F480696

General Info

Members Datasets Scaffolds Average Seq Length
784 384 783 154

Family's Representative Sequence

Representative Sequence 3300025949|Ga0207667_10626150|Ga0207667_106261502
Length 188
Sequence MVRYLLVGSLIPPGVRAATADGSGILPKLCLCPGPPMIQLTINGKARRFDGDPEMPLLWFLRDELQLTGTKFGCGMGLCGACTVHVNGEAARSCLTPMSAAAGKTVTTIEGLSATGSHPLQKAWEEANVPQCGYCQSGQIMQAAAMLKAKPHPTDQDIDSAMSGNICRCGTYQRIRQAIRMAANGGKA

Samples

Sample ID Description Type Environment
1 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
116 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
129 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
146 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
151 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
152 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
153 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
154 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
155 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
156 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
157 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
166 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
167 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
170 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
171 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
223 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
224 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
225 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
228 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
229 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
230 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
231 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
232 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
234 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
235 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
236 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
250 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
251 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
252 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
253 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
254 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
255 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
256 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
257 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
258 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
259 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
260 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
261 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
262 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
263 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
264 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
265 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
266 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
267 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
268 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
269 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
276 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
277 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
278 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
279 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
280 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
281 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
284 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
287 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
288 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
291 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
292 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
293 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
294 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
295 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
321 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
322 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
323 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
324 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
325 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
326 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
337 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
338 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
339 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
340 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
341 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
342 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
343 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
344 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
345 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
346 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
347 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
348 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
350 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
354 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
357 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
358 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
359 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
360 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
361 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
362 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
363 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
364 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
365 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
366 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
367 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
368 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
369 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
370 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
371 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
372 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
373 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
374 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
375 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
376 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
377 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
378 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
379 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
380 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
384 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 1.15
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.27
Nodule 0
Rhizoplane 2.42
Rhizosphere 75.26
Stem 0
Stem Tuber 0
Unclassified 9.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10082966 3300001979 Bacteria 837
2 JGI24739J22299_10027145 3300001989 Bacteria 2004
3 JGI24735J21928_10072852 3300002067 Bacteria 984
4 JGI25156J39149_1001597 3300002705 Bacteria 9270
5 JGI25156J39149_1016641 3300002705 Bacteria 1422
6 JGI25162J39368_1006156 3300002737 Bacteria 2141
7 JGI25157J39369_1001161 3300002741 Bacteria 11328
8 JGI25157J39369_1001478 3300002741 Bacteria 8667
9 JGI25164J39214_1000198 3300002772 Bacteria 51603
10 JGI25406J46586_10032341 3300003203 Bacteria 1945
11 JGI25165J46597_1000354 3300003214 Bacteria 51605
12 rootH1_10024611 3300003316 Bacteria 4634
13 rootH2_10304912 3300003320 Bacteria 1231
14 Ga0007416J51690_1114583 3300003577 Bacteria 626
15 Ga0007429J51699_1092521 3300003579 Bacteria 932
16 Ga0055539_1001188 3300003752 Bacteria 5293
17 Ga0055533_1014903 3300003756 Bacteria 773
18 Ga0055532_1000185 3300003758 Bacteria 52548
19 Ga0055532_1000217 3300003758 Bacteria 44081
20 Ga0055525_1000059 3300003759 Bacteria 202797
21 Ga0055527_1000050 3300003760 Bacteria 104542
22 Ga0055527_1000128 3300003760 Bacteria 53342
23 Ga0055527_1001996 3300003760 Bacteria 3719
24 Ga0055527_1006915 3300003760 Bacteria 1406
25 Ga0055535_1000119 3300003761 Bacteria 84990
26 Ga0055535_1000206 3300003761 Bacteria 62330
27 Ga0055535_1000212 3300003761 Bacteria 61691
28 Ga0055535_1000287 3300003761 Bacteria 53346
29 Ga0055535_1000295 3300003761 Bacteria 51620
30 Ga0055542_1000057 3300003762 Bacteria 162955
31 Ga0055542_1000119 3300003762 Bacteria 104542
32 Ga0055542_1000238 3300003762 Bacteria 63399
33 Ga0055542_1000311 3300003762 Bacteria 53346
34 Ga0055542_1000966 3300003762 Bacteria 18722
35 Ga0055529_1000049 3300003763 Bacteria 208413
36 Ga0055529_1000270 3300003763 Bacteria 61712
37 Ga0055529_1000329 3300003763 Bacteria 53347
38 Ga0055529_1000884 3300003763 Bacteria 16980
39 Ga0055526_1017989 3300003771 Bacteria 2665
40 Ga0055528_1000986 3300003790 Bacteria 18895
41 Ga0055540_1007096 3300003792 Bacteria 4300
42 Ga0055531_10015237 3300003794 Bacteria 3405
43 Ga0055541_1015339 3300003841 Bacteria 1022
44 JGI25405J52794_10117483 3300003911 Bacteria 598
45 Ga0055543_1025049 3300004625 Bacteria 1067
46 Ga0058862_12866476 3300004803 Bacteria 597
47 Ga0065165_1000490 3300005262 Bacteria 61094
48 Ga0065704_10379807 3300005289 Bacteria 775
49 Ga0065712_10025321 3300005290 Bacteria 1399
50 Ga0065715_10016620 3300005293 Bacteria 2090
51 Ga0065707_10020820 3300005295 Bacteria 1694
52 Ga0070658_10013460 3300005327 Bacteria 6565
53 Ga0070658_10019732 3300005327 Bacteria 5397
54 Ga0070676_10460293 3300005328 Bacteria 896
55 Ga0070690_100826417 3300005330 Bacteria 720
56 Ga0070670_101042285 3300005331 Bacteria 745
57 Ga0068869_100621768 3300005334 Bacteria 914
58 Ga0070666_11014417 3300005335 Bacteria 616
59 Ga0070680_100003733 3300005336 Bacteria 11378
60 Ga0070680_100092078 3300005336 Bacteria 2510
61 Ga0070680_100646880 3300005336 Bacteria 909
62 Ga0070680_101034608 3300005336 Bacteria 709
63 Ga0070682_101551439 3300005337 Bacteria 571
64 Ga0068868_101255339 3300005338 Bacteria 687
65 Ga0070660_100000004 3300005339 Bacteria 171018
66 Ga0070660_100237424 3300005339 Bacteria 1484
67 Ga0070689_101386646 3300005340 Bacteria 635
68 Ga0070675_100985211 3300005354 Bacteria 774
69 Ga0070675_101303418 3300005354 Unclassified 669
70 Ga0070674_100058186 3300005356 Bacteria 2686
71 Ga0070674_100438288 3300005356 Bacteria 1076
72 Ga0070673_100065377 3300005364 Bacteria 2901
73 Ga0070673_100889690 3300005364 Bacteria 825
74 Ga0070688_100176706 3300005365 Bacteria 1478
75 Ga0070688_100803867 3300005365 Bacteria 736
76 Ga0070659_100000023 3300005366 Bacteria 150907
77 Ga0070659_100282912 3300005366 Bacteria 1380
78 Ga0070709_10026841 3300005434 Bacteria 3417
79 Ga0070714_100176322 3300005435 Bacteria 1942
80 Ga0070714_100298913 3300005435 Bacteria 1500
81 Ga0070714_100779577 3300005435 Bacteria 925
82 Ga0070713_101691405 3300005436 Bacteria 614
83 Ga0070713_101977762 3300005436 Bacteria 565
84 Ga0070710_10052966 3300005437 Bacteria 2284
85 Ga0070710_10109467 3300005437 Bacteria 1657
86 Ga0070710_10390861 3300005437 Bacteria 930
87 Ga0070711_100019243 3300005439 Bacteria 4378
88 Ga0070711_100137094 3300005439 Bacteria 1830
89 Ga0070711_100187298 3300005439 Bacteria 1588
90 Ga0070705_100656145 3300005440 Bacteria 819
91 Ga0070694_100003493 3300005444 Bacteria 9404
92 Ga0070694_101397333 3300005444 Bacteria 590
93 Ga0070708_100101800 3300005445 Bacteria 2631
94 Ga0070708_100165342 3300005445 Bacteria 2064
95 Ga0070663_100003816 3300005455 Bacteria 8772
96 Ga0070678_100258533 3300005456 Bacteria 1463
97 Ga0070678_100418023 3300005456 Bacteria 1168
98 Ga0070662_100139989 3300005457 Bacteria 1874
99 Ga0070662_101229062 3300005457 Bacteria 644
100 Ga0070681_10280278 3300005458 Bacteria 1577
101 Ga0070681_10747956 3300005458 Bacteria 894
102 Ga0070681_11367505 3300005458 Bacteria 631
103 Ga0068867_100221425 3300005459 Bacteria 1525
104 Ga0070685_11189472 3300005466 Bacteria 579
105 Ga0070706_100293128 3300005467 Bacteria 1518
106 Ga0070706_100368912 3300005467 Bacteria 1337
107 Ga0070706_100720437 3300005467 Bacteria 925
108 Ga0070707_100039683 3300005468 Bacteria 4501
109 Ga0070707_100860618 3300005468 Bacteria 871
110 Ga0070698_100000373 3300005471 Bacteria 46692
111 Ga0070698_100095616 3300005471 Bacteria 2948
112 Ga0070699_100058652 3300005518 Bacteria 3335
113 Ga0070699_100100014 3300005518 Bacteria 2541
114 Ga0070699_100279308 3300005518 Bacteria 1496
115 Ga0070699_101285789 3300005518 Bacteria 671
116 Ga0070679_100180423 3300005530 Bacteria 2084
117 Ga0070679_100576487 3300005530 Bacteria 1069
118 Ga0070679_100791708 3300005530 Bacteria 891
119 Ga0070684_100138170 3300005535 Bacteria 2202
120 Ga0070697_100030107 3300005536 Bacteria 4358
121 Ga0068853_100312418 3300005539 Bacteria 1455
122 Ga0068853_101553536 3300005539 Bacteria 641
123 Ga0070672_100330382 3300005543 Bacteria 1297
124 Ga0070672_101570790 3300005543 Bacteria 590
125 Ga0070695_100257127 3300005545 Bacteria 1274
126 Ga0070696_100115548 3300005546 Bacteria 1937
127 Ga0070665_100031017 3300005548 Bacteria 5380
128 Ga0070665_100034634 3300005548 Bacteria 5078
129 Ga0070665_100102956 3300005548 Bacteria 2859
130 Ga0070665_100205709 3300005548 Bacteria 1969
131 Ga0070665_100861402 3300005548 Bacteria 919
132 Ga0070704_100573890 3300005549 Bacteria 988
133 Ga0070704_100712086 3300005549 Bacteria 891
134 Ga0068855_100008161 3300005563 Bacteria 12658
135 Ga0068855_100018483 3300005563 Bacteria 8378
136 Ga0068855_100021333 3300005563 Bacteria 7767
137 Ga0068855_100078722 3300005563 Bacteria 3824
138 Ga0068855_100558349 3300005563 Bacteria 1239
139 Ga0068855_100881104 3300005563 Bacteria 947
140 Ga0070664_100092553 3300005564 Bacteria 2618
141 Ga0070664_100140946 3300005564 Bacteria 2123
142 Ga0068854_101301605 3300005578 Bacteria 654
143 Ga0068854_101588320 3300005578 Bacteria 596
144 Ga0068856_100000455 3300005614 Bacteria 45174
145 Ga0068856_100039844 3300005614 Bacteria 4613
146 Ga0068856_100111296 3300005614 Bacteria 2736
147 Ga0068856_100164962 3300005614 Bacteria 2226
148 Ga0068856_100326776 3300005614 Bacteria 1551
149 Ga0068856_100447973 3300005614 Bacteria 1312
150 Ga0068856_100638230 3300005614 Bacteria 1086
151 Ga0068856_101137822 3300005614 Bacteria 798
152 Ga0070702_101267641 3300005615 Bacteria 597
153 Ga0068852_100015181 3300005616 Bacteria 5961
154 Ga0068852_100544718 3300005616 Bacteria 1160
155 Ga0068852_101517615 3300005616 Unclassified 692
156 Ga0068859_100277630 3300005617 Bacteria 1768
157 Ga0068864_100527368 3300005618 Bacteria 1139
158 Ga0068864_100893620 3300005618 Bacteria 877
159 Ga0068864_101246982 3300005618 Bacteria 743
160 Ga0068864_101394447 3300005618 Bacteria 702
161 Ga0068866_10732638 3300005718 Bacteria 681
162 Ga0068861_100067402 3300005719 Bacteria 2762
163 Ga0068861_100335650 3300005719 Bacteria 1321
164 Ga0068863_100389331 3300005841 Bacteria 1362
165 Ga0068858_100280984 3300005842 Bacteria 1585
166 Ga0068858_100306012 3300005842 Bacteria 1517
167 Ga0068858_100807547 3300005842 Bacteria 915
168 Ga0068858_101053404 3300005842 Bacteria 798
169 Ga0068862_100027705 3300005844 Bacteria 4770
170 Ga0081455_10078082 3300005937 Bacteria 2721
171 Ga0081455_10090188 3300005937 Bacteria 2486
172 Ga0081455_10183189 3300005937 Bacteria 1584
173 Ga0081538_10010333 3300005981 Bacteria 7658
174 Ga0081540_1104017 3300005983 Bacteria 1216
175 Ga0081540_1219320 3300005983 Bacteria 678
176 Ga0081539_10016966 3300005985 Bacteria 5157
177 Ga0070717_10028502 3300006028 Bacteria 4471
178 Ga0070717_10033606 3300006028 Bacteria 4138
179 Ga0070717_10048549 3300006028 Bacteria 3482
180 Ga0070717_10158061 3300006028 Bacteria 1965
181 Ga0070717_11529869 3300006028 Bacteria 605
182 Ga0075368_10284662 3300006042 Bacteria 711
183 Ga0075364_10263931 3300006051 Bacteria 1171
184 Ga0075364_10452104 3300006051 Bacteria 877
185 Ga0070715_10005486 3300006163 Bacteria 4234
186 Ga0070716_100221099 3300006173 Bacteria 1272
187 Ga0070712_100207703 3300006175 Bacteria 1542
188 Ga0070712_100237032 3300006175 Bacteria 1452
189 Ga0070712_100371547 3300006175 Bacteria 1175
190 Ga0070712_100688436 3300006175 Bacteria 871
191 Ga0075367_10140420 3300006178 Bacteria 1496
192 Ga0075367_10319264 3300006178 Bacteria 979
193 Ga0075369_10008829 3300006186 Bacteria 3893
194 Ga0075366_10079958 3300006195 Bacteria 1952
195 Ga0097621_100378603 3300006237 Bacteria 1264
196 Ga0075428_100129484 3300006844 Bacteria 2746
197 Ga0075428_100213687 3300006844 Bacteria 2084
198 Ga0075428_101365436 3300006844 Bacteria 744
199 Ga0075430_100017099 3300006846 Bacteria 6178
200 Ga0075430_100208253 3300006846 Bacteria 1623
201 Ga0075430_100365188 3300006846 Bacteria 1192
202 Ga0075430_100382421 3300006846 Bacteria 1162
203 Ga0075431_100049994 3300006847 Bacteria 4311
204 Ga0075431_101303471 3300006847 Bacteria 687
205 Ga0075433_10739008 3300006852 Bacteria 861
206 Ga0075434_100074195 3300006871 Bacteria 3395
207 Ga0075434_101430195 3300006871 Bacteria 701
208 Ga0075429_100065686 3300006880 Bacteria 3159
209 Ga0075429_100289861 3300006880 Unclassified 1433
210 Ga0075436_100177970 3300006914 Bacteria 1503
211 Ga0097620_100277631 3300006931 Bacteria 1768
212 Ga0075435_100117975 3300007076 Bacteria 2212
213 Ga0099795_10002609 3300007788 Bacteria 4283
214 Ga0099795_10030126 3300007788 Bacteria 1860
215 Ga0099795_10172256 3300007788 Bacteria 900
216 Ga0105250_10019883 3300009092 Bacteria 2715
217 Ga0105240_10000337 3300009093 Bacteria 87719
218 Ga0105240_10001353 3300009093 Bacteria 42046
219 Ga0105240_10006874 3300009093 Bacteria 16625
220 Ga0105240_10095466 3300009093 Bacteria 3625
221 Ga0105240_10132247 3300009093 Bacteria 2992
222 Ga0105240_10296296 3300009093 Bacteria 1852
223 Ga0105240_10335475 3300009093 Bacteria 1719
224 Ga0105240_12115071 3300009093 Bacteria 584
225 Ga0111539_10305921 3300009094 Bacteria 1850
226 Ga0111539_10617194 3300009094 Bacteria 1263
227 Ga0105245_10041617 3300009098 Bacteria 4096
228 Ga0105245_10529817 3300009098 Bacteria 1198
229 Ga0105245_10548624 3300009098 Bacteria 1178
230 Ga0105245_10953931 3300009098 Bacteria 901
231 Ga0114129_10202084 3300009147 Bacteria 2691
232 Ga0114129_10257209 3300009147 Bacteria 2342
233 Ga0114129_10283516 3300009147 Bacteria 2213
234 Ga0114129_10772223 3300009147 Bacteria 1228
235 Ga0114129_11024268 3300009147 Bacteria 1038
236 Ga0114129_11050039 3300009147 Bacteria 1023
237 Ga0114129_12410464 3300009147 Bacteria 630
238 Ga0105243_10291796 3300009148 Unclassified 1474
239 Ga0105241_10877466 3300009174 Bacteria 831
240 Ga0105241_11182011 3300009174 Bacteria 724
241 Ga0105242_10159121 3300009176 Bacteria 1975
242 Ga0105242_10279618 3300009176 Bacteria 1515
243 Ga0105242_10453292 3300009176 Bacteria 1210
244 Ga0105248_10050901 3300009177 Bacteria 4647
245 Ga0105248_10757727 3300009177 Bacteria 1095
246 Ga0105248_10806005 3300009177 Bacteria 1060
247 Ga0105248_10982851 3300009177 Bacteria 953
248 Ga0105248_11411424 3300009177 Bacteria 788
249 Ga0105248_12343157 3300009177 Bacteria 608
250 Ga0105248_12591790 3300009177 Bacteria 578
251 Ga0105237_10002393 3300009545 Bacteria 23297
252 Ga0105237_10004165 3300009545 Bacteria 16837
253 Ga0105237_10009190 3300009545 Bacteria 10610
254 Ga0105237_10133017 3300009545 Bacteria 2482
255 Ga0105238_10008672 3300009551 Bacteria 10171
256 Ga0105238_10021470 3300009551 Bacteria 6576
257 Ga0105238_10324851 3300009551 Bacteria 1525
258 Ga0105249_10613862 3300009553 Bacteria 1143
259 Ga0105249_10805681 3300009553 Bacteria 1003
260 Ga0105249_11518156 3300009553 Bacteria 742
261 Ga0105035_107571 3300009988 Bacteria 916
262 Ga0099796_10006093 3300010159 Bacteria 3065
263 Ga0099796_10115822 3300010159 Bacteria 1025
264 Ga0105239_10005104 3300010375 Bacteria 15496
265 Ga0105246_10533496 3300011119 Bacteria 1003
266 Ga0105246_11086427 3300011119 Bacteria 730
267 Ga0157370_10005606 3300013104 Bacteria 14053
268 Ga0157370_10146500 3300013104 Bacteria 2199
269 Ga0157370_10276222 3300013104 Bacteria 1552
270 Ga0157370_10607615 3300013104 Bacteria 1001
271 Ga0157370_11069860 3300013104 Bacteria 729
272 Ga0157369_10001633 3300013105 Bacteria 27410
273 Ga0157369_10004521 3300013105 Bacteria 16369
274 Ga0157369_10088108 3300013105 Bacteria 3313
275 Ga0157369_10215104 3300013105 Bacteria 2013
276 Ga0157369_10504677 3300013105 Bacteria 1251
277 Ga0157369_11449589 3300013105 Bacteria 699
278 Ga0157374_10027248 3300013296 Bacteria 5152
279 Ga0157374_10180316 3300013296 Bacteria 2063
280 Ga0157374_11790706 3300013296 Bacteria 639
281 Ga0157378_10064717 3300013297 Bacteria 3272
282 Ga0157378_12308919 3300013297 Bacteria 589
283 Ga0163162_10181605 3300013306 Bacteria 2230
284 Ga0163162_11346718 3300013306 Bacteria 812
285 Ga0163162_11670522 3300013306 Bacteria 727
286 Ga0163162_11964272 3300013306 Bacteria 670
287 Ga0157372_10450412 3300013307 Bacteria 1500
288 Ga0157372_11166673 3300013307 Bacteria 890
289 Ga0157375_11085361 3300013308 Bacteria 937
290 Ga0157375_12126510 3300013308 Bacteria 668
291 Ga0157515_126273 3300013875 Bacteria 814
292 Ga0163163_10024356 3300014325 Bacteria 5760
293 Ga0163163_10024722 3300014325 Bacteria 5719
294 Ga0163163_10026417 3300014325 Bacteria 5550
295 Ga0163163_10179909 3300014325 Bacteria 2162
296 Ga0163163_12157092 3300014325 Bacteria 616
297 Ga0157380_10075894 3300014326 Bacteria 2733
298 Ga0157380_10240941 3300014326 Bacteria 1630
299 Ga0157380_10603157 3300014326 Bacteria 1087
300 Ga0157380_11581399 3300014326 Bacteria 711
301 Ga0157380_12208626 3300014326 Bacteria 614
302 Ga0182008_10403786 3300014497 Bacteria 734
303 Ga0157379_10029397 3300014968 Bacteria 4888
304 Ga0157376_10105338 3300014969 Bacteria 2472
305 Ga0157376_10816888 3300014969 Bacteria 946
306 Ga0157376_10892597 3300014969 Bacteria 907
307 Ga0182006_1014936 3300015261 Bacteria 3339
308 Ga0182006_1021466 3300015261 Bacteria 2693
309 Ga0182007_10000106 3300015262 Bacteria 59012
310 Ga0163161_10590593 3300017792 Bacteria 914
311 Ga0163161_11083324 3300017792 Bacteria 688
312 Ga0184601_134489 3300019183 Bacteria 587
313 Ga0206350_10736505 3300020080 Bacteria 1520
314 Ga0213873_10071571 3300021358 Bacteria 956
315 Ga0213872_10000071 3300021361 Bacteria 91423
316 Ga0213872_10000785 3300021361 Bacteria 23235
317 Ga0213872_10003152 3300021361 Bacteria 9257
318 Ga0213872_10059439 3300021361 Bacteria 1730
319 Ga0213872_10060842 3300021361 Bacteria 1708
320 Ga0213872_10115178 3300021361 Bacteria 1191
321 Ga0213872_10117995 3300021361 Bacteria 1174
322 Ga0213874_10030925 3300021377 Bacteria 1546
323 Ga0213874_10179083 3300021377 Bacteria 753
324 Ga0213876_10033677 3300021384 Bacteria 2701
325 Ga0213876_10156838 3300021384 Bacteria 1211
326 Ga0213876_10227828 3300021384 Bacteria 991
327 Ga0213875_10000004 3300021388 Bacteria 703388
328 Ga0213875_10000409 3300021388 Bacteria 37759
329 Ga0213875_10010793 3300021388 Bacteria 4567
330 Ga0213875_10084814 3300021388 Bacteria 1478
331 Ga0213875_10122583 3300021388 Bacteria 1215
332 Ga0213875_10445581 3300021388 Bacteria 619
333 Ga0213875_10542333 3300021388 Bacteria 560
334 Ga0213871_10006468 3300021441 Bacteria 2479
335 Ga0213871_10024857 3300021441 Bacteria 1521
336 Ga0228598_1041091 3300024227 Bacteria 913
337 Ga0209566_100408 3300025225 Bacteria 34108
338 Ga0209674_100026 3300025226 Bacteria 490631
339 Ga0209674_101565 3300025226 Bacteria 5812
340 Ga0209674_102480 3300025226 Bacteria 3933
341 Ga0209672_100007 3300025228 Bacteria 959482
342 Ga0209672_100017 3300025228 Bacteria 514236
343 Ga0209672_100065 3300025228 Bacteria 198168
344 Ga0209672_100173 3300025228 Bacteria 54084
345 Ga0209672_100857 3300025228 Bacteria 13919
346 Ga0209147_100044 3300025229 Bacteria 300330
347 Ga0209147_100124 3300025229 Bacteria 133627
348 Ga0209563_100074 3300025230 Bacteria 224912
349 Ga0207427_100213 3300025231 Bacteria 51669
350 Ga0209437_100381 3300025233 Bacteria 43879
351 Ga0209258_100017 3300025242 Bacteria 590785
352 Ga0209258_100031 3300025242 Bacteria 463572
353 Ga0209258_100038 3300025242 Bacteria 398959
354 Ga0209258_100118 3300025242 Bacteria 183558
355 Ga0209258_100144 3300025242 Bacteria 163814
356 Ga0209646_1000824 3300025246 Bacteria 10466
357 Ga0209026_1000044 3300025250 Bacteria 266550
358 Ga0209026_1000431 3300025250 Bacteria 34966
359 Ga0209677_107487 3300025253 Bacteria 2310
360 Ga0209148_1000009 3300025254 Bacteria 1395625
361 Ga0209148_1000024 3300025254 Bacteria 669890
362 Ga0209148_1000027 3300025254 Bacteria 616374
363 Ga0209148_1000044 3300025254 Bacteria 458417
364 Ga0209148_1000141 3300025254 Bacteria 163821
365 Ga0209759_1000517 3300025256 Bacteria 41788
366 Ga0209759_1000779 3300025256 Bacteria 26706
367 Ga0209233_1000323 3300025261 Bacteria 51669
368 Ga0209455_1000010 3300025272 Bacteria 959482
369 Ga0209455_1000025 3300025272 Bacteria 670673
370 Ga0209455_1000032 3300025272 Bacteria 514243
371 Ga0209455_1000058 3300025272 Bacteria 342028
372 Ga0209455_1001839 3300025272 Bacteria 8885
373 Ga0209673_1000059 3300025273 Bacteria 268892
374 Ga0209564_1000283 3300025295 Bacteria 102740
375 Ga0209051_1001186 3300025303 Bacteria 23570
376 Ga0209051_1005394 3300025303 Bacteria 7492
377 Ga0209051_1047107 3300025303 Bacteria 1476
378 Ga0209257_1000264 3300025304 Bacteria 120518
379 Ga0209257_1059664 3300025304 Bacteria 1041
380 Ga0207696_1074758 3300025711 Bacteria 939
381 Ga0207692_10083636 3300025898 Bacteria 1713
382 Ga0207692_10247372 3300025898 Bacteria 1067
383 Ga0207647_10004854 3300025904 Bacteria 9943
384 Ga0207685_10073115 3300025905 Bacteria 1396
385 Ga0207699_10016761 3300025906 Bacteria 3840
386 Ga0207705_10112777 3300025909 Bacteria 2010
387 Ga0207705_10329270 3300025909 Bacteria 1174
388 Ga0207705_10404288 3300025909 Bacteria 1056
389 Ga0207684_10332074 3300025910 Bacteria 1310
390 Ga0207654_11063366 3300025911 Bacteria 589
391 Ga0207695_10000203 3300025913 Bacteria 163681
392 Ga0207695_10000273 3300025913 Bacteria 129404
393 Ga0207695_10001289 3300025913 Bacteria 42571
394 Ga0207695_10005122 3300025913 Bacteria 17554
395 Ga0207695_10098915 3300025913 Bacteria 2916
396 Ga0207695_10217137 3300025913 Bacteria 1821
397 Ga0207695_10597292 3300025913 Bacteria 985
398 Ga0207695_10780400 3300025913 Bacteria 836
399 Ga0207671_10011634 3300025914 Bacteria 7141
400 Ga0207671_10013289 3300025914 Bacteria 6566
401 Ga0207671_10313390 3300025914 Bacteria 1241
402 Ga0207693_10016897 3300025915 Bacteria 5826
403 Ga0207693_10052095 3300025915 Bacteria 3210
404 Ga0207693_10154990 3300025915 Bacteria 1802
405 Ga0207693_10161001 3300025915 Bacteria 1766
406 Ga0207693_10332234 3300025915 Bacteria 1190
407 Ga0207663_10052557 3300025916 Bacteria 2542
408 Ga0207663_10122286 3300025916 Bacteria 1784
409 Ga0207663_10144307 3300025916 Bacteria 1662
410 Ga0207663_10271920 3300025916 Bacteria 1255
411 Ga0207660_10091219 3300025917 Bacteria 2259
412 Ga0207657_10000001 3300025919 Bacteria 458536
413 Ga0207649_10388800 3300025920 Bacteria 1041
414 Ga0207649_11187655 3300025920 Bacteria 603
415 Ga0207652_10148061 3300025921 Bacteria 2101
416 Ga0207652_10158359 3300025921 Bacteria 2029
417 Ga0207652_10952038 3300025921 Bacteria 756
418 Ga0207646_10008018 3300025922 Bacteria 10651
419 Ga0207646_10123363 3300025922 Bacteria 2329
420 Ga0207681_10010470 3300025923 Bacteria 5676
421 Ga0207681_10403376 3300025923 Bacteria 1105
422 Ga0207694_10050890 3300025924 Bacteria 3210
423 Ga0207694_10499828 3300025924 Bacteria 1018
424 Ga0207650_10446098 3300025925 Bacteria 1076
425 Ga0207650_10625289 3300025925 Bacteria 907
426 Ga0207700_10013731 3300025928 Bacteria 5283
427 Ga0207700_10543166 3300025928 Bacteria 1031
428 Ga0207664_10390836 3300025929 Bacteria 1236
429 Ga0207664_10460911 3300025929 Bacteria 1135
430 Ga0207664_10569742 3300025929 Bacteria 1016
431 Ga0207690_10000029 3300025932 Bacteria 160406
432 Ga0207690_10090684 3300025932 Bacteria 2158
433 Ga0207690_10221243 3300025932 Bacteria 1448
434 Ga0207686_10016496 3300025934 Bacteria 4146
435 Ga0207686_10543413 3300025934 Bacteria 907
436 Ga0207686_10568711 3300025934 Bacteria 888
437 Ga0207669_10070655 3300025937 Bacteria 2190
438 Ga0207665_10001976 3300025939 Bacteria 13813
439 Ga0207665_10019541 3300025939 Bacteria 4455
440 Ga0207691_10342247 3300025940 Bacteria 1280
441 Ga0207711_10832823 3300025941 Bacteria 859
442 Ga0207689_11530744 3300025942 Bacteria 556
443 Ga0207679_10224928 3300025945 Bacteria 1581
444 Ga0207679_10549384 3300025945 Bacteria 1036
445 Ga0207667_10003915 3300025949 Bacteria 18324
446 Ga0207667_10049760 3300025949 Bacteria 4424
447 Ga0207667_10374971 3300025949 Bacteria 1450
448 Ga0207667_10605563 3300025949 Bacteria 1104
449 Ga0207667_10626150 3300025949 Bacteria 1083
450 Ga0207667_10655380 3300025949 Bacteria 1055
451 Ga0207651_10120103 3300025960 Bacteria 1992
452 Ga0207651_11151891 3300025960 Bacteria 696
453 Ga0207712_10202145 3300025961 Bacteria 1576
454 Ga0207712_10357695 3300025961 Bacteria 1215
455 Ga0207703_10247960 3300026035 Bacteria 1604
456 Ga0207703_10442763 3300026035 Bacteria 1212
457 Ga0207703_10895219 3300026035 Bacteria 850
458 Ga0207703_12129612 3300026035 Bacteria 537
459 Ga0207639_10283578 3300026041 Bacteria 1458
460 Ga0207639_11275386 3300026041 Bacteria 689
461 Ga0207678_10000227 3300026067 Bacteria 50150
462 Ga0207708_10202584 3300026075 Bacteria 1584
463 Ga0207708_10763063 3300026075 Bacteria 831
464 Ga0207708_11089557 3300026075 Bacteria 696
465 Ga0207702_10002529 3300026078 Bacteria 17222
466 Ga0207702_10012718 3300026078 Bacteria 7003
467 Ga0207702_10036512 3300026078 Bacteria 4111
468 Ga0207702_10052635 3300026078 Bacteria 3445
469 Ga0207702_10401868 3300026078 Bacteria 1321
470 Ga0207702_10472674 3300026078 Bacteria 1219
471 Ga0207648_10353116 3300026089 Bacteria 1326
472 Ga0207676_10860450 3300026095 Bacteria 887
473 Ga0207675_100085125 3300026118 Bacteria 2967
474 Ga0207675_100460912 3300026118 Bacteria 1261
475 Ga0207675_100500949 3300026118 Bacteria 1209
476 Ga0207698_10024704 3300026142 Bacteria 4222
477 Ga0207698_10054163 3300026142 Bacteria 3085
478 Ga0207698_11276307 3300026142 Unclassified 749
479 Ga0207698_11417460 3300026142 Bacteria 710
480 Ga0207698_12393151 3300026142 Bacteria 539
481 Ga0209371_1000129 3300027312 Bacteria 124523
482 Ga0268266_10010740 3300028379 Bacteria 7980
483 Ga0268266_10284707 3300028379 Bacteria 1538
484 Ga0268265_10308291 3300028380 Bacteria 1428
485 Ga0307515_10093088 3300028794 Bacteria 3742
486 Ga0265338_10113802 3300028800 Bacteria 2173
487 Ga0268256_1000133 3300030500 Bacteria 102725
488 Ga0307512_10172021 3300030522 Bacteria 1239
489 Ga0265770_1007398 3300030878 Bacteria 1546
490 Ga0265760_10011916 3300031090 Bacteria 2484
491 Ga0265760_10339073 3300031090 Bacteria 537
492 Ga0265327_10004235 3300031251 Bacteria 12871
493 Ga0265316_10095091 3300031344 Bacteria 2270
494 Ga0265316_10105173 3300031344 Bacteria 2142
495 Ga0265316_11192990 3300031344 Bacteria 527
496 Ga0307513_10284836 3300031456 Bacteria 1427
497 Ga0307516_10000499 3300031730 Bacteria 52269
498 Ga0316053_112151 3300032120 Bacteria 614
499 Ga0373923_0296135 3300035111 Bacteria 765
500 Ga0373932_0011260 3300035112 Bacteria 2182
501 Ga0373943_0026858 3300035170 Bacteria 2701
502 Ga0373943_0364261 3300035170 Bacteria 830
503 Ga0373946_0226390 3300035171 Bacteria 905
504 Ga0316574_0221228 3300035398 Bacteria 1213
505 Ga0373935_0008964 3300035692 Bacteria 5988
506 Ga0373947_0044834 3300035725 Bacteria 2645
507 Ga0373947_0265587 3300035725 Bacteria 1138
508 Ga0373947_0331982 3300035725 Bacteria 1018
509 Ga0373937_0228238 3300036401 Bacteria 1753
510 Ga0373925_0149534 3300037068 Bacteria 1833
511 Ga0373925_0854255 3300037068 Bacteria 750
512 Ga0373925_0882413 3300037068 Bacteria 737
513 Ga0395899_0000062 3300037312 Bacteria 211388
514 Ga0395899_0000167 3300037312 Bacteria 100973
515 Ga0395899_0051027 3300037312 Bacteria 3071
516 Ga0395899_0345830 3300037312 Bacteria 996
517 Ga0395900_0000009 3300037418 Bacteria 476249
518 Ga0395900_0000039 3300037418 Bacteria 248722
519 Ga0395900_0043542 3300037418 Bacteria 4627
520 Ga0395900_0599874 3300037418 Bacteria 1042
521 Ga0395898_0000069 3300037466 Bacteria 254587
522 Ga0395898_0000140 3300037466 Bacteria 190587
523 Ga0395898_0259449 3300037466 Bacteria 1657
524 Ga0395898_1487548 3300037466 Bacteria 603
525 Ga0395898_1726355 3300037466 Bacteria 548
526 Ga0395905_0019189 3300037471 Bacteria 6484
527 Ga0395905_0078049 3300037471 Bacteria 3103
528 Ga0395905_1479575 3300037471 Bacteria 583
529 Ga0436364_0199993 3300037853 Bacteria 1822
530 Ga0436364_0356734 3300037853 Bacteria 1492
531 Ga0436364_0431728 3300037853 Bacteria 222864
532 Ga0436364_0748068 3300037853 Bacteria 528910
533 Ga0436364_0843268 3300037853 Bacteria 3606
534 Ga0436364_1236165 3300037853 Bacteria 5054
535 Ga0436364_1261036 3300037853 Bacteria 595
536 Ga0436364_1342962 3300037853 Bacteria 521
537 Ga0436364_1457846 3300037853 Bacteria 7907
538 Ga0395901_0000014 3300038443 Bacteria 375100
539 Ga0395901_1521625 3300038443 Bacteria 624
540 Ga0400489_41603 3300039093 Bacteria 12259
541 Ga0436365_0206806 3300039437 Bacteria 1657
542 Ga0436365_0430209 3300039437 Bacteria 2425
543 Ga0436365_0472708 3300039437 Bacteria 4488
544 Ga0436365_0543679 3300039437 Bacteria 12016
545 Ga0436365_0844407 3300039437 Unclassified 1031
546 Ga0436365_1303722 3300039437 Bacteria 1639
547 Ga0436365_1737587 3300039437 Bacteria 1954
548 Ga0436360_0058815 3300039438 Bacteria 1227
549 Ga0436360_0213572 3300039438 Bacteria 12542
550 Ga0436360_0285718 3300039438 Bacteria 878
551 Ga0436360_0380383 3300039438 Bacteria 11032
552 Ga0436360_0517441 3300039438 Bacteria 2030
553 Ga0436360_0914568 3300039438 Bacteria 14130
554 Ga0436360_1336127 3300039438 Bacteria 987
555 Ga0436361_0047346 3300039447 Bacteria 87631
556 Ga0436361_0055354 3300039447 Bacteria 9058
557 Ga0436361_0154707 3300039447 Bacteria 20033
558 Ga0436361_0157085 3300039447 Bacteria 3080
559 Ga0436361_0384722 3300039447 Bacteria 11499
560 Ga0436361_0484676 3300039447 Unclassified 3794
561 Ga0436361_0652142 3300039447 Bacteria 829
562 Ga0436361_0666244 3300039447 Bacteria 8526
563 Ga0436361_0788442 3300039447 Bacteria 540
564 Ga0436361_0895187 3300039447 Bacteria 79068
565 Ga0436361_0910912 3300039447 Bacteria 627
566 Ga0436361_0923671 3300039447 Bacteria 2829
567 Ga0436361_0932086 3300039447 Bacteria 3324
568 Ga0436361_1021429 3300039447 Bacteria 12623
569 Ga0436361_1097826 3300039447 Bacteria 2340
570 Ga0436363_0756951 3300039450 Bacteria 1047
571 Ga0436363_0963290 3300039450 Unclassified 2428
572 Ga0436363_1397348 3300039450 Bacteria 3742
573 Ga0436362_0063915 3300039453 Bacteria 5363
574 Ga0436362_0283413 3300039453 Bacteria 2818
575 Ga0436362_0566135 3300039453 Bacteria 1031
576 Ga0436362_0955192 3300039453 Bacteria 1290
577 Ga0436362_1210783 3300039453 Bacteria 3954
578 Ga0451795_1304938 3300041456 Bacteria 1254
579 Ga0451849_0220963 3300041505 Bacteria 756
580 Ga0451853_0555938 3300041512 Bacteria 518
581 Ga0439431_0003477 3300041997 Bacteria 3472
582 Ga0439432_063004 3300042006 Bacteria 1140
583 Ga0439446_0177389 3300042156 Bacteria 711
584 Ga0451577_0035832 3300042876 Bacteria 4469
585 Ga0451577_0070218 3300042876 Bacteria 3124
586 Ga0451577_0815176 3300042876 Bacteria 843
587 Ga0466969_0013964 3300044656 Bacteria 4228
588 Ga0453683_0003615 3300044673 Bacteria 11339
589 Ga0453683_0045779 3300044673 Bacteria 2743
590 Ga0453683_0163493 3300044673 Bacteria 1409
591 Ga0453683_0182467 3300044673 Bacteria 1331
592 Ga0466965_0325808 3300044683 Bacteria 837
593 Ga0466966_0021400 3300044684 Bacteria 4246
594 Ga0466966_0253495 3300044684 Bacteria 1060
595 Ga0466966_0408152 3300044684 Bacteria 816
596 Ga0466961_0019310 3300044693 Bacteria 4384
597 Ga0466961_0035203 3300044693 Bacteria 3215
598 Ga0466961_0072126 3300044693 Bacteria 2190
599 Ga0466961_0128385 3300044693 Bacteria 1589
600 Ga0466963_0232258 3300044694 Bacteria 1293
601 Ga0466963_0814535 3300044694 Bacteria 658
602 Ga0453684_0000951 3300044712 Bacteria 95417
603 Ga0453684_0001767 3300044712 Bacteria 57669
604 Ga0453684_0165592 3300044712 Bacteria 2610
605 Ga0453684_0391319 3300044712 Bacteria 1559
606 Ga0466971_0002070 3300044719 Bacteria 8502
607 Ga0466968_0066312 3300044735 Bacteria 1564
608 Ga0466970_0000163 3300044765 Bacteria 31774
609 Ga0466970_0279741 3300044765 Bacteria 938
610 Ga0466957_0002878 3300044842 Bacteria 9324
611 Ga0466959_0000383 3300045049 Bacteria 26156
612 Ga0466959_0068211 3300045049 Bacteria 2577
613 Ga0466959_0169300 3300045049 Bacteria 1533
614 Ga0466959_0486696 3300045049 Bacteria 834
615 Ga0451576_0003996 3300045051 Bacteria 19640
616 Ga0451576_0424920 3300045051 Bacteria 1394
617 Ga0451576_0503573 3300045051 Bacteria 1272
618 Ga0466958_0145503 3300045836 Bacteria 1493
619 Ga0466967_0579131 3300045976 Bacteria 1106
620 Ga0495627_000483 3300046453 Bacteria 33680
621 Ga0495638_0169811 3300046460 Bacteria 1252
622 Ga0495650_0000007 3300046471 Bacteria 718072
623 Ga0495650_0063018 3300046471 Bacteria 1480
624 Ga0495580_0527279 3300046472 Bacteria 786
625 Ga0495585_0013190 3300046492 Bacteria 4842
626 Ga0495610_0018383 3300046512 Bacteria 3951
627 Ga0495620_0061257 3300046515 Bacteria 1566
628 Ga0495630_1027872 3300046517 Bacteria 626
629 Ga0495632_0018888 3300046519 Bacteria 3767
630 Ga0495637_0042169 3300046520 Bacteria 1954
631 Ga0495648_0000039 3300046524 Bacteria 185430
632 Ga0495666_0269840 3300046526 Bacteria 773
633 Ga0495652_0103129 3300046529 Bacteria 2309
634 Ga0495652_0622100 3300046529 Bacteria 734
635 Ga0495654_0000053 3300046530 Bacteria 145014
636 Ga0495634_0634917 3300046642 Bacteria 618
637 Ga0495625_0000683 3300046660 Bacteria 48312
638 Ga0495625_0004788 3300046660 Bacteria 12657
639 Ga0495625_0007535 3300046660 Bacteria 9453
640 Ga0495625_0009883 3300046660 Bacteria 7934
641 Ga0495625_0387504 3300046660 Bacteria 875
642 Ga0495588_0120713 3300046674 Bacteria 1382
643 Ga0495647_0184949 3300046681 Bacteria 908
644 Ga0495658_0067976 3300046683 Bacteria 2062
645 Ga0495670_0647241 3300046691 Bacteria 576
646 Ga0495671_0250159 3300046692 Bacteria 855
647 Ga0495604_0159347 3300047317 Bacteria 1596
648 Ga0495674_0080503 3300047319 Bacteria 2795
649 Ga0495675_0146301 3300047444 Bacteria 1462
650 Ga0495673_0000148 3300047469 Bacteria 124135
651 Ga0495673_0000377 3300047469 Bacteria 53346
652 Ga0495684_0556766 3300047471 Bacteria 780
653 Ga0495686_0010996 3300047472 Bacteria 6402
654 Ga0495686_0015143 3300047472 Bacteria 5281
655 Ga0495686_0063473 3300047472 Bacteria 2289
656 Ga0495602_0271131 3300048088 Bacteria 1254
657 Ga0495602_0378390 3300048088 Bacteria 1015
658 Ga0495614_0356171 3300048089 Bacteria 683
659 Ga0496100_0550846 3300048903 Bacteria 892
660 Ga0496101_0072322 3300048904 Bacteria 2531
661 Ga0496102_1527023 3300048905 Bacteria 586
662 Ga0496104_0131456 3300048907 Bacteria 2404
663 Ga0496105_0089442 3300048908 Bacteria 2544
664 Ga0496106_0208732 3300048909 Bacteria 1555
665 Ga0496106_0743448 3300048909 Bacteria 780
666 Ga0496107_0000113 3300048910 Bacteria 39326
667 Ga0496107_0841192 3300048910 Bacteria 671
668 Ga0496108_0305201 3300048911 Bacteria 1387
669 Ga0496110_0387687 3300048913 Bacteria 1273
670 Ga0496112_0103364 3300048915 Bacteria 2819
671 Ga0496113_0592473 3300048916 Bacteria 888
672 Ga0496113_0820937 3300048916 Bacteria 738
673 Ga0496113_1386334 3300048916 Bacteria 545
674 Ga0496114_0199953 3300048917 Bacteria 1750
675 Ga0496114_0362178 3300048917 Bacteria 1283
676 Ga0496115_0034331 3300048918 Bacteria 4009
677 Ga0496116_0010230 3300048919 Bacteria 7891
678 Ga0496117_0131997 3300048920 Bacteria 1512
679 Ga0496117_0485986 3300048920 Bacteria 602
680 Ga0496118_0042016 3300048921 Bacteria 3612
681 Ga0496118_0072464 3300048921 Bacteria 2474
682 Ga0496118_0186132 3300048921 Bacteria 1248
683 Ga0496118_0294034 3300048921 Bacteria 896
684 Ga0496118_0322079 3300048921 Bacteria 838
685 Ga0496120_0053556 3300048923 Bacteria 2292
686 Ga0496121_0000197 3300048924 Bacteria 135555
687 Ga0496121_0002319 3300048924 Bacteria 29484
688 Ga0496121_0003184 3300048924 Bacteria 23655
689 Ga0496121_0038189 3300048924 Bacteria 4257
690 Ga0496121_0282033 3300048924 Bacteria 1136
691 Ga0496122_0015369 3300048925 Bacteria 7322
692 Ga0496123_0008845 3300048926 Bacteria 9174
693 Ga0496125_0249106 3300048928 Bacteria 1122
694 Ga0496126_0002536 3300048929 Bacteria 24441
695 Ga0496126_0009870 3300048929 Bacteria 10101
696 Ga0496126_0076035 3300048929 Bacteria 2980
697 Ga0496126_0091443 3300048929 Bacteria 2676
698 Ga0496126_0315743 3300048929 Bacteria 1286
699 Ga0501034_0481604 3300049571 Bacteria 1156
700 Ga0501036_0029060 3300049572 Bacteria 4673
701 Ga0501036_0217846 3300049572 Bacteria 1603
702 Ga0501037_0546519 3300049573 Bacteria 782
703 Ga0501038_0110429 3300049574 Bacteria 2278
704 Ga0501039_0065713 3300049575 Bacteria 2814
705 Ga0501039_0142423 3300049575 Bacteria 1883
706 Ga0501040_0097502 3300049576 Bacteria 2048
707 Ga0501041_0061435 3300049577 Bacteria 2300
708 Ga0501041_0087895 3300049577 Bacteria 1918
709 Ga0501042_0044735 3300049578 Bacteria 3155
710 Ga0501042_0158598 3300049578 Bacteria 1632
711 Ga0501042_0600819 3300049578 Bacteria 800
712 Ga0501046_0121394 3300049580 Bacteria 1988
713 Ga0501046_0146614 3300049580 Bacteria 1782
714 Ga0501048_0076493 3300049582 Bacteria 2362
715 Ga0501048_0125570 3300049582 Bacteria 1814
716 Ga0501048_0279458 3300049582 Bacteria 1187
717 Ga0501068_0175822 3300049584 Bacteria 1352
718 Ga0501071_0024968 3300049587 Bacteria 4183
719 Ga0501072_0027502 3300049588 Bacteria 4437
720 Ga0501074_0062883 3300049590 Bacteria 2674
721 Ga0501074_0532786 3300049590 Bacteria 832
722 Ga0501075_0166277 3300049591 Bacteria 1683
723 Ga0501075_0288508 3300049591 Bacteria 1250
724 Ga0501075_0331294 3300049591 Bacteria 1160
725 Ga0501076_0081126 3300049592 Bacteria 2604
726 Ga0501076_0275343 3300049592 Bacteria 1378
727 Ga0501077_0570600 3300049593 Bacteria 726
728 Ga0501206_066988 3300049653 Bacteria 600
729 Ga0501249_072623 3300049679 Unclassified 804
730 Ga0501257_111028 3300049686 Bacteria 727
731 Ga0501079_0093635 3300049741 Bacteria 2328
732 Ga0501079_0283130 3300049741 Bacteria 1296
733 Ga0501081_0028476 3300049743 Bacteria 3771
734 Ga0501044_0179264 3300049823 Bacteria 2086
735 Ga0501045_0033860 3300049824 Bacteria 3706
736 Ga0501045_0052036 3300049824 Bacteria 2989
737 Ga0501045_0733848 3300049824 Bacteria 728
738 nmdc:mga00v17_111656_c1 3300050491 Bacteria 1734
739 nmdc:mga0k408_76832_c1 3300050493 Bacteria 1952
740 nmdc:mga05p37_116569_c1 3300050507 Bacteria 3282
741 nmdc:mga05p37_792441_c1 3300050507 Bacteria 1038
742 nmdc:mga0qj67_15553_c1 3300050509 Bacteria 5761
743 nmdc:mga0qj67_218183_c1 3300050509 Bacteria 1548
744 nmdc:mga0qj67_501783_c1 3300050509 Bacteria 975
745 nmdc:mga0qj67_598641_c1 3300050509 Bacteria 882
746 nmdc:mga06r32_368541_c1 3300050510 Bacteria 1420
747 nmdc:mga06r32_647643_c1 3300050510 Bacteria 1025
748 nmdc:mga08y16_455950_c1 3300050511 Bacteria 1303
749 nmdc:mga0rr50_150110_c1 3300050513 Bacteria 1882
750 nmdc:mga0rr50_168753_c1 3300050513 Bacteria 1781
751 nmdc:mga0a205_645359_c1 3300050515 Bacteria 910
752 nmdc:mga0sz30_65059_c1 3300050516 Bacteria 1563
753 Ga0500643_017572 3300053087 Bacteria 2393
754 Ga0500644_0000241 3300053088 Bacteria 31000
755 Ga0500566_0000074 3300053094 Bacteria 48359
756 Ga0500641_0033523 3300053096 Bacteria 2039
757 Ga0500554_001170 3300053102 Bacteria 5087
758 Ga0500555_008448 3300053103 Bacteria 2935
759 Ga0500572_003846 3300053111 Bacteria 3411
760 Ga0500608_068929 3300053122 Bacteria 1683
761 Ga0500614_000300 3300053123 Bacteria 12752
762 Ga0500618_006400 3300053125 Bacteria 3463
763 Ga0500559_0000015 3300053136 Bacteria 158494
764 Ga0500559_0001726 3300053136 Bacteria 11987
765 Ga0500564_000200 3300053138 Bacteria 16311
766 Ga0500577_0010853 3300053142 Bacteria 2698
767 Ga0500588_0150619 3300053146 Bacteria 841
768 Ga0500590_020390 3300053148 Bacteria 3441
769 Ga0500603_000030 3300053150 Bacteria 34154
770 Ga0500604_0008017 3300053151 Bacteria 2802
771 Ga0500616_0013843 3300053153 Bacteria 4657
772 Ga0500627_0041165 3300053158 Bacteria 1985
773 Ga0500630_003168 3300053159 Bacteria 7958
774 Ga0500639_000047 3300053163 Bacteria 57835
775 Ga0500596_003610 3300053735 Bacteria 2916
776 Ga0501084_0199189 3300054114 Bacteria 1689
777 Ga0501084_0470074 3300054114 Bacteria 1063
778 Ga0501084_0758517 3300054114 Bacteria 817
779 Ga0501082_0473518 3300060353 Bacteria 1094
780 Ga0501082_0602291 3300060353 Bacteria 961
781 Ga0466962_0001068 3300061719 Bacteria 12599
782 Ga0530510_0357863 3300061734 Bacteria 1097
783 Ga0530510_0576680 3300061734 Bacteria 855

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_11050039 Ga0114129_110500392 140
2 3300048913 Ga0496110_0387687 Ga0496110_0387687_294_785 140
3 3300048916 Ga0496113_1386334 Ga0496113_1386334_32_523 140
4 3300005354 Ga0070675_101303418 Ga0070675_1013034182 146
5 3300009147 Ga0114129_10202084 Ga0114129_102020842 146
6 3300005444 Ga0070694_100003493 Ga0070694_1000034933 147
7 3300005937 Ga0081455_10090188 Ga0081455_100901882 148
8 3300042876 Ga0451577_0035832 Ga0451577_0035832_2351_2806 148
9 3300044712 Ga0453684_0001767 Ga0453684_0001767_27623_28078 148
10 3300044712 Ga0453684_0165592 Ga0453684_0165592_167_622 148
11 3300005337 Ga0070682_101551439 Ga0070682_1015514391 149
12 3300009174 Ga0105241_11182011 Ga0105241_111820112 149
13 3300014326 Ga0157380_10075894 Ga0157380_100758944 149
14 3300035398 Ga0316574_0221228 Ga0316574_0221228_328_783 149
15 3300044684 Ga0466966_0408152 Ga0466966_0408152_332_796 149
16 3300003203 JGI25406J46586_10032341 JGI25406J46586_100323412 150
17 3300003577 Ga0007416J51690_1114583 Ga0007416J51690_11145832 150
18 3300003579 Ga0007429J51699_1092521 Ga0007429J51699_10925211 150
19 3300003792 Ga0055540_1007096 Ga0055540_10070963 150
20 3300003911 JGI25405J52794_10117483 JGI25405J52794_101174831 150
21 3300005289 Ga0065704_10379807 Ga0065704_103798071 150
22 3300005290 Ga0065712_10025321 Ga0065712_100253212 150
23 3300005293 Ga0065715_10016620 Ga0065715_100166202 150
24 3300005330 Ga0070690_100826417 Ga0070690_1008264172 150
25 3300005331 Ga0070670_101042285 Ga0070670_1010422852 150
26 3300005334 Ga0068869_100621768 Ga0068869_1006217682 150
27 3300005335 Ga0070666_11014417 Ga0070666_110144171 150
28 3300005336 Ga0070680_100092078 Ga0070680_1000920782 150
29 3300005338 Ga0068868_101255339 Ga0068868_1012553391 150
30 3300005356 Ga0070674_100438288 Ga0070674_1004382882 150
31 3300005364 Ga0070673_100889690 Ga0070673_1008896901 150
32 3300005365 Ga0070688_100803867 Ga0070688_1008038671 150
33 3300005366 Ga0070659_100282912 Ga0070659_1002829122 150
34 3300005435 Ga0070714_100298913 Ga0070714_1002989132 150
35 3300005435 Ga0070714_100779577 Ga0070714_1007795772 150
36 3300005436 Ga0070713_101691405 Ga0070713_1016914051 150
37 3300005436 Ga0070713_101977762 Ga0070713_1019777621 150
38 3300005437 Ga0070710_10390861 Ga0070710_103908612 150
39 3300005444 Ga0070694_101397333 Ga0070694_1013973331 150
40 3300005456 Ga0070678_100258533 Ga0070678_1002585333 150
41 3300005456 Ga0070678_100418023 Ga0070678_1004180232 150
42 3300005457 Ga0070662_100139989 Ga0070662_1001399892 150
43 3300005458 Ga0070681_10747956 Ga0070681_107479562 150
44 3300005458 Ga0070681_11367505 Ga0070681_113675051 150
45 3300005459 Ga0068867_100221425 Ga0068867_1002214252 150
46 3300005466 Ga0070685_11189472 Ga0070685_111894721 150
47 3300005467 Ga0070706_100293128 Ga0070706_1002931282 150
48 3300005467 Ga0070706_100720437 Ga0070706_1007204372 150
49 3300005518 Ga0070699_101285789 Ga0070699_1012857891 150
50 3300005530 Ga0070679_100576487 Ga0070679_1005764872 150
51 3300005530 Ga0070679_100791708 Ga0070679_1007917082 150
52 3300005535 Ga0070684_100138170 Ga0070684_1001381703 150
53 3300005539 Ga0068853_100312418 Ga0068853_1003124182 150
54 3300005539 Ga0068853_101553536 Ga0068853_1015535362 150
55 3300005543 Ga0070672_100330382 Ga0070672_1003303823 150
56 3300005543 Ga0070672_101570790 Ga0070672_1015707901 150
57 3300005548 Ga0070665_100031017 Ga0070665_1000310172 150
58 3300005548 Ga0070665_100034634 Ga0070665_1000346342 150
59 3300005548 Ga0070665_100102956 Ga0070665_1001029562 150
60 3300005548 Ga0070665_100205709 Ga0070665_1002057092 150
61 3300005548 Ga0070665_100861402 Ga0070665_1008614022 150
62 3300005549 Ga0070704_100573890 Ga0070704_1005738902 150
63 3300005549 Ga0070704_100712086 Ga0070704_1007120861 150
64 3300005563 Ga0068855_100078722 Ga0068855_1000787224 150
65 3300005563 Ga0068855_100558349 Ga0068855_1005583492 150
66 3300005563 Ga0068855_100881104 Ga0068855_1008811042 150
67 3300005564 Ga0070664_100092553 Ga0070664_1000925532 150
68 3300005578 Ga0068854_101301605 Ga0068854_1013016052 150
69 3300005578 Ga0068854_101588320 Ga0068854_1015883202 150
70 3300005614 Ga0068856_100039844 Ga0068856_1000398442 150
71 3300005614 Ga0068856_100111296 Ga0068856_1001112962 150
72 3300005614 Ga0068856_100164962 Ga0068856_1001649622 150
73 3300005614 Ga0068856_100326776 Ga0068856_1003267762 150
74 3300005614 Ga0068856_100447973 Ga0068856_1004479732 150
75 3300005615 Ga0070702_101267641 Ga0070702_1012676412 150
76 3300005616 Ga0068852_100544718 Ga0068852_1005447182 150
77 3300005617 Ga0068859_100277630 Ga0068859_1002776302 150
78 3300005618 Ga0068864_100527368 Ga0068864_1005273682 150
79 3300005618 Ga0068864_100893620 Ga0068864_1008936201 150
80 3300005618 Ga0068864_101246982 Ga0068864_1012469821 150
81 3300005618 Ga0068864_101394447 Ga0068864_1013944471 150
82 3300005841 Ga0068863_100389331 Ga0068863_1003893312 150
83 3300005842 Ga0068858_100280984 Ga0068858_1002809842 150
84 3300005937 Ga0081455_10078082 Ga0081455_100780822 150
85 3300005937 Ga0081455_10183189 Ga0081455_101831892 150
86 3300005985 Ga0081539_10016966 Ga0081539_100169662 150
87 3300006028 Ga0070717_10028502 Ga0070717_100285023 150
88 3300006028 Ga0070717_11529869 Ga0070717_115298691 150
89 3300006042 Ga0075368_10284662 Ga0075368_102846621 150
90 3300006051 Ga0075364_10263931 Ga0075364_102639312 150
91 3300006051 Ga0075364_10452104 Ga0075364_104521042 150
92 3300006175 Ga0070712_100207703 Ga0070712_1002077032 150
93 3300006175 Ga0070712_100371547 Ga0070712_1003715472 150
94 3300006178 Ga0075367_10140420 Ga0075367_101404202 150
95 3300006178 Ga0075367_10319264 Ga0075367_103192642 150
96 3300006237 Ga0097621_100378603 Ga0097621_1003786032 150
97 3300006844 Ga0075428_101365436 Ga0075428_1013654361 150
98 3300006846 Ga0075430_100017099 Ga0075430_1000170992 150
99 3300006846 Ga0075430_100208253 Ga0075430_1002082533 150
100 3300006847 Ga0075431_100049994 Ga0075431_1000499943 150
101 3300006847 Ga0075431_101303471 Ga0075431_1013034711 150
102 3300006871 Ga0075434_101430195 Ga0075434_1014301951 150
103 3300006880 Ga0075429_100289861 Ga0075429_1002898611 150
104 3300006931 Ga0097620_100277631 Ga0097620_1002776312 150
105 3300007788 Ga0099795_10002609 Ga0099795_100026093 150
106 3300009093 Ga0105240_10006874 Ga0105240_100068747 150
107 3300009093 Ga0105240_10296296 Ga0105240_102962961 150
108 3300009093 Ga0105240_12115071 Ga0105240_121150711 150
109 3300009098 Ga0105245_10529817 Ga0105245_105298172 150
110 3300009098 Ga0105245_10548624 Ga0105245_105486241 150
111 3300009098 Ga0105245_10953931 Ga0105245_109539311 150
112 3300009147 Ga0114129_10257209 Ga0114129_102572092 150
113 3300009147 Ga0114129_12410464 Ga0114129_124104641 150
114 3300009174 Ga0105241_10877466 Ga0105241_108774661 150
115 3300009176 Ga0105242_10159121 Ga0105242_101591212 150
116 3300009176 Ga0105242_10279618 Ga0105242_102796182 150
117 3300009176 Ga0105242_10453292 Ga0105242_104532922 150
118 3300009177 Ga0105248_10050901 Ga0105248_100509012 150
119 3300009177 Ga0105248_10757727 Ga0105248_107577272 150
120 3300009177 Ga0105248_10806005 Ga0105248_108060052 150
121 3300009177 Ga0105248_10982851 Ga0105248_109828511 150
122 3300009177 Ga0105248_12343157 Ga0105248_123431571 150
123 3300009177 Ga0105248_12591790 Ga0105248_125917902 150
124 3300009545 Ga0105237_10002393 Ga0105237_100023933 150
125 3300009545 Ga0105237_10009190 Ga0105237_100091909 150
126 3300009551 Ga0105238_10324851 Ga0105238_103248512 150
127 3300010159 Ga0099796_10006093 Ga0099796_100060932 150
128 3300011119 Ga0105246_10533496 Ga0105246_105334961 150
129 3300011119 Ga0105246_11086427 Ga0105246_110864271 150
130 3300013104 Ga0157370_10146500 Ga0157370_101465002 150
131 3300013104 Ga0157370_11069860 Ga0157370_110698602 150
132 3300013105 Ga0157369_10001633 Ga0157369_100016336 150
133 3300013105 Ga0157369_10088108 Ga0157369_100881082 150
134 3300013105 Ga0157369_11449589 Ga0157369_114495892 150
135 3300013296 Ga0157374_10027248 Ga0157374_100272483 150
136 3300013296 Ga0157374_10180316 Ga0157374_101803162 150
137 3300013296 Ga0157374_11790706 Ga0157374_117907061 150
138 3300013297 Ga0157378_10064717 Ga0157378_100647172 150
139 3300013297 Ga0157378_12308919 Ga0157378_123089191 150
140 3300013306 Ga0163162_11346718 Ga0163162_113467182 150
141 3300013306 Ga0163162_11670522 Ga0163162_116705221 150
142 3300013306 Ga0163162_11964272 Ga0163162_119642722 150
143 3300013307 Ga0157372_10450412 Ga0157372_104504122 150
144 3300013308 Ga0157375_11085361 Ga0157375_110853611 150
145 3300013308 Ga0157375_12126510 Ga0157375_121265102 150
146 3300014325 Ga0163163_10024356 Ga0163163_100243563 150
147 3300014325 Ga0163163_10024722 Ga0163163_100247222 150
148 3300014325 Ga0163163_10026417 Ga0163163_100264172 150
149 3300014325 Ga0163163_10179909 Ga0163163_101799091 150
150 3300014325 Ga0163163_12157092 Ga0163163_121570922 150
151 3300014326 Ga0157380_11581399 Ga0157380_115813992 150
152 3300014326 Ga0157380_12208626 Ga0157380_122086261 150
153 3300014497 Ga0182008_10403786 Ga0182008_104037861 150
154 3300014968 Ga0157379_10029397 Ga0157379_100293974 150
155 3300014969 Ga0157376_10105338 Ga0157376_101053382 150
156 3300014969 Ga0157376_10816888 Ga0157376_108168882 150
157 3300014969 Ga0157376_10892597 Ga0157376_108925971 150
158 3300017792 Ga0163161_11083324 Ga0163161_110833242 150
159 3300019183 Ga0184601_134489 Ga0184601_1344891 150
160 3300020080 Ga0206350_10736505 Ga0206350_107365051 150
161 3300021361 Ga0213872_10060842 Ga0213872_100608421 150
162 3300021361 Ga0213872_10115178 Ga0213872_101151782 150
163 3300021377 Ga0213874_10030925 Ga0213874_100309252 150
164 3300021384 Ga0213876_10156838 Ga0213876_101568381 150
165 3300021384 Ga0213876_10227828 Ga0213876_102278282 150
166 3300021388 Ga0213875_10000004 Ga0213875_1000000475 150
167 3300021388 Ga0213875_10000409 Ga0213875_1000040912 150
168 3300021388 Ga0213875_10010793 Ga0213875_100107936 150
169 3300021388 Ga0213875_10084814 Ga0213875_100848142 150
170 3300021388 Ga0213875_10122583 Ga0213875_101225832 150
171 3300021388 Ga0213875_10445581 Ga0213875_104455811 150
172 3300021388 Ga0213875_10542333 Ga0213875_105423331 150
173 3300021441 Ga0213871_10006468 Ga0213871_100064682 150
174 3300025303 Ga0209051_1001186 Ga0209051_10011862 150
175 3300025303 Ga0209051_1005394 Ga0209051_10053949 150
176 3300025303 Ga0209051_1047107 Ga0209051_10471071 150
177 3300025304 Ga0209257_1059664 Ga0209257_10596642 150
178 3300025909 Ga0207705_10329270 Ga0207705_103292702 150
179 3300025911 Ga0207654_11063366 Ga0207654_110633661 150
180 3300025913 Ga0207695_10005122 Ga0207695_1000512214 150
181 3300025913 Ga0207695_10217137 Ga0207695_102171371 150
182 3300025914 Ga0207671_10013289 Ga0207671_100132892 150
183 3300025915 Ga0207693_10332234 Ga0207693_103322342 150
184 3300025921 Ga0207652_10158359 Ga0207652_101583592 150
185 3300025925 Ga0207650_10625289 Ga0207650_106252891 150
186 3300025928 Ga0207700_10543166 Ga0207700_105431662 150
187 3300025929 Ga0207664_10569742 Ga0207664_105697422 150
188 3300025932 Ga0207690_10090684 Ga0207690_100906842 150
189 3300025932 Ga0207690_10221243 Ga0207690_102212431 150
190 3300025934 Ga0207686_10016496 Ga0207686_100164965 150
191 3300025934 Ga0207686_10543413 Ga0207686_105434132 150
192 3300025934 Ga0207686_10568711 Ga0207686_105687112 150
193 3300025940 Ga0207691_10342247 Ga0207691_103422473 150
194 3300025941 Ga0207711_10832823 Ga0207711_108328232 150
195 3300025942 Ga0207689_11530744 Ga0207689_115307441 150
196 3300025945 Ga0207679_10224928 Ga0207679_102249282 150
197 3300025949 Ga0207667_10049760 Ga0207667_100497602 150
198 3300025949 Ga0207667_10605563 Ga0207667_106055632 150
199 3300025960 Ga0207651_10120103 Ga0207651_101201033 150
200 3300026035 Ga0207703_10247960 Ga0207703_102479602 150
201 3300026041 Ga0207639_10283578 Ga0207639_102835782 150
202 3300026041 Ga0207639_11275386 Ga0207639_112753861 150
203 3300026075 Ga0207708_10202584 Ga0207708_102025841 150
204 3300026078 Ga0207702_10012718 Ga0207702_100127183 150
205 3300026078 Ga0207702_10036512 Ga0207702_100365123 150
206 3300026078 Ga0207702_10052635 Ga0207702_100526353 150
207 3300026089 Ga0207648_10353116 Ga0207648_103531161 150
208 3300026095 Ga0207676_10860450 Ga0207676_108604502 150
209 3300026118 Ga0207675_100460912 Ga0207675_1004609122 150
210 3300026142 Ga0207698_11417460 Ga0207698_114174601 150
211 3300026142 Ga0207698_12393151 Ga0207698_123931511 150
212 3300028379 Ga0268266_10010740 Ga0268266_100107402 150
213 3300028379 Ga0268266_10284707 Ga0268266_102847072 150
214 3300031344 Ga0265316_10105173 Ga0265316_101051733 150
215 3300031344 Ga0265316_11192990 Ga0265316_111929901 150
216 3300031456 Ga0307513_10284836 Ga0307513_102848362 150
217 3300032120 Ga0316053_112151 Ga0316053_1121511 150
218 3300035111 Ga0373923_0296135 Ga0373923_0296135_293_748 150
219 3300035112 Ga0373932_0011260 Ga0373932_0011260_1511_1972 150
220 3300035170 Ga0373943_0026858 Ga0373943_0026858_1739_2194 150
221 3300035171 Ga0373946_0226390 Ga0373946_0226390_336_794 150
222 3300035692 Ga0373935_0008964 Ga0373935_0008964_5267_5722 150
223 3300035725 Ga0373947_0044834 Ga0373947_0044834_296_751 150
224 3300035725 Ga0373947_0331982 Ga0373947_0331982_426_881 150
225 3300036401 Ga0373937_0228238 Ga0373937_0228238_961_1416 150
226 3300037068 Ga0373925_0854255 Ga0373925_0854255_183_638 150
227 3300037068 Ga0373925_0882413 Ga0373925_0882413_165_620 150
228 3300037418 Ga0395900_0043542 Ga0395900_0043542_3351_3863 150
229 3300037471 Ga0395905_1479575 Ga0395905_1479575_56_511 150
230 3300037853 Ga0436364_0199993 Ga0436364_0199993_296_763 150
231 3300037853 Ga0436364_0356734 Ga0436364_0356734_556_1014 150
232 3300037853 Ga0436364_0431728 Ga0436364_0431728_30065_30532 150
233 3300037853 Ga0436364_0748068 Ga0436364_0748068_515511_515978 150
234 3300037853 Ga0436364_0843268 Ga0436364_0843268_1368_1835 150
235 3300037853 Ga0436364_1236165 Ga0436364_1236165_2258_2728 150
236 3300037853 Ga0436364_1261036 Ga0436364_1261036_39_494 150
237 3300037853 Ga0436364_1342962 Ga0436364_1342962_46_501 150
238 3300037853 Ga0436364_1457846 Ga0436364_1457846_3491_3946 150
239 3300039093 Ga0400489_41603 Ga0400489_41603_9134_9595 150
240 3300039437 Ga0436365_0206806 Ga0436365_0206806_1082_1537 150
241 3300039437 Ga0436365_0430209 Ga0436365_0430209_805_1260 150
242 3300039437 Ga0436365_0543679 Ga0436365_0543679_11369_11824 150
243 3300039437 Ga0436365_0844407 Ga0436365_0844407_427_885 150
244 3300039437 Ga0436365_1303722 Ga0436365_1303722_336_803 150
245 3300039438 Ga0436360_0213572 Ga0436360_0213572_6280_6735 150
246 3300039438 Ga0436360_1336127 Ga0436360_1336127_485_952 150
247 3300039447 Ga0436361_0666244 Ga0436361_0666244_5448_5906 150
248 3300039447 Ga0436361_1021429 Ga0436361_1021429_3530_3988 150
249 3300039450 Ga0436363_1397348 Ga0436363_1397348_2658_3113 150
250 3300039453 Ga0436362_0283413 Ga0436362_0283413_1245_1700 150
251 3300039453 Ga0436362_0566135 Ga0436362_0566135_110_577 150
252 3300041512 Ga0451853_0555938 Ga0451853_0555938_16_471 150
253 3300041997 Ga0439431_0003477 Ga0439431_0003477_679_1146 150
254 3300042156 Ga0439446_0177389 Ga0439446_0177389_188_655 150
255 3300042876 Ga0451577_0815176 Ga0451577_0815176_31_486 150
256 3300044673 Ga0453683_0045779 Ga0453683_0045779_1992_2447 150
257 3300044673 Ga0453683_0163493 Ga0453683_0163493_709_1170 150
258 3300044673 Ga0453683_0182467 Ga0453683_0182467_20_475 150
259 3300044684 Ga0466966_0253495 Ga0466966_0253495_57_524 150
260 3300044694 Ga0466963_0814535 Ga0466963_0814535_19_486 150
261 3300044712 Ga0453684_0391319 Ga0453684_0391319_302_763 150
262 3300046472 Ga0495580_0527279 Ga0495580_0527279_300_755 150
263 3300046681 Ga0495647_0184949 Ga0495647_0184949_316_774 150
264 3300046683 Ga0495658_0067976 Ga0495658_0067976_622_1080 150
265 3300047317 Ga0495604_0159347 Ga0495604_0159347_642_1103 150
266 3300047319 Ga0495674_0080503 Ga0495674_0080503_1030_1491 150
267 3300047444 Ga0495675_0146301 Ga0495675_0146301_849_1310 150
268 3300048088 Ga0495602_0271131 Ga0495602_0271131_739_1200 150
269 3300048089 Ga0495614_0356171 Ga0495614_0356171_73_537 150
270 3300048903 Ga0496100_0550846 Ga0496100_0550846_97_555 150
271 3300048907 Ga0496104_0131456 Ga0496104_0131456_184_642 150
272 3300048908 Ga0496105_0089442 Ga0496105_0089442_1626_2084 150
273 3300048909 Ga0496106_0743448 Ga0496106_0743448_269_724 150
274 3300048915 Ga0496112_0103364 Ga0496112_0103364_2051_2506 150
275 3300048916 Ga0496113_0592473 Ga0496113_0592473_231_686 150
276 3300048917 Ga0496114_0199953 Ga0496114_0199953_918_1376 150
277 3300048918 Ga0496115_0034331 Ga0496115_0034331_2287_2742 150
278 3300048929 Ga0496126_0315743 Ga0496126_0315743_387_902 150
279 3300049571 Ga0501034_0481604 Ga0501034_0481604_466_921 150
280 3300049572 Ga0501036_0217846 Ga0501036_0217846_881_1339 150
281 3300049573 Ga0501037_0546519 Ga0501037_0546519_279_740 150
282 3300049575 Ga0501039_0142423 Ga0501039_0142423_632_1093 150
283 3300049576 Ga0501040_0097502 Ga0501040_0097502_992_1453 150
284 3300049577 Ga0501041_0087895 Ga0501041_0087895_131_592 150
285 3300049578 Ga0501042_0044735 Ga0501042_0044735_435_896 150
286 3300049578 Ga0501042_0600819 Ga0501042_0600819_205_702 150
287 3300049580 Ga0501046_0121394 Ga0501046_0121394_1170_1631 150
288 3300049582 Ga0501048_0279458 Ga0501048_0279458_574_1035 150
289 3300049584 Ga0501068_0175822 Ga0501068_0175822_639_1139 150
290 3300049587 Ga0501071_0024968 Ga0501071_0024968_2874_3332 150
291 3300049588 Ga0501072_0027502 Ga0501072_0027502_329_787 150
292 3300049590 Ga0501074_0062883 Ga0501074_0062883_1660_2121 150
293 3300049591 Ga0501075_0288508 Ga0501075_0288508_579_1040 150
294 3300049591 Ga0501075_0331294 Ga0501075_0331294_436_894 150
295 3300049592 Ga0501076_0081126 Ga0501076_0081126_1230_1691 150
296 3300049653 Ga0501206_066988 Ga0501206_066988_77_532 150
297 3300049679 Ga0501249_072623 Ga0501249_072623_327_782 150
298 3300049686 Ga0501257_111028 Ga0501257_111028_116_571 150
299 3300049741 Ga0501079_0283130 Ga0501079_0283130_629_1087 150
300 3300049824 Ga0501045_0033860 Ga0501045_0033860_183_644 150
301 3300050509 nmdc:mga0qj67_15553_c1 nmdc:mga0qj67_15553_c1_4145_4600 150
302 3300050509 nmdc:mga0qj67_598641_c1 nmdc:mga0qj67_598641_c1_283_771 150
303 3300050510 nmdc:mga06r32_368541_c1 nmdc:mga06r32_368541_c1_44_532 150
304 3300050510 nmdc:mga06r32_647643_c1 nmdc:mga06r32_647643_c1_305_760 150
305 3300050511 nmdc:mga08y16_455950_c1 nmdc:mga08y16_455950_c1_155_610 150
306 3300053096 Ga0500641_0033523 Ga0500641_0033523_334_855 150
307 3300053103 Ga0500555_008448 Ga0500555_008448_765_1286 150
308 3300054114 Ga0501084_0199189 Ga0501084_0199189_324_785 150
309 3300054114 Ga0501084_0758517 Ga0501084_0758517_336_794 150
310 3300060353 Ga0501082_0602291 Ga0501082_0602291_222_683 150
311 iso_pu_bacteria 2829745981 2829749919 150
312 3300003320 rootH2_10304912 rootH2_103049122 151
313 3300004803 Ga0058862_12866476 Ga0058862_128664762 151
314 3300005327 Ga0070658_10013460 Ga0070658_100134604 151
315 3300005336 Ga0070680_100003733 Ga0070680_1000037336 151
316 3300005336 Ga0070680_100646880 Ga0070680_1006468801 151
317 3300005336 Ga0070680_101034608 Ga0070680_1010346081 151
318 3300005339 Ga0070660_100237424 Ga0070660_1002374242 151
319 3300005340 Ga0070689_101386646 Ga0070689_1013866461 151
320 3300005354 Ga0070675_100985211 Ga0070675_1009852112 151
321 3300005364 Ga0070673_100065377 Ga0070673_1000653772 151
322 3300005365 Ga0070688_100176706 Ga0070688_1001767062 151
323 3300005440 Ga0070705_100656145 Ga0070705_1006561452 151
324 3300005445 Ga0070708_100101800 Ga0070708_1001018002 151
325 3300005445 Ga0070708_100165342 Ga0070708_1001653422 151
326 3300005458 Ga0070681_10280278 Ga0070681_102802781 151
327 3300005467 Ga0070706_100368912 Ga0070706_1003689123 151
328 3300005468 Ga0070707_100039683 Ga0070707_1000396837 151
329 3300005468 Ga0070707_100860618 Ga0070707_1008606182 151
330 3300005471 Ga0070698_100000373 Ga0070698_10000037328 151
331 3300005471 Ga0070698_100095616 Ga0070698_1000956162 151
332 3300005518 Ga0070699_100058652 Ga0070699_1000586524 151
333 3300005518 Ga0070699_100100014 Ga0070699_1001000143 151
334 3300005518 Ga0070699_100279308 Ga0070699_1002793082 151
335 3300005530 Ga0070679_100180423 Ga0070679_1001804232 151
336 3300005536 Ga0070697_100030107 Ga0070697_1000301075 151
337 3300005545 Ga0070695_100257127 Ga0070695_1002571272 151
338 3300005563 Ga0068855_100018483 Ga0068855_1000184836 151
339 3300005563 Ga0068855_100021333 Ga0068855_1000213335 151
340 3300005614 Ga0068856_100638230 Ga0068856_1006382302 151
341 3300005614 Ga0068856_101137822 Ga0068856_1011378222 151
342 3300005616 Ga0068852_101517615 Ga0068852_1015176151 151
343 3300005718 Ga0068866_10732638 Ga0068866_107326381 151
344 3300005719 Ga0068861_100335650 Ga0068861_1003356502 151
345 3300005842 Ga0068858_101053404 Ga0068858_1010534041 151
346 3300005983 Ga0081540_1219320 Ga0081540_12193201 151
347 3300006028 Ga0070717_10048549 Ga0070717_100485492 151
348 3300006175 Ga0070712_100688436 Ga0070712_1006884362 151
349 3300007788 Ga0099795_10030126 Ga0099795_100301262 151
350 3300007788 Ga0099795_10172256 Ga0099795_101722562 151
351 3300009093 Ga0105240_10000337 Ga0105240_1000033736 151
352 3300009545 Ga0105237_10133017 Ga0105237_101330172 151
353 3300009553 Ga0105249_10613862 Ga0105249_106138621 151
354 3300009553 Ga0105249_10805681 Ga0105249_108056812 151
355 3300013104 Ga0157370_10005606 Ga0157370_100056065 151
356 3300013104 Ga0157370_10607615 Ga0157370_106076152 151
357 3300013105 Ga0157369_10215104 Ga0157369_102151042 151
358 3300013307 Ga0157372_11166673 Ga0157372_111666732 151
359 3300017792 Ga0163161_10590593 Ga0163161_105905932 151
360 3300021361 Ga0213872_10000785 Ga0213872_100007856 151
361 3300021361 Ga0213872_10117995 Ga0213872_101179952 151
362 3300021384 Ga0213876_10033677 Ga0213876_100336772 151
363 3300024227 Ga0228598_1041091 Ga0228598_10410911 151
364 3300025909 Ga0207705_10404288 Ga0207705_104042882 151
365 3300025910 Ga0207684_10332074 Ga0207684_103320742 151
366 3300025913 Ga0207695_10001289 Ga0207695_1000128915 151
367 3300025914 Ga0207671_10011634 Ga0207671_100116343 151
368 3300025916 Ga0207663_10052557 Ga0207663_100525572 151
369 3300025917 Ga0207660_10091219 Ga0207660_100912192 151
370 3300025920 Ga0207649_11187655 Ga0207649_111876552 151
371 3300025921 Ga0207652_10148061 Ga0207652_101480612 151
372 3300025921 Ga0207652_10952038 Ga0207652_109520381 151
373 3300025922 Ga0207646_10008018 Ga0207646_100080187 151
374 3300025923 Ga0207681_10403376 Ga0207681_104033762 151
375 3300025925 Ga0207650_10446098 Ga0207650_104460982 151
376 3300025929 Ga0207664_10390836 Ga0207664_103908361 151
377 3300025949 Ga0207667_10374971 Ga0207667_103749712 151
378 3300025949 Ga0207667_10626150 Ga0207667_106261502 151
379 3300025949 Ga0207667_10655380 Ga0207667_106553802 151
380 3300025960 Ga0207651_11151891 Ga0207651_111518911 151
381 3300025961 Ga0207712_10357695 Ga0207712_103576952 151
382 3300026035 Ga0207703_12129612 Ga0207703_121296121 151
383 3300026078 Ga0207702_10401868 Ga0207702_104018681 151
384 3300026078 Ga0207702_10472674 Ga0207702_104726741 151
385 3300026118 Ga0207675_100500949 Ga0207675_1005009492 151
386 3300026142 Ga0207698_10054163 Ga0207698_100541632 151
387 3300026142 Ga0207698_11276307 Ga0207698_112763072 151
388 3300028800 Ga0265338_10113802 Ga0265338_101138022 151
389 3300030878 Ga0265770_1007398 Ga0265770_10073982 151
390 3300031090 Ga0265760_10011916 Ga0265760_100119162 151
391 3300031251 Ga0265327_10004235 Ga0265327_100042352 151
392 3300031344 Ga0265316_10095091 Ga0265316_100950911 151
393 3300035170 Ga0373943_0364261 Ga0373943_0364261_151_606 151
394 3300035725 Ga0373947_0265587 Ga0373947_0265587_437_892 151
395 3300037068 Ga0373925_0149534 Ga0373925_0149534_611_1066 151
396 3300037312 Ga0395899_0345830 Ga0395899_0345830_33_491 151
397 3300037418 Ga0395900_0599874 Ga0395900_0599874_159_617 151
398 3300037466 Ga0395898_1487548 Ga0395898_1487548_135_593 151
399 3300037466 Ga0395898_1726355 Ga0395898_1726355_83_538 151
400 3300037471 Ga0395905_0078049 Ga0395905_0078049_1320_1775 151
401 3300039437 Ga0436365_0472708 Ga0436365_0472708_2820_3305 151
402 3300039438 Ga0436360_0285718 Ga0436360_0285718_94_588 151
403 3300039447 Ga0436361_0047346 Ga0436361_0047346_85349_85804 151
404 3300039447 Ga0436361_0055354 Ga0436361_0055354_683_1162 151
405 3300039447 Ga0436361_0154707 Ga0436361_0154707_6169_6627 151
406 3300039447 Ga0436361_0932086 Ga0436361_0932086_693_1172 151
407 3300039450 Ga0436363_0756951 Ga0436363_0756951_181_642 151
408 3300044673 Ga0453683_0003615 Ga0453683_0003615_6128_6592 151
409 3300044735 Ga0466968_0066312 Ga0466968_0066312_621_1082 151
410 3300045051 Ga0451576_0424920 Ga0451576_0424920_53_508 151
411 3300045051 Ga0451576_0503573 Ga0451576_0503573_494_958 151
412 3300045976 Ga0466967_0579131 Ga0466967_0579131_291_746 151
413 3300046512 Ga0495610_0018383 Ga0495610_0018383_840_1301 151
414 3300046526 Ga0495666_0269840 Ga0495666_0269840_299_754 151
415 3300046674 Ga0495588_0120713 Ga0495588_0120713_165_620 151
416 3300047471 Ga0495684_0556766 Ga0495684_0556766_23_478 151
417 3300048088 Ga0495602_0378390 Ga0495602_0378390_189_644 151
418 3300048910 Ga0496107_0841192 Ga0496107_0841192_11_487 151
419 3300048917 Ga0496114_0362178 Ga0496114_0362178_398_874 151
420 3300048920 Ga0496117_0131997 Ga0496117_0131997_771_1247 151
421 3300048921 Ga0496118_0186132 Ga0496118_0186132_583_1059 151
422 3300048924 Ga0496121_0003184 Ga0496121_0003184_12268_12735 151
423 3300048929 Ga0496126_0009870 Ga0496126_0009870_4290_4766 151
424 3300049572 Ga0501036_0029060 Ga0501036_0029060_1690_2148 151
425 3300049574 Ga0501038_0110429 Ga0501038_0110429_395_853 151
426 3300049575 Ga0501039_0065713 Ga0501039_0065713_2060_2518 151
427 3300049577 Ga0501041_0061435 Ga0501041_0061435_1304_1762 151
428 3300049578 Ga0501042_0158598 Ga0501042_0158598_573_1031 151
429 3300049580 Ga0501046_0146614 Ga0501046_0146614_407_865 151
430 3300049582 Ga0501048_0076493 Ga0501048_0076493_454_912 151
431 3300049590 Ga0501074_0532786 Ga0501074_0532786_343_801 151
432 3300049591 Ga0501075_0166277 Ga0501075_0166277_712_1170 151
433 3300049592 Ga0501076_0275343 Ga0501076_0275343_464_922 151
434 3300049593 Ga0501077_0570600 Ga0501077_0570600_86_544 151
435 3300049741 Ga0501079_0093635 Ga0501079_0093635_501_959 151
436 3300049743 Ga0501081_0028476 Ga0501081_0028476_2013_2471 151
437 3300049824 Ga0501045_0052036 Ga0501045_0052036_1065_1523 151
438 3300053094 Ga0500566_0000074 Ga0500566_0000074_22358_22834 151
439 3300053111 Ga0500572_003846 Ga0500572_003846_2646_3122 151
440 3300053122 Ga0500608_068929 Ga0500608_068929_583_1059 151
441 3300053123 Ga0500614_000300 Ga0500614_000300_8128_8604 151
442 3300053136 Ga0500559_0001726 Ga0500559_0001726_3404_3880 151
443 3300053148 Ga0500590_020390 Ga0500590_020390_494_970 151
444 3300053150 Ga0500603_000030 Ga0500603_000030_6730_7206 151
445 3300053159 Ga0500630_003168 Ga0500630_003168_876_1352 151
446 3300053163 Ga0500639_000047 Ga0500639_000047_43730_44206 151
447 3300053735 Ga0500596_003610 Ga0500596_003610_1782_2258 151
448 3300060353 Ga0501082_0473518 Ga0501082_0473518_285_743 151
449 3300061734 Ga0530510_0576680 Ga0530510_0576680_227_688 151
450 3300003771 Ga0055526_1017989 Ga0055526_10179892 152
451 3300003794 Ga0055531_10015237 Ga0055531_100152372 152
452 3300004625 Ga0055543_1025049 Ga0055543_10250492 152
453 3300005262 Ga0065165_1000490 Ga0065165_100049045 152
454 3300005434 Ga0070709_10026841 Ga0070709_100268412 152
455 3300005435 Ga0070714_100176322 Ga0070714_1001763222 152
456 3300005437 Ga0070710_10052966 Ga0070710_100529662 152
457 3300005437 Ga0070710_10109467 Ga0070710_101094672 152
458 3300005439 Ga0070711_100019243 Ga0070711_1000192432 152
459 3300005439 Ga0070711_100137094 Ga0070711_1001370942 152
460 3300005439 Ga0070711_100187298 Ga0070711_1001872982 152
461 3300005457 Ga0070662_101229062 Ga0070662_1012290621 152
462 3300005546 Ga0070696_100115548 Ga0070696_1001155482 152
463 3300005842 Ga0068858_100807547 Ga0068858_1008075472 152
464 3300005983 Ga0081540_1104017 Ga0081540_11040172 152
465 3300006028 Ga0070717_10033606 Ga0070717_100336064 152
466 3300006028 Ga0070717_10158061 Ga0070717_101580612 152
467 3300006163 Ga0070715_10005486 Ga0070715_100054862 152
468 3300006173 Ga0070716_100221099 Ga0070716_1002210992 152
469 3300006175 Ga0070712_100237032 Ga0070712_1002370322 152
470 3300006186 Ga0075369_10008829 Ga0075369_100088292 152
471 3300006195 Ga0075366_10079958 Ga0075366_100799582 152
472 3300006844 Ga0075428_100129484 Ga0075428_1001294842 152
473 3300006844 Ga0075428_100213687 Ga0075428_1002136873 152
474 3300006846 Ga0075430_100365188 Ga0075430_1003651882 152
475 3300006852 Ga0075433_10739008 Ga0075433_107390082 152
476 3300006871 Ga0075434_100074195 Ga0075434_1000741952 152
477 3300006880 Ga0075429_100065686 Ga0075429_1000656863 152
478 3300006914 Ga0075436_100177970 Ga0075436_1001779702 152
479 3300007076 Ga0075435_100117975 Ga0075435_1001179752 152
480 3300009093 Ga0105240_10095466 Ga0105240_100954662 152
481 3300009094 Ga0111539_10617194 Ga0111539_106171942 152
482 3300009147 Ga0114129_10283516 Ga0114129_102835162 152
483 3300009147 Ga0114129_11024268 Ga0114129_110242682 152
484 3300009553 Ga0105249_11518156 Ga0105249_115181561 152
485 3300010159 Ga0099796_10115822 Ga0099796_101158222 152
486 3300013105 Ga0157369_10004521 Ga0157369_1000452110 152
487 3300013306 Ga0163162_10181605 Ga0163162_101816052 152
488 3300021358 Ga0213873_10071571 Ga0213873_100715712 152
489 3300021361 Ga0213872_10000071 Ga0213872_1000007114 152
490 3300021361 Ga0213872_10003152 Ga0213872_100031522 152
491 3300021361 Ga0213872_10059439 Ga0213872_100594392 152
492 3300021377 Ga0213874_10179083 Ga0213874_101790832 152
493 3300021441 Ga0213871_10024857 Ga0213871_100248572 152
494 3300025295 Ga0209564_1000283 Ga0209564_100028310 152
495 3300025304 Ga0209257_1000264 Ga0209257_100026463 152
496 3300025898 Ga0207692_10083636 Ga0207692_100836362 152
497 3300025898 Ga0207692_10247372 Ga0207692_102473721 152
498 3300025905 Ga0207685_10073115 Ga0207685_100731152 152
499 3300025906 Ga0207699_10016761 Ga0207699_100167612 152
500 3300025913 Ga0207695_10098915 Ga0207695_100989152 152
501 3300025915 Ga0207693_10016897 Ga0207693_100168973 152
502 3300025915 Ga0207693_10052095 Ga0207693_100520953 152
503 3300025915 Ga0207693_10154990 Ga0207693_101549902 152
504 3300025915 Ga0207693_10161001 Ga0207693_101610012 152
505 3300025916 Ga0207663_10122286 Ga0207663_101222862 152
506 3300025916 Ga0207663_10144307 Ga0207663_101443072 152
507 3300025916 Ga0207663_10271920 Ga0207663_102719202 152
508 3300025922 Ga0207646_10123363 Ga0207646_101233632 152
509 3300025928 Ga0207700_10013731 Ga0207700_100137313 152
510 3300025929 Ga0207664_10460911 Ga0207664_104609112 152
511 3300025939 Ga0207665_10001976 Ga0207665_100019762 152
512 3300025939 Ga0207665_10019541 Ga0207665_100195413 152
513 3300026035 Ga0207703_10895219 Ga0207703_108952192 152
514 3300026075 Ga0207708_11089557 Ga0207708_110895572 152
515 3300028794 Ga0307515_10093088 Ga0307515_100930883 152
516 3300030522 Ga0307512_10172021 Ga0307512_101720212 152
517 3300031090 Ga0265760_10339073 Ga0265760_103390731 152
518 3300031730 Ga0307516_10000499 Ga0307516_1000049915 152
519 3300039438 Ga0436360_0058815 Ga0436360_0058815_114_587 152
520 3300039438 Ga0436360_0380383 Ga0436360_0380383_7888_8358 152
521 3300039438 Ga0436360_0517441 Ga0436360_0517441_1049_1519 152
522 3300039438 Ga0436360_0914568 Ga0436360_0914568_10846_11331 152
523 3300039447 Ga0436361_0157085 Ga0436361_0157085_295_765 152
524 3300039447 Ga0436361_0384722 Ga0436361_0384722_3806_4291 152
525 3300039447 Ga0436361_0484676 Ga0436361_0484676_1704_2174 152
526 3300039447 Ga0436361_0652142 Ga0436361_0652142_36_506 152
527 3300039447 Ga0436361_0788442 Ga0436361_0788442_30_500 152
528 3300039447 Ga0436361_0895187 Ga0436361_0895187_75601_76074 152
529 3300039447 Ga0436361_0910912 Ga0436361_0910912_52_537 152
530 3300039447 Ga0436361_0923671 Ga0436361_0923671_2035_2508 152
531 3300039447 Ga0436361_1097826 Ga0436361_1097826_935_1408 152
532 3300039450 Ga0436363_0963290 Ga0436363_0963290_36_506 152
533 3300039453 Ga0436362_0063915 Ga0436362_0063915_2705_3190 152
534 3300039453 Ga0436362_0955192 Ga0436362_0955192_320_805 152
535 3300039453 Ga0436362_1210783 Ga0436362_1210783_600_1070 152
536 3300041456 Ga0451795_1304938 Ga0451795_1304938_628_1092 152
537 3300041505 Ga0451849_0220963 Ga0451849_0220963_177_653 152
538 3300044712 Ga0453684_0000951 Ga0453684_0000951_41182_41646 152
539 3300045051 Ga0451576_0003996 Ga0451576_0003996_6210_6674 152
540 3300046460 Ga0495638_0169811 Ga0495638_0169811_243_707 152
541 3300046471 Ga0495650_0000007 Ga0495650_0000007_530340_530804 152
542 3300046471 Ga0495650_0063018 Ga0495650_0063018_602_1066 152
543 3300046492 Ga0495585_0013190 Ga0495585_0013190_2663_3196 152
544 3300046515 Ga0495620_0061257 Ga0495620_0061257_920_1408 152
545 3300046517 Ga0495630_1027872 Ga0495630_1027872_45_518 152
546 3300046519 Ga0495632_0018888 Ga0495632_0018888_1325_1789 152
547 3300046520 Ga0495637_0042169 Ga0495637_0042169_1221_1685 152
548 3300046524 Ga0495648_0000039 Ga0495648_0000039_133836_134324 152
549 3300046529 Ga0495652_0103129 Ga0495652_0103129_979_1446 152
550 3300046529 Ga0495652_0622100 Ga0495652_0622100_129_662 152
551 3300046530 Ga0495654_0000053 Ga0495654_0000053_33727_34191 152
552 3300046642 Ga0495634_0634917 Ga0495634_0634917_41_574 152
553 3300046660 Ga0495625_0000683 Ga0495625_0000683_1174_1638 152
554 3300046660 Ga0495625_0004788 Ga0495625_0004788_1189_1653 152
555 3300046660 Ga0495625_0007535 Ga0495625_0007535_1606_2070 152
556 3300046660 Ga0495625_0009883 Ga0495625_0009883_2655_3119 152
557 3300046660 Ga0495625_0387504 Ga0495625_0387504_147_611 152
558 3300046692 Ga0495671_0250159 Ga0495671_0250159_28_492 152
559 3300047469 Ga0495673_0000148 Ga0495673_0000148_87911_88399 152
560 3300047472 Ga0495686_0010996 Ga0495686_0010996_5546_6010 152
561 3300047472 Ga0495686_0015143 Ga0495686_0015143_1619_2107 152
562 3300047472 Ga0495686_0063473 Ga0495686_0063473_665_1129 152
563 3300048904 Ga0496101_0072322 Ga0496101_0072322_1259_1723 152
564 3300048905 Ga0496102_1527023 Ga0496102_1527023_69_542 152
565 3300048909 Ga0496106_0208732 Ga0496106_0208732_885_1349 152
566 3300048910 Ga0496107_0000113 Ga0496107_0000113_10593_11057 152
567 3300048911 Ga0496108_0305201 Ga0496108_0305201_279_752 152
568 3300048916 Ga0496113_0820937 Ga0496113_0820937_76_540 152
569 3300048921 Ga0496118_0072464 Ga0496118_0072464_1888_2355 152
570 3300048921 Ga0496118_0294034 Ga0496118_0294034_373_840 152
571 3300048921 Ga0496118_0322079 Ga0496118_0322079_32_499 152
572 3300048923 Ga0496120_0053556 Ga0496120_0053556_1209_1676 152
573 3300048924 Ga0496121_0000197 Ga0496121_0000197_75803_76270 152
574 3300048924 Ga0496121_0002319 Ga0496121_0002319_7915_8379 152
575 3300048924 Ga0496121_0038189 Ga0496121_0038189_190_657 152
576 3300048924 Ga0496121_0282033 Ga0496121_0282033_179_646 152
577 3300048925 Ga0496122_0015369 Ga0496122_0015369_1518_1985 152
578 3300048926 Ga0496123_0008845 Ga0496123_0008845_4409_4876 152
579 3300048929 Ga0496126_0002536 Ga0496126_0002536_7319_7783 152
580 3300048929 Ga0496126_0091443 Ga0496126_0091443_1842_2306 152
581 3300049582 Ga0501048_0125570 Ga0501048_0125570_357_827 152
582 3300049823 Ga0501044_0179264 Ga0501044_0179264_35_505 152
583 3300050491 nmdc:mga00v17_111656_c1 nmdc:mga00v17_111656_c1_1251_1724 152
584 3300050493 nmdc:mga0k408_76832_c1 nmdc:mga0k408_76832_c1_1344_1808 152
585 3300050507 nmdc:mga05p37_792441_c1 nmdc:mga05p37_792441_c1_82_555 152
586 3300050509 nmdc:mga0qj67_501783_c1 nmdc:mga0qj67_501783_c1_479_952 152
587 3300050513 nmdc:mga0rr50_150110_c1 nmdc:mga0rr50_150110_c1_996_1463 152
588 3300050513 nmdc:mga0rr50_168753_c1 nmdc:mga0rr50_168753_c1_961_1434 152
589 3300050515 nmdc:mga0a205_645359_c1 nmdc:mga0a205_645359_c1_45_512 152
590 3300050516 nmdc:mga0sz30_65059_c1 nmdc:mga0sz30_65059_c1_687_1175 152
591 3300053087 Ga0500643_017572 Ga0500643_017572_1827_2315 152
592 3300053088 Ga0500644_0000241 Ga0500644_0000241_1897_2385 152
593 3300053102 Ga0500554_001170 Ga0500554_001170_3466_3930 152
594 3300053125 Ga0500618_006400 Ga0500618_006400_1411_1878 152
595 3300053136 Ga0500559_0000015 Ga0500559_0000015_10863_11327 152
596 3300053138 Ga0500564_000200 Ga0500564_000200_11444_11932 152
597 3300053142 Ga0500577_0010853 Ga0500577_0010853_654_1142 152
598 3300053146 Ga0500588_0150619 Ga0500588_0150619_84_554 152
599 3300053151 Ga0500604_0008017 Ga0500604_0008017_2064_2540 152
600 3300053153 Ga0500616_0013843 Ga0500616_0013843_2180_2644 152
601 3300053158 Ga0500627_0041165 Ga0500627_0041165_1390_1854 152
602 3300001979 JGI24740J21852_10082966 JGI24740J21852_100829661 153
603 3300001989 JGI24739J22299_10027145 JGI24739J22299_100271451 153
604 3300002067 JGI24735J21928_10072852 JGI24735J21928_100728521 153
605 3300002705 JGI25156J39149_1001597 JGI25156J39149_10015972 153
606 3300002705 JGI25156J39149_1016641 JGI25156J39149_10166412 153
607 3300002737 JGI25162J39368_1006156 JGI25162J39368_10061561 153
608 3300002741 JGI25157J39369_1001161 JGI25157J39369_10011614 153
609 3300002741 JGI25157J39369_1001478 JGI25157J39369_10014786 153
610 3300002772 JGI25164J39214_1000198 JGI25164J39214_100019839 153
611 3300003214 JGI25165J46597_1000354 JGI25165J46597_100035439 153
612 3300003316 rootH1_10024611 rootH1_100246112 153
613 3300003752 Ga0055539_1001188 Ga0055539_10011882 153
614 3300003756 Ga0055533_1014903 Ga0055533_10149031 153
615 3300003758 Ga0055532_1000185 Ga0055532_100018521 153
616 3300003758 Ga0055532_1000217 Ga0055532_100021725 153
617 3300003759 Ga0055525_1000059 Ga0055525_100005966 153
618 3300003760 Ga0055527_1000050 Ga0055527_100005066 153
619 3300003760 Ga0055527_1000128 Ga0055527_100012817 153
620 3300003760 Ga0055527_1001996 Ga0055527_10019962 153
621 3300003760 Ga0055527_1006915 Ga0055527_10069152 153
622 3300003761 Ga0055535_1000119 Ga0055535_100011948 153
623 3300003761 Ga0055535_1000206 Ga0055535_10002062 153
624 3300003761 Ga0055535_1000212 Ga0055535_100021234 153
625 3300003761 Ga0055535_1000287 Ga0055535_100028731 153
626 3300003761 Ga0055535_1000295 Ga0055535_100029536 153
627 3300003762 Ga0055542_1000057 Ga0055542_100005757 153
628 3300003762 Ga0055542_1000119 Ga0055542_100011966 153
629 3300003762 Ga0055542_1000238 Ga0055542_100023826 153
630 3300003762 Ga0055542_1000311 Ga0055542_100031131 153
631 3300003762 Ga0055542_1000966 Ga0055542_10009663 153
632 3300003763 Ga0055529_1000049 Ga0055529_100004965 153
633 3300003763 Ga0055529_1000270 Ga0055529_100027025 153
634 3300003763 Ga0055529_1000329 Ga0055529_100032917 153
635 3300003763 Ga0055529_1000884 Ga0055529_10008847 153
636 3300003790 Ga0055528_1000986 Ga0055528_10009868 153
637 3300003841 Ga0055541_1015339 Ga0055541_10153392 153
638 3300005295 Ga0065707_10020820 Ga0065707_100208202 153
639 3300005327 Ga0070658_10019732 Ga0070658_100197322 153
640 3300005328 Ga0070676_10460293 Ga0070676_104602932 153
641 3300005339 Ga0070660_100000004 Ga0070660_100000004107 153
642 3300005356 Ga0070674_100058186 Ga0070674_1000581862 153
643 3300005366 Ga0070659_100000023 Ga0070659_10000002390 153
644 3300005455 Ga0070663_100003816 Ga0070663_1000038163 153
645 3300005563 Ga0068855_100008161 Ga0068855_1000081612 153
646 3300005564 Ga0070664_100140946 Ga0070664_1001409461 153
647 3300005614 Ga0068856_100000455 Ga0068856_10000045530 153
648 3300005616 Ga0068852_100015181 Ga0068852_1000151812 153
649 3300005719 Ga0068861_100067402 Ga0068861_1000674022 153
650 3300005842 Ga0068858_100306012 Ga0068858_1003060122 153
651 3300005844 Ga0068862_100027705 Ga0068862_1000277053 153
652 3300005981 Ga0081538_10010333 Ga0081538_100103332 153
653 3300006846 Ga0075430_100382421 Ga0075430_1003824212 153
654 3300009092 Ga0105250_10019883 Ga0105250_100198833 153
655 3300009093 Ga0105240_10001353 Ga0105240_1000135319 153
656 3300009093 Ga0105240_10132247 Ga0105240_101322472 153
657 3300009093 Ga0105240_10335475 Ga0105240_103354751 153
658 3300009094 Ga0111539_10305921 Ga0111539_103059212 153
659 3300009098 Ga0105245_10041617 Ga0105245_100416172 153
660 3300009147 Ga0114129_10772223 Ga0114129_107722232 153
661 3300009148 Ga0105243_10291796 Ga0105243_102917962 153
662 3300009177 Ga0105248_11411424 Ga0105248_114114242 153
663 3300009545 Ga0105237_10004165 Ga0105237_100041652 153
664 3300009551 Ga0105238_10008672 Ga0105238_100086724 153
665 3300009551 Ga0105238_10021470 Ga0105238_100214709 153
666 3300009988 Ga0105035_107571 Ga0105035_1075711 153
667 3300010375 Ga0105239_10005104 Ga0105239_1000510410 153
668 3300013104 Ga0157370_10276222 Ga0157370_102762222 153
669 3300013105 Ga0157369_10504677 Ga0157369_105046772 153
670 3300013875 Ga0157515_126273 Ga0157515_1262732 153
671 3300014326 Ga0157380_10240941 Ga0157380_102409412 153
672 3300014326 Ga0157380_10603157 Ga0157380_106031571 153
673 3300015261 Ga0182006_1014936 Ga0182006_10149363 153
674 3300015261 Ga0182006_1021466 Ga0182006_10214662 153
675 3300015262 Ga0182007_10000106 Ga0182007_1000010626 153
676 3300025225 Ga0209566_100408 Ga0209566_10040821 153
677 3300025226 Ga0209674_100026 Ga0209674_100026156 153
678 3300025226 Ga0209674_101565 Ga0209674_1015653 153
679 3300025226 Ga0209674_102480 Ga0209674_1024805 153
680 3300025228 Ga0209672_100007 Ga0209672_100007754 153
681 3300025228 Ga0209672_100017 Ga0209672_100017296 153
682 3300025228 Ga0209672_100065 Ga0209672_100065147 153
683 3300025228 Ga0209672_100173 Ga0209672_10017311 153
684 3300025228 Ga0209672_100857 Ga0209672_1008572 153
685 3300025229 Ga0209147_100044 Ga0209147_10004468 153
686 3300025229 Ga0209147_100124 Ga0209147_10012486 153
687 3300025230 Ga0209563_100074 Ga0209563_100074107 153
688 3300025231 Ga0207427_100213 Ga0207427_10021310 153
689 3300025233 Ga0209437_100381 Ga0209437_10038139 153
690 3300025242 Ga0209258_100017 Ga0209258_10001766 153
691 3300025242 Ga0209258_100031 Ga0209258_100031147 153
692 3300025242 Ga0209258_100038 Ga0209258_10003816 153
693 3300025242 Ga0209258_100118 Ga0209258_10011846 153
694 3300025242 Ga0209258_100144 Ga0209258_10014481 153
695 3300025246 Ga0209646_1000824 Ga0209646_10008246 153
696 3300025250 Ga0209026_1000044 Ga0209026_1000044135 153
697 3300025250 Ga0209026_1000431 Ga0209026_100043128 153
698 3300025253 Ga0209677_107487 Ga0209677_1074874 153
699 3300025254 Ga0209148_1000009 Ga0209148_1000009916 153
700 3300025254 Ga0209148_1000024 Ga0209148_1000024331 153
701 3300025254 Ga0209148_1000027 Ga0209148_1000027147 153
702 3300025254 Ga0209148_1000044 Ga0209148_100004466 153
703 3300025254 Ga0209148_1000141 Ga0209148_100014156 153
704 3300025256 Ga0209759_1000517 Ga0209759_10005176 153
705 3300025256 Ga0209759_1000779 Ga0209759_10007792 153
706 3300025261 Ga0209233_1000323 Ga0209233_100032310 153
707 3300025272 Ga0209455_1000010 Ga0209455_1000010754 153
708 3300025272 Ga0209455_1000025 Ga0209455_1000025331 153
709 3300025272 Ga0209455_1000032 Ga0209455_1000032296 153
710 3300025272 Ga0209455_1000058 Ga0209455_1000058105 153
711 3300025272 Ga0209455_1001839 Ga0209455_10018396 153
712 3300025273 Ga0209673_1000059 Ga0209673_100005965 153
713 3300025711 Ga0207696_1074758 Ga0207696_10747581 153
714 3300025904 Ga0207647_10004854 Ga0207647_100048544 153
715 3300025909 Ga0207705_10112777 Ga0207705_101127772 153
716 3300025913 Ga0207695_10000203 Ga0207695_1000020344 153
717 3300025913 Ga0207695_10000273 Ga0207695_1000027359 153
718 3300025913 Ga0207695_10597292 Ga0207695_105972922 153
719 3300025913 Ga0207695_10780400 Ga0207695_107804001 153
720 3300025914 Ga0207671_10313390 Ga0207671_103133902 153
721 3300025919 Ga0207657_10000001 Ga0207657_1000000151 153
722 3300025920 Ga0207649_10388800 Ga0207649_103888001 153
723 3300025923 Ga0207681_10010470 Ga0207681_100104703 153
724 3300025924 Ga0207694_10050890 Ga0207694_100508902 153
725 3300025924 Ga0207694_10499828 Ga0207694_104998281 153
726 3300025932 Ga0207690_10000029 Ga0207690_1000002994 153
727 3300025937 Ga0207669_10070655 Ga0207669_100706552 153
728 3300025945 Ga0207679_10549384 Ga0207679_105493841 153
729 3300025949 Ga0207667_10003915 Ga0207667_100039153 153
730 3300025961 Ga0207712_10202145 Ga0207712_102021452 153
731 3300026035 Ga0207703_10442763 Ga0207703_104427632 153
732 3300026067 Ga0207678_10000227 Ga0207678_100002274 153
733 3300026075 Ga0207708_10763063 Ga0207708_107630631 153
734 3300026078 Ga0207702_10002529 Ga0207702_100025298 153
735 3300026118 Ga0207675_100085125 Ga0207675_1000851252 153
736 3300026142 Ga0207698_10024704 Ga0207698_100247042 153
737 3300027312 Ga0209371_1000129 Ga0209371_100012959 153
738 3300028380 Ga0268265_10308291 Ga0268265_103082912 153
739 3300030500 Ga0268256_1000133 Ga0268256_100013348 153
740 3300037312 Ga0395899_0000062 Ga0395899_0000062_194715_195176 153
741 3300037312 Ga0395899_0000167 Ga0395899_0000167_40959_41456 153
742 3300037312 Ga0395899_0051027 Ga0395899_0051027_576_1037 153
743 3300037418 Ga0395900_0000009 Ga0395900_0000009_364922_365419 153
744 3300037418 Ga0395900_0000039 Ga0395900_0000039_95784_96245 153
745 3300037466 Ga0395898_0000069 Ga0395898_0000069_91201_91662 153
746 3300037466 Ga0395898_0000140 Ga0395898_0000140_16170_16631 153
747 3300037466 Ga0395898_0259449 Ga0395898_0259449_830_1327 153
748 3300037471 Ga0395905_0019189 Ga0395905_0019189_80_577 153
749 3300038443 Ga0395901_0000014 Ga0395901_0000014_316128_316625 153
750 3300038443 Ga0395901_1521625 Ga0395901_1521625_86_547 153
751 3300039437 Ga0436365_1737587 Ga0436365_1737587_751_1212 153
752 3300042006 Ga0439432_063004 Ga0439432_063004_563_1030 153
753 3300042876 Ga0451577_0070218 Ga0451577_0070218_1010_1486 153
754 3300044656 Ga0466969_0013964 Ga0466969_0013964_2489_2950 153
755 3300044683 Ga0466965_0325808 Ga0466965_0325808_220_681 153
756 3300044684 Ga0466966_0021400 Ga0466966_0021400_1510_1971 153
757 3300044693 Ga0466961_0019310 Ga0466961_0019310_3894_4355 153
758 3300044693 Ga0466961_0035203 Ga0466961_0035203_271_732 153
759 3300044693 Ga0466961_0072126 Ga0466961_0072126_1050_1511 153
760 3300044693 Ga0466961_0128385 Ga0466961_0128385_976_1437 153
761 3300044694 Ga0466963_0232258 Ga0466963_0232258_666_1127 153
762 3300044719 Ga0466971_0002070 Ga0466971_0002070_2836_3297 153
763 3300044765 Ga0466970_0000163 Ga0466970_0000163_19917_20378 153
764 3300044765 Ga0466970_0279741 Ga0466970_0279741_309_770 153
765 3300044842 Ga0466957_0002878 Ga0466957_0002878_3186_3647 153
766 3300045049 Ga0466959_0000383 Ga0466959_0000383_1047_1508 153
767 3300045049 Ga0466959_0068211 Ga0466959_0068211_1298_1759 153
768 3300045049 Ga0466959_0169300 Ga0466959_0169300_291_752 153
769 3300045049 Ga0466959_0486696 Ga0466959_0486696_18_479 153
770 3300045836 Ga0466958_0145503 Ga0466958_0145503_782_1243 153
771 3300046453 Ga0495627_000483 Ga0495627_000483_15446_15949 153
772 3300046691 Ga0495670_0647241 Ga0495670_0647241_89_556 153
773 3300047469 Ga0495673_0000377 Ga0495673_0000377_3429_3932 153
774 3300048919 Ga0496116_0010230 Ga0496116_0010230_3502_3978 153
775 3300048920 Ga0496117_0485986 Ga0496117_0485986_10_486 153
776 3300048921 Ga0496118_0042016 Ga0496118_0042016_2737_3198 153
777 3300048928 Ga0496125_0249106 Ga0496125_0249106_392_856 153
778 3300048929 Ga0496126_0076035 Ga0496126_0076035_1858_2334 153
779 3300049824 Ga0501045_0733848 Ga0501045_0733848_88_549 153
780 3300050507 nmdc:mga05p37_116569_c1 nmdc:mga05p37_116569_c1_2162_2629 153
781 3300050509 nmdc:mga0qj67_218183_c1 nmdc:mga0qj67_218183_c1_812_1279 153
782 3300054114 Ga0501084_0470074 Ga0501084_0470074_154_630 153
783 3300061719 Ga0466962_0001068 Ga0466962_0001068_4789_5250 153
784 3300061734 Ga0530510_0357863 Ga0530510_0357863_468_929 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

108

180

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

40

108

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9816 2 150
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9617 2 150
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9611 2 149
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9555 2 149
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9502 2 150
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9783 2 74 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9741 2 72 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9643 2 74 3.10.20.30
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9626 82 150 1.10.150.120
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9556 2 74 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A7Y5QJI1-F1-model_v4 (2Fe-2S)-binding protein 0.9924 2 150 GO:0016491
GO:0046872
GO:0051537
AF-A0A7V9BKS3-F1-model_v4 (2Fe-2S)-binding protein 0.992 2 150 GO:0016491
GO:0046872
GO:0051537
AF-A0A191ZHF8-F1-model_v4 (2Fe-2S)-binding protein 0.9916 2 148 GO:0016491
GO:0046872
GO:0051537
AF-A0A1X9X044-F1-model_v4 MmAcDH small subunit 0.9914 1 133 GO:0016491
GO:0046872
GO:0051537
AF-A0A349TGJ4-F1-model_v4 (2Fe-2S)-binding protein 0.9913 2 140 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
94.06 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map