 415 | 3300006931 | Ga0097620_100015676 | Ga0097620_1000156766 | 472 |
| 416 | 3300009147 | Ga0114129_10003827 | Ga0114129_100038276 | 472 |
| 417 | 3300009147 | Ga0114129_10235483 | Ga0114129_102354832 | 472 |
| 418 | 3300013296 | Ga0157374_10106790 | Ga0157374_101067903 | 472 |
| 419 | 3300014969 | Ga0157376_10148196 | Ga0157376_101481963 | 472 |
| 420 | 3300025315 | Ga0207697_10003472 | Ga0207697_100034725 | 472 |
| 421 | 3300025901 | Ga0207688_10046191 | Ga0207688_100461912 | 472 |
| 422 | 3300025925 | Ga0207650_10006792 | Ga0207650_100067926 | 472 |
| 423 | 3300025926 | Ga0207659_10000547 | Ga0207659_100005477 | 472 |
| 424 | 3300025933 | Ga0207706_10078262 | Ga0207706_100782623 | 472 |
| 425 | 3300025936 | Ga0207670_10008107 | Ga0207670_100081074 | 472 |
| 426 | 3300026035 | Ga0207703_10029451 | Ga0207703_100294513 | 472 |
| 427 | 3300026116 | Ga0207674_10075303 | Ga0207674_100753032 | 472 |
| 428 | 3300026121 | Ga0207683_10025245 | Ga0207683_100252454 | 472 |
| 429 | 3300028381 | Ga0268264_10018583 | Ga0268264_100185833 | 472 |
| 430 | 3300028577 | Ga0265318_10000389 | Ga0265318_1000038924 | 472 |
| 431 | 3300031235 | Ga0265330_10004502 | Ga0265330_100045023 | 472 |
| 432 | 3300031238 | Ga0265332_10001310 | Ga0265332_100013102 | 472 |
| 433 | 3300031239 | Ga0265328_10013091 | Ga0265328_100130912 | 472 |
| 434 | 3300031241 | Ga0265325_10011487 | Ga0265325_100114874 | 472 |
| 435 | 3300031595 | Ga0265313_10036627 | Ga0265313_100366273 | 472 |
| 436 | 3300031711 | Ga0265314_10002399 | Ga0265314_100023997 | 472 |
| 437 | 3300031712 | Ga0265342_10003673 | Ga0265342_100036739 | 472 |
| 438 | 3300035695 | Ga0373927_0005509 | Ga0373927_0005509_3612_5081 | 472 |
| 439 | 3300037068 | Ga0373925_0012759 | Ga0373925_0012759_3636_5105 | 472 |
| 440 | 3300042876 | Ga0451577_0082264 | Ga0451577_0082264_1111_2577 | 472 |
| 441 | 3300044712 | Ga0453684_0112915 | Ga0453684_0112915_1468_2952 | 472 |
| 442 | 3300045051 | Ga0451576_0033144 | Ga0451576_0033144_15_1499 | 472 |
| 443 | 3300046455 | Ga0495603_0114710 | Ga0495603_0114710_35_1519 | 472 |
| 444 | 3300046499 | Ga0495594_0002079 | Ga0495594_0002079_5688_7172 | 472 |
| 445 | 3300046558 | Ga0495633_0045297 | Ga0495633_0045297_144_1628 | 472 |
| 446 | 3300046674 | Ga0495588_0004739 | Ga0495588_0004739_1261_2745 | 472 |
| 447 | 3300046684 | Ga0495669_0011319 | Ga0495669_0011319_2181_3656 | 472 |
| 448 | 3300048905 | Ga0496102_0047284 | Ga0496102_0047284_2233_3747 | 472 |
| 449 | 3300048907 | Ga0496104_0066908 | Ga0496104_0066908_65_1576 | 472 |
| 450 | 3300048908 | Ga0496105_0017162 | Ga0496105_0017162_3748_5259 | 472 |
| 451 | 3300048909 | Ga0496106_0086181 | Ga0496106_0086181_55_1569 | 472 |
| 452 | 3300048911 | Ga0496108_0187089 | Ga0496108_0187089_156_1670 | 472 |
| 453 | 3300048915 | Ga0496112_0140827 | Ga0496112_0140827_453_1967 | 472 |
| 454 | 3300048916 | Ga0496113_0036162 | Ga0496113_0036162_390_1904 | 472 |
| 455 | 3300049583 | Ga0501067_0034245 | Ga0501067_0034245_1178_2737 | 472 |
| 456 | 3300050507 | nmdc:mga05p37_105628_c1 | nmdc:mga05p37_105628_c1_271_1743 | 472 |
| 457 | 3300050507 | nmdc:mga05p37_212581_c1 | nmdc:mga05p37_212581_c1_843_2318 | 472 |
| 458 | 3300050507 | nmdc:mga05p37_2349_c1 | nmdc:mga05p37_2349_c1_10221_11726 | 472 |
| 459 | 3300050508 | nmdc:mga09592_55768_c1 | nmdc:mga09592_55768_c1_28_1533 | 472 |
| 460 | 3300050512 | nmdc:mga0n895_105864_c1 | nmdc:mga0n895_105864_c1_1201_2673 | 472 |
| 461 | 3300050512 | nmdc:mga0n895_2718_c1 | nmdc:mga0n895_2718_c1_4705_6213 | 472 |
| 462 | 3300050513 | nmdc:mga0rr50_136040_c1 | nmdc:mga0rr50_136040_c1_198_1691 | 472 |
| 463 | 3300053139 | Ga0500568_0001372 | Ga0500568_0001372_9121_11895 | 472 |
| 464 | 3300005549 | Ga0070704_100005018 | Ga0070704_1000050184 | 473 |
| 465 | 3300006844 | Ga0075428_100011674 | Ga0075428_1000116747 | 473 |
| 466 | 3300009094 | Ga0111539_10041043 | Ga0111539_100410435 | 473 |
| 467 | 3300009147 | Ga0114129_10084404 | Ga0114129_100844042 | 473 |
| 468 | 3300013306 | Ga0163162_10195582 | Ga0163162_101955822 | 473 |
| 469 | 3300013308 | Ga0157375_10008985 | Ga0157375_1000898510 | 473 |
| 470 | 3300025960 | Ga0207651_10000346 | Ga0207651_1000034611 | 473 |
| 471 | 3300048907 | Ga0496104_0154594 | Ga0496104_0154594_624_2108 | 473 |
| 472 | 3300048913 | Ga0496110_0025238 | Ga0496110_0025238_69_1553 | 473 |
| 473 | 3300050507 | nmdc:mga05p37_121253_c1 | nmdc:mga05p37_121253_c1_1363_2811 | 473 |
| 474 | 3300005617 | Ga0068859_100115711 | Ga0068859_1001157113 | 474 |
| 475 | 3300006931 | Ga0097620_100115710 | Ga0097620_1001157103 | 474 |
| 476 | 3300050491 | nmdc:mga00v17_19433_c1 | nmdc:mga00v17_19433_c1_1652_3844 | 474 |
| 477 | 3300050493 | nmdc:mga0k408_2628_c1 | nmdc:mga0k408_2628_c1_21_1760 | 474 |
| 478 | 3300050493 | nmdc:mga0k408_9107_c1 | nmdc:mga0k408_9107_c1_188_1789 | 474 |
| 479 | 3300050493 | nmdc:mga0k408_91323_c1 | nmdc:mga0k408_91323_c1_64_1773 | 474 |
| 480 | 3300050496 | nmdc:mga07m45_22076_c1 | nmdc:mga07m45_22076_c1_427_2028 | 474 |
| 481 | 3300035695 | Ga0373927_0022499 | Ga0373927_0022499_1769_3241 | 475 |
| 482 | 3300037471 | Ga0395905_0039280 | Ga0395905_0039280_1757_3217 | 475 |
| 483 | 3300005563 | Ga0068855_100097073 | Ga0068855_1000970732 | 476 |
| 484 | 3300009147 | Ga0114129_10001102 | Ga0114129_1000110212 | 476 |
| 485 | 3300025913 | Ga0207695_10004005 | Ga0207695_100040052 | 476 |
| 486 | 3300025949 | Ga0207667_10064160 | Ga0207667_100641601 | 476 |
| 487 | 3300050507 | nmdc:mga05p37_5343_c1 | nmdc:mga05p37_5343_c1_1314_2825 | 476 |
| 488 | 3300005468 | Ga0070707_100070380 | Ga0070707_1000703802 | 477 |
| 489 | 3300005545 | Ga0070695_100054983 | Ga0070695_1000549832 | 477 |
| 490 | 3300006871 | Ga0075434_100065887 | Ga0075434_1000658871 | 477 |
| 491 | 3300007076 | Ga0075435_100012719 | Ga0075435_1000127192 | 477 |
| 492 | 3300009147 | Ga0114129_10283104 | Ga0114129_102831042 | 477 |
| 493 | 3300028556 | Ga0265337_1000441 | Ga0265337_10004414 | 477 |
| 494 | 3300028558 | Ga0265326_10002006 | Ga0265326_100020063 | 477 |
| 495 | 3300028563 | Ga0265319_1004110 | Ga0265319_10041103 | 477 |
| 496 | 3300028563 | Ga0265319_1005369 | Ga0265319_10053692 | 477 |
| 497 | 3300028563 | Ga0265319_1030511 | Ga0265319_10305111 | 477 |
| 498 | 3300028573 | Ga0265334_10007200 | Ga0265334_100072002 | 477 |
| 499 | 3300028577 | Ga0265318_10007501 | Ga0265318_100075013 | 477 |
| 500 | 3300028653 | Ga0265323_10000508 | Ga0265323_1000050811 | 477 |
| 501 | 3300028654 | Ga0265322_10001506 | Ga0265322_100015063 | 477 |
| 502 | 3300028666 | Ga0265336_10001214 | Ga0265336_100012142 | 477 |
| 503 | 3300028800 | Ga0265338_10000257 | Ga0265338_1000025752 | 477 |
| 504 | 3300028800 | Ga0265338_10003601 | Ga0265338_100036018 | 477 |
| 505 | 3300028800 | Ga0265338_10008539 | Ga0265338_100085392 | 477 |
| 506 | 3300028800 | Ga0265338_10023649 | Ga0265338_100236494 | 477 |
| 507 | 3300029957 | Ga0265324_10002503 | Ga0265324_100025032 | 477 |
| 508 | 3300029957 | Ga0265324_10016792 | Ga0265324_100167922 | 477 |
| 509 | 3300031235 | Ga0265330_10001184 | Ga0265330_100011845 | 477 |
| 510 | 3300031235 | Ga0265330_10049061 | Ga0265330_100490611 | 477 |
| 511 | 3300031238 | Ga0265332_10000361 | Ga0265332_1000036118 | 477 |
| 512 | 3300031239 | Ga0265328_10013000 | Ga0265328_100130002 | 477 |
| 513 | 3300031240 | Ga0265320_10000444 | Ga0265320_1000044415 | 477 |
| 514 | 3300031241 | Ga0265325_10003182 | Ga0265325_100031824 | 477 |
| 515 | 3300031241 | Ga0265325_10014433 | Ga0265325_100144334 | 477 |
| 516 | 3300031242 | Ga0265329_10000898 | Ga0265329_1000089811 | 477 |
| 517 | 3300031247 | Ga0265340_10015605 | Ga0265340_100156053 | 477 |
| 518 | 3300031247 | Ga0265340_10034337 | Ga0265340_100343372 | 477 |
| 519 | 3300031249 | Ga0265339_10000245 | Ga0265339_1000024521 | 477 |
| 520 | 3300031250 | Ga0265331_10001532 | Ga0265331_100015324 | 477 |
| 521 | 3300031344 | Ga0265316_10001703 | Ga0265316_1000170319 | 477 |
| 522 | 3300031595 | Ga0265313_10002783 | Ga0265313_1000278313 | 477 |
| 523 | 3300031711 | Ga0265314_10000378 | Ga0265314_1000037812 | 477 |
| 524 | 3300031711 | Ga0265314_10001444 | Ga0265314_100014447 | 477 |
| 525 | 3300031712 | Ga0265342_10001152 | Ga0265342_100011522 | 477 |
| 526 | 3300031712 | Ga0265342_10075626 | Ga0265342_100756262 | 477 |
| 527 | 3300042876 | Ga0451577_0000109 | Ga0451577_0000109_52101_53579 | 477 |
| 528 | 3300044712 | Ga0453684_0000004 | Ga0453684_0000004_1178376_1179854 | 477 |
| 529 | 3300047320 | Ga0495672_0003359 | Ga0495672_0003359_9899_11353 | 477 |
| 530 | 3300049588 | Ga0501072_0120618 | Ga0501072_0120618_371_1849 | 477 |
| 531 | 3300049591 | Ga0501075_0024904 | Ga0501075_0024904_654_2132 | 477 |
| 532 | 3300049592 | Ga0501076_0011377 | Ga0501076_0011377_4454_5932 | 477 |
| 533 | 3300049593 | Ga0501077_0041991 | Ga0501077_0041991_604_2082 | 477 |
| 534 | 3300049741 | Ga0501079_0028221 | Ga0501079_0028221_1256_2734 | 477 |
| 535 | 3300049741 | Ga0501079_0176754 | Ga0501079_0176754_183_1637 | 477 |
| 536 | 3300049742 | Ga0501080_0071677 | Ga0501080_0071677_997_2475 | 477 |
| 537 | 3300049743 | Ga0501081_0020439 | Ga0501081_0020439_563_2041 | 477 |
| 538 | 3300061734 | Ga0530510_0072776 | Ga0530510_0072776_655_2133 | 477 |
| 539 | 3300005344 | Ga0070661_100081001 | Ga0070661_1000810012 | 478 |
| 540 | 3300005354 | Ga0070675_100105287 | Ga0070675_1001052872 | 478 |
| 541 | 3300005356 | Ga0070674_100001864 | Ga0070674_1000018649 | 478 |
| 542 | 3300005367 | Ga0070667_100034813 | Ga0070667_1000348134 | 478 |
| 543 | 3300005445 | Ga0070708_100005303 | Ga0070708_1000053031 | 478 |
| 544 | 3300005467 | Ga0070706_100000257 | Ga0070706_10000025731 | 478 |
| 545 | 3300005518 | Ga0070699_100077324 | Ga0070699_1000773242 | 478 |
| 546 | 3300005543 | Ga0070672_100002438 | Ga0070672_1000024386 | 478 |
| 547 | 3300006358 | Ga0068871_100018677 | Ga0068871_1000186777 | 478 |
| 548 | 3300013297 | Ga0157378_10163797 | Ga0157378_101637972 | 478 |
| 549 | 3300025910 | Ga0207684_10002463 | Ga0207684_100024635 | 478 |
| 550 | 3300025925 | Ga0207650_10036967 | Ga0207650_100369674 | 478 |
| 551 | 3300025926 | Ga0207659_10014217 | Ga0207659_100142172 | 478 |
| 552 | 3300025933 | Ga0207706_10006013 | Ga0207706_1000601311 | 478 |
| 553 | 3300025937 | Ga0207669_10003145 | Ga0207669_100031458 | 478 |
| 554 | 3300025940 | Ga0207691_10000071 | Ga0207691_1000007141 | 478 |
| 555 | 3300026023 | Ga0207677_10060882 | Ga0207677_100608822 | 478 |
| 556 | 3300026121 | Ga0207683_10000607 | Ga0207683_1000060731 | 478 |
| 557 | 3300027907 | Ga0207428_10009261 | Ga0207428_100092614 | 478 |
| 558 | 3300042876 | Ga0451577_0030087 | Ga0451577_0030087_2273_3730 | 478 |
| 559 | 3300006880 | Ga0075429_100010629 | Ga0075429_1000106298 | 479 |
| 560 | 3300013297 | Ga0157378_10002432 | Ga0157378_1000243216 | 479 |
| 561 | 3300031090 | Ga0265760_10022377 | Ga0265760_100223772 | 479 |
| 562 | 3300031235 | Ga0265330_10008012 | Ga0265330_100080122 | 479 |
| 563 | 3300031238 | Ga0265332_10000044 | Ga0265332_1000004434 | 479 |
| 564 | 3300031241 | Ga0265325_10004663 | Ga0265325_100046638 | 479 |
| 565 | 3300031241 | Ga0265325_10012362 | Ga0265325_100123624 | 479 |
| 566 | 3300031242 | Ga0265329_10004863 | Ga0265329_100048634 | 479 |
| 567 | 3300031249 | Ga0265339_10032574 | Ga0265339_100325742 | 479 |
| 568 | 3300031250 | Ga0265331_10000076 | Ga0265331_1000007699 | 479 |
| 569 | 3300031250 | Ga0265331_10005198 | Ga0265331_100051987 | 479 |
| 570 | 3300031251 | Ga0265327_10034465 | Ga0265327_100344652 | 479 |
| 571 | 3300031344 | Ga0265316_10000006 | Ga0265316_10000006147 | 479 |
| 572 | 3300031344 | Ga0265316_10004811 | Ga0265316_1000481113 | 479 |
| 573 | 3300031711 | Ga0265314_10000056 | Ga0265314_1000005663 | 479 |
| 574 | 3300035086 | Ga0373934_0038249 | Ga0373934_0038249_56_1522 | 479 |
| 575 | 3300035119 | Ga0373956_0014257 | Ga0373956_0014257_1510_2976 | 479 |
| 576 | 3300035724 | Ga0373933_0000430 | Ga0373933_0000430_509_1975 | 479 |
| 577 | 3300035724 | Ga0373933_0025244 | Ga0373933_0025244_580_2178 | 479 |
| 578 | 3300035725 | Ga0373947_0027787 | Ga0373947_0027787_921_2519 | 479 |
| 579 | 3300044673 | Ga0453683_0006726 | Ga0453683_0006726_2098_3594 | 479 |
| 580 | 3300046454 | Ga0495592_0120756 | Ga0495592_0120756_21_1619 | 479 |
| 581 | 3300046463 | Ga0495653_0018444 | Ga0495653_0018444_3481_5079 | 479 |
| 582 | 3300046511 | Ga0495608_0040191 | Ga0495608_0040191_1006_2604 | 479 |
| 583 | 3300046516 | Ga0495628_0127524 | Ga0495628_0127524_19_1617 | 479 |
| 584 | 3300046526 | Ga0495666_0016631 | Ga0495666_0016631_1220_2818 | 479 |
| 585 | 3300046536 | Ga0495587_0001108 | Ga0495587_0001108_11930_13396 | 479 |
| 586 | 3300046543 | Ga0495645_0036742 | Ga0495645_0036742_318_1916 | 479 |
| 587 | 3300046675 | Ga0495657_0044161 | Ga0495657_0044161_708_2306 | 479 |
| 588 | 3300046678 | Ga0495599_0034933 | Ga0495599_0034933_712_2244 | 479 |
| 589 | 3300046678 | Ga0495599_0079049 | Ga0495599_0079049_392_1990 | 479 |
| 590 | 3300046679 | Ga0495623_0005481 | Ga0495623_0005481_971_2569 | 479 |
| 591 | 3300046679 | Ga0495623_0027249 | Ga0495623_0027249_737_2203 | 479 |
| 592 | 3300046690 | Ga0495624_0042324 | Ga0495624_0042324_207_1805 | 479 |
| 593 | 3300047317 | Ga0495604_0037431 | Ga0495604_0037431_2074_3609 | 479 |
| 594 | 3300047319 | Ga0495674_0037716 | Ga0495674_0037716_1178_2713 | 479 |
| 595 | 3300047673 | Ga0495593_0007862 | Ga0495593_0007862_2930_4528 | 479 |
| 596 | 3300048088 | Ga0495602_0000224 | Ga0495602_0000224_1027_2493 | 479 |
| 597 | 3300048089 | Ga0495614_0020467 | Ga0495614_0020467_331_1929 | 479 |
| 598 | 3300050508 | nmdc:mga09592_2431_c1 | nmdc:mga09592_2431_c1_13101_14663 | 479 |
| 599 | 3300053078 | Ga0495612_0002105 | Ga0495612_0002105_977_2575 | 479 |
| 600 | 3300005434 | Ga0070709_10020223 | Ga0070709_100202234 | 480 |
| 601 | 3300005439 | Ga0070711_100114354 | Ga0070711_1001143542 | 480 |
| 602 | 3300005458 | Ga0070681_10080321 | Ga0070681_100803212 | 480 |
| 603 | 3300005467 | Ga0070706_100130894 | Ga0070706_1001308942 | 480 |
| 604 | 3300005535 | Ga0070684_100073592 | Ga0070684_1000735922 | 480 |
| 605 | 3300005618 | Ga0068864_100037779 | Ga0068864_1000377792 | 480 |
| 606 | 3300006028 | Ga0070717_10017657 | Ga0070717_100176573 | 480 |
| 607 | 3300006871 | Ga0075434_100001538 | Ga0075434_1000015389 | 480 |
| 608 | 3300014325 | Ga0163163_10002199 | Ga0163163_100021993 | 480 |
| 609 | 3300014325 | Ga0163163_10022035 | Ga0163163_100220352 | 480 |
| 610 | 3300025941 | Ga0207711_10149066 | Ga0207711_101490662 | 480 |
| 611 | 3300025949 | Ga0207667_10274294 | Ga0207667_102742941 | 480 |
| 612 | 3300026088 | Ga0207641_10055387 | Ga0207641_100553872 | 480 |
| 613 | 3300028653 | Ga0265323_10006216 | Ga0265323_100062162 | 480 |
| 614 | 3300028800 | Ga0265338_10006415 | Ga0265338_100064154 | 480 |
| 615 | 3300031242 | Ga0265329_10028508 | Ga0265329_100285081 | 480 |
| 616 | 3300037068 | Ga0373925_0012943 | Ga0373925_0012943_84_1544 | 480 |
| 617 | 3300048912 | Ga0496109_0036399 | Ga0496109_0036399_962_2431 | 480 |
| 618 | 3300005290 | Ga0065712_10094144 | Ga0065712_100941442 | 481 |
| 619 | 3300005328 | Ga0070676_10003362 | Ga0070676_100033623 | 481 |
| 620 | 3300005330 | Ga0070690_100018063 | Ga0070690_1000180633 | 481 |
| 621 | 3300005334 | Ga0068869_100092340 | Ga0068869_1000923401 | 481 |
| 622 | 3300005337 | Ga0070682_100016065 | Ga0070682_1000160653 | 481 |
| 623 | 3300005338 | Ga0068868_100003218 | Ga0068868_10000321813 | 481 |
| 624 | 3300005341 | Ga0070691_10053018 | Ga0070691_100530181 | 481 |
| 625 | 3300005344 | Ga0070661_100013918 | Ga0070661_1000139181 | 481 |
| 626 | 3300005344 | Ga0070661_100116047 | Ga0070661_1001160472 | 481 |
| 627 | 3300005347 | Ga0070668_100018335 | Ga0070668_1000183351 | 481 |
| 628 | 3300005356 | Ga0070674_100113064 | Ga0070674_1001130641 | 481 |
| 629 | 3300005366 | Ga0070659_100004597 | Ga0070659_1000045977 | 481 |
| 630 | 3300005367 | Ga0070667_100004110 | Ga0070667_1000041104 | 481 |
| 631 | 3300005434 | Ga0070709_10016589 | Ga0070709_100165893 | 481 |
| 632 | 3300005434 | Ga0070709_10024126 | Ga0070709_100241262 | 481 |
| 633 | 3300005439 | Ga0070711_100029520 | Ga0070711_1000295203 | 481 |
| 634 | 3300005445 | Ga0070708_100000298 | Ga0070708_10000029814 | 481 |
| 635 | 3300005445 | Ga0070708_100002919 | Ga0070708_1000029193 | 481 |
| 636 | 3300005445 | Ga0070708_100017425 | Ga0070708_1000174255 | 481 |
| 637 | 3300005455 | Ga0070663_100072156 | Ga0070663_1000721562 | 481 |
| 638 | 3300005458 | Ga0070681_10038239 | Ga0070681_100382393 | 481 |
| 639 | 3300005458 | Ga0070681_10171230 | Ga0070681_101712302 | 481 |
| 640 | 3300005467 | Ga0070706_100000529 | Ga0070706_10000052933 | 481 |
| 641 | 3300005467 | Ga0070706_100092316 | Ga0070706_1000923162 | 481 |
| 642 | 3300005468 | Ga0070707_100058073 | Ga0070707_1000580733 | 481 |
| 643 | 3300005468 | Ga0070707_100076535 | Ga0070707_1000765352 | 481 |
| 644 | 3300005471 | Ga0070698_100000171 | Ga0070698_10000017115 | 481 |
| 645 | 3300005518 | Ga0070699_100003167 | Ga0070699_1000031673 | 481 |
| 646 | 3300005518 | Ga0070699_100020718 | Ga0070699_1000207185 | 481 |
| 647 | 3300005535 | Ga0070684_100047883 | Ga0070684_1000478832 | 481 |
| 648 | 3300005536 | Ga0070697_100000054 | Ga0070697_10000005422 | 481 |
| 649 | 3300005536 | Ga0070697_100001040 | Ga0070697_1000010406 | 481 |
| 650 | 3300005536 | Ga0070697_100028044 | Ga0070697_1000280444 | 481 |
| 651 | 3300005536 | Ga0070697_100073967 | Ga0070697_1000739672 | 481 |
| 652 | 3300005539 | Ga0068853_100180292 | Ga0068853_1001802921 | 481 |
| 653 | 3300005563 | Ga0068855_100008313 | Ga0068855_1000083136 | 481 |
| 654 | 3300005563 | Ga0068855_100323382 | Ga0068855_1003233821 | 481 |
| 655 | 3300005564 | Ga0070664_100001855 | Ga0070664_1000018553 | 481 |
| 656 | 3300005564 | Ga0070664_100067583 | Ga0070664_1000675832 | 481 |
| 657 | 3300005577 | Ga0068857_100001887 | Ga0068857_10000188711 | 481 |
| 658 | 3300005578 | Ga0068854_100001333 | Ga0068854_1000013337 | 481 |
| 659 | 3300005578 | Ga0068854_100080099 | Ga0068854_1000800991 | 481 |
| 660 | 3300005614 | Ga0068856_100002155 | Ga0068856_10000215515 | 481 |
| 661 | 3300005614 | Ga0068856_100003339 | Ga0068856_10000333910 | 481 |
| 662 | 3300005617 | Ga0068859_100005436 | Ga0068859_10000543613 | 481 |
| 663 | 3300005618 | Ga0068864_100005740 | Ga0068864_10000574010 | 481 |
| 664 | 3300005618 | Ga0068864_100066290 | Ga0068864_1000662902 | 481 |
| 665 | 3300005718 | Ga0068866_10019161 | Ga0068866_100191612 | 481 |
| 666 | 3300005840 | Ga0068870_10027197 | Ga0068870_100271972 | 481 |
| 667 | 3300005840 | Ga0068870_10050018 | Ga0068870_100500182 | 481 |
| 668 | 3300005841 | Ga0068863_100087281 | Ga0068863_1000872811 | 481 |
| 669 | 3300005841 | Ga0068863_100163660 | Ga0068863_1001636602 | 481 |
| 670 | 3300005842 | Ga0068858_100001136 | Ga0068858_10000113614 | 481 |
| 671 | 3300005843 | Ga0068860_100009175 | Ga0068860_1000091753 | 481 |
| 672 | 3300005843 | Ga0068860_100010389 | Ga0068860_1000103893 | 481 |
| 673 | 3300006028 | Ga0070717_10003073 | Ga0070717_100030738 | 481 |
| 674 | 3300006028 | Ga0070717_10014404 | Ga0070717_100144042 | 481 |
| 675 | 3300006173 | Ga0070716_100014738 | Ga0070716_1000147382 | 481 |
| 676 | 3300006173 | Ga0070716_100040172 | Ga0070716_1000401722 | 481 |
| 677 | 3300006173 | Ga0070716_100060782 | Ga0070716_1000607822 | 481 |
| 678 | 3300006175 | Ga0070712_100000624 | Ga0070712_10000062421 | 481 |
| 679 | 3300006175 | Ga0070712_100016216 | Ga0070712_1000162163 | 481 |
| 680 | 3300006237 | Ga0097621_100067469 | Ga0097621_1000674692 | 481 |
| 681 | 3300006871 | Ga0075434_100017175 | Ga0075434_1000171754 | 481 |
| 682 | 3300006914 | Ga0075436_100001527 | Ga0075436_1000015273 | 481 |
| 683 | 3300006914 | Ga0075436_100011060 | Ga0075436_1000110603 | 481 |
| 684 | 3300006931 | Ga0097620_100005436 | Ga0097620_10000543613 | 481 |
| 685 | 3300007076 | Ga0075435_100000357 | Ga0075435_10000035715 | 481 |
| 686 | 3300009093 | Ga0105240_10105790 | Ga0105240_101057901 | 481 |
| 687 | 3300009093 | Ga0105240_10332337 | Ga0105240_103323371 | 481 |
| 688 | 3300009098 | Ga0105245_10143724 | Ga0105245_101437242 | 481 |
| 689 | 3300009101 | Ga0105247_10042469 | Ga0105247_100424693 | 481 |
| 690 | 3300009177 | Ga0105248_10006415 | Ga0105248_1000641510 | 481 |
| 691 | 3300011119 | Ga0105246_10107642 | Ga0105246_101076421 | 481 |
| 692 | 3300013104 | Ga0157370_10050083 | Ga0157370_100500833 | 481 |
| 693 | 3300013105 | Ga0157369_10000176 | Ga0157369_1000017676 | 481 |
| 694 | 3300013105 | Ga0157369_10019633 | Ga0157369_100196335 | 481 |
| 695 | 3300013296 | Ga0157374_10102908 | Ga0157374_101029082 | 481 |
| 696 | 3300013297 | Ga0157378_10000057 | Ga0157378_1000005716 | 481 |
| 697 | 3300013297 | Ga0157378_10125593 | Ga0157378_101255932 | 481 |
| 698 | 3300013306 | Ga0163162_10021711 | Ga0163162_100217114 | 481 |
| 699 | 3300013306 | Ga0163162_10063330 | Ga0163162_100633302 | 481 |
| 700 | 3300013307 | Ga0157372_10000471 | Ga0157372_1000047125 | 481 |
| 701 | 3300013308 | Ga0157375_10059425 | Ga0157375_100594253 | 481 |
| 702 | 3300014325 | Ga0163163_10039284 | Ga0163163_100392843 | 481 |
| 703 | 3300014968 | Ga0157379_10005147 | Ga0157379_100051472 | 481 |
| 704 | 3300014968 | Ga0157379_10040559 | Ga0157379_100405593 | 481 |
| 705 | 3300014968 | Ga0157379_10092885 | Ga0157379_100928852 | 481 |
| 706 | 3300024227 | Ga0228598_1000117 | Ga0228598_10001175 | 481 |
| 707 | 3300025910 | Ga0207684_10000702 | Ga0207684_1000070230 | 481 |
| 708 | 3300025912 | Ga0207707_10004695 | Ga0207707_100046958 | 481 |
| 709 | 3300025912 | Ga0207707_10008801 | Ga0207707_100088017 | 481 |
| 710 | 3300025913 | Ga0207695_10090874 | Ga0207695_100908742 | 481 |
| 711 | 3300025913 | Ga0207695_10194628 | Ga0207695_101946281 | 481 |
| 712 | 3300025915 | Ga0207693_10000173 | Ga0207693_1000017336 | 481 |
| 713 | 3300025915 | Ga0207693_10014694 | Ga0207693_100146945 | 481 |
| 714 | 3300025915 | Ga0207693_10016874 | Ga0207693_100168743 | 481 |
| 715 | 3300025916 | Ga0207663_10003624 | Ga0207663_100036246 | 481 |
| 716 | 3300025919 | Ga0207657_10012381 | Ga0207657_100123812 | 481 |
| 717 | 3300025922 | Ga0207646_10022810 | Ga0207646_100228102 | 481 |
| 718 | 3300025922 | Ga0207646_10121421 | Ga0207646_101214211 | 481 |
| 719 | 3300025927 | Ga0207687_10007320 | Ga0207687_100073205 | 481 |
| 720 | 3300025928 | Ga0207700_10096097 | Ga0207700_100960973 | 481 |
| 721 | 3300025929 | Ga0207664_10050007 | Ga0207664_100500073 | 481 |
| 722 | 3300025933 | Ga0207706_10003473 | Ga0207706_100034732 | 481 |
| 723 | 3300025938 | Ga0207704_10042233 | Ga0207704_100422331 | 481 |
| 724 | 3300025939 | Ga0207665_10002707 | Ga0207665_1000270711 | 481 |
| 725 | 3300025939 | Ga0207665_10007285 | Ga0207665_100072852 | 481 |
| 726 | 3300025939 | Ga0207665_10035777 | Ga0207665_100357772 | 481 |
| 727 | 3300025941 | Ga0207711_10014596 | Ga0207711_100145965 | 481 |
| 728 | 3300025942 | Ga0207689_10038924 | Ga0207689_100389242 | 481 |
| 729 | 3300025945 | Ga0207679_10009368 | Ga0207679_100093683 | 481 |
| 730 | 3300025949 | Ga0207667_10006069 | Ga0207667_100060692 | 481 |
| 731 | 3300025949 | Ga0207667_10049431 | Ga0207667_100494312 | 481 |
| 732 | 3300025981 | Ga0207640_10002629 | Ga0207640_100026295 | 481 |
| 733 | 3300026023 | Ga0207677_10016898 | Ga0207677_100168982 | 481 |
| 734 | 3300026023 | Ga0207677_10027424 | Ga0207677_100274242 | 481 |
| 735 | 3300026035 | Ga0207703_10001910 | Ga0207703_100019107 | 481 |
| 736 | 3300026067 | Ga0207678_10000874 | Ga0207678_1000087421 | 481 |
| 737 | 3300026078 | Ga0207702_10005378 | Ga0207702_100053785 | 481 |
| 738 | 3300026089 | Ga0207648_10034527 | Ga0207648_100345273 | 481 |
| 739 | 3300026089 | Ga0207648_10095760 | Ga0207648_100957602 | 481 |
| 740 | 3300026095 | Ga0207676_10002505 | Ga0207676_100025053 | 481 |
| 741 | 3300026095 | Ga0207676_10102311 | Ga0207676_101023111 | 481 |
| 742 | 3300026116 | Ga0207674_10007174 | Ga0207674_100071745 | 481 |
| 743 | 3300026116 | Ga0207674_10055814 | Ga0207674_100558142 | 481 |
| 744 | 3300026118 | Ga0207675_100023243 | Ga0207675_1000232432 | 481 |
| 745 | 3300028381 | Ga0268264_10029004 | Ga0268264_100290043 | 481 |
| 746 | 3300028381 | Ga0268264_10077994 | Ga0268264_100779942 | 481 |
| 747 | 3300028800 | Ga0265338_10026728 | Ga0265338_100267282 | 481 |
| 748 | 3300031090 | Ga0265760_10007428 | Ga0265760_100074283 | 481 |
| 749 | 3300031249 | Ga0265339_10012897 | Ga0265339_100128972 | 481 |
| 750 | 3300034816 | Ga0373930_0002470 | Ga0373930_0002470_71_1612 | 481 |
| 751 | 3300035085 | Ga0373929_0011324 | Ga0373929_0011324_99_1640 | 481 |
| 752 | 3300035086 | Ga0373934_0057453 | Ga0373934_0057453_40_1527 | 481 |
| 753 | 3300035691 | Ga0373931_0047740 | Ga0373931_0047740_748_2211 | 481 |
| 754 | 3300035695 | Ga0373927_0048489 | Ga0373927_0048489_544_2043 | 481 |
| 755 | 3300036401 | Ga0373937_0000559 | Ga0373937_0000559_17999_19483 | 481 |
| 756 | 3300037068 | Ga0373925_0001264 | Ga0373925_0001264_544_2007 | 481 |
| 757 | 3300037471 | Ga0395905_0138296 | Ga0395905_0138296_47_1510 | 481 |
| 758 | 3300039437 | Ga0436365_1746299 | Ga0436365_1746299_53_1537 | 481 |
| 759 | 3300044694 | Ga0466963_0010778 | Ga0466963_0010778_394_1857 | 481 |
| 760 | 3300044694 | Ga0466963_0012505 | Ga0466963_0012505_382_1845 | 481 |
| 761 | 3300044694 | Ga0466963_0024022 | Ga0466963_0024022_458_1921 | 481 |
| 762 | 3300046472 | Ga0495580_0051758 | Ga0495580_0051758_1072_2568 | 481 |
| 763 | 3300046472 | Ga0495580_0059731 | Ga0495580_0059731_218_1723 | 481 |
| 764 | 3300046472 | Ga0495580_0062866 | Ga0495580_0062866_675_2138 | 481 |
| 765 | 3300046473 | Ga0495582_0005957 | Ga0495582_0005957_1820_3283 | 481 |
| 766 | 3300047319 | Ga0495674_0064218 | Ga0495674_0064218_852_2351 | 481 |
| 767 | 3300048904 | Ga0496101_0007379 | Ga0496101_0007379_1381_2880 | 481 |
| 768 | 3300048905 | Ga0496102_0005869 | Ga0496102_0005869_3666_5165 | 481 |
| 769 | 3300048906 | Ga0496103_0004547 | Ga0496103_0004547_1146_2645 | 481 |
| 770 | 3300048907 | Ga0496104_0053014 | Ga0496104_0053014_772_2277 | 481 |
| 771 | 3300048907 | Ga0496104_0234036 | Ga0496104_0234036_242_1705 | 481 |
| 772 | 3300048914 | Ga0496111_0008000 | Ga0496111_0008000_52_1539 | 481 |
| 773 | 3300048915 | Ga0496112_0174969 | Ga0496112_0174969_78_1619 | 481 |
| 774 | 3300048918 | Ga0496115_0065835 | Ga0496115_0065835_1005_2504 | 481 |
| 775 | 3300050512 | nmdc:mga0n895_1794_c1 | nmdc:mga0n895_1794_c1_2222_3727 | 481 |
| 776 | 3300050512 | nmdc:mga0n895_57853_c1 | nmdc:mga0n895_57853_c1_868_2409 | 481 |
| 777 | 3300050514 | nmdc:mga08x19_65863_c1 | nmdc:mga08x19_65863_c1_283_1746 | 481 |
| 778 | 3300053077 | Ga0495601_0001879 | Ga0495601_0001879_2391_3875 | 481 |
| 779 | 3300061719 | Ga0466962_0016740 | Ga0466962_0016740_1458_2921 | 481 |
| 780 | 3300005329 | Ga0070683_100212620 | Ga0070683_1002126202 | 482 |
| 781 | 3300005336 | Ga0070680_100041435 | Ga0070680_1000414351 | 482 |
| 782 | 3300005530 | Ga0070679_100010668 | Ga0070679_1000106687 | 482 |
| 783 | 3300005577 | Ga0068857_100192182 | Ga0068857_1001921822 | 482 |
| 784 | 3300025917 | Ga0207660_10028785 | Ga0207660_100287852 | 482 |
| 785 | 3300025921 | Ga0207652_10011594 | Ga0207652_100115946 | 482 |
| 786 | 3300000546 | LJNas_1000797 | LJNas_10007974 | 483 |
| 787 | 3300013105 | Ga0157369_10043083 | Ga0157369_100430833 | 483 |
| 788 | 3300021361 | Ga0213872_10003228 | Ga0213872_100032289 | 483 |
| 789 | 3300021441 | Ga0213871_10001966 | Ga0213871_100019664 | 483 |
| 790 | 3300028800 | Ga0265338_10066956 | Ga0265338_100669563 | 483 |
| 791 | 3300031238 | Ga0265332_10046701 | Ga0265332_100467011 | 483 |
| 792 | 3300039438 | Ga0436360_1294278 | Ga0436360_1294278_1285_2742 | 483 |
| 793 | 3300039447 | Ga0436361_0533922 | Ga0436361_0533922_2516_3973 | 483 |
| 794 | 3300039447 | Ga0436361_0550373 | Ga0436361_0550373_6289_7746 | 483 |
| 795 | 3300039447 | Ga0436361_1111084 | Ga0436361_1111084_709_2166 | 483 |
| 796 | 3300048911 | Ga0496108_0017528 | Ga0496108_0017528_2930_4381 | 483 |
| 797 | 3300048929 | Ga0496126_0002019 | Ga0496126_0002019_5059_6513 | 483 |
| 798 | 3300053077 | Ga0495601_0007359 | Ga0495601_0007359_2342_3835 | 483 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cx4-assembly1.cif.gz_A | crystal structure of e.coli gs mutant e377a in complex with adp and oligosaccharides | 0.9468 | 1 | 477 |
| 2r4t-assembly1.cif.gz_A | crystal structure of wild-type e.coli gs in complex with adp and glucose(wtgsc) | 0.9464 | 1 | 477 |
| 3cx4-assembly1.cif.gz_A | crystal structure of e.coli gs mutant e377a in complex with adp and oligosaccharides | 0.943 | 1 | 477 |
| 2r4t-assembly1.cif.gz_A | crystal structure of wild-type e.coli gs in complex with adp and glucose(wtgsc) | 0.9406 | 1 | 477 |
| 6gne-assembly1.cif.gz_A | catalytic domain of starch synthase iv from arabidopsis thaliana bound to adp and acarbose | 0.921 | 2 | 480 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0DEC8_405_613_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9768 | 254 | 457 | 3.40.50.2000 |
| 3copA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9693 | 254 | 460 | 3.40.50.2000 |
| af_Q59001_288_450_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9584 | 291 | 442 | 3.40.50.2000 |
| 1rzvB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9514 | 254 | 457 | 3.40.50.2000 |
| 3copA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9514 | 254 | 460 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0J5G2-F1-model_v4 | starch synthase (EC 2.4.1.21) | 0.9796 | 53 | 482 |
GO:0004373
GO:0005978 GO:0009011 |
| AF-A0A3D4Z1U1-F1-model_v4 | Glycogen synthase (EC 2.4.1.21) (Starch [bacterial glycogen] synthase) | 0.9728 | 1 | 480 |
GO:0004373
GO:0005978 GO:0009011 |
| AF-A0A534M3C6-F1-model_v4 | Glycogen synthase | 0.9708 | 1 | 412 |
GO:0004373
|
| AF-A0A3D5ZNV8-F1-model_v4 | Glycogen synthase (EC 2.4.1.21) (Starch [bacterial glycogen] synthase) | 0.9684 | 2 | 475 |
GO:0004373
GO:0005978 GO:0009011 |
| AF-A0A0S8K904-F1-model_v4 | Glycogen synthase (EC 2.4.1.21) (Starch [bacterial glycogen] synthase) | 0.9681 | 1 | 480 |
GO:0004373
GO:0005829 GO:0005978 GO:0009011 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar