F480696
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 784 | 384 | 783 | 154 |
Family's Representative Sequence
| Representative Sequence | 3300025949|Ga0207667_10626150|Ga0207667_106261502 |
| Length | 188 |
| Sequence | MVRYLLVGSLIPPGVRAATADGSGILPKLCLCPGPPMIQLTINGKARRFDGDPEMPLLWFLRDELQLTGTKFGCGMGLCGACTVHVNGEAARSCLTPMSAAAGKTVTTIEGLSATGSHPLQKAWEEANVPQCGYCQSGQIMQAAAMLKAKPHPTDQDIDSAMSGNICRCGTYQRIRQAIRMAANGGKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 29 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 98 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 99 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 115 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 116 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 129 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013875 | Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 151 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 152 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 153 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 154 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 155 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 156 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 157 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 166 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 222 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 224 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 225 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 228 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 229 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 230 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 231 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 232 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 248 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 249 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 250 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 251 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 252 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 253 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 255 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 256 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 257 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 258 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 259 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 260 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 261 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 262 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 263 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 264 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 265 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 266 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 267 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 268 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 269 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 274 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 275 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 310 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 311 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 314 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 315 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 316 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 317 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 318 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 319 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 320 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 321 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 322 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 323 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 324 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 325 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 326 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 344 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 345 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 346 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 352 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 359 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 360 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 362 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 363 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 364 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 365 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 366 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 367 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 368 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 370 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 372 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 373 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 374 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 375 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 376 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 377 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 379 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 380 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 381 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 384 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.72 |
| Metatranscriptomes | 1.15 |
| Isolates | 0.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.27 |
| Nodule | 0 |
| Rhizoplane | 2.42 |
| Rhizosphere | 75.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10082966 | 3300001979 | Bacteria | 837 |
| 2 | JGI24739J22299_10027145 | 3300001989 | Bacteria | 2004 |
| 3 | JGI24735J21928_10072852 | 3300002067 | Bacteria | 984 |
| 4 | JGI25156J39149_1001597 | 3300002705 | Bacteria | 9270 |
| 5 | JGI25156J39149_1016641 | 3300002705 | Bacteria | 1422 |
| 6 | JGI25162J39368_1006156 | 3300002737 | Bacteria | 2141 |
| 7 | JGI25157J39369_1001161 | 3300002741 | Bacteria | 11328 |
| 8 | JGI25157J39369_1001478 | 3300002741 | Bacteria | 8667 |
| 9 | JGI25164J39214_1000198 | 3300002772 | Bacteria | 51603 |
| 10 | JGI25406J46586_10032341 | 3300003203 | Bacteria | 1945 |
| 11 | JGI25165J46597_1000354 | 3300003214 | Bacteria | 51605 |
| 12 | rootH1_10024611 | 3300003316 | Bacteria | 4634 |
| 13 | rootH2_10304912 | 3300003320 | Bacteria | 1231 |
| 14 | Ga0007416J51690_1114583 | 3300003577 | Bacteria | 626 |
| 15 | Ga0007429J51699_1092521 | 3300003579 | Bacteria | 932 |
| 16 | Ga0055539_1001188 | 3300003752 | Bacteria | 5293 |
| 17 | Ga0055533_1014903 | 3300003756 | Bacteria | 773 |
| 18 | Ga0055532_1000185 | 3300003758 | Bacteria | 52548 |
| 19 | Ga0055532_1000217 | 3300003758 | Bacteria | 44081 |
| 20 | Ga0055525_1000059 | 3300003759 | Bacteria | 202797 |
| 21 | Ga0055527_1000050 | 3300003760 | Bacteria | 104542 |
| 22 | Ga0055527_1000128 | 3300003760 | Bacteria | 53342 |
| 23 | Ga0055527_1001996 | 3300003760 | Bacteria | 3719 |
| 24 | Ga0055527_1006915 | 3300003760 | Bacteria | 1406 |
| 25 | Ga0055535_1000119 | 3300003761 | Bacteria | 84990 |
| 26 | Ga0055535_1000206 | 3300003761 | Bacteria | 62330 |
| 27 | Ga0055535_1000212 | 3300003761 | Bacteria | 61691 |
| 28 | Ga0055535_1000287 | 3300003761 | Bacteria | 53346 |
| 29 | Ga0055535_1000295 | 3300003761 | Bacteria | 51620 |
| 30 | Ga0055542_1000057 | 3300003762 | Bacteria | 162955 |
| 31 | Ga0055542_1000119 | 3300003762 | Bacteria | 104542 |
| 32 | Ga0055542_1000238 | 3300003762 | Bacteria | 63399 |
| 33 | Ga0055542_1000311 | 3300003762 | Bacteria | 53346 |
| 34 | Ga0055542_1000966 | 3300003762 | Bacteria | 18722 |
| 35 | Ga0055529_1000049 | 3300003763 | Bacteria | 208413 |
| 36 | Ga0055529_1000270 | 3300003763 | Bacteria | 61712 |
| 37 | Ga0055529_1000329 | 3300003763 | Bacteria | 53347 |
| 38 | Ga0055529_1000884 | 3300003763 | Bacteria | 16980 |
| 39 | Ga0055526_1017989 | 3300003771 | Bacteria | 2665 |
| 40 | Ga0055528_1000986 | 3300003790 | Bacteria | 18895 |
| 41 | Ga0055540_1007096 | 3300003792 | Bacteria | 4300 |
| 42 | Ga0055531_10015237 | 3300003794 | Bacteria | 3405 |
| 43 | Ga0055541_1015339 | 3300003841 | Bacteria | 1022 |
| 44 | JGI25405J52794_10117483 | 3300003911 | Bacteria | 598 |
| 45 | Ga0055543_1025049 | 3300004625 | Bacteria | 1067 |
| 46 | Ga0058862_12866476 | 3300004803 | Bacteria | 597 |
| 47 | Ga0065165_1000490 | 3300005262 | Bacteria | 61094 |
| 48 | Ga0065704_10379807 | 3300005289 | Bacteria | 775 |
| 49 | Ga0065712_10025321 | 3300005290 | Bacteria | 1399 |
| 50 | Ga0065715_10016620 | 3300005293 | Bacteria | 2090 |
| 51 | Ga0065707_10020820 | 3300005295 | Bacteria | 1694 |
| 52 | Ga0070658_10013460 | 3300005327 | Bacteria | 6565 |
| 53 | Ga0070658_10019732 | 3300005327 | Bacteria | 5397 |
| 54 | Ga0070676_10460293 | 3300005328 | Bacteria | 896 |
| 55 | Ga0070690_100826417 | 3300005330 | Bacteria | 720 |
| 56 | Ga0070670_101042285 | 3300005331 | Bacteria | 745 |
| 57 | Ga0068869_100621768 | 3300005334 | Bacteria | 914 |
| 58 | Ga0070666_11014417 | 3300005335 | Bacteria | 616 |
| 59 | Ga0070680_100003733 | 3300005336 | Bacteria | 11378 |
| 60 | Ga0070680_100092078 | 3300005336 | Bacteria | 2510 |
| 61 | Ga0070680_100646880 | 3300005336 | Bacteria | 909 |
| 62 | Ga0070680_101034608 | 3300005336 | Bacteria | 709 |
| 63 | Ga0070682_101551439 | 3300005337 | Bacteria | 571 |
| 64 | Ga0068868_101255339 | 3300005338 | Bacteria | 687 |
| 65 | Ga0070660_100000004 | 3300005339 | Bacteria | 171018 |
| 66 | Ga0070660_100237424 | 3300005339 | Bacteria | 1484 |
| 67 | Ga0070689_101386646 | 3300005340 | Bacteria | 635 |
| 68 | Ga0070675_100985211 | 3300005354 | Bacteria | 774 |
| 69 | Ga0070675_101303418 | 3300005354 | Unclassified | 669 |
| 70 | Ga0070674_100058186 | 3300005356 | Bacteria | 2686 |
| 71 | Ga0070674_100438288 | 3300005356 | Bacteria | 1076 |
| 72 | Ga0070673_100065377 | 3300005364 | Bacteria | 2901 |
| 73 | Ga0070673_100889690 | 3300005364 | Bacteria | 825 |
| 74 | Ga0070688_100176706 | 3300005365 | Bacteria | 1478 |
| 75 | Ga0070688_100803867 | 3300005365 | Bacteria | 736 |
| 76 | Ga0070659_100000023 | 3300005366 | Bacteria | 150907 |
| 77 | Ga0070659_100282912 | 3300005366 | Bacteria | 1380 |
| 78 | Ga0070709_10026841 | 3300005434 | Bacteria | 3417 |
| 79 | Ga0070714_100176322 | 3300005435 | Bacteria | 1942 |
| 80 | Ga0070714_100298913 | 3300005435 | Bacteria | 1500 |
| 81 | Ga0070714_100779577 | 3300005435 | Bacteria | 925 |
| 82 | Ga0070713_101691405 | 3300005436 | Bacteria | 614 |
| 83 | Ga0070713_101977762 | 3300005436 | Bacteria | 565 |
| 84 | Ga0070710_10052966 | 3300005437 | Bacteria | 2284 |
| 85 | Ga0070710_10109467 | 3300005437 | Bacteria | 1657 |
| 86 | Ga0070710_10390861 | 3300005437 | Bacteria | 930 |
| 87 | Ga0070711_100019243 | 3300005439 | Bacteria | 4378 |
| 88 | Ga0070711_100137094 | 3300005439 | Bacteria | 1830 |
| 89 | Ga0070711_100187298 | 3300005439 | Bacteria | 1588 |
| 90 | Ga0070705_100656145 | 3300005440 | Bacteria | 819 |
| 91 | Ga0070694_100003493 | 3300005444 | Bacteria | 9404 |
| 92 | Ga0070694_101397333 | 3300005444 | Bacteria | 590 |
| 93 | Ga0070708_100101800 | 3300005445 | Bacteria | 2631 |
| 94 | Ga0070708_100165342 | 3300005445 | Bacteria | 2064 |
| 95 | Ga0070663_100003816 | 3300005455 | Bacteria | 8772 |
| 96 | Ga0070678_100258533 | 3300005456 | Bacteria | 1463 |
| 97 | Ga0070678_100418023 | 3300005456 | Bacteria | 1168 |
| 98 | Ga0070662_100139989 | 3300005457 | Bacteria | 1874 |
| 99 | Ga0070662_101229062 | 3300005457 | Bacteria | 644 |
| 100 | Ga0070681_10280278 | 3300005458 | Bacteria | 1577 |
| 101 | Ga0070681_10747956 | 3300005458 | Bacteria | 894 |
| 102 | Ga0070681_11367505 | 3300005458 | Bacteria | 631 |
| 103 | Ga0068867_100221425 | 3300005459 | Bacteria | 1525 |
| 104 | Ga0070685_11189472 | 3300005466 | Bacteria | 579 |
| 105 | Ga0070706_100293128 | 3300005467 | Bacteria | 1518 |
| 106 | Ga0070706_100368912 | 3300005467 | Bacteria | 1337 |
| 107 | Ga0070706_100720437 | 3300005467 | Bacteria | 925 |
| 108 | Ga0070707_100039683 | 3300005468 | Bacteria | 4501 |
| 109 | Ga0070707_100860618 | 3300005468 | Bacteria | 871 |
| 110 | Ga0070698_100000373 | 3300005471 | Bacteria | 46692 |
| 111 | Ga0070698_100095616 | 3300005471 | Bacteria | 2948 |
| 112 | Ga0070699_100058652 | 3300005518 | Bacteria | 3335 |
| 113 | Ga0070699_100100014 | 3300005518 | Bacteria | 2541 |
| 114 | Ga0070699_100279308 | 3300005518 | Bacteria | 1496 |
| 115 | Ga0070699_101285789 | 3300005518 | Bacteria | 671 |
| 116 | Ga0070679_100180423 | 3300005530 | Bacteria | 2084 |
| 117 | Ga0070679_100576487 | 3300005530 | Bacteria | 1069 |
| 118 | Ga0070679_100791708 | 3300005530 | Bacteria | 891 |
| 119 | Ga0070684_100138170 | 3300005535 | Bacteria | 2202 |
| 120 | Ga0070697_100030107 | 3300005536 | Bacteria | 4358 |
| 121 | Ga0068853_100312418 | 3300005539 | Bacteria | 1455 |
| 122 | Ga0068853_101553536 | 3300005539 | Bacteria | 641 |
| 123 | Ga0070672_100330382 | 3300005543 | Bacteria | 1297 |
| 124 | Ga0070672_101570790 | 3300005543 | Bacteria | 590 |
| 125 | Ga0070695_100257127 | 3300005545 | Bacteria | 1274 |
| 126 | Ga0070696_100115548 | 3300005546 | Bacteria | 1937 |
| 127 | Ga0070665_100031017 | 3300005548 | Bacteria | 5380 |
| 128 | Ga0070665_100034634 | 3300005548 | Bacteria | 5078 |
| 129 | Ga0070665_100102956 | 3300005548 | Bacteria | 2859 |
| 130 | Ga0070665_100205709 | 3300005548 | Bacteria | 1969 |
| 131 | Ga0070665_100861402 | 3300005548 | Bacteria | 919 |
| 132 | Ga0070704_100573890 | 3300005549 | Bacteria | 988 |
| 133 | Ga0070704_100712086 | 3300005549 | Bacteria | 891 |
| 134 | Ga0068855_100008161 | 3300005563 | Bacteria | 12658 |
| 135 | Ga0068855_100018483 | 3300005563 | Bacteria | 8378 |
| 136 | Ga0068855_100021333 | 3300005563 | Bacteria | 7767 |
| 137 | Ga0068855_100078722 | 3300005563 | Bacteria | 3824 |
| 138 | Ga0068855_100558349 | 3300005563 | Bacteria | 1239 |
| 139 | Ga0068855_100881104 | 3300005563 | Bacteria | 947 |
| 140 | Ga0070664_100092553 | 3300005564 | Bacteria | 2618 |
| 141 | Ga0070664_100140946 | 3300005564 | Bacteria | 2123 |
| 142 | Ga0068854_101301605 | 3300005578 | Bacteria | 654 |
| 143 | Ga0068854_101588320 | 3300005578 | Bacteria | 596 |
| 144 | Ga0068856_100000455 | 3300005614 | Bacteria | 45174 |
| 145 | Ga0068856_100039844 | 3300005614 | Bacteria | 4613 |
| 146 | Ga0068856_100111296 | 3300005614 | Bacteria | 2736 |
| 147 | Ga0068856_100164962 | 3300005614 | Bacteria | 2226 |
| 148 | Ga0068856_100326776 | 3300005614 | Bacteria | 1551 |
| 149 | Ga0068856_100447973 | 3300005614 | Bacteria | 1312 |
| 150 | Ga0068856_100638230 | 3300005614 | Bacteria | 1086 |
| 151 | Ga0068856_101137822 | 3300005614 | Bacteria | 798 |
| 152 | Ga0070702_101267641 | 3300005615 | Bacteria | 597 |
| 153 | Ga0068852_100015181 | 3300005616 | Bacteria | 5961 |
| 154 | Ga0068852_100544718 | 3300005616 | Bacteria | 1160 |
| 155 | Ga0068852_101517615 | 3300005616 | Unclassified | 692 |
| 156 | Ga0068859_100277630 | 3300005617 | Bacteria | 1768 |
| 157 | Ga0068864_100527368 | 3300005618 | Bacteria | 1139 |
| 158 | Ga0068864_100893620 | 3300005618 | Bacteria | 877 |
| 159 | Ga0068864_101246982 | 3300005618 | Bacteria | 743 |
| 160 | Ga0068864_101394447 | 3300005618 | Bacteria | 702 |
| 161 | Ga0068866_10732638 | 3300005718 | Bacteria | 681 |
| 162 | Ga0068861_100067402 | 3300005719 | Bacteria | 2762 |
| 163 | Ga0068861_100335650 | 3300005719 | Bacteria | 1321 |
| 164 | Ga0068863_100389331 | 3300005841 | Bacteria | 1362 |
| 165 | Ga0068858_100280984 | 3300005842 | Bacteria | 1585 |
| 166 | Ga0068858_100306012 | 3300005842 | Bacteria | 1517 |
| 167 | Ga0068858_100807547 | 3300005842 | Bacteria | 915 |
| 168 | Ga0068858_101053404 | 3300005842 | Bacteria | 798 |
| 169 | Ga0068862_100027705 | 3300005844 | Bacteria | 4770 |
| 170 | Ga0081455_10078082 | 3300005937 | Bacteria | 2721 |
| 171 | Ga0081455_10090188 | 3300005937 | Bacteria | 2486 |
| 172 | Ga0081455_10183189 | 3300005937 | Bacteria | 1584 |
| 173 | Ga0081538_10010333 | 3300005981 | Bacteria | 7658 |
| 174 | Ga0081540_1104017 | 3300005983 | Bacteria | 1216 |
| 175 | Ga0081540_1219320 | 3300005983 | Bacteria | 678 |
| 176 | Ga0081539_10016966 | 3300005985 | Bacteria | 5157 |
| 177 | Ga0070717_10028502 | 3300006028 | Bacteria | 4471 |
| 178 | Ga0070717_10033606 | 3300006028 | Bacteria | 4138 |
| 179 | Ga0070717_10048549 | 3300006028 | Bacteria | 3482 |
| 180 | Ga0070717_10158061 | 3300006028 | Bacteria | 1965 |
| 181 | Ga0070717_11529869 | 3300006028 | Bacteria | 605 |
| 182 | Ga0075368_10284662 | 3300006042 | Bacteria | 711 |
| 183 | Ga0075364_10263931 | 3300006051 | Bacteria | 1171 |
| 184 | Ga0075364_10452104 | 3300006051 | Bacteria | 877 |
| 185 | Ga0070715_10005486 | 3300006163 | Bacteria | 4234 |
| 186 | Ga0070716_100221099 | 3300006173 | Bacteria | 1272 |
| 187 | Ga0070712_100207703 | 3300006175 | Bacteria | 1542 |
| 188 | Ga0070712_100237032 | 3300006175 | Bacteria | 1452 |
| 189 | Ga0070712_100371547 | 3300006175 | Bacteria | 1175 |
| 190 | Ga0070712_100688436 | 3300006175 | Bacteria | 871 |
| 191 | Ga0075367_10140420 | 3300006178 | Bacteria | 1496 |
| 192 | Ga0075367_10319264 | 3300006178 | Bacteria | 979 |
| 193 | Ga0075369_10008829 | 3300006186 | Bacteria | 3893 |
| 194 | Ga0075366_10079958 | 3300006195 | Bacteria | 1952 |
| 195 | Ga0097621_100378603 | 3300006237 | Bacteria | 1264 |
| 196 | Ga0075428_100129484 | 3300006844 | Bacteria | 2746 |
| 197 | Ga0075428_100213687 | 3300006844 | Bacteria | 2084 |
| 198 | Ga0075428_101365436 | 3300006844 | Bacteria | 744 |
| 199 | Ga0075430_100017099 | 3300006846 | Bacteria | 6178 |
| 200 | Ga0075430_100208253 | 3300006846 | Bacteria | 1623 |
| 201 | Ga0075430_100365188 | 3300006846 | Bacteria | 1192 |
| 202 | Ga0075430_100382421 | 3300006846 | Bacteria | 1162 |
| 203 | Ga0075431_100049994 | 3300006847 | Bacteria | 4311 |
| 204 | Ga0075431_101303471 | 3300006847 | Bacteria | 687 |
| 205 | Ga0075433_10739008 | 3300006852 | Bacteria | 861 |
| 206 | Ga0075434_100074195 | 3300006871 | Bacteria | 3395 |
| 207 | Ga0075434_101430195 | 3300006871 | Bacteria | 701 |
| 208 | Ga0075429_100065686 | 3300006880 | Bacteria | 3159 |
| 209 | Ga0075429_100289861 | 3300006880 | Unclassified | 1433 |
| 210 | Ga0075436_100177970 | 3300006914 | Bacteria | 1503 |
| 211 | Ga0097620_100277631 | 3300006931 | Bacteria | 1768 |
| 212 | Ga0075435_100117975 | 3300007076 | Bacteria | 2212 |
| 213 | Ga0099795_10002609 | 3300007788 | Bacteria | 4283 |
| 214 | Ga0099795_10030126 | 3300007788 | Bacteria | 1860 |
| 215 | Ga0099795_10172256 | 3300007788 | Bacteria | 900 |
| 216 | Ga0105250_10019883 | 3300009092 | Bacteria | 2715 |
| 217 | Ga0105240_10000337 | 3300009093 | Bacteria | 87719 |
| 218 | Ga0105240_10001353 | 3300009093 | Bacteria | 42046 |
| 219 | Ga0105240_10006874 | 3300009093 | Bacteria | 16625 |
| 220 | Ga0105240_10095466 | 3300009093 | Bacteria | 3625 |
| 221 | Ga0105240_10132247 | 3300009093 | Bacteria | 2992 |
| 222 | Ga0105240_10296296 | 3300009093 | Bacteria | 1852 |
| 223 | Ga0105240_10335475 | 3300009093 | Bacteria | 1719 |
| 224 | Ga0105240_12115071 | 3300009093 | Bacteria | 584 |
| 225 | Ga0111539_10305921 | 3300009094 | Bacteria | 1850 |
| 226 | Ga0111539_10617194 | 3300009094 | Bacteria | 1263 |
| 227 | Ga0105245_10041617 | 3300009098 | Bacteria | 4096 |
| 228 | Ga0105245_10529817 | 3300009098 | Bacteria | 1198 |
| 229 | Ga0105245_10548624 | 3300009098 | Bacteria | 1178 |
| 230 | Ga0105245_10953931 | 3300009098 | Bacteria | 901 |
| 231 | Ga0114129_10202084 | 3300009147 | Bacteria | 2691 |
| 232 | Ga0114129_10257209 | 3300009147 | Bacteria | 2342 |
| 233 | Ga0114129_10283516 | 3300009147 | Bacteria | 2213 |
| 234 | Ga0114129_10772223 | 3300009147 | Bacteria | 1228 |
| 235 | Ga0114129_11024268 | 3300009147 | Bacteria | 1038 |
| 236 | Ga0114129_11050039 | 3300009147 | Bacteria | 1023 |
| 237 | Ga0114129_12410464 | 3300009147 | Bacteria | 630 |
| 238 | Ga0105243_10291796 | 3300009148 | Unclassified | 1474 |
| 239 | Ga0105241_10877466 | 3300009174 | Bacteria | 831 |
| 240 | Ga0105241_11182011 | 3300009174 | Bacteria | 724 |
| 241 | Ga0105242_10159121 | 3300009176 | Bacteria | 1975 |
| 242 | Ga0105242_10279618 | 3300009176 | Bacteria | 1515 |
| 243 | Ga0105242_10453292 | 3300009176 | Bacteria | 1210 |
| 244 | Ga0105248_10050901 | 3300009177 | Bacteria | 4647 |
| 245 | Ga0105248_10757727 | 3300009177 | Bacteria | 1095 |
| 246 | Ga0105248_10806005 | 3300009177 | Bacteria | 1060 |
| 247 | Ga0105248_10982851 | 3300009177 | Bacteria | 953 |
| 248 | Ga0105248_11411424 | 3300009177 | Bacteria | 788 |
| 249 | Ga0105248_12343157 | 3300009177 | Bacteria | 608 |
| 250 | Ga0105248_12591790 | 3300009177 | Bacteria | 578 |
| 251 | Ga0105237_10002393 | 3300009545 | Bacteria | 23297 |
| 252 | Ga0105237_10004165 | 3300009545 | Bacteria | 16837 |
| 253 | Ga0105237_10009190 | 3300009545 | Bacteria | 10610 |
| 254 | Ga0105237_10133017 | 3300009545 | Bacteria | 2482 |
| 255 | Ga0105238_10008672 | 3300009551 | Bacteria | 10171 |
| 256 | Ga0105238_10021470 | 3300009551 | Bacteria | 6576 |
| 257 | Ga0105238_10324851 | 3300009551 | Bacteria | 1525 |
| 258 | Ga0105249_10613862 | 3300009553 | Bacteria | 1143 |
| 259 | Ga0105249_10805681 | 3300009553 | Bacteria | 1003 |
| 260 | Ga0105249_11518156 | 3300009553 | Bacteria | 742 |
| 261 | Ga0105035_107571 | 3300009988 | Bacteria | 916 |
| 262 | Ga0099796_10006093 | 3300010159 | Bacteria | 3065 |
| 263 | Ga0099796_10115822 | 3300010159 | Bacteria | 1025 |
| 264 | Ga0105239_10005104 | 3300010375 | Bacteria | 15496 |
| 265 | Ga0105246_10533496 | 3300011119 | Bacteria | 1003 |
| 266 | Ga0105246_11086427 | 3300011119 | Bacteria | 730 |
| 267 | Ga0157370_10005606 | 3300013104 | Bacteria | 14053 |
| 268 | Ga0157370_10146500 | 3300013104 | Bacteria | 2199 |
| 269 | Ga0157370_10276222 | 3300013104 | Bacteria | 1552 |
| 270 | Ga0157370_10607615 | 3300013104 | Bacteria | 1001 |
| 271 | Ga0157370_11069860 | 3300013104 | Bacteria | 729 |
| 272 | Ga0157369_10001633 | 3300013105 | Bacteria | 27410 |
| 273 | Ga0157369_10004521 | 3300013105 | Bacteria | 16369 |
| 274 | Ga0157369_10088108 | 3300013105 | Bacteria | 3313 |
| 275 | Ga0157369_10215104 | 3300013105 | Bacteria | 2013 |
| 276 | Ga0157369_10504677 | 3300013105 | Bacteria | 1251 |
| 277 | Ga0157369_11449589 | 3300013105 | Bacteria | 699 |
| 278 | Ga0157374_10027248 | 3300013296 | Bacteria | 5152 |
| 279 | Ga0157374_10180316 | 3300013296 | Bacteria | 2063 |
| 280 | Ga0157374_11790706 | 3300013296 | Bacteria | 639 |
| 281 | Ga0157378_10064717 | 3300013297 | Bacteria | 3272 |
| 282 | Ga0157378_12308919 | 3300013297 | Bacteria | 589 |
| 283 | Ga0163162_10181605 | 3300013306 | Bacteria | 2230 |
| 284 | Ga0163162_11346718 | 3300013306 | Bacteria | 812 |
| 285 | Ga0163162_11670522 | 3300013306 | Bacteria | 727 |
| 286 | Ga0163162_11964272 | 3300013306 | Bacteria | 670 |
| 287 | Ga0157372_10450412 | 3300013307 | Bacteria | 1500 |
| 288 | Ga0157372_11166673 | 3300013307 | Bacteria | 890 |
| 289 | Ga0157375_11085361 | 3300013308 | Bacteria | 937 |
| 290 | Ga0157375_12126510 | 3300013308 | Bacteria | 668 |
| 291 | Ga0157515_126273 | 3300013875 | Bacteria | 814 |
| 292 | Ga0163163_10024356 | 3300014325 | Bacteria | 5760 |
| 293 | Ga0163163_10024722 | 3300014325 | Bacteria | 5719 |
| 294 | Ga0163163_10026417 | 3300014325 | Bacteria | 5550 |
| 295 | Ga0163163_10179909 | 3300014325 | Bacteria | 2162 |
| 296 | Ga0163163_12157092 | 3300014325 | Bacteria | 616 |
| 297 | Ga0157380_10075894 | 3300014326 | Bacteria | 2733 |
| 298 | Ga0157380_10240941 | 3300014326 | Bacteria | 1630 |
| 299 | Ga0157380_10603157 | 3300014326 | Bacteria | 1087 |
| 300 | Ga0157380_11581399 | 3300014326 | Bacteria | 711 |
| 301 | Ga0157380_12208626 | 3300014326 | Bacteria | 614 |
| 302 | Ga0182008_10403786 | 3300014497 | Bacteria | 734 |
| 303 | Ga0157379_10029397 | 3300014968 | Bacteria | 4888 |
| 304 | Ga0157376_10105338 | 3300014969 | Bacteria | 2472 |
| 305 | Ga0157376_10816888 | 3300014969 | Bacteria | 946 |
| 306 | Ga0157376_10892597 | 3300014969 | Bacteria | 907 |
| 307 | Ga0182006_1014936 | 3300015261 | Bacteria | 3339 |
| 308 | Ga0182006_1021466 | 3300015261 | Bacteria | 2693 |
| 309 | Ga0182007_10000106 | 3300015262 | Bacteria | 59012 |
| 310 | Ga0163161_10590593 | 3300017792 | Bacteria | 914 |
| 311 | Ga0163161_11083324 | 3300017792 | Bacteria | 688 |
| 312 | Ga0184601_134489 | 3300019183 | Bacteria | 587 |
| 313 | Ga0206350_10736505 | 3300020080 | Bacteria | 1520 |
| 314 | Ga0213873_10071571 | 3300021358 | Bacteria | 956 |
| 315 | Ga0213872_10000071 | 3300021361 | Bacteria | 91423 |
| 316 | Ga0213872_10000785 | 3300021361 | Bacteria | 23235 |
| 317 | Ga0213872_10003152 | 3300021361 | Bacteria | 9257 |
| 318 | Ga0213872_10059439 | 3300021361 | Bacteria | 1730 |
| 319 | Ga0213872_10060842 | 3300021361 | Bacteria | 1708 |
| 320 | Ga0213872_10115178 | 3300021361 | Bacteria | 1191 |
| 321 | Ga0213872_10117995 | 3300021361 | Bacteria | 1174 |
| 322 | Ga0213874_10030925 | 3300021377 | Bacteria | 1546 |
| 323 | Ga0213874_10179083 | 3300021377 | Bacteria | 753 |
| 324 | Ga0213876_10033677 | 3300021384 | Bacteria | 2701 |
| 325 | Ga0213876_10156838 | 3300021384 | Bacteria | 1211 |
| 326 | Ga0213876_10227828 | 3300021384 | Bacteria | 991 |
| 327 | Ga0213875_10000004 | 3300021388 | Bacteria | 703388 |
| 328 | Ga0213875_10000409 | 3300021388 | Bacteria | 37759 |
| 329 | Ga0213875_10010793 | 3300021388 | Bacteria | 4567 |
| 330 | Ga0213875_10084814 | 3300021388 | Bacteria | 1478 |
| 331 | Ga0213875_10122583 | 3300021388 | Bacteria | 1215 |
| 332 | Ga0213875_10445581 | 3300021388 | Bacteria | 619 |
| 333 | Ga0213875_10542333 | 3300021388 | Bacteria | 560 |
| 334 | Ga0213871_10006468 | 3300021441 | Bacteria | 2479 |
| 335 | Ga0213871_10024857 | 3300021441 | Bacteria | 1521 |
| 336 | Ga0228598_1041091 | 3300024227 | Bacteria | 913 |
| 337 | Ga0209566_100408 | 3300025225 | Bacteria | 34108 |
| 338 | Ga0209674_100026 | 3300025226 | Bacteria | 490631 |
| 339 | Ga0209674_101565 | 3300025226 | Bacteria | 5812 |
| 340 | Ga0209674_102480 | 3300025226 | Bacteria | 3933 |
| 341 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 342 | Ga0209672_100017 | 3300025228 | Bacteria | 514236 |
| 343 | Ga0209672_100065 | 3300025228 | Bacteria | 198168 |
| 344 | Ga0209672_100173 | 3300025228 | Bacteria | 54084 |
| 345 | Ga0209672_100857 | 3300025228 | Bacteria | 13919 |
| 346 | Ga0209147_100044 | 3300025229 | Bacteria | 300330 |
| 347 | Ga0209147_100124 | 3300025229 | Bacteria | 133627 |
| 348 | Ga0209563_100074 | 3300025230 | Bacteria | 224912 |
| 349 | Ga0207427_100213 | 3300025231 | Bacteria | 51669 |
| 350 | Ga0209437_100381 | 3300025233 | Bacteria | 43879 |
| 351 | Ga0209258_100017 | 3300025242 | Bacteria | 590785 |
| 352 | Ga0209258_100031 | 3300025242 | Bacteria | 463572 |
| 353 | Ga0209258_100038 | 3300025242 | Bacteria | 398959 |
| 354 | Ga0209258_100118 | 3300025242 | Bacteria | 183558 |
| 355 | Ga0209258_100144 | 3300025242 | Bacteria | 163814 |
| 356 | Ga0209646_1000824 | 3300025246 | Bacteria | 10466 |
| 357 | Ga0209026_1000044 | 3300025250 | Bacteria | 266550 |
| 358 | Ga0209026_1000431 | 3300025250 | Bacteria | 34966 |
| 359 | Ga0209677_107487 | 3300025253 | Bacteria | 2310 |
| 360 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 361 | Ga0209148_1000024 | 3300025254 | Bacteria | 669890 |
| 362 | Ga0209148_1000027 | 3300025254 | Bacteria | 616374 |
| 363 | Ga0209148_1000044 | 3300025254 | Bacteria | 458417 |
| 364 | Ga0209148_1000141 | 3300025254 | Bacteria | 163821 |
| 365 | Ga0209759_1000517 | 3300025256 | Bacteria | 41788 |
| 366 | Ga0209759_1000779 | 3300025256 | Bacteria | 26706 |
| 367 | Ga0209233_1000323 | 3300025261 | Bacteria | 51669 |
| 368 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 369 | Ga0209455_1000025 | 3300025272 | Bacteria | 670673 |
| 370 | Ga0209455_1000032 | 3300025272 | Bacteria | 514243 |
| 371 | Ga0209455_1000058 | 3300025272 | Bacteria | 342028 |
| 372 | Ga0209455_1001839 | 3300025272 | Bacteria | 8885 |
| 373 | Ga0209673_1000059 | 3300025273 | Bacteria | 268892 |
| 374 | Ga0209564_1000283 | 3300025295 | Bacteria | 102740 |
| 375 | Ga0209051_1001186 | 3300025303 | Bacteria | 23570 |
| 376 | Ga0209051_1005394 | 3300025303 | Bacteria | 7492 |
| 377 | Ga0209051_1047107 | 3300025303 | Bacteria | 1476 |
| 378 | Ga0209257_1000264 | 3300025304 | Bacteria | 120518 |
| 379 | Ga0209257_1059664 | 3300025304 | Bacteria | 1041 |
| 380 | Ga0207696_1074758 | 3300025711 | Bacteria | 939 |
| 381 | Ga0207692_10083636 | 3300025898 | Bacteria | 1713 |
| 382 | Ga0207692_10247372 | 3300025898 | Bacteria | 1067 |
| 383 | Ga0207647_10004854 | 3300025904 | Bacteria | 9943 |
| 384 | Ga0207685_10073115 | 3300025905 | Bacteria | 1396 |
| 385 | Ga0207699_10016761 | 3300025906 | Bacteria | 3840 |
| 386 | Ga0207705_10112777 | 3300025909 | Bacteria | 2010 |
| 387 | Ga0207705_10329270 | 3300025909 | Bacteria | 1174 |
| 388 | Ga0207705_10404288 | 3300025909 | Bacteria | 1056 |
| 389 | Ga0207684_10332074 | 3300025910 | Bacteria | 1310 |
| 390 | Ga0207654_11063366 | 3300025911 | Bacteria | 589 |
| 391 | Ga0207695_10000203 | 3300025913 | Bacteria | 163681 |
| 392 | Ga0207695_10000273 | 3300025913 | Bacteria | 129404 |
| 393 | Ga0207695_10001289 | 3300025913 | Bacteria | 42571 |
| 394 | Ga0207695_10005122 | 3300025913 | Bacteria | 17554 |
| 395 | Ga0207695_10098915 | 3300025913 | Bacteria | 2916 |
| 396 | Ga0207695_10217137 | 3300025913 | Bacteria | 1821 |
| 397 | Ga0207695_10597292 | 3300025913 | Bacteria | 985 |
| 398 | Ga0207695_10780400 | 3300025913 | Bacteria | 836 |
| 399 | Ga0207671_10011634 | 3300025914 | Bacteria | 7141 |
| 400 | Ga0207671_10013289 | 3300025914 | Bacteria | 6566 |
| 401 | Ga0207671_10313390 | 3300025914 | Bacteria | 1241 |
| 402 | Ga0207693_10016897 | 3300025915 | Bacteria | 5826 |
| 403 | Ga0207693_10052095 | 3300025915 | Bacteria | 3210 |
| 404 | Ga0207693_10154990 | 3300025915 | Bacteria | 1802 |
| 405 | Ga0207693_10161001 | 3300025915 | Bacteria | 1766 |
| 406 | Ga0207693_10332234 | 3300025915 | Bacteria | 1190 |
| 407 | Ga0207663_10052557 | 3300025916 | Bacteria | 2542 |
| 408 | Ga0207663_10122286 | 3300025916 | Bacteria | 1784 |
| 409 | Ga0207663_10144307 | 3300025916 | Bacteria | 1662 |
| 410 | Ga0207663_10271920 | 3300025916 | Bacteria | 1255 |
| 411 | Ga0207660_10091219 | 3300025917 | Bacteria | 2259 |
| 412 | Ga0207657_10000001 | 3300025919 | Bacteria | 458536 |
| 413 | Ga0207649_10388800 | 3300025920 | Bacteria | 1041 |
| 414 | Ga0207649_11187655 | 3300025920 | Bacteria | 603 |
| 415 | Ga0207652_10148061 | 3300025921 | Bacteria | 2101 |
| 416 | Ga0207652_10158359 | 3300025921 | Bacteria | 2029 |
| 417 | Ga0207652_10952038 | 3300025921 | Bacteria | 756 |
| 418 | Ga0207646_10008018 | 3300025922 | Bacteria | 10651 |
| 419 | Ga0207646_10123363 | 3300025922 | Bacteria | 2329 |
| 420 | Ga0207681_10010470 | 3300025923 | Bacteria | 5676 |
| 421 | Ga0207681_10403376 | 3300025923 | Bacteria | 1105 |
| 422 | Ga0207694_10050890 | 3300025924 | Bacteria | 3210 |
| 423 | Ga0207694_10499828 | 3300025924 | Bacteria | 1018 |
| 424 | Ga0207650_10446098 | 3300025925 | Bacteria | 1076 |
| 425 | Ga0207650_10625289 | 3300025925 | Bacteria | 907 |
| 426 | Ga0207700_10013731 | 3300025928 | Bacteria | 5283 |
| 427 | Ga0207700_10543166 | 3300025928 | Bacteria | 1031 |
| 428 | Ga0207664_10390836 | 3300025929 | Bacteria | 1236 |
| 429 | Ga0207664_10460911 | 3300025929 | Bacteria | 1135 |
| 430 | Ga0207664_10569742 | 3300025929 | Bacteria | 1016 |
| 431 | Ga0207690_10000029 | 3300025932 | Bacteria | 160406 |
| 432 | Ga0207690_10090684 | 3300025932 | Bacteria | 2158 |
| 433 | Ga0207690_10221243 | 3300025932 | Bacteria | 1448 |
| 434 | Ga0207686_10016496 | 3300025934 | Bacteria | 4146 |
| 435 | Ga0207686_10543413 | 3300025934 | Bacteria | 907 |
| 436 | Ga0207686_10568711 | 3300025934 | Bacteria | 888 |
| 437 | Ga0207669_10070655 | 3300025937 | Bacteria | 2190 |
| 438 | Ga0207665_10001976 | 3300025939 | Bacteria | 13813 |
| 439 | Ga0207665_10019541 | 3300025939 | Bacteria | 4455 |
| 440 | Ga0207691_10342247 | 3300025940 | Bacteria | 1280 |
| 441 | Ga0207711_10832823 | 3300025941 | Bacteria | 859 |
| 442 | Ga0207689_11530744 | 3300025942 | Bacteria | 556 |
| 443 | Ga0207679_10224928 | 3300025945 | Bacteria | 1581 |
| 444 | Ga0207679_10549384 | 3300025945 | Bacteria | 1036 |
| 445 | Ga0207667_10003915 | 3300025949 | Bacteria | 18324 |
| 446 | Ga0207667_10049760 | 3300025949 | Bacteria | 4424 |
| 447 | Ga0207667_10374971 | 3300025949 | Bacteria | 1450 |
| 448 | Ga0207667_10605563 | 3300025949 | Bacteria | 1104 |
| 449 | Ga0207667_10626150 | 3300025949 | Bacteria | 1083 |
| 450 | Ga0207667_10655380 | 3300025949 | Bacteria | 1055 |
| 451 | Ga0207651_10120103 | 3300025960 | Bacteria | 1992 |
| 452 | Ga0207651_11151891 | 3300025960 | Bacteria | 696 |
| 453 | Ga0207712_10202145 | 3300025961 | Bacteria | 1576 |
| 454 | Ga0207712_10357695 | 3300025961 | Bacteria | 1215 |
| 455 | Ga0207703_10247960 | 3300026035 | Bacteria | 1604 |
| 456 | Ga0207703_10442763 | 3300026035 | Bacteria | 1212 |
| 457 | Ga0207703_10895219 | 3300026035 | Bacteria | 850 |
| 458 | Ga0207703_12129612 | 3300026035 | Bacteria | 537 |
| 459 | Ga0207639_10283578 | 3300026041 | Bacteria | 1458 |
| 460 | Ga0207639_11275386 | 3300026041 | Bacteria | 689 |
| 461 | Ga0207678_10000227 | 3300026067 | Bacteria | 50150 |
| 462 | Ga0207708_10202584 | 3300026075 | Bacteria | 1584 |
| 463 | Ga0207708_10763063 | 3300026075 | Bacteria | 831 |
| 464 | Ga0207708_11089557 | 3300026075 | Bacteria | 696 |
| 465 | Ga0207702_10002529 | 3300026078 | Bacteria | 17222 |
| 466 | Ga0207702_10012718 | 3300026078 | Bacteria | 7003 |
| 467 | Ga0207702_10036512 | 3300026078 | Bacteria | 4111 |
| 468 | Ga0207702_10052635 | 3300026078 | Bacteria | 3445 |
| 469 | Ga0207702_10401868 | 3300026078 | Bacteria | 1321 |
| 470 | Ga0207702_10472674 | 3300026078 | Bacteria | 1219 |
| 471 | Ga0207648_10353116 | 3300026089 | Bacteria | 1326 |
| 472 | Ga0207676_10860450 | 3300026095 | Bacteria | 887 |
| 473 | Ga0207675_100085125 | 3300026118 | Bacteria | 2967 |
| 474 | Ga0207675_100460912 | 3300026118 | Bacteria | 1261 |
| 475 | Ga0207675_100500949 | 3300026118 | Bacteria | 1209 |
| 476 | Ga0207698_10024704 | 3300026142 | Bacteria | 4222 |
| 477 | Ga0207698_10054163 | 3300026142 | Bacteria | 3085 |
| 478 | Ga0207698_11276307 | 3300026142 | Unclassified | 749 |
| 479 | Ga0207698_11417460 | 3300026142 | Bacteria | 710 |
| 480 | Ga0207698_12393151 | 3300026142 | Bacteria | 539 |
| 481 | Ga0209371_1000129 | 3300027312 | Bacteria | 124523 |
| 482 | Ga0268266_10010740 | 3300028379 | Bacteria | 7980 |
| 483 | Ga0268266_10284707 | 3300028379 | Bacteria | 1538 |
| 484 | Ga0268265_10308291 | 3300028380 | Bacteria | 1428 |
| 485 | Ga0307515_10093088 | 3300028794 | Bacteria | 3742 |
| 486 | Ga0265338_10113802 | 3300028800 | Bacteria | 2173 |
| 487 | Ga0268256_1000133 | 3300030500 | Bacteria | 102725 |
| 488 | Ga0307512_10172021 | 3300030522 | Bacteria | 1239 |
| 489 | Ga0265770_1007398 | 3300030878 | Bacteria | 1546 |
| 490 | Ga0265760_10011916 | 3300031090 | Bacteria | 2484 |
| 491 | Ga0265760_10339073 | 3300031090 | Bacteria | 537 |
| 492 | Ga0265327_10004235 | 3300031251 | Bacteria | 12871 |
| 493 | Ga0265316_10095091 | 3300031344 | Bacteria | 2270 |
| 494 | Ga0265316_10105173 | 3300031344 | Bacteria | 2142 |
| 495 | Ga0265316_11192990 | 3300031344 | Bacteria | 527 |
| 496 | Ga0307513_10284836 | 3300031456 | Bacteria | 1427 |
| 497 | Ga0307516_10000499 | 3300031730 | Bacteria | 52269 |
| 498 | Ga0316053_112151 | 3300032120 | Bacteria | 614 |
| 499 | Ga0373923_0296135 | 3300035111 | Bacteria | 765 |
| 500 | Ga0373932_0011260 | 3300035112 | Bacteria | 2182 |
| 501 | Ga0373943_0026858 | 3300035170 | Bacteria | 2701 |
| 502 | Ga0373943_0364261 | 3300035170 | Bacteria | 830 |
| 503 | Ga0373946_0226390 | 3300035171 | Bacteria | 905 |
| 504 | Ga0316574_0221228 | 3300035398 | Bacteria | 1213 |
| 505 | Ga0373935_0008964 | 3300035692 | Bacteria | 5988 |
| 506 | Ga0373947_0044834 | 3300035725 | Bacteria | 2645 |
| 507 | Ga0373947_0265587 | 3300035725 | Bacteria | 1138 |
| 508 | Ga0373947_0331982 | 3300035725 | Bacteria | 1018 |
| 509 | Ga0373937_0228238 | 3300036401 | Bacteria | 1753 |
| 510 | Ga0373925_0149534 | 3300037068 | Bacteria | 1833 |
| 511 | Ga0373925_0854255 | 3300037068 | Bacteria | 750 |
| 512 | Ga0373925_0882413 | 3300037068 | Bacteria | 737 |
| 513 | Ga0395899_0000062 | 3300037312 | Bacteria | 211388 |
| 514 | Ga0395899_0000167 | 3300037312 | Bacteria | 100973 |
| 515 | Ga0395899_0051027 | 3300037312 | Bacteria | 3071 |
| 516 | Ga0395899_0345830 | 3300037312 | Bacteria | 996 |
| 517 | Ga0395900_0000009 | 3300037418 | Bacteria | 476249 |
| 518 | Ga0395900_0000039 | 3300037418 | Bacteria | 248722 |
| 519 | Ga0395900_0043542 | 3300037418 | Bacteria | 4627 |
| 520 | Ga0395900_0599874 | 3300037418 | Bacteria | 1042 |
| 521 | Ga0395898_0000069 | 3300037466 | Bacteria | 254587 |
| 522 | Ga0395898_0000140 | 3300037466 | Bacteria | 190587 |
| 523 | Ga0395898_0259449 | 3300037466 | Bacteria | 1657 |
| 524 | Ga0395898_1487548 | 3300037466 | Bacteria | 603 |
| 525 | Ga0395898_1726355 | 3300037466 | Bacteria | 548 |
| 526 | Ga0395905_0019189 | 3300037471 | Bacteria | 6484 |
| 527 | Ga0395905_0078049 | 3300037471 | Bacteria | 3103 |
| 528 | Ga0395905_1479575 | 3300037471 | Bacteria | 583 |
| 529 | Ga0436364_0199993 | 3300037853 | Bacteria | 1822 |
| 530 | Ga0436364_0356734 | 3300037853 | Bacteria | 1492 |
| 531 | Ga0436364_0431728 | 3300037853 | Bacteria | 222864 |
| 532 | Ga0436364_0748068 | 3300037853 | Bacteria | 528910 |
| 533 | Ga0436364_0843268 | 3300037853 | Bacteria | 3606 |
| 534 | Ga0436364_1236165 | 3300037853 | Bacteria | 5054 |
| 535 | Ga0436364_1261036 | 3300037853 | Bacteria | 595 |
| 536 | Ga0436364_1342962 | 3300037853 | Bacteria | 521 |
| 537 | Ga0436364_1457846 | 3300037853 | Bacteria | 7907 |
| 538 | Ga0395901_0000014 | 3300038443 | Bacteria | 375100 |
| 539 | Ga0395901_1521625 | 3300038443 | Bacteria | 624 |
| 540 | Ga0400489_41603 | 3300039093 | Bacteria | 12259 |
| 541 | Ga0436365_0206806 | 3300039437 | Bacteria | 1657 |
| 542 | Ga0436365_0430209 | 3300039437 | Bacteria | 2425 |
| 543 | Ga0436365_0472708 | 3300039437 | Bacteria | 4488 |
| 544 | Ga0436365_0543679 | 3300039437 | Bacteria | 12016 |
| 545 | Ga0436365_0844407 | 3300039437 | Unclassified | 1031 |
| 546 | Ga0436365_1303722 | 3300039437 | Bacteria | 1639 |
| 547 | Ga0436365_1737587 | 3300039437 | Bacteria | 1954 |
| 548 | Ga0436360_0058815 | 3300039438 | Bacteria | 1227 |
| 549 | Ga0436360_0213572 | 3300039438 | Bacteria | 12542 |
| 550 | Ga0436360_0285718 | 3300039438 | Bacteria | 878 |
| 551 | Ga0436360_0380383 | 3300039438 | Bacteria | 11032 |
| 552 | Ga0436360_0517441 | 3300039438 | Bacteria | 2030 |
| 553 | Ga0436360_0914568 | 3300039438 | Bacteria | 14130 |
| 554 | Ga0436360_1336127 | 3300039438 | Bacteria | 987 |
| 555 | Ga0436361_0047346 | 3300039447 | Bacteria | 87631 |
| 556 | Ga0436361_0055354 | 3300039447 | Bacteria | 9058 |
| 557 | Ga0436361_0154707 | 3300039447 | Bacteria | 20033 |
| 558 | Ga0436361_0157085 | 3300039447 | Bacteria | 3080 |
| 559 | Ga0436361_0384722 | 3300039447 | Bacteria | 11499 |
| 560 | Ga0436361_0484676 | 3300039447 | Unclassified | 3794 |
| 561 | Ga0436361_0652142 | 3300039447 | Bacteria | 829 |
| 562 | Ga0436361_0666244 | 3300039447 | Bacteria | 8526 |
| 563 | Ga0436361_0788442 | 3300039447 | Bacteria | 540 |
| 564 | Ga0436361_0895187 | 3300039447 | Bacteria | 79068 |
| 565 | Ga0436361_0910912 | 3300039447 | Bacteria | 627 |
| 566 | Ga0436361_0923671 | 3300039447 | Bacteria | 2829 |
| 567 | Ga0436361_0932086 | 3300039447 | Bacteria | 3324 |
| 568 | Ga0436361_1021429 | 3300039447 | Bacteria | 12623 |
| 569 | Ga0436361_1097826 | 3300039447 | Bacteria | 2340 |
| 570 | Ga0436363_0756951 | 3300039450 | Bacteria | 1047 |
| 571 | Ga0436363_0963290 | 3300039450 | Unclassified | 2428 |
| 572 | Ga0436363_1397348 | 3300039450 | Bacteria | 3742 |
| 573 | Ga0436362_0063915 | 3300039453 | Bacteria | 5363 |
| 574 | Ga0436362_0283413 | 3300039453 | Bacteria | 2818 |
| 575 | Ga0436362_0566135 | 3300039453 | Bacteria | 1031 |
| 576 | Ga0436362_0955192 | 3300039453 | Bacteria | 1290 |
| 577 | Ga0436362_1210783 | 3300039453 | Bacteria | 3954 |
| 578 | Ga0451795_1304938 | 3300041456 | Bacteria | 1254 |
| 579 | Ga0451849_0220963 | 3300041505 | Bacteria | 756 |
| 580 | Ga0451853_0555938 | 3300041512 | Bacteria | 518 |
| 581 | Ga0439431_0003477 | 3300041997 | Bacteria | 3472 |
| 582 | Ga0439432_063004 | 3300042006 | Bacteria | 1140 |
| 583 | Ga0439446_0177389 | 3300042156 | Bacteria | 711 |
| 584 | Ga0451577_0035832 | 3300042876 | Bacteria | 4469 |
| 585 | Ga0451577_0070218 | 3300042876 | Bacteria | 3124 |
| 586 | Ga0451577_0815176 | 3300042876 | Bacteria | 843 |
| 587 | Ga0466969_0013964 | 3300044656 | Bacteria | 4228 |
| 588 | Ga0453683_0003615 | 3300044673 | Bacteria | 11339 |
| 589 | Ga0453683_0045779 | 3300044673 | Bacteria | 2743 |
| 590 | Ga0453683_0163493 | 3300044673 | Bacteria | 1409 |
| 591 | Ga0453683_0182467 | 3300044673 | Bacteria | 1331 |
| 592 | Ga0466965_0325808 | 3300044683 | Bacteria | 837 |
| 593 | Ga0466966_0021400 | 3300044684 | Bacteria | 4246 |
| 594 | Ga0466966_0253495 | 3300044684 | Bacteria | 1060 |
| 595 | Ga0466966_0408152 | 3300044684 | Bacteria | 816 |
| 596 | Ga0466961_0019310 | 3300044693 | Bacteria | 4384 |
| 597 | Ga0466961_0035203 | 3300044693 | Bacteria | 3215 |
| 598 | Ga0466961_0072126 | 3300044693 | Bacteria | 2190 |
| 599 | Ga0466961_0128385 | 3300044693 | Bacteria | 1589 |
| 600 | Ga0466963_0232258 | 3300044694 | Bacteria | 1293 |
| 601 | Ga0466963_0814535 | 3300044694 | Bacteria | 658 |
| 602 | Ga0453684_0000951 | 3300044712 | Bacteria | 95417 |
| 603 | Ga0453684_0001767 | 3300044712 | Bacteria | 57669 |
| 604 | Ga0453684_0165592 | 3300044712 | Bacteria | 2610 |
| 605 | Ga0453684_0391319 | 3300044712 | Bacteria | 1559 |
| 606 | Ga0466971_0002070 | 3300044719 | Bacteria | 8502 |
| 607 | Ga0466968_0066312 | 3300044735 | Bacteria | 1564 |
| 608 | Ga0466970_0000163 | 3300044765 | Bacteria | 31774 |
| 609 | Ga0466970_0279741 | 3300044765 | Bacteria | 938 |
| 610 | Ga0466957_0002878 | 3300044842 | Bacteria | 9324 |
| 611 | Ga0466959_0000383 | 3300045049 | Bacteria | 26156 |
| 612 | Ga0466959_0068211 | 3300045049 | Bacteria | 2577 |
| 613 | Ga0466959_0169300 | 3300045049 | Bacteria | 1533 |
| 614 | Ga0466959_0486696 | 3300045049 | Bacteria | 834 |
| 615 | Ga0451576_0003996 | 3300045051 | Bacteria | 19640 |
| 616 | Ga0451576_0424920 | 3300045051 | Bacteria | 1394 |
| 617 | Ga0451576_0503573 | 3300045051 | Bacteria | 1272 |
| 618 | Ga0466958_0145503 | 3300045836 | Bacteria | 1493 |
| 619 | Ga0466967_0579131 | 3300045976 | Bacteria | 1106 |
| 620 | Ga0495627_000483 | 3300046453 | Bacteria | 33680 |
| 621 | Ga0495638_0169811 | 3300046460 | Bacteria | 1252 |
| 622 | Ga0495650_0000007 | 3300046471 | Bacteria | 718072 |
| 623 | Ga0495650_0063018 | 3300046471 | Bacteria | 1480 |
| 624 | Ga0495580_0527279 | 3300046472 | Bacteria | 786 |
| 625 | Ga0495585_0013190 | 3300046492 | Bacteria | 4842 |
| 626 | Ga0495610_0018383 | 3300046512 | Bacteria | 3951 |
| 627 | Ga0495620_0061257 | 3300046515 | Bacteria | 1566 |
| 628 | Ga0495630_1027872 | 3300046517 | Bacteria | 626 |
| 629 | Ga0495632_0018888 | 3300046519 | Bacteria | 3767 |
| 630 | Ga0495637_0042169 | 3300046520 | Bacteria | 1954 |
| 631 | Ga0495648_0000039 | 3300046524 | Bacteria | 185430 |
| 632 | Ga0495666_0269840 | 3300046526 | Bacteria | 773 |
| 633 | Ga0495652_0103129 | 3300046529 | Bacteria | 2309 |
| 634 | Ga0495652_0622100 | 3300046529 | Bacteria | 734 |
| 635 | Ga0495654_0000053 | 3300046530 | Bacteria | 145014 |
| 636 | Ga0495634_0634917 | 3300046642 | Bacteria | 618 |
| 637 | Ga0495625_0000683 | 3300046660 | Bacteria | 48312 |
| 638 | Ga0495625_0004788 | 3300046660 | Bacteria | 12657 |
| 639 | Ga0495625_0007535 | 3300046660 | Bacteria | 9453 |
| 640 | Ga0495625_0009883 | 3300046660 | Bacteria | 7934 |
| 641 | Ga0495625_0387504 | 3300046660 | Bacteria | 875 |
| 642 | Ga0495588_0120713 | 3300046674 | Bacteria | 1382 |
| 643 | Ga0495647_0184949 | 3300046681 | Bacteria | 908 |
| 644 | Ga0495658_0067976 | 3300046683 | Bacteria | 2062 |
| 645 | Ga0495670_0647241 | 3300046691 | Bacteria | 576 |
| 646 | Ga0495671_0250159 | 3300046692 | Bacteria | 855 |
| 647 | Ga0495604_0159347 | 3300047317 | Bacteria | 1596 |
| 648 | Ga0495674_0080503 | 3300047319 | Bacteria | 2795 |
| 649 | Ga0495675_0146301 | 3300047444 | Bacteria | 1462 |
| 650 | Ga0495673_0000148 | 3300047469 | Bacteria | 124135 |
| 651 | Ga0495673_0000377 | 3300047469 | Bacteria | 53346 |
| 652 | Ga0495684_0556766 | 3300047471 | Bacteria | 780 |
| 653 | Ga0495686_0010996 | 3300047472 | Bacteria | 6402 |
| 654 | Ga0495686_0015143 | 3300047472 | Bacteria | 5281 |
| 655 | Ga0495686_0063473 | 3300047472 | Bacteria | 2289 |
| 656 | Ga0495602_0271131 | 3300048088 | Bacteria | 1254 |
| 657 | Ga0495602_0378390 | 3300048088 | Bacteria | 1015 |
| 658 | Ga0495614_0356171 | 3300048089 | Bacteria | 683 |
| 659 | Ga0496100_0550846 | 3300048903 | Bacteria | 892 |
| 660 | Ga0496101_0072322 | 3300048904 | Bacteria | 2531 |
| 661 | Ga0496102_1527023 | 3300048905 | Bacteria | 586 |
| 662 | Ga0496104_0131456 | 3300048907 | Bacteria | 2404 |
| 663 | Ga0496105_0089442 | 3300048908 | Bacteria | 2544 |
| 664 | Ga0496106_0208732 | 3300048909 | Bacteria | 1555 |
| 665 | Ga0496106_0743448 | 3300048909 | Bacteria | 780 |
| 666 | Ga0496107_0000113 | 3300048910 | Bacteria | 39326 |
| 667 | Ga0496107_0841192 | 3300048910 | Bacteria | 671 |
| 668 | Ga0496108_0305201 | 3300048911 | Bacteria | 1387 |
| 669 | Ga0496110_0387687 | 3300048913 | Bacteria | 1273 |
| 670 | Ga0496112_0103364 | 3300048915 | Bacteria | 2819 |
| 671 | Ga0496113_0592473 | 3300048916 | Bacteria | 888 |
| 672 | Ga0496113_0820937 | 3300048916 | Bacteria | 738 |
| 673 | Ga0496113_1386334 | 3300048916 | Bacteria | 545 |
| 674 | Ga0496114_0199953 | 3300048917 | Bacteria | 1750 |
| 675 | Ga0496114_0362178 | 3300048917 | Bacteria | 1283 |
| 676 | Ga0496115_0034331 | 3300048918 | Bacteria | 4009 |
| 677 | Ga0496116_0010230 | 3300048919 | Bacteria | 7891 |
| 678 | Ga0496117_0131997 | 3300048920 | Bacteria | 1512 |
| 679 | Ga0496117_0485986 | 3300048920 | Bacteria | 602 |
| 680 | Ga0496118_0042016 | 3300048921 | Bacteria | 3612 |
| 681 | Ga0496118_0072464 | 3300048921 | Bacteria | 2474 |
| 682 | Ga0496118_0186132 | 3300048921 | Bacteria | 1248 |
| 683 | Ga0496118_0294034 | 3300048921 | Bacteria | 896 |
| 684 | Ga0496118_0322079 | 3300048921 | Bacteria | 838 |
| 685 | Ga0496120_0053556 | 3300048923 | Bacteria | 2292 |
| 686 | Ga0496121_0000197 | 3300048924 | Bacteria | 135555 |
| 687 | Ga0496121_0002319 | 3300048924 | Bacteria | 29484 |
| 688 | Ga0496121_0003184 | 3300048924 | Bacteria | 23655 |
| 689 | Ga0496121_0038189 | 3300048924 | Bacteria | 4257 |
| 690 | Ga0496121_0282033 | 3300048924 | Bacteria | 1136 |
| 691 | Ga0496122_0015369 | 3300048925 | Bacteria | 7322 |
| 692 | Ga0496123_0008845 | 3300048926 | Bacteria | 9174 |
| 693 | Ga0496125_0249106 | 3300048928 | Bacteria | 1122 |
| 694 | Ga0496126_0002536 | 3300048929 | Bacteria | 24441 |
| 695 | Ga0496126_0009870 | 3300048929 | Bacteria | 10101 |
| 696 | Ga0496126_0076035 | 3300048929 | Bacteria | 2980 |
| 697 | Ga0496126_0091443 | 3300048929 | Bacteria | 2676 |
| 698 | Ga0496126_0315743 | 3300048929 | Bacteria | 1286 |
| 699 | Ga0501034_0481604 | 3300049571 | Bacteria | 1156 |
| 700 | Ga0501036_0029060 | 3300049572 | Bacteria | 4673 |
| 701 | Ga0501036_0217846 | 3300049572 | Bacteria | 1603 |
| 702 | Ga0501037_0546519 | 3300049573 | Bacteria | 782 |
| 703 | Ga0501038_0110429 | 3300049574 | Bacteria | 2278 |
| 704 | Ga0501039_0065713 | 3300049575 | Bacteria | 2814 |
| 705 | Ga0501039_0142423 | 3300049575 | Bacteria | 1883 |
| 706 | Ga0501040_0097502 | 3300049576 | Bacteria | 2048 |
| 707 | Ga0501041_0061435 | 3300049577 | Bacteria | 2300 |
| 708 | Ga0501041_0087895 | 3300049577 | Bacteria | 1918 |
| 709 | Ga0501042_0044735 | 3300049578 | Bacteria | 3155 |
| 710 | Ga0501042_0158598 | 3300049578 | Bacteria | 1632 |
| 711 | Ga0501042_0600819 | 3300049578 | Bacteria | 800 |
| 712 | Ga0501046_0121394 | 3300049580 | Bacteria | 1988 |
| 713 | Ga0501046_0146614 | 3300049580 | Bacteria | 1782 |
| 714 | Ga0501048_0076493 | 3300049582 | Bacteria | 2362 |
| 715 | Ga0501048_0125570 | 3300049582 | Bacteria | 1814 |
| 716 | Ga0501048_0279458 | 3300049582 | Bacteria | 1187 |
| 717 | Ga0501068_0175822 | 3300049584 | Bacteria | 1352 |
| 718 | Ga0501071_0024968 | 3300049587 | Bacteria | 4183 |
| 719 | Ga0501072_0027502 | 3300049588 | Bacteria | 4437 |
| 720 | Ga0501074_0062883 | 3300049590 | Bacteria | 2674 |
| 721 | Ga0501074_0532786 | 3300049590 | Bacteria | 832 |
| 722 | Ga0501075_0166277 | 3300049591 | Bacteria | 1683 |
| 723 | Ga0501075_0288508 | 3300049591 | Bacteria | 1250 |
| 724 | Ga0501075_0331294 | 3300049591 | Bacteria | 1160 |
| 725 | Ga0501076_0081126 | 3300049592 | Bacteria | 2604 |
| 726 | Ga0501076_0275343 | 3300049592 | Bacteria | 1378 |
| 727 | Ga0501077_0570600 | 3300049593 | Bacteria | 726 |
| 728 | Ga0501206_066988 | 3300049653 | Bacteria | 600 |
| 729 | Ga0501249_072623 | 3300049679 | Unclassified | 804 |
| 730 | Ga0501257_111028 | 3300049686 | Bacteria | 727 |
| 731 | Ga0501079_0093635 | 3300049741 | Bacteria | 2328 |
| 732 | Ga0501079_0283130 | 3300049741 | Bacteria | 1296 |
| 733 | Ga0501081_0028476 | 3300049743 | Bacteria | 3771 |
| 734 | Ga0501044_0179264 | 3300049823 | Bacteria | 2086 |
| 735 | Ga0501045_0033860 | 3300049824 | Bacteria | 3706 |
| 736 | Ga0501045_0052036 | 3300049824 | Bacteria | 2989 |
| 737 | Ga0501045_0733848 | 3300049824 | Bacteria | 728 |
| 738 | nmdc:mga00v17_111656_c1 | 3300050491 | Bacteria | 1734 |
| 739 | nmdc:mga0k408_76832_c1 | 3300050493 | Bacteria | 1952 |
| 740 | nmdc:mga05p37_116569_c1 | 3300050507 | Bacteria | 3282 |
| 741 | nmdc:mga05p37_792441_c1 | 3300050507 | Bacteria | 1038 |
| 742 | nmdc:mga0qj67_15553_c1 | 3300050509 | Bacteria | 5761 |
| 743 | nmdc:mga0qj67_218183_c1 | 3300050509 | Bacteria | 1548 |
| 744 | nmdc:mga0qj67_501783_c1 | 3300050509 | Bacteria | 975 |
| 745 | nmdc:mga0qj67_598641_c1 | 3300050509 | Bacteria | 882 |
| 746 | nmdc:mga06r32_368541_c1 | 3300050510 | Bacteria | 1420 |
| 747 | nmdc:mga06r32_647643_c1 | 3300050510 | Bacteria | 1025 |
| 748 | nmdc:mga08y16_455950_c1 | 3300050511 | Bacteria | 1303 |
| 749 | nmdc:mga0rr50_150110_c1 | 3300050513 | Bacteria | 1882 |
| 750 | nmdc:mga0rr50_168753_c1 | 3300050513 | Bacteria | 1781 |
| 751 | nmdc:mga0a205_645359_c1 | 3300050515 | Bacteria | 910 |
| 752 | nmdc:mga0sz30_65059_c1 | 3300050516 | Bacteria | 1563 |
| 753 | Ga0500643_017572 | 3300053087 | Bacteria | 2393 |
| 754 | Ga0500644_0000241 | 3300053088 | Bacteria | 31000 |
| 755 | Ga0500566_0000074 | 3300053094 | Bacteria | 48359 |
| 756 | Ga0500641_0033523 | 3300053096 | Bacteria | 2039 |
| 757 | Ga0500554_001170 | 3300053102 | Bacteria | 5087 |
| 758 | Ga0500555_008448 | 3300053103 | Bacteria | 2935 |
| 759 | Ga0500572_003846 | 3300053111 | Bacteria | 3411 |
| 760 | Ga0500608_068929 | 3300053122 | Bacteria | 1683 |
| 761 | Ga0500614_000300 | 3300053123 | Bacteria | 12752 |
| 762 | Ga0500618_006400 | 3300053125 | Bacteria | 3463 |
| 763 | Ga0500559_0000015 | 3300053136 | Bacteria | 158494 |
| 764 | Ga0500559_0001726 | 3300053136 | Bacteria | 11987 |
| 765 | Ga0500564_000200 | 3300053138 | Bacteria | 16311 |
| 766 | Ga0500577_0010853 | 3300053142 | Bacteria | 2698 |
| 767 | Ga0500588_0150619 | 3300053146 | Bacteria | 841 |
| 768 | Ga0500590_020390 | 3300053148 | Bacteria | 3441 |
| 769 | Ga0500603_000030 | 3300053150 | Bacteria | 34154 |
| 770 | Ga0500604_0008017 | 3300053151 | Bacteria | 2802 |
| 771 | Ga0500616_0013843 | 3300053153 | Bacteria | 4657 |
| 772 | Ga0500627_0041165 | 3300053158 | Bacteria | 1985 |
| 773 | Ga0500630_003168 | 3300053159 | Bacteria | 7958 |
| 774 | Ga0500639_000047 | 3300053163 | Bacteria | 57835 |
| 775 | Ga0500596_003610 | 3300053735 | Bacteria | 2916 |
| 776 | Ga0501084_0199189 | 3300054114 | Bacteria | 1689 |
| 777 | Ga0501084_0470074 | 3300054114 | Bacteria | 1063 |
| 778 | Ga0501084_0758517 | 3300054114 | Bacteria | 817 |
| 779 | Ga0501082_0473518 | 3300060353 | Bacteria | 1094 |
| 780 | Ga0501082_0602291 | 3300060353 | Bacteria | 961 |
| 781 | Ga0466962_0001068 | 3300061719 | Bacteria | 12599 |
| 782 | Ga0530510_0357863 | 3300061734 | Bacteria | 1097 |
| 783 | Ga0530510_0576680 | 3300061734 | Bacteria | 855 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_11050039 | Ga0114129_110500392 | 140 |
| 2 | 3300048913 | Ga0496110_0387687 | Ga0496110_0387687_294_785 | 140 |
| 3 | 3300048916 | Ga0496113_1386334 | Ga0496113_1386334_32_523 | 140 |
| 4 | 3300005354 | Ga0070675_101303418 | Ga0070675_1013034182 | 146 |
| 5 | 3300009147 | Ga0114129_10202084 | Ga0114129_102020842 | 146 |
| 6 | 3300005444 | Ga0070694_100003493 | Ga0070694_1000034933 | 147 |
| 7 | 3300005937 | Ga0081455_10090188 | Ga0081455_100901882 | 148 |
| 8 | 3300042876 | Ga0451577_0035832 | Ga0451577_0035832_2351_2806 | 148 |
| 9 | 3300044712 | Ga0453684_0001767 | Ga0453684_0001767_27623_28078 | 148 |
| 10 | 3300044712 | Ga0453684_0165592 | Ga0453684_0165592_167_622 | 148 |
| 11 | 3300005337 | Ga0070682_101551439 | Ga0070682_1015514391 | 149 |
| 12 | 3300009174 | Ga0105241_11182011 | Ga0105241_111820112 | 149 |
| 13 | 3300014326 | Ga0157380_10075894 | Ga0157380_100758944 | 149 |
| 14 | 3300035398 | Ga0316574_0221228 | Ga0316574_0221228_328_783 | 149 |
| 15 | 3300044684 | Ga0466966_0408152 | Ga0466966_0408152_332_796 | 149 |
| 16 | 3300003203 | JGI25406J46586_10032341 | JGI25406J46586_100323412 | 150 |
| 17 | 3300003577 | Ga0007416J51690_1114583 | Ga0007416J51690_11145832 | 150 |
| 18 | 3300003579 | Ga0007429J51699_1092521 | Ga0007429J51699_10925211 | 150 |
| 19 | 3300003792 | Ga0055540_1007096 | Ga0055540_10070963 | 150 |
| 20 | 3300003911 | JGI25405J52794_10117483 | JGI25405J52794_101174831 | 150 |
| 21 | 3300005289 | Ga0065704_10379807 | Ga0065704_103798071 | 150 |
| 22 | 3300005290 | Ga0065712_10025321 | Ga0065712_100253212 | 150 |
| 23 | 3300005293 | Ga0065715_10016620 | Ga0065715_100166202 | 150 |
| 24 | 3300005330 | Ga0070690_100826417 | Ga0070690_1008264172 | 150 |
| 25 | 3300005331 | Ga0070670_101042285 | Ga0070670_1010422852 | 150 |
| 26 | 3300005334 | Ga0068869_100621768 | Ga0068869_1006217682 | 150 |
| 27 | 3300005335 | Ga0070666_11014417 | Ga0070666_110144171 | 150 |
| 28 | 3300005336 | Ga0070680_100092078 | Ga0070680_1000920782 | 150 |
| 29 | 3300005338 | Ga0068868_101255339 | Ga0068868_1012553391 | 150 |
| 30 | 3300005356 | Ga0070674_100438288 | Ga0070674_1004382882 | 150 |
| 31 | 3300005364 | Ga0070673_100889690 | Ga0070673_1008896901 | 150 |
| 32 | 3300005365 | Ga0070688_100803867 | Ga0070688_1008038671 | 150 |
| 33 | 3300005366 | Ga0070659_100282912 | Ga0070659_1002829122 | 150 |
| 34 | 3300005435 | Ga0070714_100298913 | Ga0070714_1002989132 | 150 |
| 35 | 3300005435 | Ga0070714_100779577 | Ga0070714_1007795772 | 150 |
| 36 | 3300005436 | Ga0070713_101691405 | Ga0070713_1016914051 | 150 |
| 37 | 3300005436 | Ga0070713_101977762 | Ga0070713_1019777621 | 150 |
| 38 | 3300005437 | Ga0070710_10390861 | Ga0070710_103908612 | 150 |
| 39 | 3300005444 | Ga0070694_101397333 | Ga0070694_1013973331 | 150 |
| 40 | 3300005456 | Ga0070678_100258533 | Ga0070678_1002585333 | 150 |
| 41 | 3300005456 | Ga0070678_100418023 | Ga0070678_1004180232 | 150 |
| 42 | 3300005457 | Ga0070662_100139989 | Ga0070662_1001399892 | 150 |
| 43 | 3300005458 | Ga0070681_10747956 | Ga0070681_107479562 | 150 |
| 44 | 3300005458 | Ga0070681_11367505 | Ga0070681_113675051 | 150 |
| 45 | 3300005459 | Ga0068867_100221425 | Ga0068867_1002214252 | 150 |
| 46 | 3300005466 | Ga0070685_11189472 | Ga0070685_111894721 | 150 |
| 47 | 3300005467 | Ga0070706_100293128 | Ga0070706_1002931282 | 150 |
| 48 | 3300005467 | Ga0070706_100720437 | Ga0070706_1007204372 | 150 |
| 49 | 3300005518 | Ga0070699_101285789 | Ga0070699_1012857891 | 150 |
| 50 | 3300005530 | Ga0070679_100576487 | Ga0070679_1005764872 | 150 |
| 51 | 3300005530 | Ga0070679_100791708 | Ga0070679_1007917082 | 150 |
| 52 | 3300005535 | Ga0070684_100138170 | Ga0070684_1001381703 | 150 |
| 53 | 3300005539 | Ga0068853_100312418 | Ga0068853_1003124182 | 150 |
| 54 | 3300005539 | Ga0068853_101553536 | Ga0068853_1015535362 | 150 |
| 55 | 3300005543 | Ga0070672_100330382 | Ga0070672_1003303823 | 150 |
| 56 | 3300005543 | Ga0070672_101570790 | Ga0070672_1015707901 | 150 |
| 57 | 3300005548 | Ga0070665_100031017 | Ga0070665_1000310172 | 150 |
| 58 | 3300005548 | Ga0070665_100034634 | Ga0070665_1000346342 | 150 |
| 59 | 3300005548 | Ga0070665_100102956 | Ga0070665_1001029562 | 150 |
| 60 | 3300005548 | Ga0070665_100205709 | Ga0070665_1002057092 | 150 |
| 61 | 3300005548 | Ga0070665_100861402 | Ga0070665_1008614022 | 150 |
| 62 | 3300005549 | Ga0070704_100573890 | Ga0070704_1005738902 | 150 |
| 63 | 3300005549 | Ga0070704_100712086 | Ga0070704_1007120861 | 150 |
| 64 | 3300005563 | Ga0068855_100078722 | Ga0068855_1000787224 | 150 |
| 65 | 3300005563 | Ga0068855_100558349 | Ga0068855_1005583492 | 150 |
| 66 | 3300005563 | Ga0068855_100881104 | Ga0068855_1008811042 | 150 |
| 67 | 3300005564 | Ga0070664_100092553 | Ga0070664_1000925532 | 150 |
| 68 | 3300005578 | Ga0068854_101301605 | Ga0068854_1013016052 | 150 |
| 69 | 3300005578 | Ga0068854_101588320 | Ga0068854_1015883202 | 150 |
| 70 | 3300005614 | Ga0068856_100039844 | Ga0068856_1000398442 | 150 |
| 71 | 3300005614 | Ga0068856_100111296 | Ga0068856_1001112962 | 150 |
| 72 | 3300005614 | Ga0068856_100164962 | Ga0068856_1001649622 | 150 |
| 73 | 3300005614 | Ga0068856_100326776 | Ga0068856_1003267762 | 150 |
| 74 | 3300005614 | Ga0068856_100447973 | Ga0068856_1004479732 | 150 |
| 75 | 3300005615 | Ga0070702_101267641 | Ga0070702_1012676412 | 150 |
| 76 | 3300005616 | Ga0068852_100544718 | Ga0068852_1005447182 | 150 |
| 77 | 3300005617 | Ga0068859_100277630 | Ga0068859_1002776302 | 150 |
| 78 | 3300005618 | Ga0068864_100527368 | Ga0068864_1005273682 | 150 |
| 79 | 3300005618 | Ga0068864_100893620 | Ga0068864_1008936201 | 150 |
| 80 | 3300005618 | Ga0068864_101246982 | Ga0068864_1012469821 | 150 |
| 81 | 3300005618 | Ga0068864_101394447 | Ga0068864_1013944471 | 150 |
| 82 | 3300005841 | Ga0068863_100389331 | Ga0068863_1003893312 | 150 |
| 83 | 3300005842 | Ga0068858_100280984 | Ga0068858_1002809842 | 150 |
| 84 | 3300005937 | Ga0081455_10078082 | Ga0081455_100780822 | 150 |
| 85 | 3300005937 | Ga0081455_10183189 | Ga0081455_101831892 | 150 |
| 86 | 3300005985 | Ga0081539_10016966 | Ga0081539_100169662 | 150 |
| 87 | 3300006028 | Ga0070717_10028502 | Ga0070717_100285023 | 150 |
| 88 | 3300006028 | Ga0070717_11529869 | Ga0070717_115298691 | 150 |
| 89 | 3300006042 | Ga0075368_10284662 | Ga0075368_102846621 | 150 |
| 90 | 3300006051 | Ga0075364_10263931 | Ga0075364_102639312 | 150 |
| 91 | 3300006051 | Ga0075364_10452104 | Ga0075364_104521042 | 150 |
| 92 | 3300006175 | Ga0070712_100207703 | Ga0070712_1002077032 | 150 |
| 93 | 3300006175 | Ga0070712_100371547 | Ga0070712_1003715472 | 150 |
| 94 | 3300006178 | Ga0075367_10140420 | Ga0075367_101404202 | 150 |
| 95 | 3300006178 | Ga0075367_10319264 | Ga0075367_103192642 | 150 |
| 96 | 3300006237 | Ga0097621_100378603 | Ga0097621_1003786032 | 150 |
| 97 | 3300006844 | Ga0075428_101365436 | Ga0075428_1013654361 | 150 |
| 98 | 3300006846 | Ga0075430_100017099 | Ga0075430_1000170992 | 150 |
| 99 | 3300006846 | Ga0075430_100208253 | Ga0075430_1002082533 | 150 |
| 100 | 3300006847 | Ga0075431_100049994 | Ga0075431_1000499943 | 150 |
| 101 | 3300006847 | Ga0075431_101303471 | Ga0075431_1013034711 | 150 |
| 102 | 3300006871 | Ga0075434_101430195 | Ga0075434_1014301951 | 150 |
| 103 | 3300006880 | Ga0075429_100289861 | Ga0075429_1002898611 | 150 |
| 104 | 3300006931 | Ga0097620_100277631 | Ga0097620_1002776312 | 150 |
| 105 | 3300007788 | Ga0099795_10002609 | Ga0099795_100026093 | 150 |
| 106 | 3300009093 | Ga0105240_10006874 | Ga0105240_100068747 | 150 |
| 107 | 3300009093 | Ga0105240_10296296 | Ga0105240_102962961 | 150 |
| 108 | 3300009093 | Ga0105240_12115071 | Ga0105240_121150711 | 150 |
| 109 | 3300009098 | Ga0105245_10529817 | Ga0105245_105298172 | 150 |
| 110 | 3300009098 | Ga0105245_10548624 | Ga0105245_105486241 | 150 |
| 111 | 3300009098 | Ga0105245_10953931 | Ga0105245_109539311 | 150 |
| 112 | 3300009147 | Ga0114129_10257209 | Ga0114129_102572092 | 150 |
| 113 | 3300009147 | Ga0114129_12410464 | Ga0114129_124104641 | 150 |
| 114 | 3300009174 | Ga0105241_10877466 | Ga0105241_108774661 | 150 |
| 115 | 3300009176 | Ga0105242_10159121 | Ga0105242_101591212 | 150 |
| 116 | 3300009176 | Ga0105242_10279618 | Ga0105242_102796182 | 150 |
| 117 | 3300009176 | Ga0105242_10453292 | Ga0105242_104532922 | 150 |
| 118 | 3300009177 | Ga0105248_10050901 | Ga0105248_100509012 | 150 |
| 119 | 3300009177 | Ga0105248_10757727 | Ga0105248_107577272 | 150 |
| 120 | 3300009177 | Ga0105248_10806005 | Ga0105248_108060052 | 150 |
| 121 | 3300009177 | Ga0105248_10982851 | Ga0105248_109828511 | 150 |
| 122 | 3300009177 | Ga0105248_12343157 | Ga0105248_123431571 | 150 |
| 123 | 3300009177 | Ga0105248_12591790 | Ga0105248_125917902 | 150 |
| 124 | 3300009545 | Ga0105237_10002393 | Ga0105237_100023933 | 150 |
| 125 | 3300009545 | Ga0105237_10009190 | Ga0105237_100091909 | 150 |
| 126 | 3300009551 | Ga0105238_10324851 | Ga0105238_103248512 | 150 |
| 127 | 3300010159 | Ga0099796_10006093 | Ga0099796_100060932 | 150 |
| 128 | 3300011119 | Ga0105246_10533496 | Ga0105246_105334961 | 150 |
| 129 | 3300011119 | Ga0105246_11086427 | Ga0105246_110864271 | 150 |
| 130 | 3300013104 | Ga0157370_10146500 | Ga0157370_101465002 | 150 |
| 131 | 3300013104 | Ga0157370_11069860 | Ga0157370_110698602 | 150 |
| 132 | 3300013105 | Ga0157369_10001633 | Ga0157369_100016336 | 150 |
| 133 | 3300013105 | Ga0157369_10088108 | Ga0157369_100881082 | 150 |
| 134 | 3300013105 | Ga0157369_11449589 | Ga0157369_114495892 | 150 |
| 135 | 3300013296 | Ga0157374_10027248 | Ga0157374_100272483 | 150 |
| 136 | 3300013296 | Ga0157374_10180316 | Ga0157374_101803162 | 150 |
| 137 | 3300013296 | Ga0157374_11790706 | Ga0157374_117907061 | 150 |
| 138 | 3300013297 | Ga0157378_10064717 | Ga0157378_100647172 | 150 |
| 139 | 3300013297 | Ga0157378_12308919 | Ga0157378_123089191 | 150 |
| 140 | 3300013306 | Ga0163162_11346718 | Ga0163162_113467182 | 150 |
| 141 | 3300013306 | Ga0163162_11670522 | Ga0163162_116705221 | 150 |
| 142 | 3300013306 | Ga0163162_11964272 | Ga0163162_119642722 | 150 |
| 143 | 3300013307 | Ga0157372_10450412 | Ga0157372_104504122 | 150 |
| 144 | 3300013308 | Ga0157375_11085361 | Ga0157375_110853611 | 150 |
| 145 | 3300013308 | Ga0157375_12126510 | Ga0157375_121265102 | 150 |
| 146 | 3300014325 | Ga0163163_10024356 | Ga0163163_100243563 | 150 |
| 147 | 3300014325 | Ga0163163_10024722 | Ga0163163_100247222 | 150 |
| 148 | 3300014325 | Ga0163163_10026417 | Ga0163163_100264172 | 150 |
| 149 | 3300014325 | Ga0163163_10179909 | Ga0163163_101799091 | 150 |
| 150 | 3300014325 | Ga0163163_12157092 | Ga0163163_121570922 | 150 |
| 151 | 3300014326 | Ga0157380_11581399 | Ga0157380_115813992 | 150 |
| 152 | 3300014326 | Ga0157380_12208626 | Ga0157380_122086261 | 150 |
| 153 | 3300014497 | Ga0182008_10403786 | Ga0182008_104037861 | 150 |
| 154 | 3300014968 | Ga0157379_10029397 | Ga0157379_100293974 | 150 |
| 155 | 3300014969 | Ga0157376_10105338 | Ga0157376_101053382 | 150 |
| 156 | 3300014969 | Ga0157376_10816888 | Ga0157376_108168882 | 150 |
| 157 | 3300014969 | Ga0157376_10892597 | Ga0157376_108925971 | 150 |
| 158 | 3300017792 | Ga0163161_11083324 | Ga0163161_110833242 | 150 |
| 159 | 3300019183 | Ga0184601_134489 | Ga0184601_1344891 | 150 |
| 160 | 3300020080 | Ga0206350_10736505 | Ga0206350_107365051 | 150 |
| 161 | 3300021361 | Ga0213872_10060842 | Ga0213872_100608421 | 150 |
| 162 | 3300021361 | Ga0213872_10115178 | Ga0213872_101151782 | 150 |
| 163 | 3300021377 | Ga0213874_10030925 | Ga0213874_100309252 | 150 |
| 164 | 3300021384 | Ga0213876_10156838 | Ga0213876_101568381 | 150 |
| 165 | 3300021384 | Ga0213876_10227828 | Ga0213876_102278282 | 150 |
| 166 | 3300021388 | Ga0213875_10000004 | Ga0213875_1000000475 | 150 |
| 167 | 3300021388 | Ga0213875_10000409 | Ga0213875_1000040912 | 150 |
| 168 | 3300021388 | Ga0213875_10010793 | Ga0213875_100107936 | 150 |
| 169 | 3300021388 | Ga0213875_10084814 | Ga0213875_100848142 | 150 |
| 170 | 3300021388 | Ga0213875_10122583 | Ga0213875_101225832 | 150 |
| 171 | 3300021388 | Ga0213875_10445581 | Ga0213875_104455811 | 150 |
| 172 | 3300021388 | Ga0213875_10542333 | Ga0213875_105423331 | 150 |
| 173 | 3300021441 | Ga0213871_10006468 | Ga0213871_100064682 | 150 |
| 174 | 3300025303 | Ga0209051_1001186 | Ga0209051_10011862 | 150 |
| 175 | 3300025303 | Ga0209051_1005394 | Ga0209051_10053949 | 150 |
| 176 | 3300025303 | Ga0209051_1047107 | Ga0209051_10471071 | 150 |
| 177 | 3300025304 | Ga0209257_1059664 | Ga0209257_10596642 | 150 |
| 178 | 3300025909 | Ga0207705_10329270 | Ga0207705_103292702 | 150 |
| 179 | 3300025911 | Ga0207654_11063366 | Ga0207654_110633661 | 150 |
| 180 | 3300025913 | Ga0207695_10005122 | Ga0207695_1000512214 | 150 |
| 181 | 3300025913 | Ga0207695_10217137 | Ga0207695_102171371 | 150 |
| 182 | 3300025914 | Ga0207671_10013289 | Ga0207671_100132892 | 150 |
| 183 | 3300025915 | Ga0207693_10332234 | Ga0207693_103322342 | 150 |
| 184 | 3300025921 | Ga0207652_10158359 | Ga0207652_101583592 | 150 |
| 185 | 3300025925 | Ga0207650_10625289 | Ga0207650_106252891 | 150 |
| 186 | 3300025928 | Ga0207700_10543166 | Ga0207700_105431662 | 150 |
| 187 | 3300025929 | Ga0207664_10569742 | Ga0207664_105697422 | 150 |
| 188 | 3300025932 | Ga0207690_10090684 | Ga0207690_100906842 | 150 |
| 189 | 3300025932 | Ga0207690_10221243 | Ga0207690_102212431 | 150 |
| 190 | 3300025934 | Ga0207686_10016496 | Ga0207686_100164965 | 150 |
| 191 | 3300025934 | Ga0207686_10543413 | Ga0207686_105434132 | 150 |
| 192 | 3300025934 | Ga0207686_10568711 | Ga0207686_105687112 | 150 |
| 193 | 3300025940 | Ga0207691_10342247 | Ga0207691_103422473 | 150 |
| 194 | 3300025941 | Ga0207711_10832823 | Ga0207711_108328232 | 150 |
| 195 | 3300025942 | Ga0207689_11530744 | Ga0207689_115307441 | 150 |
| 196 | 3300025945 | Ga0207679_10224928 | Ga0207679_102249282 | 150 |
| 197 | 3300025949 | Ga0207667_10049760 | Ga0207667_100497602 | 150 |
| 198 | 3300025949 | Ga0207667_10605563 | Ga0207667_106055632 | 150 |
| 199 | 3300025960 | Ga0207651_10120103 | Ga0207651_101201033 | 150 |
| 200 | 3300026035 | Ga0207703_10247960 | Ga0207703_102479602 | 150 |
| 201 | 3300026041 | Ga0207639_10283578 | Ga0207639_102835782 | 150 |
| 202 | 3300026041 | Ga0207639_11275386 | Ga0207639_112753861 | 150 |
| 203 | 3300026075 | Ga0207708_10202584 | Ga0207708_102025841 | 150 |
| 204 | 3300026078 | Ga0207702_10012718 | Ga0207702_100127183 | 150 |
| 205 | 3300026078 | Ga0207702_10036512 | Ga0207702_100365123 | 150 |
| 206 | 3300026078 | Ga0207702_10052635 | Ga0207702_100526353 | 150 |
| 207 | 3300026089 | Ga0207648_10353116 | Ga0207648_103531161 | 150 |
| 208 | 3300026095 | Ga0207676_10860450 | Ga0207676_108604502 | 150 |
| 209 | 3300026118 | Ga0207675_100460912 | Ga0207675_1004609122 | 150 |
| 210 | 3300026142 | Ga0207698_11417460 | Ga0207698_114174601 | 150 |
| 211 | 3300026142 | Ga0207698_12393151 | Ga0207698_123931511 | 150 |
| 212 | 3300028379 | Ga0268266_10010740 | Ga0268266_100107402 | 150 |
| 213 | 3300028379 | Ga0268266_10284707 | Ga0268266_102847072 | 150 |
| 214 | 3300031344 | Ga0265316_10105173 | Ga0265316_101051733 | 150 |
| 215 | 3300031344 | Ga0265316_11192990 | Ga0265316_111929901 | 150 |
| 216 | 3300031456 | Ga0307513_10284836 | Ga0307513_102848362 | 150 |
| 217 | 3300032120 | Ga0316053_112151 | Ga0316053_1121511 | 150 |
| 218 | 3300035111 | Ga0373923_0296135 | Ga0373923_0296135_293_748 | 150 |
| 219 | 3300035112 | Ga0373932_0011260 | Ga0373932_0011260_1511_1972 | 150 |
| 220 | 3300035170 | Ga0373943_0026858 | Ga0373943_0026858_1739_2194 | 150 |
| 221 | 3300035171 | Ga0373946_0226390 | Ga0373946_0226390_336_794 | 150 |
| 222 | 3300035692 | Ga0373935_0008964 | Ga0373935_0008964_5267_5722 | 150 |
| 223 | 3300035725 | Ga0373947_0044834 | Ga0373947_0044834_296_751 | 150 |
| 224 | 3300035725 | Ga0373947_0331982 | Ga0373947_0331982_426_881 | 150 |
| 225 | 3300036401 | Ga0373937_0228238 | Ga0373937_0228238_961_1416 | 150 |
| 226 | 3300037068 | Ga0373925_0854255 | Ga0373925_0854255_183_638 | 150 |
| 227 | 3300037068 | Ga0373925_0882413 | Ga0373925_0882413_165_620 | 150 |
| 228 | 3300037418 | Ga0395900_0043542 | Ga0395900_0043542_3351_3863 | 150 |
| 229 | 3300037471 | Ga0395905_1479575 | Ga0395905_1479575_56_511 | 150 |
| 230 | 3300037853 | Ga0436364_0199993 | Ga0436364_0199993_296_763 | 150 |
| 231 | 3300037853 | Ga0436364_0356734 | Ga0436364_0356734_556_1014 | 150 |
| 232 | 3300037853 | Ga0436364_0431728 | Ga0436364_0431728_30065_30532 | 150 |
| 233 | 3300037853 | Ga0436364_0748068 | Ga0436364_0748068_515511_515978 | 150 |
| 234 | 3300037853 | Ga0436364_0843268 | Ga0436364_0843268_1368_1835 | 150 |
| 235 | 3300037853 | Ga0436364_1236165 | Ga0436364_1236165_2258_2728 | 150 |
| 236 | 3300037853 | Ga0436364_1261036 | Ga0436364_1261036_39_494 | 150 |
| 237 | 3300037853 | Ga0436364_1342962 | Ga0436364_1342962_46_501 | 150 |
| 238 | 3300037853 | Ga0436364_1457846 | Ga0436364_1457846_3491_3946 | 150 |
| 239 | 3300039093 | Ga0400489_41603 | Ga0400489_41603_9134_9595 | 150 |
| 240 | 3300039437 | Ga0436365_0206806 | Ga0436365_0206806_1082_1537 | 150 |
| 241 | 3300039437 | Ga0436365_0430209 | Ga0436365_0430209_805_1260 | 150 |
| 242 | 3300039437 | Ga0436365_0543679 | Ga0436365_0543679_11369_11824 | 150 |
| 243 | 3300039437 | Ga0436365_0844407 | Ga0436365_0844407_427_885 | 150 |
| 244 | 3300039437 | Ga0436365_1303722 | Ga0436365_1303722_336_803 | 150 |
| 245 | 3300039438 | Ga0436360_0213572 | Ga0436360_0213572_6280_6735 | 150 |
| 246 | 3300039438 | Ga0436360_1336127 | Ga0436360_1336127_485_952 | 150 |
| 247 | 3300039447 | Ga0436361_0666244 | Ga0436361_0666244_5448_5906 | 150 |
| 248 | 3300039447 | Ga0436361_1021429 | Ga0436361_1021429_3530_3988 | 150 |
| 249 | 3300039450 | Ga0436363_1397348 | Ga0436363_1397348_2658_3113 | 150 |
| 250 | 3300039453 | Ga0436362_0283413 | Ga0436362_0283413_1245_1700 | 150 |
| 251 | 3300039453 | Ga0436362_0566135 | Ga0436362_0566135_110_577 | 150 |
| 252 | 3300041512 | Ga0451853_0555938 | Ga0451853_0555938_16_471 | 150 |
| 253 | 3300041997 | Ga0439431_0003477 | Ga0439431_0003477_679_1146 | 150 |
| 254 | 3300042156 | Ga0439446_0177389 | Ga0439446_0177389_188_655 | 150 |
| 255 | 3300042876 | Ga0451577_0815176 | Ga0451577_0815176_31_486 | 150 |
| 256 | 3300044673 | Ga0453683_0045779 | Ga0453683_0045779_1992_2447 | 150 |
| 257 | 3300044673 | Ga0453683_0163493 | Ga0453683_0163493_709_1170 | 150 |
| 258 | 3300044673 | Ga0453683_0182467 | Ga0453683_0182467_20_475 | 150 |
| 259 | 3300044684 | Ga0466966_0253495 | Ga0466966_0253495_57_524 | 150 |
| 260 | 3300044694 | Ga0466963_0814535 | Ga0466963_0814535_19_486 | 150 |
| 261 | 3300044712 | Ga0453684_0391319 | Ga0453684_0391319_302_763 | 150 |
| 262 | 3300046472 | Ga0495580_0527279 | Ga0495580_0527279_300_755 | 150 |
| 263 | 3300046681 | Ga0495647_0184949 | Ga0495647_0184949_316_774 | 150 |
| 264 | 3300046683 | Ga0495658_0067976 | Ga0495658_0067976_622_1080 | 150 |
| 265 | 3300047317 | Ga0495604_0159347 | Ga0495604_0159347_642_1103 | 150 |
| 266 | 3300047319 | Ga0495674_0080503 | Ga0495674_0080503_1030_1491 | 150 |
| 267 | 3300047444 | Ga0495675_0146301 | Ga0495675_0146301_849_1310 | 150 |
| 268 | 3300048088 | Ga0495602_0271131 | Ga0495602_0271131_739_1200 | 150 |
| 269 | 3300048089 | Ga0495614_0356171 | Ga0495614_0356171_73_537 | 150 |
| 270 | 3300048903 | Ga0496100_0550846 | Ga0496100_0550846_97_555 | 150 |
| 271 | 3300048907 | Ga0496104_0131456 | Ga0496104_0131456_184_642 | 150 |
| 272 | 3300048908 | Ga0496105_0089442 | Ga0496105_0089442_1626_2084 | 150 |
| 273 | 3300048909 | Ga0496106_0743448 | Ga0496106_0743448_269_724 | 150 |
| 274 | 3300048915 | Ga0496112_0103364 | Ga0496112_0103364_2051_2506 | 150 |
| 275 | 3300048916 | Ga0496113_0592473 | Ga0496113_0592473_231_686 | 150 |
| 276 | 3300048917 | Ga0496114_0199953 | Ga0496114_0199953_918_1376 | 150 |
| 277 | 3300048918 | Ga0496115_0034331 | Ga0496115_0034331_2287_2742 | 150 |
| 278 | 3300048929 | Ga0496126_0315743 | Ga0496126_0315743_387_902 | 150 |
| 279 | 3300049571 | Ga0501034_0481604 | Ga0501034_0481604_466_921 | 150 |
| 280 | 3300049572 | Ga0501036_0217846 | Ga0501036_0217846_881_1339 | 150 |
| 281 | 3300049573 | Ga0501037_0546519 | Ga0501037_0546519_279_740 | 150 |
| 282 | 3300049575 | Ga0501039_0142423 | Ga0501039_0142423_632_1093 | 150 |
| 283 | 3300049576 | Ga0501040_0097502 | Ga0501040_0097502_992_1453 | 150 |
| 284 | 3300049577 | Ga0501041_0087895 | Ga0501041_0087895_131_592 | 150 |
| 285 | 3300049578 | Ga0501042_0044735 | Ga0501042_0044735_435_896 | 150 |
| 286 | 3300049578 | Ga0501042_0600819 | Ga0501042_0600819_205_702 | 150 |
| 287 | 3300049580 | Ga0501046_0121394 | Ga0501046_0121394_1170_1631 | 150 |
| 288 | 3300049582 | Ga0501048_0279458 | Ga0501048_0279458_574_1035 | 150 |
| 289 | 3300049584 | Ga0501068_0175822 | Ga0501068_0175822_639_1139 | 150 |
| 290 | 3300049587 | Ga0501071_0024968 | Ga0501071_0024968_2874_3332 | 150 |
| 291 | 3300049588 | Ga0501072_0027502 | Ga0501072_0027502_329_787 | 150 |
| 292 | 3300049590 | Ga0501074_0062883 | Ga0501074_0062883_1660_2121 | 150 |
| 293 | 3300049591 | Ga0501075_0288508 | Ga0501075_0288508_579_1040 | 150 |
| 294 | 3300049591 | Ga0501075_0331294 | Ga0501075_0331294_436_894 | 150 |
| 295 | 3300049592 | Ga0501076_0081126 | Ga0501076_0081126_1230_1691 | 150 |
| 296 | 3300049653 | Ga0501206_066988 | Ga0501206_066988_77_532 | 150 |
| 297 | 3300049679 | Ga0501249_072623 | Ga0501249_072623_327_782 | 150 |
| 298 | 3300049686 | Ga0501257_111028 | Ga0501257_111028_116_571 | 150 |
| 299 | 3300049741 | Ga0501079_0283130 | Ga0501079_0283130_629_1087 | 150 |
| 300 | 3300049824 | Ga0501045_0033860 | Ga0501045_0033860_183_644 | 150 |
| 301 | 3300050509 | nmdc:mga0qj67_15553_c1 | nmdc:mga0qj67_15553_c1_4145_4600 | 150 |
| 302 | 3300050509 | nmdc:mga0qj67_598641_c1 | nmdc:mga0qj67_598641_c1_283_771 | 150 |
| 303 | 3300050510 | nmdc:mga06r32_368541_c1 | nmdc:mga06r32_368541_c1_44_532 | 150 |
| 304 | 3300050510 | nmdc:mga06r32_647643_c1 | nmdc:mga06r32_647643_c1_305_760 | 150 |
| 305 | 3300050511 | nmdc:mga08y16_455950_c1 | nmdc:mga08y16_455950_c1_155_610 | 150 |
| 306 | 3300053096 | Ga0500641_0033523 | Ga0500641_0033523_334_855 | 150 |
| 307 | 3300053103 | Ga0500555_008448 | Ga0500555_008448_765_1286 | 150 |
| 308 | 3300054114 | Ga0501084_0199189 | Ga0501084_0199189_324_785 | 150 |
| 309 | 3300054114 | Ga0501084_0758517 | Ga0501084_0758517_336_794 | 150 |
| 310 | 3300060353 | Ga0501082_0602291 | Ga0501082_0602291_222_683 | 150 |
| 311 | iso_pu_bacteria | 2829745981 | 2829749919 | 150 |
| 312 | 3300003320 | rootH2_10304912 | rootH2_103049122 | 151 |
| 313 | 3300004803 | Ga0058862_12866476 | Ga0058862_128664762 | 151 |
| 314 | 3300005327 | Ga0070658_10013460 | Ga0070658_100134604 | 151 |
| 315 | 3300005336 | Ga0070680_100003733 | Ga0070680_1000037336 | 151 |
| 316 | 3300005336 | Ga0070680_100646880 | Ga0070680_1006468801 | 151 |
| 317 | 3300005336 | Ga0070680_101034608 | Ga0070680_1010346081 | 151 |
| 318 | 3300005339 | Ga0070660_100237424 | Ga0070660_1002374242 | 151 |
| 319 | 3300005340 | Ga0070689_101386646 | Ga0070689_1013866461 | 151 |
| 320 | 3300005354 | Ga0070675_100985211 | Ga0070675_1009852112 | 151 |
| 321 | 3300005364 | Ga0070673_100065377 | Ga0070673_1000653772 | 151 |
| 322 | 3300005365 | Ga0070688_100176706 | Ga0070688_1001767062 | 151 |
| 323 | 3300005440 | Ga0070705_100656145 | Ga0070705_1006561452 | 151 |
| 324 | 3300005445 | Ga0070708_100101800 | Ga0070708_1001018002 | 151 |
| 325 | 3300005445 | Ga0070708_100165342 | Ga0070708_1001653422 | 151 |
| 326 | 3300005458 | Ga0070681_10280278 | Ga0070681_102802781 | 151 |
| 327 | 3300005467 | Ga0070706_100368912 | Ga0070706_1003689123 | 151 |
| 328 | 3300005468 | Ga0070707_100039683 | Ga0070707_1000396837 | 151 |
| 329 | 3300005468 | Ga0070707_100860618 | Ga0070707_1008606182 | 151 |
| 330 | 3300005471 | Ga0070698_100000373 | Ga0070698_10000037328 | 151 |
| 331 | 3300005471 | Ga0070698_100095616 | Ga0070698_1000956162 | 151 |
| 332 | 3300005518 | Ga0070699_100058652 | Ga0070699_1000586524 | 151 |
| 333 | 3300005518 | Ga0070699_100100014 | Ga0070699_1001000143 | 151 |
| 334 | 3300005518 | Ga0070699_100279308 | Ga0070699_1002793082 | 151 |
| 335 | 3300005530 | Ga0070679_100180423 | Ga0070679_1001804232 | 151 |
| 336 | 3300005536 | Ga0070697_100030107 | Ga0070697_1000301075 | 151 |
| 337 | 3300005545 | Ga0070695_100257127 | Ga0070695_1002571272 | 151 |
| 338 | 3300005563 | Ga0068855_100018483 | Ga0068855_1000184836 | 151 |
| 339 | 3300005563 | Ga0068855_100021333 | Ga0068855_1000213335 | 151 |
| 340 | 3300005614 | Ga0068856_100638230 | Ga0068856_1006382302 | 151 |
| 341 | 3300005614 | Ga0068856_101137822 | Ga0068856_1011378222 | 151 |
| 342 | 3300005616 | Ga0068852_101517615 | Ga0068852_1015176151 | 151 |
| 343 | 3300005718 | Ga0068866_10732638 | Ga0068866_107326381 | 151 |
| 344 | 3300005719 | Ga0068861_100335650 | Ga0068861_1003356502 | 151 |
| 345 | 3300005842 | Ga0068858_101053404 | Ga0068858_1010534041 | 151 |
| 346 | 3300005983 | Ga0081540_1219320 | Ga0081540_12193201 | 151 |
| 347 | 3300006028 | Ga0070717_10048549 | Ga0070717_100485492 | 151 |
| 348 | 3300006175 | Ga0070712_100688436 | Ga0070712_1006884362 | 151 |
| 349 | 3300007788 | Ga0099795_10030126 | Ga0099795_100301262 | 151 |
| 350 | 3300007788 | Ga0099795_10172256 | Ga0099795_101722562 | 151 |
| 351 | 3300009093 | Ga0105240_10000337 | Ga0105240_1000033736 | 151 |
| 352 | 3300009545 | Ga0105237_10133017 | Ga0105237_101330172 | 151 |
| 353 | 3300009553 | Ga0105249_10613862 | Ga0105249_106138621 | 151 |
| 354 | 3300009553 | Ga0105249_10805681 | Ga0105249_108056812 | 151 |
| 355 | 3300013104 | Ga0157370_10005606 | Ga0157370_100056065 | 151 |
| 356 | 3300013104 | Ga0157370_10607615 | Ga0157370_106076152 | 151 |
| 357 | 3300013105 | Ga0157369_10215104 | Ga0157369_102151042 | 151 |
| 358 | 3300013307 | Ga0157372_11166673 | Ga0157372_111666732 | 151 |
| 359 | 3300017792 | Ga0163161_10590593 | Ga0163161_105905932 | 151 |
| 360 | 3300021361 | Ga0213872_10000785 | Ga0213872_100007856 | 151 |
| 361 | 3300021361 | Ga0213872_10117995 | Ga0213872_101179952 | 151 |
| 362 | 3300021384 | Ga0213876_10033677 | Ga0213876_100336772 | 151 |
| 363 | 3300024227 | Ga0228598_1041091 | Ga0228598_10410911 | 151 |
| 364 | 3300025909 | Ga0207705_10404288 | Ga0207705_104042882 | 151 |
| 365 | 3300025910 | Ga0207684_10332074 | Ga0207684_103320742 | 151 |
| 366 | 3300025913 | Ga0207695_10001289 | Ga0207695_1000128915 | 151 |
| 367 | 3300025914 | Ga0207671_10011634 | Ga0207671_100116343 | 151 |
| 368 | 3300025916 | Ga0207663_10052557 | Ga0207663_100525572 | 151 |
| 369 | 3300025917 | Ga0207660_10091219 | Ga0207660_100912192 | 151 |
| 370 | 3300025920 | Ga0207649_11187655 | Ga0207649_111876552 | 151 |
| 371 | 3300025921 | Ga0207652_10148061 | Ga0207652_101480612 | 151 |
| 372 | 3300025921 | Ga0207652_10952038 | Ga0207652_109520381 | 151 |
| 373 | 3300025922 | Ga0207646_10008018 | Ga0207646_100080187 | 151 |
| 374 | 3300025923 | Ga0207681_10403376 | Ga0207681_104033762 | 151 |
| 375 | 3300025925 | Ga0207650_10446098 | Ga0207650_104460982 | 151 |
| 376 | 3300025929 | Ga0207664_10390836 | Ga0207664_103908361 | 151 |
| 377 | 3300025949 | Ga0207667_10374971 | Ga0207667_103749712 | 151 |
| 378 | 3300025949 | Ga0207667_10626150 | Ga0207667_106261502 | 151 |
| 379 | 3300025949 | Ga0207667_10655380 | Ga0207667_106553802 | 151 |
| 380 | 3300025960 | Ga0207651_11151891 | Ga0207651_111518911 | 151 |
| 381 | 3300025961 | Ga0207712_10357695 | Ga0207712_103576952 | 151 |
| 382 | 3300026035 | Ga0207703_12129612 | Ga0207703_121296121 | 151 |
| 383 | 3300026078 | Ga0207702_10401868 | Ga0207702_104018681 | 151 |
| 384 | 3300026078 | Ga0207702_10472674 | Ga0207702_104726741 | 151 |
| 385 | 3300026118 | Ga0207675_100500949 | Ga0207675_1005009492 | 151 |
| 386 | 3300026142 | Ga0207698_10054163 | Ga0207698_100541632 | 151 |
| 387 | 3300026142 | Ga0207698_11276307 | Ga0207698_112763072 | 151 |
| 388 | 3300028800 | Ga0265338_10113802 | Ga0265338_101138022 | 151 |
| 389 | 3300030878 | Ga0265770_1007398 | Ga0265770_10073982 | 151 |
| 390 | 3300031090 | Ga0265760_10011916 | Ga0265760_100119162 | 151 |
| 391 | 3300031251 | Ga0265327_10004235 | Ga0265327_100042352 | 151 |
| 392 | 3300031344 | Ga0265316_10095091 | Ga0265316_100950911 | 151 |
| 393 | 3300035170 | Ga0373943_0364261 | Ga0373943_0364261_151_606 | 151 |
| 394 | 3300035725 | Ga0373947_0265587 | Ga0373947_0265587_437_892 | 151 |
| 395 | 3300037068 | Ga0373925_0149534 | Ga0373925_0149534_611_1066 | 151 |
| 396 | 3300037312 | Ga0395899_0345830 | Ga0395899_0345830_33_491 | 151 |
| 397 | 3300037418 | Ga0395900_0599874 | Ga0395900_0599874_159_617 | 151 |
| 398 | 3300037466 | Ga0395898_1487548 | Ga0395898_1487548_135_593 | 151 |
| 399 | 3300037466 | Ga0395898_1726355 | Ga0395898_1726355_83_538 | 151 |
| 400 | 3300037471 | Ga0395905_0078049 | Ga0395905_0078049_1320_1775 | 151 |
| 401 | 3300039437 | Ga0436365_0472708 | Ga0436365_0472708_2820_3305 | 151 |
| 402 | 3300039438 | Ga0436360_0285718 | Ga0436360_0285718_94_588 | 151 |
| 403 | 3300039447 | Ga0436361_0047346 | Ga0436361_0047346_85349_85804 | 151 |
| 404 | 3300039447 | Ga0436361_0055354 | Ga0436361_0055354_683_1162 | 151 |
| 405 | 3300039447 | Ga0436361_0154707 | Ga0436361_0154707_6169_6627 | 151 |
| 406 | 3300039447 | Ga0436361_0932086 | Ga0436361_0932086_693_1172 | 151 |
| 407 | 3300039450 | Ga0436363_0756951 | Ga0436363_0756951_181_642 | 151 |
| 408 | 3300044673 | Ga0453683_0003615 | Ga0453683_0003615_6128_6592 | 151 |
| 409 | 3300044735 | Ga0466968_0066312 | Ga0466968_0066312_621_1082 | 151 |
| 410 | 3300045051 | Ga0451576_0424920 | Ga0451576_0424920_53_508 | 151 |
| 411 | 3300045051 | Ga0451576_0503573 | Ga0451576_0503573_494_958 | 151 |
| 412 | 3300045976 | Ga0466967_0579131 | Ga0466967_0579131_291_746 | 151 |
| 413 | 3300046512 | Ga0495610_0018383 | Ga0495610_0018383_840_1301 | 151 |
| 414 | 3300046526 | Ga0495666_0269840 | Ga0495666_0269840_299_754 | 151 |
| 415 | 3300046674 | Ga0495588_0120713 | Ga0495588_0120713_165_620 | 151 |
| 416 | 3300047471 | Ga0495684_0556766 | Ga0495684_0556766_23_478 | 151 |
| 417 | 3300048088 | Ga0495602_0378390 | Ga0495602_0378390_189_644 | 151 |
| 418 | 3300048910 | Ga0496107_0841192 | Ga0496107_0841192_11_487 | 151 |
| 419 | 3300048917 | Ga0496114_0362178 | Ga0496114_0362178_398_874 | 151 |
| 420 | 3300048920 | Ga0496117_0131997 | Ga0496117_0131997_771_1247 | 151 |
| 421 | 3300048921 | Ga0496118_0186132 | Ga0496118_0186132_583_1059 | 151 |
| 422 | 3300048924 | Ga0496121_0003184 | Ga0496121_0003184_12268_12735 | 151 |
| 423 | 3300048929 | Ga0496126_0009870 | Ga0496126_0009870_4290_4766 | 151 |
| 424 | 3300049572 | Ga0501036_0029060 | Ga0501036_0029060_1690_2148 | 151 |
| 425 | 3300049574 | Ga0501038_0110429 | Ga0501038_0110429_395_853 | 151 |
| 426 | 3300049575 | Ga0501039_0065713 | Ga0501039_0065713_2060_2518 | 151 |
| 427 | 3300049577 | Ga0501041_0061435 | Ga0501041_0061435_1304_1762 | 151 |
| 428 | 3300049578 | Ga0501042_0158598 | Ga0501042_0158598_573_1031 | 151 |
| 429 | 3300049580 | Ga0501046_0146614 | Ga0501046_0146614_407_865 | 151 |
| 430 | 3300049582 | Ga0501048_0076493 | Ga0501048_0076493_454_912 | 151 |
| 431 | 3300049590 | Ga0501074_0532786 | Ga0501074_0532786_343_801 | 151 |
| 432 | 3300049591 | Ga0501075_0166277 | Ga0501075_0166277_712_1170 | 151 |
| 433 | 3300049592 | Ga0501076_0275343 | Ga0501076_0275343_464_922 | 151 |
| 434 | 3300049593 | Ga0501077_0570600 | Ga0501077_0570600_86_544 | 151 |
| 435 | 3300049741 | Ga0501079_0093635 | Ga0501079_0093635_501_959 | 151 |
| 436 | 3300049743 | Ga0501081_0028476 | Ga0501081_0028476_2013_2471 | 151 |
| 437 | 3300049824 | Ga0501045_0052036 | Ga0501045_0052036_1065_1523 | 151 |
| 438 | 3300053094 | Ga0500566_0000074 | Ga0500566_0000074_22358_22834 | 151 |
| 439 | 3300053111 | Ga0500572_003846 | Ga0500572_003846_2646_3122 | 151 |
| 440 | 3300053122 | Ga0500608_068929 | Ga0500608_068929_583_1059 | 151 |
| 441 | 3300053123 | Ga0500614_000300 | Ga0500614_000300_8128_8604 | 151 |
| 442 | 3300053136 | Ga0500559_0001726 | Ga0500559_0001726_3404_3880 | 151 |
| 443 | 3300053148 | Ga0500590_020390 | Ga0500590_020390_494_970 | 151 |
| 444 | 3300053150 | Ga0500603_000030 | Ga0500603_000030_6730_7206 | 151 |
| 445 | 3300053159 | Ga0500630_003168 | Ga0500630_003168_876_1352 | 151 |
| 446 | 3300053163 | Ga0500639_000047 | Ga0500639_000047_43730_44206 | 151 |
| 447 | 3300053735 | Ga0500596_003610 | Ga0500596_003610_1782_2258 | 151 |
| 448 | 3300060353 | Ga0501082_0473518 | Ga0501082_0473518_285_743 | 151 |
| 449 | 3300061734 | Ga0530510_0576680 | Ga0530510_0576680_227_688 | 151 |
| 450 | 3300003771 | Ga0055526_1017989 | Ga0055526_10179892 | 152 |
| 451 | 3300003794 | Ga0055531_10015237 | Ga0055531_100152372 | 152 |
| 452 | 3300004625 | Ga0055543_1025049 | Ga0055543_10250492 | 152 |
| 453 | 3300005262 | Ga0065165_1000490 | Ga0065165_100049045 | 152 |
| 454 | 3300005434 | Ga0070709_10026841 | Ga0070709_100268412 | 152 |
| 455 | 3300005435 | Ga0070714_100176322 | Ga0070714_1001763222 | 152 |
| 456 | 3300005437 | Ga0070710_10052966 | Ga0070710_100529662 | 152 |
| 457 | 3300005437 | Ga0070710_10109467 | Ga0070710_101094672 | 152 |
| 458 | 3300005439 | Ga0070711_100019243 | Ga0070711_1000192432 | 152 |
| 459 | 3300005439 | Ga0070711_100137094 | Ga0070711_1001370942 | 152 |
| 460 | 3300005439 | Ga0070711_100187298 | Ga0070711_1001872982 | 152 |
| 461 | 3300005457 | Ga0070662_101229062 | Ga0070662_1012290621 | 152 |
| 462 | 3300005546 | Ga0070696_100115548 | Ga0070696_1001155482 | 152 |
| 463 | 3300005842 | Ga0068858_100807547 | Ga0068858_1008075472 | 152 |
| 464 | 3300005983 | Ga0081540_1104017 | Ga0081540_11040172 | 152 |
| 465 | 3300006028 | Ga0070717_10033606 | Ga0070717_100336064 | 152 |
| 466 | 3300006028 | Ga0070717_10158061 | Ga0070717_101580612 | 152 |
| 467 | 3300006163 | Ga0070715_10005486 | Ga0070715_100054862 | 152 |
| 468 | 3300006173 | Ga0070716_100221099 | Ga0070716_1002210992 | 152 |
| 469 | 3300006175 | Ga0070712_100237032 | Ga0070712_1002370322 | 152 |
| 470 | 3300006186 | Ga0075369_10008829 | Ga0075369_100088292 | 152 |
| 471 | 3300006195 | Ga0075366_10079958 | Ga0075366_100799582 | 152 |
| 472 | 3300006844 | Ga0075428_100129484 | Ga0075428_1001294842 | 152 |
| 473 | 3300006844 | Ga0075428_100213687 | Ga0075428_1002136873 | 152 |
| 474 | 3300006846 | Ga0075430_100365188 | Ga0075430_1003651882 | 152 |
| 475 | 3300006852 | Ga0075433_10739008 | Ga0075433_107390082 | 152 |
| 476 | 3300006871 | Ga0075434_100074195 | Ga0075434_1000741952 | 152 |
| 477 | 3300006880 | Ga0075429_100065686 | Ga0075429_1000656863 | 152 |
| 478 | 3300006914 | Ga0075436_100177970 | Ga0075436_1001779702 | 152 |
| 479 | 3300007076 | Ga0075435_100117975 | Ga0075435_1001179752 | 152 |
| 480 | 3300009093 | Ga0105240_10095466 | Ga0105240_100954662 | 152 |
| 481 | 3300009094 | Ga0111539_10617194 | Ga0111539_106171942 | 152 |
| 482 | 3300009147 | Ga0114129_10283516 | Ga0114129_102835162 | 152 |
| 483 | 3300009147 | Ga0114129_11024268 | Ga0114129_110242682 | 152 |
| 484 | 3300009553 | Ga0105249_11518156 | Ga0105249_115181561 | 152 |
| 485 | 3300010159 | Ga0099796_10115822 | Ga0099796_101158222 | 152 |
| 486 | 3300013105 | Ga0157369_10004521 | Ga0157369_1000452110 | 152 |
| 487 | 3300013306 | Ga0163162_10181605 | Ga0163162_101816052 | 152 |
| 488 | 3300021358 | Ga0213873_10071571 | Ga0213873_100715712 | 152 |
| 489 | 3300021361 | Ga0213872_10000071 | Ga0213872_1000007114 | 152 |
| 490 | 3300021361 | Ga0213872_10003152 | Ga0213872_100031522 | 152 |
| 491 | 3300021361 | Ga0213872_10059439 | Ga0213872_100594392 | 152 |
| 492 | 3300021377 | Ga0213874_10179083 | Ga0213874_101790832 | 152 |
| 493 | 3300021441 | Ga0213871_10024857 | Ga0213871_100248572 | 152 |
| 494 | 3300025295 | Ga0209564_1000283 | Ga0209564_100028310 | 152 |
| 495 | 3300025304 | Ga0209257_1000264 | Ga0209257_100026463 | 152 |
| 496 | 3300025898 | Ga0207692_10083636 | Ga0207692_100836362 | 152 |
| 497 | 3300025898 | Ga0207692_10247372 | Ga0207692_102473721 | 152 |
| 498 | 3300025905 | Ga0207685_10073115 | Ga0207685_100731152 | 152 |
| 499 | 3300025906 | Ga0207699_10016761 | Ga0207699_100167612 | 152 |
| 500 | 3300025913 | Ga0207695_10098915 | Ga0207695_100989152 | 152 |
| 501 | 3300025915 | Ga0207693_10016897 | Ga0207693_100168973 | 152 |
| 502 | 3300025915 | Ga0207693_10052095 | Ga0207693_100520953 | 152 |
| 503 | 3300025915 | Ga0207693_10154990 | Ga0207693_101549902 | 152 |
| 504 | 3300025915 | Ga0207693_10161001 | Ga0207693_101610012 | 152 |
| 505 | 3300025916 | Ga0207663_10122286 | Ga0207663_101222862 | 152 |
| 506 | 3300025916 | Ga0207663_10144307 | Ga0207663_101443072 | 152 |
| 507 | 3300025916 | Ga0207663_10271920 | Ga0207663_102719202 | 152 |
| 508 | 3300025922 | Ga0207646_10123363 | Ga0207646_101233632 | 152 |
| 509 | 3300025928 | Ga0207700_10013731 | Ga0207700_100137313 | 152 |
| 510 | 3300025929 | Ga0207664_10460911 | Ga0207664_104609112 | 152 |
| 511 | 3300025939 | Ga0207665_10001976 | Ga0207665_100019762 | 152 |
| 512 | 3300025939 | Ga0207665_10019541 | Ga0207665_100195413 | 152 |
| 513 | 3300026035 | Ga0207703_10895219 | Ga0207703_108952192 | 152 |
| 514 | 3300026075 | Ga0207708_11089557 | Ga0207708_110895572 | 152 |
| 515 | 3300028794 | Ga0307515_10093088 | Ga0307515_100930883 | 152 |
| 516 | 3300030522 | Ga0307512_10172021 | Ga0307512_101720212 | 152 |
| 517 | 3300031090 | Ga0265760_10339073 | Ga0265760_103390731 | 152 |
| 518 | 3300031730 | Ga0307516_10000499 | Ga0307516_1000049915 | 152 |
| 519 | 3300039438 | Ga0436360_0058815 | Ga0436360_0058815_114_587 | 152 |
| 520 | 3300039438 | Ga0436360_0380383 | Ga0436360_0380383_7888_8358 | 152 |
| 521 | 3300039438 | Ga0436360_0517441 | Ga0436360_0517441_1049_1519 | 152 |
| 522 | 3300039438 | Ga0436360_0914568 | Ga0436360_0914568_10846_11331 | 152 |
| 523 | 3300039447 | Ga0436361_0157085 | Ga0436361_0157085_295_765 | 152 |
| 524 | 3300039447 | Ga0436361_0384722 | Ga0436361_0384722_3806_4291 | 152 |
| 525 | 3300039447 | Ga0436361_0484676 | Ga0436361_0484676_1704_2174 | 152 |
| 526 | 3300039447 | Ga0436361_0652142 | Ga0436361_0652142_36_506 | 152 |
| 527 | 3300039447 | Ga0436361_0788442 | Ga0436361_0788442_30_500 | 152 |
| 528 | 3300039447 | Ga0436361_0895187 | Ga0436361_0895187_75601_76074 | 152 |
| 529 | 3300039447 | Ga0436361_0910912 | Ga0436361_0910912_52_537 | 152 |
| 530 | 3300039447 | Ga0436361_0923671 | Ga0436361_0923671_2035_2508 | 152 |
| 531 | 3300039447 | Ga0436361_1097826 | Ga0436361_1097826_935_1408 | 152 |
| 532 | 3300039450 | Ga0436363_0963290 | Ga0436363_0963290_36_506 | 152 |
| 533 | 3300039453 | Ga0436362_0063915 | Ga0436362_0063915_2705_3190 | 152 |
| 534 | 3300039453 | Ga0436362_0955192 | Ga0436362_0955192_320_805 | 152 |
| 535 | 3300039453 | Ga0436362_1210783 | Ga0436362_1210783_600_1070 | 152 |
| 536 | 3300041456 | Ga0451795_1304938 | Ga0451795_1304938_628_1092 | 152 |
| 537 | 3300041505 | Ga0451849_0220963 | Ga0451849_0220963_177_653 | 152 |
| 538 | 3300044712 | Ga0453684_0000951 | Ga0453684_0000951_41182_41646 | 152 |
| 539 | 3300045051 | Ga0451576_0003996 | Ga0451576_0003996_6210_6674 | 152 |
| 540 | 3300046460 | Ga0495638_0169811 | Ga0495638_0169811_243_707 | 152 |
| 541 | 3300046471 | Ga0495650_0000007 | Ga0495650_0000007_530340_530804 | 152 |
| 542 | 3300046471 | Ga0495650_0063018 | Ga0495650_0063018_602_1066 | 152 |
| 543 | 3300046492 | Ga0495585_0013190 | Ga0495585_0013190_2663_3196 | 152 |
| 544 | 3300046515 | Ga0495620_0061257 | Ga0495620_0061257_920_1408 | 152 |
| 545 | 3300046517 | Ga0495630_1027872 | Ga0495630_1027872_45_518 | 152 |
| 546 | 3300046519 | Ga0495632_0018888 | Ga0495632_0018888_1325_1789 | 152 |
| 547 | 3300046520 | Ga0495637_0042169 | Ga0495637_0042169_1221_1685 | 152 |
| 548 | 3300046524 | Ga0495648_0000039 | Ga0495648_0000039_133836_134324 | 152 |
| 549 | 3300046529 | Ga0495652_0103129 | Ga0495652_0103129_979_1446 | 152 |
| 550 | 3300046529 | Ga0495652_0622100 | Ga0495652_0622100_129_662 | 152 |
| 551 | 3300046530 | Ga0495654_0000053 | Ga0495654_0000053_33727_34191 | 152 |
| 552 | 3300046642 | Ga0495634_0634917 | Ga0495634_0634917_41_574 | 152 |
| 553 | 3300046660 | Ga0495625_0000683 | Ga0495625_0000683_1174_1638 | 152 |
| 554 | 3300046660 | Ga0495625_0004788 | Ga0495625_0004788_1189_1653 | 152 |
| 555 | 3300046660 | Ga0495625_0007535 | Ga0495625_0007535_1606_2070 | 152 |
| 556 | 3300046660 | Ga0495625_0009883 | Ga0495625_0009883_2655_3119 | 152 |
| 557 | 3300046660 | Ga0495625_0387504 | Ga0495625_0387504_147_611 | 152 |
| 558 | 3300046692 | Ga0495671_0250159 | Ga0495671_0250159_28_492 | 152 |
| 559 | 3300047469 | Ga0495673_0000148 | Ga0495673_0000148_87911_88399 | 152 |
| 560 | 3300047472 | Ga0495686_0010996 | Ga0495686_0010996_5546_6010 | 152 |
| 561 | 3300047472 | Ga0495686_0015143 | Ga0495686_0015143_1619_2107 | 152 |
| 562 | 3300047472 | Ga0495686_0063473 | Ga0495686_0063473_665_1129 | 152 |
| 563 | 3300048904 | Ga0496101_0072322 | Ga0496101_0072322_1259_1723 | 152 |
| 564 | 3300048905 | Ga0496102_1527023 | Ga0496102_1527023_69_542 | 152 |
| 565 | 3300048909 | Ga0496106_0208732 | Ga0496106_0208732_885_1349 | 152 |
| 566 | 3300048910 | Ga0496107_0000113 | Ga0496107_0000113_10593_11057 | 152 |
| 567 | 3300048911 | Ga0496108_0305201 | Ga0496108_0305201_279_752 | 152 |
| 568 | 3300048916 | Ga0496113_0820937 | Ga0496113_0820937_76_540 | 152 |
| 569 | 3300048921 | Ga0496118_0072464 | Ga0496118_0072464_1888_2355 | 152 |
| 570 | 3300048921 | Ga0496118_0294034 | Ga0496118_0294034_373_840 | 152 |
| 571 | 3300048921 | Ga0496118_0322079 | Ga0496118_0322079_32_499 | 152 |
| 572 | 3300048923 | Ga0496120_0053556 | Ga0496120_0053556_1209_1676 | 152 |
| 573 | 3300048924 | Ga0496121_0000197 | Ga0496121_0000197_75803_76270 | 152 |
| 574 | 3300048924 | Ga0496121_0002319 | Ga0496121_0002319_7915_8379 | 152 |
| 575 | 3300048924 | Ga0496121_0038189 | Ga0496121_0038189_190_657 | 152 |
| 576 | 3300048924 | Ga0496121_0282033 | Ga0496121_0282033_179_646 | 152 |
| 577 | 3300048925 | Ga0496122_0015369 | Ga0496122_0015369_1518_1985 | 152 |
| 578 | 3300048926 | Ga0496123_0008845 | Ga0496123_0008845_4409_4876 | 152 |
| 579 | 3300048929 | Ga0496126_0002536 | Ga0496126_0002536_7319_7783 | 152 |
| 580 | 3300048929 | Ga0496126_0091443 | Ga0496126_0091443_1842_2306 | 152 |
| 581 | 3300049582 | Ga0501048_0125570 | Ga0501048_0125570_357_827 | 152 |
| 582 | 3300049823 | Ga0501044_0179264 | Ga0501044_0179264_35_505 | 152 |
| 583 | 3300050491 | nmdc:mga00v17_111656_c1 | nmdc:mga00v17_111656_c1_1251_1724 | 152 |
| 584 | 3300050493 | nmdc:mga0k408_76832_c1 | nmdc:mga0k408_76832_c1_1344_1808 | 152 |
| 585 | 3300050507 | nmdc:mga05p37_792441_c1 | nmdc:mga05p37_792441_c1_82_555 | 152 |
| 586 | 3300050509 | nmdc:mga0qj67_501783_c1 | nmdc:mga0qj67_501783_c1_479_952 | 152 |
| 587 | 3300050513 | nmdc:mga0rr50_150110_c1 | nmdc:mga0rr50_150110_c1_996_1463 | 152 |
| 588 | 3300050513 | nmdc:mga0rr50_168753_c1 | nmdc:mga0rr50_168753_c1_961_1434 | 152 |
| 589 | 3300050515 | nmdc:mga0a205_645359_c1 | nmdc:mga0a205_645359_c1_45_512 | 152 |
| 590 | 3300050516 | nmdc:mga0sz30_65059_c1 | nmdc:mga0sz30_65059_c1_687_1175 | 152 |
| 591 | 3300053087 | Ga0500643_017572 | Ga0500643_017572_1827_2315 | 152 |
| 592 | 3300053088 | Ga0500644_0000241 | Ga0500644_0000241_1897_2385 | 152 |
| 593 | 3300053102 | Ga0500554_001170 | Ga0500554_001170_3466_3930 | 152 |
| 594 | 3300053125 | Ga0500618_006400 | Ga0500618_006400_1411_1878 | 152 |
| 595 | 3300053136 | Ga0500559_0000015 | Ga0500559_0000015_10863_11327 | 152 |
| 596 | 3300053138 | Ga0500564_000200 | Ga0500564_000200_11444_11932 | 152 |
| 597 | 3300053142 | Ga0500577_0010853 | Ga0500577_0010853_654_1142 | 152 |
| 598 | 3300053146 | Ga0500588_0150619 | Ga0500588_0150619_84_554 | 152 |
| 599 | 3300053151 | Ga0500604_0008017 | Ga0500604_0008017_2064_2540 | 152 |
| 600 | 3300053153 | Ga0500616_0013843 | Ga0500616_0013843_2180_2644 | 152 |
| 601 | 3300053158 | Ga0500627_0041165 | Ga0500627_0041165_1390_1854 | 152 |
| 602 | 3300001979 | JGI24740J21852_10082966 | JGI24740J21852_100829661 | 153 |
| 603 | 3300001989 | JGI24739J22299_10027145 | JGI24739J22299_100271451 | 153 |
| 604 | 3300002067 | JGI24735J21928_10072852 | JGI24735J21928_100728521 | 153 |
| 605 | 3300002705 | JGI25156J39149_1001597 | JGI25156J39149_10015972 | 153 |
| 606 | 3300002705 | JGI25156J39149_1016641 | JGI25156J39149_10166412 | 153 |
| 607 | 3300002737 | JGI25162J39368_1006156 | JGI25162J39368_10061561 | 153 |
| 608 | 3300002741 | JGI25157J39369_1001161 | JGI25157J39369_10011614 | 153 |
| 609 | 3300002741 | JGI25157J39369_1001478 | JGI25157J39369_10014786 | 153 |
| 610 | 3300002772 | JGI25164J39214_1000198 | JGI25164J39214_100019839 | 153 |
| 611 | 3300003214 | JGI25165J46597_1000354 | JGI25165J46597_100035439 | 153 |
| 612 | 3300003316 | rootH1_10024611 | rootH1_100246112 | 153 |
| 613 | 3300003752 | Ga0055539_1001188 | Ga0055539_10011882 | 153 |
| 614 | 3300003756 | Ga0055533_1014903 | Ga0055533_10149031 | 153 |
| 615 | 3300003758 | Ga0055532_1000185 | Ga0055532_100018521 | 153 |
| 616 | 3300003758 | Ga0055532_1000217 | Ga0055532_100021725 | 153 |
| 617 | 3300003759 | Ga0055525_1000059 | Ga0055525_100005966 | 153 |
| 618 | 3300003760 | Ga0055527_1000050 | Ga0055527_100005066 | 153 |
| 619 | 3300003760 | Ga0055527_1000128 | Ga0055527_100012817 | 153 |
| 620 | 3300003760 | Ga0055527_1001996 | Ga0055527_10019962 | 153 |
| 621 | 3300003760 | Ga0055527_1006915 | Ga0055527_10069152 | 153 |
| 622 | 3300003761 | Ga0055535_1000119 | Ga0055535_100011948 | 153 |
| 623 | 3300003761 | Ga0055535_1000206 | Ga0055535_10002062 | 153 |
| 624 | 3300003761 | Ga0055535_1000212 | Ga0055535_100021234 | 153 |
| 625 | 3300003761 | Ga0055535_1000287 | Ga0055535_100028731 | 153 |
| 626 | 3300003761 | Ga0055535_1000295 | Ga0055535_100029536 | 153 |
| 627 | 3300003762 | Ga0055542_1000057 | Ga0055542_100005757 | 153 |
| 628 | 3300003762 | Ga0055542_1000119 | Ga0055542_100011966 | 153 |
| 629 | 3300003762 | Ga0055542_1000238 | Ga0055542_100023826 | 153 |
| 630 | 3300003762 | Ga0055542_1000311 | Ga0055542_100031131 | 153 |
| 631 | 3300003762 | Ga0055542_1000966 | Ga0055542_10009663 | 153 |
| 632 | 3300003763 | Ga0055529_1000049 | Ga0055529_100004965 | 153 |
| 633 | 3300003763 | Ga0055529_1000270 | Ga0055529_100027025 | 153 |
| 634 | 3300003763 | Ga0055529_1000329 | Ga0055529_100032917 | 153 |
| 635 | 3300003763 | Ga0055529_1000884 | Ga0055529_10008847 | 153 |
| 636 | 3300003790 | Ga0055528_1000986 | Ga0055528_10009868 | 153 |
| 637 | 3300003841 | Ga0055541_1015339 | Ga0055541_10153392 | 153 |
| 638 | 3300005295 | Ga0065707_10020820 | Ga0065707_100208202 | 153 |
| 639 | 3300005327 | Ga0070658_10019732 | Ga0070658_100197322 | 153 |
| 640 | 3300005328 | Ga0070676_10460293 | Ga0070676_104602932 | 153 |
| 641 | 3300005339 | Ga0070660_100000004 | Ga0070660_100000004107 | 153 |
| 642 | 3300005356 | Ga0070674_100058186 | Ga0070674_1000581862 | 153 |
| 643 | 3300005366 | Ga0070659_100000023 | Ga0070659_10000002390 | 153 |
| 644 | 3300005455 | Ga0070663_100003816 | Ga0070663_1000038163 | 153 |
| 645 | 3300005563 | Ga0068855_100008161 | Ga0068855_1000081612 | 153 |
| 646 | 3300005564 | Ga0070664_100140946 | Ga0070664_1001409461 | 153 |
| 647 | 3300005614 | Ga0068856_100000455 | Ga0068856_10000045530 | 153 |
| 648 | 3300005616 | Ga0068852_100015181 | Ga0068852_1000151812 | 153 |
| 649 | 3300005719 | Ga0068861_100067402 | Ga0068861_1000674022 | 153 |
| 650 | 3300005842 | Ga0068858_100306012 | Ga0068858_1003060122 | 153 |
| 651 | 3300005844 | Ga0068862_100027705 | Ga0068862_1000277053 | 153 |
| 652 | 3300005981 | Ga0081538_10010333 | Ga0081538_100103332 | 153 |
| 653 | 3300006846 | Ga0075430_100382421 | Ga0075430_1003824212 | 153 |
| 654 | 3300009092 | Ga0105250_10019883 | Ga0105250_100198833 | 153 |
| 655 | 3300009093 | Ga0105240_10001353 | Ga0105240_1000135319 | 153 |
| 656 | 3300009093 | Ga0105240_10132247 | Ga0105240_101322472 | 153 |
| 657 | 3300009093 | Ga0105240_10335475 | Ga0105240_103354751 | 153 |
| 658 | 3300009094 | Ga0111539_10305921 | Ga0111539_103059212 | 153 |
| 659 | 3300009098 | Ga0105245_10041617 | Ga0105245_100416172 | 153 |
| 660 | 3300009147 | Ga0114129_10772223 | Ga0114129_107722232 | 153 |
| 661 | 3300009148 | Ga0105243_10291796 | Ga0105243_102917962 | 153 |
| 662 | 3300009177 | Ga0105248_11411424 | Ga0105248_114114242 | 153 |
| 663 | 3300009545 | Ga0105237_10004165 | Ga0105237_100041652 | 153 |
| 664 | 3300009551 | Ga0105238_10008672 | Ga0105238_100086724 | 153 |
| 665 | 3300009551 | Ga0105238_10021470 | Ga0105238_100214709 | 153 |
| 666 | 3300009988 | Ga0105035_107571 | Ga0105035_1075711 | 153 |
| 667 | 3300010375 | Ga0105239_10005104 | Ga0105239_1000510410 | 153 |
| 668 | 3300013104 | Ga0157370_10276222 | Ga0157370_102762222 | 153 |
| 669 | 3300013105 | Ga0157369_10504677 | Ga0157369_105046772 | 153 |
| 670 | 3300013875 | Ga0157515_126273 | Ga0157515_1262732 | 153 |
| 671 | 3300014326 | Ga0157380_10240941 | Ga0157380_102409412 | 153 |
| 672 | 3300014326 | Ga0157380_10603157 | Ga0157380_106031571 | 153 |
| 673 | 3300015261 | Ga0182006_1014936 | Ga0182006_10149363 | 153 |
| 674 | 3300015261 | Ga0182006_1021466 | Ga0182006_10214662 | 153 |
| 675 | 3300015262 | Ga0182007_10000106 | Ga0182007_1000010626 | 153 |
| 676 | 3300025225 | Ga0209566_100408 | Ga0209566_10040821 | 153 |
| 677 | 3300025226 | Ga0209674_100026 | Ga0209674_100026156 | 153 |
| 678 | 3300025226 | Ga0209674_101565 | Ga0209674_1015653 | 153 |
| 679 | 3300025226 | Ga0209674_102480 | Ga0209674_1024805 | 153 |
| 680 | 3300025228 | Ga0209672_100007 | Ga0209672_100007754 | 153 |
| 681 | 3300025228 | Ga0209672_100017 | Ga0209672_100017296 | 153 |
| 682 | 3300025228 | Ga0209672_100065 | Ga0209672_100065147 | 153 |
| 683 | 3300025228 | Ga0209672_100173 | Ga0209672_10017311 | 153 |
| 684 | 3300025228 | Ga0209672_100857 | Ga0209672_1008572 | 153 |
| 685 | 3300025229 | Ga0209147_100044 | Ga0209147_10004468 | 153 |
| 686 | 3300025229 | Ga0209147_100124 | Ga0209147_10012486 | 153 |
| 687 | 3300025230 | Ga0209563_100074 | Ga0209563_100074107 | 153 |
| 688 | 3300025231 | Ga0207427_100213 | Ga0207427_10021310 | 153 |
| 689 | 3300025233 | Ga0209437_100381 | Ga0209437_10038139 | 153 |
| 690 | 3300025242 | Ga0209258_100017 | Ga0209258_10001766 | 153 |
| 691 | 3300025242 | Ga0209258_100031 | Ga0209258_100031147 | 153 |
| 692 | 3300025242 | Ga0209258_100038 | Ga0209258_10003816 | 153 |
| 693 | 3300025242 | Ga0209258_100118 | Ga0209258_10011846 | 153 |
| 694 | 3300025242 | Ga0209258_100144 | Ga0209258_10014481 | 153 |
| 695 | 3300025246 | Ga0209646_1000824 | Ga0209646_10008246 | 153 |
| 696 | 3300025250 | Ga0209026_1000044 | Ga0209026_1000044135 | 153 |
| 697 | 3300025250 | Ga0209026_1000431 | Ga0209026_100043128 | 153 |
| 698 | 3300025253 | Ga0209677_107487 | Ga0209677_1074874 | 153 |
| 699 | 3300025254 | Ga0209148_1000009 | Ga0209148_1000009916 | 153 |
| 700 | 3300025254 | Ga0209148_1000024 | Ga0209148_1000024331 | 153 |
| 701 | 3300025254 | Ga0209148_1000027 | Ga0209148_1000027147 | 153 |
| 702 | 3300025254 | Ga0209148_1000044 | Ga0209148_100004466 | 153 |
| 703 | 3300025254 | Ga0209148_1000141 | Ga0209148_100014156 | 153 |
| 704 | 3300025256 | Ga0209759_1000517 | Ga0209759_10005176 | 153 |
| 705 | 3300025256 | Ga0209759_1000779 | Ga0209759_10007792 | 153 |
| 706 | 3300025261 | Ga0209233_1000323 | Ga0209233_100032310 | 153 |
| 707 | 3300025272 | Ga0209455_1000010 | Ga0209455_1000010754 | 153 |
| 708 | 3300025272 | Ga0209455_1000025 | Ga0209455_1000025331 | 153 |
| 709 | 3300025272 | Ga0209455_1000032 | Ga0209455_1000032296 | 153 |
| 710 | 3300025272 | Ga0209455_1000058 | Ga0209455_1000058105 | 153 |
| 711 | 3300025272 | Ga0209455_1001839 | Ga0209455_10018396 | 153 |
| 712 | 3300025273 | Ga0209673_1000059 | Ga0209673_100005965 | 153 |
| 713 | 3300025711 | Ga0207696_1074758 | Ga0207696_10747581 | 153 |
| 714 | 3300025904 | Ga0207647_10004854 | Ga0207647_100048544 | 153 |
| 715 | 3300025909 | Ga0207705_10112777 | Ga0207705_101127772 | 153 |
| 716 | 3300025913 | Ga0207695_10000203 | Ga0207695_1000020344 | 153 |
| 717 | 3300025913 | Ga0207695_10000273 | Ga0207695_1000027359 | 153 |
| 718 | 3300025913 | Ga0207695_10597292 | Ga0207695_105972922 | 153 |
| 719 | 3300025913 | Ga0207695_10780400 | Ga0207695_107804001 | 153 |
| 720 | 3300025914 | Ga0207671_10313390 | Ga0207671_103133902 | 153 |
| 721 | 3300025919 | Ga0207657_10000001 | Ga0207657_1000000151 | 153 |
| 722 | 3300025920 | Ga0207649_10388800 | Ga0207649_103888001 | 153 |
| 723 | 3300025923 | Ga0207681_10010470 | Ga0207681_100104703 | 153 |
| 724 | 3300025924 | Ga0207694_10050890 | Ga0207694_100508902 | 153 |
| 725 | 3300025924 | Ga0207694_10499828 | Ga0207694_104998281 | 153 |
| 726 | 3300025932 | Ga0207690_10000029 | Ga0207690_1000002994 | 153 |
| 727 | 3300025937 | Ga0207669_10070655 | Ga0207669_100706552 | 153 |
| 728 | 3300025945 | Ga0207679_10549384 | Ga0207679_105493841 | 153 |
| 729 | 3300025949 | Ga0207667_10003915 | Ga0207667_100039153 | 153 |
| 730 | 3300025961 | Ga0207712_10202145 | Ga0207712_102021452 | 153 |
| 731 | 3300026035 | Ga0207703_10442763 | Ga0207703_104427632 | 153 |
| 732 | 3300026067 | Ga0207678_10000227 | Ga0207678_100002274 | 153 |
| 733 | 3300026075 | Ga0207708_10763063 | Ga0207708_107630631 | 153 |
| 734 | 3300026078 | Ga0207702_10002529 | Ga0207702_100025298 | 153 |
| 735 | 3300026118 | Ga0207675_100085125 | Ga0207675_1000851252 | 153 |
| 736 | 3300026142 | Ga0207698_10024704 | Ga0207698_100247042 | 153 |
| 737 | 3300027312 | Ga0209371_1000129 | Ga0209371_100012959 | 153 |
| 738 | 3300028380 | Ga0268265_10308291 | Ga0268265_103082912 | 153 |
| 739 | 3300030500 | Ga0268256_1000133 | Ga0268256_100013348 | 153 |
| 740 | 3300037312 | Ga0395899_0000062 | Ga0395899_0000062_194715_195176 | 153 |
| 741 | 3300037312 | Ga0395899_0000167 | Ga0395899_0000167_40959_41456 | 153 |
| 742 | 3300037312 | Ga0395899_0051027 | Ga0395899_0051027_576_1037 | 153 |
| 743 | 3300037418 | Ga0395900_0000009 | Ga0395900_0000009_364922_365419 | 153 |
| 744 | 3300037418 | Ga0395900_0000039 | Ga0395900_0000039_95784_96245 | 153 |
| 745 | 3300037466 | Ga0395898_0000069 | Ga0395898_0000069_91201_91662 | 153 |
| 746 | 3300037466 | Ga0395898_0000140 | Ga0395898_0000140_16170_16631 | 153 |
| 747 | 3300037466 | Ga0395898_0259449 | Ga0395898_0259449_830_1327 | 153 |
| 748 | 3300037471 | Ga0395905_0019189 | Ga0395905_0019189_80_577 | 153 |
| 749 | 3300038443 | Ga0395901_0000014 | Ga0395901_0000014_316128_316625 | 153 |
| 750 | 3300038443 | Ga0395901_1521625 | Ga0395901_1521625_86_547 | 153 |
| 751 | 3300039437 | Ga0436365_1737587 | Ga0436365_1737587_751_1212 | 153 |
| 752 | 3300042006 | Ga0439432_063004 | Ga0439432_063004_563_1030 | 153 |
| 753 | 3300042876 | Ga0451577_0070218 | Ga0451577_0070218_1010_1486 | 153 |
| 754 | 3300044656 | Ga0466969_0013964 | Ga0466969_0013964_2489_2950 | 153 |
| 755 | 3300044683 | Ga0466965_0325808 | Ga0466965_0325808_220_681 | 153 |
| 756 | 3300044684 | Ga0466966_0021400 | Ga0466966_0021400_1510_1971 | 153 |
| 757 | 3300044693 | Ga0466961_0019310 | Ga0466961_0019310_3894_4355 | 153 |
| 758 | 3300044693 | Ga0466961_0035203 | Ga0466961_0035203_271_732 | 153 |
| 759 | 3300044693 | Ga0466961_0072126 | Ga0466961_0072126_1050_1511 | 153 |
| 760 | 3300044693 | Ga0466961_0128385 | Ga0466961_0128385_976_1437 | 153 |
| 761 | 3300044694 | Ga0466963_0232258 | Ga0466963_0232258_666_1127 | 153 |
| 762 | 3300044719 | Ga0466971_0002070 | Ga0466971_0002070_2836_3297 | 153 |
| 763 | 3300044765 | Ga0466970_0000163 | Ga0466970_0000163_19917_20378 | 153 |
| 764 | 3300044765 | Ga0466970_0279741 | Ga0466970_0279741_309_770 | 153 |
| 765 | 3300044842 | Ga0466957_0002878 | Ga0466957_0002878_3186_3647 | 153 |
| 766 | 3300045049 | Ga0466959_0000383 | Ga0466959_0000383_1047_1508 | 153 |
| 767 | 3300045049 | Ga0466959_0068211 | Ga0466959_0068211_1298_1759 | 153 |
| 768 | 3300045049 | Ga0466959_0169300 | Ga0466959_0169300_291_752 | 153 |
| 769 | 3300045049 | Ga0466959_0486696 | Ga0466959_0486696_18_479 | 153 |
| 770 | 3300045836 | Ga0466958_0145503 | Ga0466958_0145503_782_1243 | 153 |
| 771 | 3300046453 | Ga0495627_000483 | Ga0495627_000483_15446_15949 | 153 |
| 772 | 3300046691 | Ga0495670_0647241 | Ga0495670_0647241_89_556 | 153 |
| 773 | 3300047469 | Ga0495673_0000377 | Ga0495673_0000377_3429_3932 | 153 |
| 774 | 3300048919 | Ga0496116_0010230 | Ga0496116_0010230_3502_3978 | 153 |
| 775 | 3300048920 | Ga0496117_0485986 | Ga0496117_0485986_10_486 | 153 |
| 776 | 3300048921 | Ga0496118_0042016 | Ga0496118_0042016_2737_3198 | 153 |
| 777 | 3300048928 | Ga0496125_0249106 | Ga0496125_0249106_392_856 | 153 |
| 778 | 3300048929 | Ga0496126_0076035 | Ga0496126_0076035_1858_2334 | 153 |
| 779 | 3300049824 | Ga0501045_0733848 | Ga0501045_0733848_88_549 | 153 |
| 780 | 3300050507 | nmdc:mga05p37_116569_c1 | nmdc:mga05p37_116569_c1_2162_2629 | 153 |
| 781 | 3300050509 | nmdc:mga0qj67_218183_c1 | nmdc:mga0qj67_218183_c1_812_1279 | 153 |
| 782 | 3300054114 | Ga0501084_0470074 | Ga0501084_0470074_154_630 | 153 |
| 783 | 3300061719 | Ga0466962_0001068 | Ga0466962_0001068_4789_5250 | 153 |
| 784 | 3300061734 | Ga0530510_0357863 | Ga0530510_0357863_468_929 | 153 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gy3-assembly1.cif.gz_B | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.9816 | 2 | 150 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9617 | 2 | 150 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9611 | 2 | 149 |
| 1n5w-assembly1.cif.gz_D | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.9555 | 2 | 149 |
| 8gy3-assembly1.cif.gz_B | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.9502 | 2 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9783 | 2 | 74 | 3.10.20.30 |
| af_Q46801_1_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9741 | 2 | 72 | 3.10.20.30 |
| 1sb3F01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9643 | 2 | 74 | 3.10.20.30 |
| 1sb3C02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9626 | 82 | 150 | 1.10.150.120 |
| 1n5wA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9556 | 2 | 74 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5QJI1-F1-model_v4 | (2Fe-2S)-binding protein | 0.9924 | 2 | 150 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A7V9BKS3-F1-model_v4 | (2Fe-2S)-binding protein | 0.992 | 2 | 150 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A191ZHF8-F1-model_v4 | (2Fe-2S)-binding protein | 0.9916 | 2 | 148 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A1X9X044-F1-model_v4 | MmAcDH small subunit | 0.9914 | 1 | 133 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A349TGJ4-F1-model_v4 | (2Fe-2S)-binding protein | 0.9913 | 2 | 140 |
GO:0016491
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar