F480257
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 775 | 316 | 755 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_11371068|Ga0114129_113710682 |
| Length | 124 |
| Sequence | MLALVLTFYLEERGMSDAATVHLTEANFDETLTGHQGLLMVDFWAEWCGPCRAIAPVLEDLARESAGRVTLAKVNVDENHTLAGRYGIRSIPTILFVKAGKVVDQVIGAIPKAKLKEKLDALAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 2 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 3 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 4 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 5 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 6 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 7 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 8 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 9 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 10 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 11 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 12 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 13 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 14 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 15 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 16 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 17 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 18 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 19 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 20 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 21 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 22 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 27 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 28 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 29 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 30 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 98 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 129 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 135 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 192 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 194 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 204 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 206 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 207 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 208 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 209 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 210 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 215 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 241 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 242 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 243 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 244 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 245 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 246 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 247 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 248 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 249 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 250 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 288 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 303 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 304 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 305 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 308 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.77 |
| Metatranscriptomes | 4.65 |
| Isolates | 2.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.03 |
| Nodule | 0 |
| Rhizoplane | 1.94 |
| Rhizosphere | 92.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10003171 | 3300002067 | Bacteria | 5625 |
| 2 | Ga0006759J45824_1059206 | 3300003163 | Bacteria | 750 |
| 3 | JGI25406J46586_10013729 | 3300003203 | Bacteria | 3466 |
| 4 | rootL2_10164021 | 3300003322 | Bacteria | 2948 |
| 5 | Ga0007417J51691_1051599 | 3300003544 | Bacteria | 1262 |
| 6 | Ga0007410J51695_1035448 | 3300003574 | Bacteria | 586 |
| 7 | Ga0007416J51690_1104318 | 3300003577 | Bacteria | 556 |
| 8 | Ga0058860_11742682 | 3300004801 | Bacteria | 721 |
| 9 | Ga0058862_12425548 | 3300004803 | Bacteria | 503 |
| 10 | Ga0065714_10026164 | 3300005288 | Bacteria | 1660 |
| 11 | Ga0065707_10012883 | 3300005295 | Bacteria | 1925 |
| 12 | Ga0065707_10132300 | 3300005295 | Bacteria | 1899 |
| 13 | Ga0065707_10153745 | 3300005295 | Bacteria | 1630 |
| 14 | Ga0065707_10261562 | 3300005295 | Bacteria | 1096 |
| 15 | Ga0065707_10444041 | 3300005295 | Bacteria | 807 |
| 16 | Ga0070658_10060932 | 3300005327 | Bacteria | 3074 |
| 17 | Ga0070676_10452395 | 3300005328 | Bacteria | 903 |
| 18 | Ga0070690_100202217 | 3300005330 | Bacteria | 1383 |
| 19 | Ga0070690_100336971 | 3300005330 | Bacteria | 1091 |
| 20 | Ga0070690_100463167 | 3300005330 | Bacteria | 942 |
| 21 | Ga0068869_100637188 | 3300005334 | Bacteria | 904 |
| 22 | Ga0070680_100089298 | 3300005336 | Bacteria | 2550 |
| 23 | Ga0070680_100260247 | 3300005336 | Bacteria | 1468 |
| 24 | Ga0070682_100592502 | 3300005337 | Bacteria | 874 |
| 25 | Ga0070660_101520589 | 3300005339 | Bacteria | 569 |
| 26 | Ga0070689_100248841 | 3300005340 | Bacteria | 1466 |
| 27 | Ga0070689_100895352 | 3300005340 | Bacteria | 785 |
| 28 | Ga0070689_100905476 | 3300005340 | Bacteria | 781 |
| 29 | Ga0070689_101185010 | 3300005340 | Bacteria | 685 |
| 30 | Ga0070687_100331451 | 3300005343 | Bacteria | 976 |
| 31 | Ga0070687_100404560 | 3300005343 | Bacteria | 896 |
| 32 | Ga0070692_10036760 | 3300005345 | Bacteria | 2487 |
| 33 | Ga0070692_11051185 | 3300005345 | Bacteria | 572 |
| 34 | Ga0070668_100126770 | 3300005347 | Bacteria | 2045 |
| 35 | Ga0070669_100032356 | 3300005353 | Bacteria | 3778 |
| 36 | Ga0070669_100119199 | 3300005353 | Bacteria | 2011 |
| 37 | Ga0070669_100294457 | 3300005353 | Unclassified | 1304 |
| 38 | Ga0070675_100470062 | 3300005354 | Unclassified | 1130 |
| 39 | Ga0070674_101179831 | 3300005356 | Bacteria | 679 |
| 40 | Ga0070673_101285428 | 3300005364 | Bacteria | 687 |
| 41 | Ga0070659_100437325 | 3300005366 | Bacteria | 1108 |
| 42 | Ga0070703_10173814 | 3300005406 | Bacteria | 827 |
| 43 | Ga0070701_10638138 | 3300005438 | Unclassified | 710 |
| 44 | Ga0070701_11192322 | 3300005438 | Bacteria | 540 |
| 45 | Ga0070705_100010699 | 3300005440 | Bacteria | 4601 |
| 46 | Ga0070705_100029993 | 3300005440 | Bacteria | 2999 |
| 47 | Ga0070705_100908666 | 3300005440 | Bacteria | 709 |
| 48 | Ga0070700_100360579 | 3300005441 | Bacteria | 1081 |
| 49 | Ga0070700_100600944 | 3300005441 | Bacteria | 862 |
| 50 | Ga0070700_101923582 | 3300005441 | Bacteria | 512 |
| 51 | Ga0070694_100076889 | 3300005444 | Bacteria | 2312 |
| 52 | Ga0070694_100154711 | 3300005444 | Bacteria | 1678 |
| 53 | Ga0070694_100189936 | 3300005444 | Bacteria | 1525 |
| 54 | Ga0070694_100398024 | 3300005444 | Bacteria | 1077 |
| 55 | Ga0070694_100474505 | 3300005444 | Bacteria | 992 |
| 56 | Ga0070708_100000456 | 3300005445 | Bacteria | 30655 |
| 57 | Ga0070708_100004479 | 3300005445 | Bacteria | 10986 |
| 58 | Ga0070708_100034475 | 3300005445 | Bacteria | 4405 |
| 59 | Ga0070708_100206866 | 3300005445 | Bacteria | 1838 |
| 60 | Ga0070708_100251233 | 3300005445 | Bacteria | 1661 |
| 61 | Ga0070708_100504070 | 3300005445 | Unclassified | 1142 |
| 62 | Ga0070708_100839961 | 3300005445 | Bacteria | 863 |
| 63 | Ga0070662_100014208 | 3300005457 | Bacteria | 5314 |
| 64 | Ga0070662_100898119 | 3300005457 | Bacteria | 756 |
| 65 | Ga0070681_10161989 | 3300005458 | Bacteria | 2161 |
| 66 | Ga0068867_100036249 | 3300005459 | Bacteria | 3580 |
| 67 | Ga0068867_100164969 | 3300005459 | Bacteria | 1750 |
| 68 | Ga0070706_100027842 | 3300005467 | Bacteria | 5198 |
| 69 | Ga0070706_100047435 | 3300005467 | Bacteria | 3963 |
| 70 | Ga0070706_100159454 | 3300005467 | Bacteria | 2106 |
| 71 | Ga0070706_100224521 | 3300005467 | Bacteria | 1753 |
| 72 | Ga0070706_101012264 | 3300005467 | Bacteria | 766 |
| 73 | Ga0070706_102097885 | 3300005467 | Bacteria | 511 |
| 74 | Ga0070707_100000758 | 3300005468 | Bacteria | 31816 |
| 75 | Ga0070707_100028839 | 3300005468 | Bacteria | 5282 |
| 76 | Ga0070707_100033492 | 3300005468 | Bacteria | 4899 |
| 77 | Ga0070698_100002218 | 3300005471 | Bacteria | 21496 |
| 78 | Ga0070698_100319863 | 3300005471 | Bacteria | 1482 |
| 79 | Ga0070698_100718095 | 3300005471 | Bacteria | 942 |
| 80 | Ga0070698_101141686 | 3300005471 | Bacteria | 728 |
| 81 | Ga0070699_100000498 | 3300005518 | Bacteria | 37320 |
| 82 | Ga0070699_100033177 | 3300005518 | Bacteria | 4460 |
| 83 | Ga0070699_100043461 | 3300005518 | Bacteria | 3889 |
| 84 | Ga0070699_100151355 | 3300005518 | Bacteria | 2052 |
| 85 | Ga0070699_100286899 | 3300005518 | Bacteria | 1475 |
| 86 | Ga0070699_100556661 | 3300005518 | Bacteria | 1044 |
| 87 | Ga0070699_100973751 | 3300005518 | Bacteria | 778 |
| 88 | Ga0070679_100972905 | 3300005530 | Bacteria | 792 |
| 89 | Ga0070697_100001129 | 3300005536 | Bacteria | 20201 |
| 90 | Ga0070697_100017366 | 3300005536 | Bacteria | 5661 |
| 91 | Ga0070697_100074426 | 3300005536 | Bacteria | 2790 |
| 92 | Ga0070697_100116744 | 3300005536 | Bacteria | 2229 |
| 93 | Ga0070697_100221432 | 3300005536 | Unclassified | 1613 |
| 94 | Ga0070697_100700559 | 3300005536 | Bacteria | 894 |
| 95 | Ga0070697_101232400 | 3300005536 | Bacteria | 667 |
| 96 | Ga0068853_100699015 | 3300005539 | Bacteria | 967 |
| 97 | Ga0068853_102453598 | 3300005539 | Bacteria | 505 |
| 98 | Ga0070672_100810116 | 3300005543 | Bacteria | 824 |
| 99 | Ga0070686_100418032 | 3300005544 | Bacteria | 1024 |
| 100 | Ga0070686_101750835 | 3300005544 | Bacteria | 528 |
| 101 | Ga0070695_100059011 | 3300005545 | Bacteria | 2483 |
| 102 | Ga0070695_100145506 | 3300005545 | Bacteria | 1648 |
| 103 | Ga0070695_100448793 | 3300005545 | Bacteria | 988 |
| 104 | Ga0070695_100647699 | 3300005545 | Bacteria | 834 |
| 105 | Ga0070695_100797224 | 3300005545 | Bacteria | 757 |
| 106 | Ga0070695_101607339 | 3300005545 | Bacteria | 543 |
| 107 | Ga0070696_100074115 | 3300005546 | Bacteria | 2400 |
| 108 | Ga0070696_100170592 | 3300005546 | Bacteria | 1608 |
| 109 | Ga0070696_101447942 | 3300005546 | Bacteria | 587 |
| 110 | Ga0070704_100078316 | 3300005549 | Bacteria | 2425 |
| 111 | Ga0070704_100555737 | 3300005549 | Bacteria | 1003 |
| 112 | Ga0070704_100588603 | 3300005549 | Bacteria | 976 |
| 113 | Ga0070704_101515582 | 3300005549 | Bacteria | 617 |
| 114 | Ga0070704_101990577 | 3300005549 | Bacteria | 539 |
| 115 | Ga0068857_100096186 | 3300005577 | Bacteria | 2654 |
| 116 | Ga0068854_100514622 | 3300005578 | Bacteria | 1010 |
| 117 | Ga0068854_100899105 | 3300005578 | Bacteria | 778 |
| 118 | Ga0070702_100426204 | 3300005615 | Bacteria | 956 |
| 119 | Ga0070702_100506494 | 3300005615 | Bacteria | 888 |
| 120 | Ga0070702_101202331 | 3300005615 | Bacteria | 611 |
| 121 | Ga0068859_100019419 | 3300005617 | Bacteria | 6826 |
| 122 | Ga0068859_100063359 | 3300005617 | Bacteria | 3728 |
| 123 | Ga0068859_100201133 | 3300005617 | Bacteria | 2077 |
| 124 | Ga0068859_101527906 | 3300005617 | Bacteria | 737 |
| 125 | Ga0068864_100195694 | 3300005618 | Bacteria | 1855 |
| 126 | Ga0068864_101719118 | 3300005618 | Bacteria | 632 |
| 127 | Ga0068866_10336332 | 3300005718 | Bacteria | 955 |
| 128 | Ga0068866_10541919 | 3300005718 | Bacteria | 777 |
| 129 | Ga0068861_100354774 | 3300005719 | Bacteria | 1288 |
| 130 | Ga0068861_100692281 | 3300005719 | Bacteria | 946 |
| 131 | Ga0068861_100961276 | 3300005719 | Bacteria | 813 |
| 132 | Ga0068870_10685190 | 3300005840 | Bacteria | 706 |
| 133 | Ga0068870_10775180 | 3300005840 | Bacteria | 668 |
| 134 | Ga0068863_100156607 | 3300005841 | Bacteria | 2181 |
| 135 | Ga0068863_100422415 | 3300005841 | Bacteria | 1306 |
| 136 | Ga0068858_100051407 | 3300005842 | Bacteria | 3813 |
| 137 | Ga0068858_101559214 | 3300005842 | Bacteria | 652 |
| 138 | Ga0068860_100471376 | 3300005843 | Unclassified | 1250 |
| 139 | Ga0068860_100558820 | 3300005843 | Bacteria | 1147 |
| 140 | Ga0068860_100654788 | 3300005843 | Bacteria | 1058 |
| 141 | Ga0068860_100680405 | 3300005843 | Bacteria | 1038 |
| 142 | Ga0068860_102310457 | 3300005843 | Bacteria | 558 |
| 143 | Ga0068862_100062629 | 3300005844 | Unclassified | 3199 |
| 144 | Ga0068862_100072772 | 3300005844 | Bacteria | 2970 |
| 145 | Ga0068862_100909682 | 3300005844 | Bacteria | 865 |
| 146 | Ga0081455_10109316 | 3300005937 | Bacteria | 2200 |
| 147 | Ga0081540_1043478 | 3300005983 | Bacteria | 2304 |
| 148 | Ga0081539_10001809 | 3300005985 | Bacteria | 33796 |
| 149 | Ga0075367_10180255 | 3300006178 | Bacteria | 1317 |
| 150 | Ga0075427_10000681 | 3300006194 | Bacteria | 4052 |
| 151 | Ga0075370_10751422 | 3300006353 | Bacteria | 594 |
| 152 | Ga0075428_100001846 | 3300006844 | Bacteria | 22712 |
| 153 | Ga0075428_100003298 | 3300006844 | Bacteria | 17657 |
| 154 | Ga0075428_100005773 | 3300006844 | Bacteria | 13743 |
| 155 | Ga0075428_100071462 | 3300006844 | Bacteria | 3793 |
| 156 | Ga0075428_100210274 | 3300006844 | Bacteria | 2102 |
| 157 | Ga0075428_100420289 | 3300006844 | Bacteria | 1432 |
| 158 | Ga0075428_100464275 | 3300006844 | Bacteria | 1355 |
| 159 | Ga0075428_100665376 | 3300006844 | Bacteria | 1110 |
| 160 | Ga0075428_100961041 | 3300006844 | Bacteria | 905 |
| 161 | Ga0075430_100000087 | 3300006846 | Bacteria | 52758 |
| 162 | Ga0075430_100000851 | 3300006846 | Bacteria | 23937 |
| 163 | Ga0075430_100034167 | 3300006846 | Bacteria | 4315 |
| 164 | Ga0075430_100509418 | 3300006846 | Bacteria | 993 |
| 165 | Ga0075430_101085859 | 3300006846 | Bacteria | 659 |
| 166 | Ga0075430_101594603 | 3300006846 | Bacteria | 536 |
| 167 | Ga0075430_101658453 | 3300006846 | Bacteria | 525 |
| 168 | Ga0075431_100000280 | 3300006847 | Bacteria | 39760 |
| 169 | Ga0075431_100000559 | 3300006847 | Bacteria | 31330 |
| 170 | Ga0075431_100007752 | 3300006847 | Bacteria | 10694 |
| 171 | Ga0075431_100039734 | 3300006847 | Bacteria | 4848 |
| 172 | Ga0075431_100051697 | 3300006847 | Bacteria | 4237 |
| 173 | Ga0075431_100068763 | 3300006847 | Bacteria | 3654 |
| 174 | Ga0075431_100120761 | 3300006847 | Bacteria | 2704 |
| 175 | Ga0075431_100126605 | 3300006847 | Bacteria | 2636 |
| 176 | Ga0075431_100266142 | 3300006847 | Bacteria | 1738 |
| 177 | Ga0075431_100551051 | 3300006847 | Bacteria | 1140 |
| 178 | Ga0075431_101675951 | 3300006847 | Bacteria | 593 |
| 179 | Ga0075433_10000147 | 3300006852 | Bacteria | 37403 |
| 180 | Ga0075433_10000942 | 3300006852 | Bacteria | 20529 |
| 181 | Ga0075433_10019113 | 3300006852 | Bacteria | 5700 |
| 182 | Ga0075433_10024441 | 3300006852 | Bacteria | 5099 |
| 183 | Ga0075433_10060713 | 3300006852 | Bacteria | 3311 |
| 184 | Ga0075433_10234916 | 3300006852 | Bacteria | 1628 |
| 185 | Ga0075433_10259002 | 3300006852 | Bacteria | 1542 |
| 186 | Ga0075433_10297718 | 3300006852 | Bacteria | 1429 |
| 187 | Ga0075433_10315471 | 3300006852 | Bacteria | 1383 |
| 188 | Ga0075433_10781418 | 3300006852 | Bacteria | 835 |
| 189 | Ga0075434_100000540 | 3300006871 | Bacteria | 28804 |
| 190 | Ga0075434_100017703 | 3300006871 | Bacteria | 6869 |
| 191 | Ga0075434_100114034 | 3300006871 | Bacteria | 2715 |
| 192 | Ga0075434_100133256 | 3300006871 | Bacteria | 2504 |
| 193 | Ga0075434_100536474 | 3300006871 | Bacteria | 1190 |
| 194 | Ga0075434_101025856 | 3300006871 | Bacteria | 839 |
| 195 | Ga0075429_100000843 | 3300006880 | Bacteria | 24082 |
| 196 | Ga0075429_100000958 | 3300006880 | Bacteria | 22882 |
| 197 | Ga0075429_100023270 | 3300006880 | Bacteria | 5373 |
| 198 | Ga0075429_100053228 | 3300006880 | Bacteria | 3522 |
| 199 | Ga0075429_100104139 | 3300006880 | Bacteria | 2478 |
| 200 | Ga0075429_100219412 | 3300006880 | Bacteria | 1666 |
| 201 | Ga0075429_100295710 | 3300006880 | Bacteria | 1418 |
| 202 | Ga0075429_100334855 | 3300006880 | Bacteria | 1325 |
| 203 | Ga0075429_100356463 | 3300006880 | Bacteria | 1281 |
| 204 | Ga0075429_100722780 | 3300006880 | Bacteria | 872 |
| 205 | Ga0068865_100070365 | 3300006881 | Bacteria | 2479 |
| 206 | Ga0068865_100292113 | 3300006881 | Bacteria | 1301 |
| 207 | Ga0075436_100000316 | 3300006914 | Bacteria | 30801 |
| 208 | Ga0075436_100011766 | 3300006914 | Bacteria | 6006 |
| 209 | Ga0075436_100051257 | 3300006914 | Bacteria | 2848 |
| 210 | Ga0075436_100067904 | 3300006914 | Bacteria | 2463 |
| 211 | Ga0075436_100746527 | 3300006914 | Bacteria | 727 |
| 212 | Ga0097620_100019419 | 3300006931 | Bacteria | 6826 |
| 213 | Ga0097620_100063359 | 3300006931 | Bacteria | 3728 |
| 214 | Ga0097620_100201116 | 3300006931 | Bacteria | 2077 |
| 215 | Ga0097620_101528306 | 3300006931 | Bacteria | 737 |
| 216 | Ga0075435_100003722 | 3300007076 | Bacteria | 10386 |
| 217 | Ga0075435_100015844 | 3300007076 | Bacteria | 5674 |
| 218 | Ga0075435_100022826 | 3300007076 | Bacteria | 4830 |
| 219 | Ga0075435_100076730 | 3300007076 | Bacteria | 2739 |
| 220 | Ga0075435_101075912 | 3300007076 | Bacteria | 703 |
| 221 | Ga0075435_102021957 | 3300007076 | Bacteria | 506 |
| 222 | Ga0075435_102063376 | 3300007076 | Bacteria | 501 |
| 223 | Ga0099794_10041868 | 3300007265 | Bacteria | 2182 |
| 224 | Ga0099794_10493869 | 3300007265 | Bacteria | 644 |
| 225 | Ga0105250_10208379 | 3300009092 | Bacteria | 826 |
| 226 | Ga0105240_12569481 | 3300009093 | Bacteria | 526 |
| 227 | Ga0111539_10000675 | 3300009094 | Bacteria | 44135 |
| 228 | Ga0111539_10001562 | 3300009094 | Bacteria | 30480 |
| 229 | Ga0111539_10594127 | 3300009094 | Bacteria | 1289 |
| 230 | Ga0111539_10997441 | 3300009094 | Bacteria | 973 |
| 231 | Ga0111539_11067343 | 3300009094 | Bacteria | 939 |
| 232 | Ga0111539_11182412 | 3300009094 | Bacteria | 888 |
| 233 | Ga0111539_11215873 | 3300009094 | Bacteria | 875 |
| 234 | Ga0111539_11492152 | 3300009094 | Bacteria | 784 |
| 235 | Ga0105247_10008646 | 3300009101 | Bacteria | 6207 |
| 236 | Ga0105247_10589909 | 3300009101 | Bacteria | 822 |
| 237 | Ga0114129_10000331 | 3300009147 | Bacteria | 55274 |
| 238 | Ga0114129_10000487 | 3300009147 | Bacteria | 47969 |
| 239 | Ga0114129_10001127 | 3300009147 | Bacteria | 35311 |
| 240 | Ga0114129_10001268 | 3300009147 | Bacteria | 33724 |
| 241 | Ga0114129_10005736 | 3300009147 | Bacteria | 17593 |
| 242 | Ga0114129_10021639 | 3300009147 | Bacteria | 9125 |
| 243 | Ga0114129_10056215 | 3300009147 | Bacteria | 5513 |
| 244 | Ga0114129_10105186 | 3300009147 | Bacteria | 3901 |
| 245 | Ga0114129_10184181 | 3300009147 | Bacteria | 2839 |
| 246 | Ga0114129_10260766 | 3300009147 | Bacteria | 2323 |
| 247 | Ga0114129_10338740 | 3300009147 | Bacteria | 1995 |
| 248 | Ga0114129_10380485 | 3300009147 | Bacteria | 1864 |
| 249 | Ga0114129_10395081 | 3300009147 | Bacteria | 1823 |
| 250 | Ga0114129_10615478 | 3300009147 | Bacteria | 1405 |
| 251 | Ga0114129_10949635 | 3300009147 | Bacteria | 1086 |
| 252 | Ga0114129_11048358 | 3300009147 | Bacteria | 1024 |
| 253 | Ga0114129_11371068 | 3300009147 | Bacteria | 874 |
| 254 | Ga0114129_11575551 | 3300009147 | Bacteria | 805 |
| 255 | Ga0105243_10159032 | 3300009148 | Bacteria | 1946 |
| 256 | Ga0105243_10249501 | 3300009148 | Bacteria | 1584 |
| 257 | Ga0105243_10584384 | 3300009148 | Unclassified | 1073 |
| 258 | Ga0105241_10063776 | 3300009174 | Bacteria | 2844 |
| 259 | Ga0105241_10653564 | 3300009174 | Bacteria | 955 |
| 260 | Ga0105242_10360527 | 3300009176 | Bacteria | 1345 |
| 261 | Ga0105242_10581274 | 3300009176 | Bacteria | 1079 |
| 262 | Ga0105242_10666146 | 3300009176 | Bacteria | 1014 |
| 263 | Ga0105242_11039901 | 3300009176 | Bacteria | 829 |
| 264 | Ga0105248_10050018 | 3300009177 | Bacteria | 4687 |
| 265 | Ga0105248_11046538 | 3300009177 | Bacteria | 922 |
| 266 | Ga0105248_11239952 | 3300009177 | Bacteria | 843 |
| 267 | Ga0105238_10849849 | 3300009551 | Bacteria | 930 |
| 268 | Ga0105249_10159286 | 3300009553 | Bacteria | 2180 |
| 269 | Ga0105249_10720544 | 3300009553 | Bacteria | 1058 |
| 270 | Ga0105249_10872284 | 3300009553 | Bacteria | 966 |
| 271 | Ga0105249_12246246 | 3300009553 | Bacteria | 618 |
| 272 | Ga0105239_10745446 | 3300010375 | Bacteria | 1121 |
| 273 | Ga0105246_11615608 | 3300011119 | Bacteria | 613 |
| 274 | Ga0105246_11965356 | 3300011119 | Bacteria | 563 |
| 275 | Ga0157373_10271315 | 3300013100 | Bacteria | 1201 |
| 276 | Ga0157373_10274538 | 3300013100 | Bacteria | 1194 |
| 277 | Ga0157370_11876273 | 3300013104 | Bacteria | 538 |
| 278 | Ga0157369_10254394 | 3300013105 | Bacteria | 1833 |
| 279 | Ga0157369_11631262 | 3300013105 | Bacteria | 656 |
| 280 | Ga0157378_10154275 | 3300013297 | Bacteria | 2142 |
| 281 | Ga0157378_10185814 | 3300013297 | Bacteria | 1957 |
| 282 | Ga0157378_10403895 | 3300013297 | Bacteria | 1347 |
| 283 | Ga0163162_10174171 | 3300013306 | Bacteria | 2276 |
| 284 | Ga0163162_10276875 | 3300013306 | Bacteria | 1810 |
| 285 | Ga0163162_10498904 | 3300013306 | Bacteria | 1348 |
| 286 | Ga0163162_10731301 | 3300013306 | Bacteria | 1110 |
| 287 | Ga0163162_12157351 | 3300013306 | Bacteria | 639 |
| 288 | Ga0157372_11311620 | 3300013307 | Bacteria | 835 |
| 289 | Ga0157375_11712207 | 3300013308 | Bacteria | 744 |
| 290 | Ga0163163_12364864 | 3300014325 | Bacteria | 590 |
| 291 | Ga0157380_10281802 | 3300014326 | Bacteria | 1521 |
| 292 | Ga0157380_10415902 | 3300014326 | Bacteria | 1281 |
| 293 | Ga0157380_11268875 | 3300014326 | Bacteria | 783 |
| 294 | Ga0157380_11451023 | 3300014326 | Bacteria | 738 |
| 295 | Ga0182008_10000154 | 3300014497 | Bacteria | 54086 |
| 296 | Ga0157379_11579587 | 3300014968 | Bacteria | 640 |
| 297 | Ga0182006_1000010 | 3300015261 | Bacteria | 413414 |
| 298 | Ga0182007_10000030 | 3300015262 | Bacteria | 156866 |
| 299 | Ga0182007_10306555 | 3300015262 | Bacteria | 584 |
| 300 | Ga0182005_1000009 | 3300015265 | Bacteria | 455334 |
| 301 | Ga0163161_10097797 | 3300017792 | Unclassified | 2180 |
| 302 | Ga0163161_10277679 | 3300017792 | Bacteria | 1313 |
| 303 | Ga0163161_10641556 | 3300017792 | Bacteria | 879 |
| 304 | Ga0197907_10518326 | 3300020069 | Bacteria | 1019 |
| 305 | Ga0197907_11509585 | 3300020069 | Bacteria | 1361 |
| 306 | Ga0206356_11505530 | 3300020070 | Bacteria | 560 |
| 307 | Ga0206356_11723322 | 3300020070 | Bacteria | 1362 |
| 308 | Ga0206355_1045112 | 3300020076 | Bacteria | 1732 |
| 309 | Ga0206355_1660841 | 3300020076 | Bacteria | 1362 |
| 310 | Ga0206351_10349927 | 3300020077 | Bacteria | 532 |
| 311 | Ga0206351_10717643 | 3300020077 | Bacteria | 1691 |
| 312 | Ga0206350_10668403 | 3300020080 | Bacteria | 851 |
| 313 | Ga0206350_10675512 | 3300020080 | Bacteria | 580 |
| 314 | Ga0206354_10238434 | 3300020081 | Bacteria | 910 |
| 315 | Ga0206353_11625478 | 3300020082 | Bacteria | 996 |
| 316 | Ga0206353_11636605 | 3300020082 | Bacteria | 1857 |
| 317 | Ga0154015_1649135 | 3300020610 | Bacteria | 621 |
| 318 | Ga0213872_10045108 | 3300021361 | Bacteria | 2005 |
| 319 | Ga0224712_10325278 | 3300022467 | Bacteria | 723 |
| 320 | Ga0207653_10229060 | 3300025885 | Bacteria | 707 |
| 321 | Ga0207653_10416094 | 3300025885 | Bacteria | 527 |
| 322 | Ga0207642_10066530 | 3300025899 | Bacteria | 1697 |
| 323 | Ga0207710_10009004 | 3300025900 | Bacteria | 4201 |
| 324 | Ga0207710_10481757 | 3300025900 | Bacteria | 643 |
| 325 | Ga0207647_10030040 | 3300025904 | Bacteria | 3510 |
| 326 | Ga0207645_10584017 | 3300025907 | Bacteria | 758 |
| 327 | Ga0207705_10829031 | 3300025909 | Bacteria | 717 |
| 328 | Ga0207684_10000456 | 3300025910 | Bacteria | 53373 |
| 329 | Ga0207684_10012314 | 3300025910 | Bacteria | 7444 |
| 330 | Ga0207684_10100931 | 3300025910 | Bacteria | 2466 |
| 331 | Ga0207684_10245616 | 3300025910 | Bacteria | 1544 |
| 332 | Ga0207684_10377903 | 3300025910 | Unclassified | 1218 |
| 333 | Ga0207684_10755786 | 3300025910 | Bacteria | 824 |
| 334 | Ga0207654_10474226 | 3300025911 | Bacteria | 881 |
| 335 | Ga0207654_11050256 | 3300025911 | Bacteria | 593 |
| 336 | Ga0207707_10022676 | 3300025912 | Bacteria | 5491 |
| 337 | Ga0207695_10018581 | 3300025913 | Bacteria | 8032 |
| 338 | Ga0207660_10004184 | 3300025917 | Bacteria | 9390 |
| 339 | Ga0207660_10163738 | 3300025917 | Bacteria | 1718 |
| 340 | Ga0207662_10296709 | 3300025918 | Bacteria | 1073 |
| 341 | Ga0207662_10422183 | 3300025918 | Bacteria | 908 |
| 342 | Ga0207662_10478153 | 3300025918 | Bacteria | 855 |
| 343 | Ga0207646_10000483 | 3300025922 | Bacteria | 53346 |
| 344 | Ga0207646_10025881 | 3300025922 | Bacteria | 5365 |
| 345 | Ga0207646_10691579 | 3300025922 | Bacteria | 912 |
| 346 | Ga0207646_11083479 | 3300025922 | Bacteria | 706 |
| 347 | Ga0207681_10027358 | 3300025923 | Bacteria | 3686 |
| 348 | Ga0207681_10123915 | 3300025923 | Bacteria | 1900 |
| 349 | Ga0207681_10727092 | 3300025923 | Bacteria | 826 |
| 350 | Ga0207681_11425898 | 3300025923 | Bacteria | 581 |
| 351 | Ga0207659_10348611 | 3300025926 | Bacteria | 1228 |
| 352 | Ga0207659_10440834 | 3300025926 | Bacteria | 1095 |
| 353 | Ga0207690_10400913 | 3300025932 | Bacteria | 1094 |
| 354 | Ga0207690_10660973 | 3300025932 | Bacteria | 857 |
| 355 | Ga0207706_10025259 | 3300025933 | Bacteria | 5325 |
| 356 | Ga0207706_10513723 | 3300025933 | Bacteria | 1033 |
| 357 | Ga0207706_10686269 | 3300025933 | Bacteria | 875 |
| 358 | Ga0207686_10298763 | 3300025934 | Bacteria | 1195 |
| 359 | Ga0207709_10048104 | 3300025935 | Bacteria | 2597 |
| 360 | Ga0207709_11060097 | 3300025935 | Bacteria | 664 |
| 361 | Ga0207709_11197348 | 3300025935 | Bacteria | 626 |
| 362 | Ga0207670_10125627 | 3300025936 | Bacteria | 1871 |
| 363 | Ga0207670_10167964 | 3300025936 | Bacteria | 1643 |
| 364 | Ga0207670_10638097 | 3300025936 | Bacteria | 877 |
| 365 | Ga0207670_11549867 | 3300025936 | Bacteria | 563 |
| 366 | Ga0207704_10332817 | 3300025938 | Bacteria | 1176 |
| 367 | Ga0207704_10625395 | 3300025938 | Bacteria | 884 |
| 368 | Ga0207691_10506303 | 3300025940 | Bacteria | 1025 |
| 369 | Ga0207711_10034666 | 3300025941 | Bacteria | 4275 |
| 370 | Ga0207689_10193380 | 3300025942 | Unclassified | 1679 |
| 371 | Ga0207712_10197938 | 3300025961 | Bacteria | 1591 |
| 372 | Ga0207712_10346561 | 3300025961 | Bacteria | 1233 |
| 373 | Ga0207668_10315614 | 3300025972 | Bacteria | 1295 |
| 374 | Ga0207668_10398212 | 3300025972 | Bacteria | 1163 |
| 375 | Ga0207658_11527172 | 3300025986 | Bacteria | 611 |
| 376 | Ga0207639_11061188 | 3300026041 | Bacteria | 759 |
| 377 | Ga0207708_11235640 | 3300026075 | Bacteria | 654 |
| 378 | Ga0207648_10113523 | 3300026089 | Bacteria | 2379 |
| 379 | Ga0207648_10194930 | 3300026089 | Bacteria | 1796 |
| 380 | Ga0207648_10467731 | 3300026089 | Bacteria | 1150 |
| 381 | Ga0207648_10770747 | 3300026089 | Bacteria | 894 |
| 382 | Ga0207676_11254722 | 3300026095 | Bacteria | 735 |
| 383 | Ga0207676_11310529 | 3300026095 | Bacteria | 719 |
| 384 | Ga0207674_10259842 | 3300026116 | Bacteria | 1684 |
| 385 | Ga0207675_100313294 | 3300026118 | Bacteria | 1531 |
| 386 | Ga0207675_100525775 | 3300026118 | Bacteria | 1180 |
| 387 | Ga0207675_101002170 | 3300026118 | Bacteria | 854 |
| 388 | Ga0207675_101875580 | 3300026118 | Bacteria | 618 |
| 389 | Ga0209968_1019566 | 3300027526 | Bacteria | 1090 |
| 390 | Ga0210002_1009917 | 3300027617 | Bacteria | 1457 |
| 391 | Ga0209588_1015659 | 3300027671 | Bacteria | 2333 |
| 392 | Ga0207428_10000095 | 3300027907 | Bacteria | 123199 |
| 393 | Ga0207428_10034391 | 3300027907 | Bacteria | 4153 |
| 394 | Ga0207428_10119790 | 3300027907 | Bacteria | 2019 |
| 395 | Ga0207428_10410040 | 3300027907 | Bacteria | 991 |
| 396 | Ga0207428_10632903 | 3300027907 | Bacteria | 769 |
| 397 | Ga0207428_10692369 | 3300027907 | Bacteria | 729 |
| 398 | Ga0268266_10932088 | 3300028379 | Bacteria | 840 |
| 399 | Ga0268265_10014082 | 3300028380 | Bacteria | 5450 |
| 400 | Ga0268265_10193837 | 3300028380 | Bacteria | 1757 |
| 401 | Ga0268265_10411269 | 3300028380 | Bacteria | 1253 |
| 402 | Ga0268264_10433688 | 3300028381 | Bacteria | 1269 |
| 403 | Ga0268264_10633397 | 3300028381 | Bacteria | 1057 |
| 404 | Ga0268264_11742507 | 3300028381 | Bacteria | 633 |
| 405 | Ga0265336_10068429 | 3300028666 | Bacteria | 1062 |
| 406 | Ga0265324_10064446 | 3300029957 | Bacteria | 1250 |
| 407 | Ga0307513_10515257 | 3300031456 | Bacteria | 912 |
| 408 | Ga0307513_10913006 | 3300031456 | Bacteria | 586 |
| 409 | Ga0307408_100000180 | 3300031548 | Bacteria | 70740 |
| 410 | Ga0307408_100640253 | 3300031548 | Bacteria | 949 |
| 411 | Ga0307405_11473073 | 3300031731 | Bacteria | 597 |
| 412 | Ga0307413_10462485 | 3300031824 | Bacteria | 1010 |
| 413 | Ga0307410_10436390 | 3300031852 | Bacteria | 1065 |
| 414 | Ga0307406_10754048 | 3300031901 | Bacteria | 817 |
| 415 | Ga0307406_12127202 | 3300031901 | Bacteria | 503 |
| 416 | Ga0307407_10367490 | 3300031903 | Bacteria | 1023 |
| 417 | Ga0307416_100158133 | 3300032002 | Bacteria | 2090 |
| 418 | Ga0307416_101062386 | 3300032002 | Bacteria | 914 |
| 419 | Ga0373958_0121516 | 3300034819 | Bacteria | 631 |
| 420 | Ga0373928_0118662 | 3300035084 | Bacteria | 707 |
| 421 | Ga0373940_0103220 | 3300035088 | Bacteria | 868 |
| 422 | Ga0373940_0335680 | 3300035088 | Bacteria | 527 |
| 423 | Ga0373949_0220662 | 3300035090 | Bacteria | 576 |
| 424 | Ga0373951_0260370 | 3300035091 | Bacteria | 524 |
| 425 | Ga0373952_0034016 | 3300035092 | Bacteria | 1147 |
| 426 | Ga0373952_0117988 | 3300035092 | Bacteria | 717 |
| 427 | Ga0373932_0095443 | 3300035112 | Bacteria | 960 |
| 428 | Ga0373939_0109957 | 3300035114 | Bacteria | 958 |
| 429 | Ga0373941_0148440 | 3300035115 | Bacteria | 858 |
| 430 | Ga0373960_0106195 | 3300035121 | Bacteria | 916 |
| 431 | Ga0373961_0102627 | 3300035241 | Bacteria | 928 |
| 432 | Ga0373961_0274793 | 3300035241 | Unclassified | 616 |
| 433 | Ga0373962_0175012 | 3300035242 | Bacteria | 715 |
| 434 | Ga0373931_0000964 | 3300035691 | Bacteria | 12154 |
| 435 | Ga0373931_0007284 | 3300035691 | Bacteria | 5206 |
| 436 | Ga0373931_0693325 | 3300035691 | Bacteria | 672 |
| 437 | Ga0395900_0001056 | 3300037418 | Bacteria | 35315 |
| 438 | Ga0395898_0204071 | 3300037466 | Bacteria | 1886 |
| 439 | Ga0395905_1484260 | 3300037471 | Bacteria | 582 |
| 440 | Ga0395901_0792448 | 3300038443 | Bacteria | 937 |
| 441 | Ga0436361_0216395 | 3300039447 | Bacteria | 3423 |
| 442 | Ga0451793_0052380 | 3300041452 | Bacteria | 1169 |
| 443 | Ga0451837_1531230 | 3300041494 | Bacteria | 589 |
| 444 | Ga0439456_023753 | 3300042013 | Bacteria | 1300 |
| 445 | Ga0439446_0109943 | 3300042156 | Bacteria | 878 |
| 446 | Ga0439435_0023476 | 3300042436 | Bacteria | 1620 |
| 447 | Ga0439435_0068112 | 3300042436 | Bacteria | 1049 |
| 448 | Ga0439460_0057644 | 3300042461 | Bacteria | 1179 |
| 449 | Ga0451577_0078197 | 3300042876 | Bacteria | 2950 |
| 450 | Ga0453683_1069691 | 3300044673 | Bacteria | 537 |
| 451 | Ga0466957_0096241 | 3300044842 | Bacteria | 1860 |
| 452 | Ga0451576_0052534 | 3300045051 | Bacteria | 4270 |
| 453 | Ga0451576_0434765 | 3300045051 | Bacteria | 1377 |
| 454 | Ga0451576_0440113 | 3300045051 | Bacteria | 1368 |
| 455 | Ga0451576_0641850 | 3300045051 | Bacteria | 1115 |
| 456 | Ga0451576_1172289 | 3300045051 | Bacteria | 803 |
| 457 | Ga0451576_1784002 | 3300045051 | Bacteria | 636 |
| 458 | Ga0466958_0703481 | 3300045836 | Bacteria | 658 |
| 459 | Ga0495638_0269228 | 3300046460 | Bacteria | 930 |
| 460 | Ga0495580_0000020 | 3300046472 | Bacteria | 91314 |
| 461 | Ga0495584_0097944 | 3300046491 | Bacteria | 1482 |
| 462 | Ga0495610_0001145 | 3300046512 | Bacteria | 24124 |
| 463 | Ga0495643_0000225 | 3300046522 | Bacteria | 86508 |
| 464 | Ga0495648_0222952 | 3300046524 | Bacteria | 928 |
| 465 | Ga0495648_0249888 | 3300046524 | Bacteria | 856 |
| 466 | Ga0495663_0014636 | 3300046525 | Bacteria | 2200 |
| 467 | Ga0495663_0184589 | 3300046525 | Bacteria | 724 |
| 468 | Ga0495642_0070793 | 3300046528 | Bacteria | 1458 |
| 469 | Ga0495642_0123422 | 3300046528 | Bacteria | 1112 |
| 470 | Ga0495656_0117906 | 3300046615 | Bacteria | 1249 |
| 471 | Ga0495656_0334379 | 3300046615 | Bacteria | 782 |
| 472 | Ga0495668_0004430 | 3300046616 | Bacteria | 9974 |
| 473 | Ga0495611_0130569 | 3300046648 | Bacteria | 1172 |
| 474 | Ga0495625_0343933 | 3300046660 | Bacteria | 944 |
| 475 | Ga0495669_0020303 | 3300046684 | Bacteria | 2874 |
| 476 | Ga0495669_0068615 | 3300046684 | Bacteria | 1613 |
| 477 | Ga0495669_0350258 | 3300046684 | Bacteria | 714 |
| 478 | Ga0495670_0376326 | 3300046691 | Bacteria | 766 |
| 479 | Ga0495670_0506212 | 3300046691 | Bacteria | 656 |
| 480 | Ga0495649_0066771 | 3300046694 | Bacteria | 1930 |
| 481 | Ga0495636_0408408 | 3300047318 | Bacteria | 648 |
| 482 | Ga0495672_0000385 | 3300047320 | Bacteria | 54448 |
| 483 | Ga0495677_0010939 | 3300047445 | Bacteria | 3324 |
| 484 | Ga0495677_0430370 | 3300047445 | Bacteria | 523 |
| 485 | Ga0495685_052074 | 3300047447 | Bacteria | 1387 |
| 486 | Ga0496101_0613329 | 3300048904 | Bacteria | 860 |
| 487 | Ga0496102_0000013 | 3300048905 | Bacteria | 311668 |
| 488 | Ga0496102_0000107 | 3300048905 | Bacteria | 118250 |
| 489 | Ga0496102_0076749 | 3300048905 | Bacteria | 3074 |
| 490 | Ga0496102_0215505 | 3300048905 | Bacteria | 1810 |
| 491 | Ga0496103_0000105 | 3300048906 | Bacteria | 92467 |
| 492 | Ga0496103_0046899 | 3300048906 | Bacteria | 2668 |
| 493 | Ga0496103_0251136 | 3300048906 | Bacteria | 1138 |
| 494 | Ga0496106_0099984 | 3300048909 | Bacteria | 2249 |
| 495 | Ga0496106_0671889 | 3300048909 | Bacteria | 827 |
| 496 | Ga0496108_0079443 | 3300048911 | Bacteria | 2778 |
| 497 | Ga0496109_0491050 | 3300048912 | Bacteria | 1159 |
| 498 | Ga0496111_0088145 | 3300048914 | Bacteria | 2272 |
| 499 | Ga0496111_0706247 | 3300048914 | Bacteria | 733 |
| 500 | Ga0496116_0091628 | 3300048919 | Bacteria | 1846 |
| 501 | Ga0496117_0000010 | 3300048920 | Bacteria | 611954 |
| 502 | Ga0496117_0093728 | 3300048920 | Bacteria | 1925 |
| 503 | Ga0496118_0000009 | 3300048921 | Bacteria | 611954 |
| 504 | Ga0496118_0018871 | 3300048921 | Bacteria | 6189 |
| 505 | Ga0496119_0051039 | 3300048922 | Bacteria | 2545 |
| 506 | Ga0496121_0005651 | 3300048924 | Bacteria | 15909 |
| 507 | Ga0496121_0053352 | 3300048924 | Bacteria | 3388 |
| 508 | Ga0496122_0007348 | 3300048925 | Bacteria | 12286 |
| 509 | Ga0496122_0015575 | 3300048925 | Bacteria | 7257 |
| 510 | Ga0496123_0002281 | 3300048926 | Bacteria | 24132 |
| 511 | Ga0496123_0007323 | 3300048926 | Bacteria | 10460 |
| 512 | Ga0496124_0138974 | 3300048927 | Bacteria | 1919 |
| 513 | Ga0496125_0018476 | 3300048928 | Bacteria | 6621 |
| 514 | Ga0501307_009855 | 3300049162 | Bacteria | 1098 |
| 515 | Ga0501307_048570 | 3300049162 | Bacteria | 633 |
| 516 | Ga0495678_001252 | 3300049459 | Bacteria | 20667 |
| 517 | Ga0501313_000344 | 3300049529 | Bacteria | 3016 |
| 518 | Ga0501315_007556 | 3300049531 | Bacteria | 1241 |
| 519 | Ga0501315_051933 | 3300049531 | Bacteria | 646 |
| 520 | Ga0501316_003385 | 3300049532 | Bacteria | 1544 |
| 521 | Ga0501317_030292 | 3300049533 | Bacteria | 782 |
| 522 | Ga0501320_058998 | 3300049536 | Bacteria | 536 |
| 523 | Ga0501031_0008878 | 3300049568 | Bacteria | 6535 |
| 524 | Ga0501031_0924314 | 3300049568 | Bacteria | 558 |
| 525 | Ga0501032_0022737 | 3300049569 | Bacteria | 4344 |
| 526 | Ga0501032_0249933 | 3300049569 | Bacteria | 1151 |
| 527 | Ga0501033_0006614 | 3300049570 | Bacteria | 9063 |
| 528 | Ga0501033_0006638 | 3300049570 | Bacteria | 9048 |
| 529 | Ga0501033_0015044 | 3300049570 | Bacteria | 5872 |
| 530 | Ga0501033_0135413 | 3300049570 | Bacteria | 1782 |
| 531 | Ga0501033_0247938 | 3300049570 | Bacteria | 1263 |
| 532 | Ga0501033_1033618 | 3300049570 | Bacteria | 548 |
| 533 | Ga0501034_0512181 | 3300049571 | Bacteria | 1112 |
| 534 | Ga0501034_1020043 | 3300049571 | Bacteria | 711 |
| 535 | Ga0501036_0000860 | 3300049572 | Bacteria | 22572 |
| 536 | Ga0501036_0038196 | 3300049572 | Bacteria | 4063 |
| 537 | Ga0501036_0061288 | 3300049572 | Bacteria | 3187 |
| 538 | Ga0501037_0120915 | 3300049573 | Bacteria | 1883 |
| 539 | Ga0501037_0133937 | 3300049573 | Bacteria | 1775 |
| 540 | Ga0501038_0001811 | 3300049574 | Bacteria | 19789 |
| 541 | Ga0501038_0007523 | 3300049574 | Bacteria | 10041 |
| 542 | Ga0501038_0123383 | 3300049574 | Bacteria | 2134 |
| 543 | Ga0501038_0863433 | 3300049574 | Bacteria | 670 |
| 544 | Ga0501039_0003590 | 3300049575 | Bacteria | 11632 |
| 545 | Ga0501039_0033847 | 3300049575 | Bacteria | 3942 |
| 546 | Ga0501039_0084380 | 3300049575 | Bacteria | 2474 |
| 547 | Ga0501039_0123796 | 3300049575 | Bacteria | 2027 |
| 548 | Ga0501039_0496823 | 3300049575 | Bacteria | 958 |
| 549 | Ga0501039_0800020 | 3300049575 | Bacteria | 735 |
| 550 | Ga0501040_0006253 | 3300049576 | Bacteria | 7728 |
| 551 | Ga0501040_0218857 | 3300049576 | Bacteria | 1355 |
| 552 | Ga0501041_0002688 | 3300049577 | Bacteria | 10140 |
| 553 | Ga0501041_0050199 | 3300049577 | Bacteria | 2542 |
| 554 | Ga0501041_0148491 | 3300049577 | Bacteria | 1463 |
| 555 | Ga0501041_0399930 | 3300049577 | Bacteria | 870 |
| 556 | Ga0501041_0707705 | 3300049577 | Bacteria | 645 |
| 557 | Ga0501042_0002889 | 3300049578 | Bacteria | 10663 |
| 558 | Ga0501042_0002934 | 3300049578 | Bacteria | 10590 |
| 559 | Ga0501042_0078030 | 3300049578 | Bacteria | 2372 |
| 560 | Ga0501042_0089306 | 3300049578 | Bacteria | 2211 |
| 561 | Ga0501042_0112374 | 3300049578 | Bacteria | 1961 |
| 562 | Ga0501042_0162058 | 3300049578 | Bacteria | 1614 |
| 563 | Ga0501043_0039590 | 3300049579 | Bacteria | 3704 |
| 564 | Ga0501043_0105147 | 3300049579 | Bacteria | 2218 |
| 565 | Ga0501046_0002460 | 3300049580 | Bacteria | 17375 |
| 566 | Ga0501046_0110602 | 3300049580 | Bacteria | 2099 |
| 567 | Ga0501046_0254075 | 3300049580 | Bacteria | 1293 |
| 568 | Ga0501046_0260783 | 3300049580 | Bacteria | 1273 |
| 569 | Ga0501047_0095003 | 3300049581 | Bacteria | 2860 |
| 570 | Ga0501047_0384053 | 3300049581 | Bacteria | 1239 |
| 571 | Ga0501048_0005635 | 3300049582 | Bacteria | 9524 |
| 572 | Ga0501048_0023088 | 3300049582 | Bacteria | 4547 |
| 573 | Ga0501048_0334812 | 3300049582 | Bacteria | 1079 |
| 574 | Ga0501048_0597310 | 3300049582 | Bacteria | 792 |
| 575 | Ga0501048_1354751 | 3300049582 | Bacteria | 511 |
| 576 | Ga0501068_0038347 | 3300049584 | Bacteria | 2871 |
| 577 | Ga0501068_0121565 | 3300049584 | Bacteria | 1628 |
| 578 | Ga0501069_0082331 | 3300049585 | Bacteria | 1814 |
| 579 | Ga0501069_0167170 | 3300049585 | Bacteria | 1268 |
| 580 | Ga0501069_0332763 | 3300049585 | Bacteria | 893 |
| 581 | Ga0501070_0018631 | 3300049586 | Bacteria | 5824 |
| 582 | Ga0501071_0017331 | 3300049587 | Bacteria | 4964 |
| 583 | Ga0501071_0033941 | 3300049587 | Bacteria | 3628 |
| 584 | Ga0501071_0170689 | 3300049587 | Bacteria | 1628 |
| 585 | Ga0501071_0222001 | 3300049587 | Bacteria | 1422 |
| 586 | Ga0501072_0000876 | 3300049588 | Bacteria | 22065 |
| 587 | Ga0501072_0004398 | 3300049588 | Bacteria | 10699 |
| 588 | Ga0501072_0005377 | 3300049588 | Bacteria | 9749 |
| 589 | Ga0501072_0086225 | 3300049588 | Bacteria | 2492 |
| 590 | Ga0501072_0349008 | 3300049588 | Bacteria | 1175 |
| 591 | Ga0501072_0861288 | 3300049588 | Bacteria | 708 |
| 592 | Ga0501073_0252972 | 3300049589 | Bacteria | 1216 |
| 593 | Ga0501074_0039136 | 3300049590 | Bacteria | 3434 |
| 594 | Ga0501074_0116871 | 3300049590 | Bacteria | 1908 |
| 595 | Ga0501074_0644176 | 3300049590 | Bacteria | 749 |
| 596 | Ga0501075_0001775 | 3300049591 | Bacteria | 14190 |
| 597 | Ga0501075_0005327 | 3300049591 | Bacteria | 8797 |
| 598 | Ga0501075_0023711 | 3300049591 | Bacteria | 4494 |
| 599 | Ga0501075_0039240 | 3300049591 | Bacteria | 3544 |
| 600 | Ga0501075_0067030 | 3300049591 | Bacteria | 2710 |
| 601 | Ga0501075_0204004 | 3300049591 | Bacteria | 1508 |
| 602 | Ga0501076_0001726 | 3300049592 | Bacteria | 14781 |
| 603 | Ga0501076_0019989 | 3300049592 | Bacteria | 5123 |
| 604 | Ga0501076_0035681 | 3300049592 | Bacteria | 3891 |
| 605 | Ga0501076_0041142 | 3300049592 | Bacteria | 3634 |
| 606 | Ga0501076_0107003 | 3300049592 | Bacteria | 2258 |
| 607 | Ga0501076_0236098 | 3300049592 | Bacteria | 1495 |
| 608 | Ga0501077_0007786 | 3300049593 | Bacteria | 6612 |
| 609 | Ga0501077_0082710 | 3300049593 | Bacteria | 2034 |
| 610 | Ga0501234_016510 | 3300049707 | Bacteria | 1165 |
| 611 | Ga0501079_0010767 | 3300049741 | Bacteria | 6964 |
| 612 | Ga0501079_0024793 | 3300049741 | Bacteria | 4601 |
| 613 | Ga0501079_0056411 | 3300049741 | Bacteria | 3031 |
| 614 | Ga0501079_0166400 | 3300049741 | Bacteria | 1720 |
| 615 | Ga0501079_0272792 | 3300049741 | Bacteria | 1322 |
| 616 | Ga0501079_0748301 | 3300049741 | Bacteria | 769 |
| 617 | Ga0501080_0001334 | 3300049742 | Bacteria | 20578 |
| 618 | Ga0501080_0028797 | 3300049742 | Bacteria | 5171 |
| 619 | Ga0501080_0384496 | 3300049742 | Bacteria | 1264 |
| 620 | Ga0501080_0506151 | 3300049742 | Bacteria | 1079 |
| 621 | Ga0501081_0001270 | 3300049743 | Bacteria | 15350 |
| 622 | Ga0501081_0002641 | 3300049743 | Bacteria | 11330 |
| 623 | Ga0501081_0267644 | 3300049743 | Bacteria | 1250 |
| 624 | Ga0501081_0420267 | 3300049743 | Bacteria | 991 |
| 625 | Ga0501081_0986286 | 3300049743 | Bacteria | 636 |
| 626 | Ga0501081_1130775 | 3300049743 | Bacteria | 593 |
| 627 | Ga0501083_0000990 | 3300049744 | Bacteria | 18870 |
| 628 | Ga0501083_0008270 | 3300049744 | Bacteria | 7355 |
| 629 | Ga0501083_0053510 | 3300049744 | Bacteria | 2710 |
| 630 | Ga0501083_0548921 | 3300049744 | Bacteria | 752 |
| 631 | Ga0501279_077216 | 3300049775 | Bacteria | 569 |
| 632 | Ga0501035_0015293 | 3300049822 | Bacteria | 7081 |
| 633 | Ga0501035_0044811 | 3300049822 | Bacteria | 3982 |
| 634 | Ga0501035_0159266 | 3300049822 | Bacteria | 1955 |
| 635 | Ga0501044_0444027 | 3300049823 | Bacteria | 1205 |
| 636 | Ga0501044_0502036 | 3300049823 | Bacteria | 1114 |
| 637 | Ga0501044_1106659 | 3300049823 | Bacteria | 661 |
| 638 | Ga0501045_0000682 | 3300049824 | Bacteria | 21537 |
| 639 | Ga0501045_0037058 | 3300049824 | Bacteria | 3544 |
| 640 | Ga0501045_0190796 | 3300049824 | Bacteria | 1527 |
| 641 | Ga0501045_0209394 | 3300049824 | Bacteria | 1452 |
| 642 | Ga0501045_0282704 | 3300049824 | Bacteria | 1235 |
| 643 | Ga0501045_0462802 | 3300049824 | Bacteria | 942 |
| 644 | Ga0501045_0762528 | 3300049824 | Bacteria | 713 |
| 645 | nmdc:mga0yw44_129854_c1 | 3300050492 | Bacteria | 1630 |
| 646 | nmdc:mga06z11_119732_c1 | 3300050494 | Bacteria | 1467 |
| 647 | nmdc:mga05p37_1143171_c1 | 3300050507 | Bacteria | 811 |
| 648 | nmdc:mga05p37_1238102_c1 | 3300050507 | Bacteria | 767 |
| 649 | nmdc:mga05p37_147312_c1 | 3300050507 | Bacteria | 2881 |
| 650 | nmdc:mga05p37_149458_c1 | 3300050507 | Bacteria | 2858 |
| 651 | nmdc:mga05p37_1616_c1 | 3300050507 | Bacteria | 26114 |
| 652 | nmdc:mga05p37_340_c1 | 3300050507 | Bacteria | 50074 |
| 653 | nmdc:mga05p37_352896_c1 | 3300050507 | Bacteria | 1731 |
| 654 | nmdc:mga05p37_388885_c1 | 3300050507 | Bacteria | 1632 |
| 655 | nmdc:mga05p37_481842_c1 | 3300050507 | Bacteria | 1429 |
| 656 | nmdc:mga05p37_550978_c1 | 3300050507 | Bacteria | 1313 |
| 657 | nmdc:mga05p37_56257_c1 | 3300050507 | Bacteria | 4843 |
| 658 | nmdc:mga05p37_6620_c1 | 3300050507 | Bacteria | 13660 |
| 659 | nmdc:mga05p37_75653_c1 | 3300050507 | Bacteria | 4145 |
| 660 | nmdc:mga05p37_87904_c1 | 3300050507 | Bacteria | 3831 |
| 661 | nmdc:mga09592_1107143_c1 | 3300050508 | Bacteria | 658 |
| 662 | nmdc:mga09592_1439824_c1 | 3300050508 | Bacteria | 562 |
| 663 | nmdc:mga09592_252445_c1 | 3300050508 | Bacteria | 1529 |
| 664 | nmdc:mga09592_29671_c1 | 3300050508 | Bacteria | 4548 |
| 665 | nmdc:mga09592_3243_c1 | 3300050508 | Bacteria | 13156 |
| 666 | nmdc:mga09592_404324_c1 | 3300050508 | Bacteria | 1180 |
| 667 | nmdc:mga09592_45640_c2 | 3300050508 | Bacteria | 2387 |
| 668 | nmdc:mga09592_466896_c1 | 3300050508 | Bacteria | 1088 |
| 669 | nmdc:mga09592_756837_c1 | 3300050508 | Bacteria | 824 |
| 670 | nmdc:mga09592_810_c2 | 3300050508 | Bacteria | 15378 |
| 671 | nmdc:mga09592_8581_c1 | 3300050508 | Bacteria | 8313 |
| 672 | nmdc:mga0qj67_1003856_c1 | 3300050509 | Bacteria | 655 |
| 673 | nmdc:mga0qj67_1133685_c1 | 3300050509 | Bacteria | 610 |
| 674 | nmdc:mga0qj67_1552_c1 | 3300050509 | Bacteria | 16119 |
| 675 | nmdc:mga0qj67_365_c1 | 3300050509 | Bacteria | 31254 |
| 676 | nmdc:mga0qj67_466097_c1 | 3300050509 | Bacteria | 1017 |
| 677 | nmdc:mga0qj67_652_c1 | 3300050509 | Bacteria | 23881 |
| 678 | nmdc:mga0qj67_762495_c1 | 3300050509 | Bacteria | 767 |
| 679 | nmdc:mga0qj67_78796_c1 | 3300050509 | Bacteria | 2637 |
| 680 | nmdc:mga06r32_1869316_c1 | 3300050510 | Bacteria | 535 |
| 681 | nmdc:mga06r32_219942_c1 | 3300050510 | Bacteria | 1887 |
| 682 | nmdc:mga06r32_28487_c1 | 3300050510 | Bacteria | 5227 |
| 683 | nmdc:mga06r32_321002_c1 | 3300050510 | Bacteria | 1534 |
| 684 | nmdc:mga06r32_3383_c1 | 3300050510 | Bacteria | 14258 |
| 685 | nmdc:mga06r32_345282_c1 | 3300050510 | Bacteria | 1473 |
| 686 | nmdc:mga06r32_44913_c1 | 3300050510 | Bacteria | 4210 |
| 687 | nmdc:mga06r32_45023_c1 | 3300050510 | Bacteria | 4204 |
| 688 | nmdc:mga06r32_4899_c1 | 3300050510 | Bacteria | 12058 |
| 689 | nmdc:mga06r32_7587_c1 | 3300050510 | Bacteria | 9750 |
| 690 | nmdc:mga08y16_13153_c1 | 3300050511 | Bacteria | 8707 |
| 691 | nmdc:mga08y16_52624_c1 | 3300050511 | Bacteria | 4259 |
| 692 | nmdc:mga08y16_638229_c1 | 3300050511 | Bacteria | 1070 |
| 693 | nmdc:mga08y16_670510_c1 | 3300050511 | Bacteria | 1039 |
| 694 | nmdc:mga08y16_8137_c1 | 3300050511 | Bacteria | 10970 |
| 695 | nmdc:mga0n895_131424_c1 | 3300050512 | Bacteria | 2528 |
| 696 | nmdc:mga0n895_131480_c1 | 3300050512 | Bacteria | 2528 |
| 697 | nmdc:mga0n895_215496_c1 | 3300050512 | Bacteria | 1950 |
| 698 | nmdc:mga0n895_4841_c1 | 3300050512 | Bacteria | 11156 |
| 699 | nmdc:mga0n895_58104_c1 | 3300050512 | Bacteria | 3814 |
| 700 | nmdc:mga0n895_9114_c1 | 3300050512 | Bacteria | 8661 |
| 701 | nmdc:mga0n895_98_c1 | 3300050512 | Bacteria | 51629 |
| 702 | nmdc:mga0rr50_107578_c1 | 3300050513 | Bacteria | 2202 |
| 703 | nmdc:mga0rr50_1348_c1 | 3300050513 | Bacteria | 13404 |
| 704 | nmdc:mga0rr50_209820_c1 | 3300050513 | Bacteria | 1604 |
| 705 | nmdc:mga0rr50_28036_c1 | 3300050513 | Bacteria | 3953 |
| 706 | nmdc:mga0rr50_287865_c1 | 3300050513 | Bacteria | 1372 |
| 707 | nmdc:mga0rr50_32889_c1 | 3300050513 | Bacteria | 3700 |
| 708 | nmdc:mga0rr50_5113_c1 | 3300050513 | Bacteria | 7786 |
| 709 | nmdc:mga0rr50_63038_c1 | 3300050513 | Bacteria | 2798 |
| 710 | nmdc:mga08x19_16214_c1 | 3300050514 | Bacteria | 4541 |
| 711 | nmdc:mga08x19_28871_c1 | 3300050514 | Bacteria | 3477 |
| 712 | nmdc:mga08x19_560250_c1 | 3300050514 | Bacteria | 809 |
| 713 | nmdc:mga08x19_77267_c1 | 3300050514 | Bacteria | 2180 |
| 714 | nmdc:mga08x19_991_c1 | 3300050514 | Bacteria | 17725 |
| 715 | nmdc:mga0a205_107177_c1 | 3300050515 | Bacteria | 2692 |
| 716 | nmdc:mga0a205_107185_c1 | 3300050515 | Bacteria | 2692 |
| 717 | nmdc:mga0a205_1206_c1 | 3300050515 | Bacteria | 21636 |
| 718 | nmdc:mga0a205_15571_c1 | 3300050515 | Bacteria | 7107 |
| 719 | nmdc:mga0a205_156652_c1 | 3300050515 | Bacteria | 2176 |
| 720 | nmdc:mga0a205_285697_c1 | 3300050515 | Bacteria | 1525 |
| 721 | nmdc:mga0a205_32330_c1 | 3300050515 | Bacteria | 5017 |
| 722 | nmdc:mga0a205_342909_c1 | 3300050515 | Bacteria | 995 |
| 723 | nmdc:mga0a205_55271_c1 | 3300050515 | Bacteria | 3835 |
| 724 | nmdc:mga0a205_56850_c1 | 3300050515 | Bacteria | 3777 |
| 725 | nmdc:mga0a205_650248_c1 | 3300050515 | Bacteria | 906 |
| 726 | Ga0500643_000124 | 3300053087 | Bacteria | 79663 |
| 727 | Ga0500646_0377385 | 3300053090 | Bacteria | 521 |
| 728 | Ga0500559_0059398 | 3300053136 | Bacteria | 1702 |
| 729 | Ga0500588_0041096 | 3300053146 | Bacteria | 1393 |
| 730 | Ga0501084_0000677 | 3300054114 | Bacteria | 25964 |
| 731 | Ga0501084_0002581 | 3300054114 | Bacteria | 14596 |
| 732 | Ga0501084_0336243 | 3300054114 | Bacteria | 1276 |
| 733 | Ga0501084_0352867 | 3300054114 | Bacteria | 1242 |
| 734 | Ga0501084_1258735 | 3300054114 | Bacteria | 620 |
| 735 | Ga0590077_069239 | 3300059426 | Bacteria | 805 |
| 736 | Ga0587077_029740 | 3300059493 | Bacteria | 1032 |
| 737 | Ga0587080_056077 | 3300059503 | Bacteria | 756 |
| 738 | Ga0587083_0085422 | 3300059505 | Bacteria | 760 |
| 739 | Ga0587086_113744 | 3300059507 | Bacteria | 511 |
| 740 | Ga0587090_118483 | 3300059510 | Bacteria | 572 |
| 741 | Ga0587068_029919 | 3300059641 | Bacteria | 939 |
| 742 | Ga0587072_074696 | 3300059643 | Bacteria | 722 |
| 743 | Ga0501082_0002693 | 3300060353 | Bacteria | 15524 |
| 744 | Ga0501082_0005933 | 3300060353 | Bacteria | 10594 |
| 745 | Ga0501082_0045078 | 3300060353 | Bacteria | 3803 |
| 746 | Ga0501082_0683433 | 3300060353 | Bacteria | 898 |
| 747 | Ga0501082_0799333 | 3300060353 | Bacteria | 825 |
| 748 | Ga0501082_0909841 | 3300060353 | Bacteria | 769 |
| 749 | Ga0530510_0001493 | 3300061734 | Bacteria | 15698 |
| 750 | Ga0530510_0003925 | 3300061734 | Bacteria | 10260 |
| 751 | Ga0530510_0037620 | 3300061734 | Bacteria | 3492 |
| 752 | Ga0530510_0053697 | 3300061734 | Bacteria | 2911 |
| 753 | Ga0530510_0056888 | 3300061734 | Bacteria | 2826 |
| 754 | Ga0530510_0100486 | 3300061734 | Bacteria | 2115 |
| 755 | Ga0530510_0316419 | 3300061734 | Bacteria | 1169 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049570 | Ga0501033_1033618 | Ga0501033_1033618_25_342 | 103 |
| 2 | 3300049590 | Ga0501074_0644176 | Ga0501074_0644176_361_678 | 104 |
| 3 | iso_pu_bacteria | 2521172590 | 2521556782 | 104 |
| 4 | iso_pu_bacteria | 2551306416 | 2553004548 | 104 |
| 5 | iso_pu_bacteria | 2738541297 | 2738825669 | 104 |
| 6 | iso_pu_bacteria | 2738541357 | 2739149466 | 104 |
| 7 | iso_pu_bacteria | 2738543003 | 2739191385 | 104 |
| 8 | iso_pu_bacteria | 2738543026 | 2739317862 | 104 |
| 9 | iso_pu_bacteria | 2738543029 | 2739336103 | 104 |
| 10 | iso_pu_bacteria | 2818991449 | 2819618633 | 104 |
| 11 | iso_pu_bacteria | 2821131069 | 2821134265 | 104 |
| 12 | iso_pu_bacteria | 2842711865 | 2842712100 | 104 |
| 13 | iso_pu_bacteria | 2852643534 | 2852644008 | 104 |
| 14 | iso_pu_bacteria | 2857564685 | 2857566070 | 104 |
| 15 | iso_pu_bacteria | 2904439833 | 2904440641 | 104 |
| 16 | iso_pu_bacteria | 2904530477 | 2904535767 | 104 |
| 17 | iso_pu_bacteria | 2904584206 | 2904586049 | 104 |
| 18 | iso_pu_bacteria | 2904589729 | 2904592138 | 104 |
| 19 | iso_pu_bacteria | 2904601388 | 2904601705 | 104 |
| 20 | iso_pu_bacteria | 2919046199 | 2919049586 | 104 |
| 21 | iso_pu_bacteria | 2919079590 | 2919082574 | 104 |
| 22 | iso_pu_bacteria | 2923510766 | 2923515375 | 104 |
| 23 | 3300003203 | JGI25406J46586_10013729 | JGI25406J46586_100137292 | 105 |
| 24 | 3300005340 | Ga0070689_101185010 | Ga0070689_1011850101 | 105 |
| 25 | 3300005445 | Ga0070708_100000456 | Ga0070708_10000045618 | 105 |
| 26 | 3300005467 | Ga0070706_100027842 | Ga0070706_1000278421 | 105 |
| 27 | 3300005468 | Ga0070707_100000758 | Ga0070707_10000075818 | 105 |
| 28 | 3300005471 | Ga0070698_100002218 | Ga0070698_10000221818 | 105 |
| 29 | 3300005518 | Ga0070699_100000498 | Ga0070699_10000049811 | 105 |
| 30 | 3300005536 | Ga0070697_100001129 | Ga0070697_10000112911 | 105 |
| 31 | 3300005549 | Ga0070704_100078316 | Ga0070704_1000783162 | 105 |
| 32 | 3300005985 | Ga0081539_10001809 | Ga0081539_1000180943 | 105 |
| 33 | 3300006844 | Ga0075428_100005773 | Ga0075428_1000057735 | 105 |
| 34 | 3300006847 | Ga0075431_100000280 | Ga0075431_10000028010 | 105 |
| 35 | 3300006847 | Ga0075431_100266142 | Ga0075431_1002661422 | 105 |
| 36 | 3300006852 | Ga0075433_10000147 | Ga0075433_1000014720 | 105 |
| 37 | 3300006852 | Ga0075433_10019113 | Ga0075433_100191137 | 105 |
| 38 | 3300006871 | Ga0075434_100114034 | Ga0075434_1001140341 | 105 |
| 39 | 3300006880 | Ga0075429_100334855 | Ga0075429_1003348552 | 105 |
| 40 | 3300006914 | Ga0075436_100000316 | Ga0075436_1000003165 | 105 |
| 41 | 3300009094 | Ga0111539_11492152 | Ga0111539_114921521 | 105 |
| 42 | 3300009147 | Ga0114129_10000331 | Ga0114129_1000033140 | 105 |
| 43 | 3300009147 | Ga0114129_10001127 | Ga0114129_100011278 | 105 |
| 44 | 3300009147 | Ga0114129_10001268 | Ga0114129_1000126829 | 105 |
| 45 | 3300009147 | Ga0114129_10380485 | Ga0114129_103804851 | 105 |
| 46 | 3300025910 | Ga0207684_10000456 | Ga0207684_1000045643 | 105 |
| 47 | 3300025922 | Ga0207646_10000483 | Ga0207646_100004832 | 105 |
| 48 | 3300027907 | Ga0207428_10632903 | Ga0207428_106329031 | 105 |
| 49 | 3300028666 | Ga0265336_10068429 | Ga0265336_100684292 | 105 |
| 50 | 3300029957 | Ga0265324_10064446 | Ga0265324_100644463 | 105 |
| 51 | 3300031456 | Ga0307513_10515257 | Ga0307513_105152572 | 105 |
| 52 | 3300038443 | Ga0395901_0792448 | Ga0395901_0792448_516_839 | 105 |
| 53 | 3300046616 | Ga0495668_0004430 | Ga0495668_0004430_256_573 | 105 |
| 54 | 3300049577 | Ga0501041_0707705 | Ga0501041_0707705_185_502 | 105 |
| 55 | 3300049744 | Ga0501083_0548921 | Ga0501083_0548921_99_422 | 105 |
| 56 | 3300050507 | nmdc:mga05p37_1616_c1 | nmdc:mga05p37_1616_c1_4848_5171 | 105 |
| 57 | 3300050507 | nmdc:mga05p37_340_c1 | nmdc:mga05p37_340_c1_36846_37169 | 105 |
| 58 | 3300050508 | nmdc:mga09592_810_c2 | nmdc:mga09592_810_c2_478_801 | 105 |
| 59 | 3300050510 | nmdc:mga06r32_28487_c1 | nmdc:mga06r32_28487_c1_1050_1373 | 105 |
| 60 | 3300050510 | nmdc:mga06r32_4899_c1 | nmdc:mga06r32_4899_c1_8200_8523 | 105 |
| 61 | 3300050512 | nmdc:mga0n895_98_c1 | nmdc:mga0n895_98_c1_24204_24527 | 105 |
| 62 | 3300050513 | nmdc:mga0rr50_1348_c1 | nmdc:mga0rr50_1348_c1_8153_8476 | 105 |
| 63 | 3300050514 | nmdc:mga08x19_991_c1 | nmdc:mga08x19_991_c1_4659_4982 | 105 |
| 64 | 3300050515 | nmdc:mga0a205_107177_c1 | nmdc:mga0a205_107177_c1_493_816 | 105 |
| 65 | 3300050515 | nmdc:mga0a205_1206_c1 | nmdc:mga0a205_1206_c1_5290_5613 | 105 |
| 66 | 3300053090 | Ga0500646_0377385 | Ga0500646_0377385_149_466 | 105 |
| 67 | 3300053136 | Ga0500559_0059398 | Ga0500559_0059398_1089_1406 | 105 |
| 68 | 3300053146 | Ga0500588_0041096 | Ga0500588_0041096_281_598 | 105 |
| 69 | 3300005295 | Ga0065707_10132300 | Ga0065707_101323002 | 106 |
| 70 | 3300005295 | Ga0065707_10444041 | Ga0065707_104440412 | 106 |
| 71 | 3300005330 | Ga0070690_100202217 | Ga0070690_1002022172 | 106 |
| 72 | 3300005334 | Ga0068869_100637188 | Ga0068869_1006371882 | 106 |
| 73 | 3300005336 | Ga0070680_100260247 | Ga0070680_1002602471 | 106 |
| 74 | 3300005340 | Ga0070689_100895352 | Ga0070689_1008953522 | 106 |
| 75 | 3300005343 | Ga0070687_100331451 | Ga0070687_1003314511 | 106 |
| 76 | 3300005345 | Ga0070692_10036760 | Ga0070692_100367602 | 106 |
| 77 | 3300005353 | Ga0070669_100294457 | Ga0070669_1002944571 | 106 |
| 78 | 3300005354 | Ga0070675_100470062 | Ga0070675_1004700622 | 106 |
| 79 | 3300005438 | Ga0070701_10638138 | Ga0070701_106381381 | 106 |
| 80 | 3300005441 | Ga0070700_100600944 | Ga0070700_1006009442 | 106 |
| 81 | 3300005444 | Ga0070694_100154711 | Ga0070694_1001547111 | 106 |
| 82 | 3300005445 | Ga0070708_100004479 | Ga0070708_1000044793 | 106 |
| 83 | 3300005445 | Ga0070708_100504070 | Ga0070708_1005040702 | 106 |
| 84 | 3300005471 | Ga0070698_100718095 | Ga0070698_1007180952 | 106 |
| 85 | 3300005471 | Ga0070698_101141686 | Ga0070698_1011416861 | 106 |
| 86 | 3300005518 | Ga0070699_100033177 | Ga0070699_1000331772 | 106 |
| 87 | 3300005518 | Ga0070699_100556661 | Ga0070699_1005566611 | 106 |
| 88 | 3300005536 | Ga0070697_100074426 | Ga0070697_1000744264 | 106 |
| 89 | 3300005536 | Ga0070697_100221432 | Ga0070697_1002214322 | 106 |
| 90 | 3300005544 | Ga0070686_100418032 | Ga0070686_1004180321 | 106 |
| 91 | 3300005545 | Ga0070695_100797224 | Ga0070695_1007972242 | 106 |
| 92 | 3300005549 | Ga0070704_100555737 | Ga0070704_1005557372 | 106 |
| 93 | 3300005549 | Ga0070704_100588603 | Ga0070704_1005886032 | 106 |
| 94 | 3300005577 | Ga0068857_100096186 | Ga0068857_1000961862 | 106 |
| 95 | 3300005615 | Ga0070702_101202331 | Ga0070702_1012023311 | 106 |
| 96 | 3300005617 | Ga0068859_100063359 | Ga0068859_1000633592 | 106 |
| 97 | 3300005618 | Ga0068864_100195694 | Ga0068864_1001956942 | 106 |
| 98 | 3300005719 | Ga0068861_100354774 | Ga0068861_1003547742 | 106 |
| 99 | 3300005840 | Ga0068870_10685190 | Ga0068870_106851902 | 106 |
| 100 | 3300005842 | Ga0068858_100051407 | Ga0068858_1000514072 | 106 |
| 101 | 3300005843 | Ga0068860_100471376 | Ga0068860_1004713762 | 106 |
| 102 | 3300005843 | Ga0068860_100654788 | Ga0068860_1006547882 | 106 |
| 103 | 3300005844 | Ga0068862_100062629 | Ga0068862_1000626292 | 106 |
| 104 | 3300006844 | Ga0075428_100665376 | Ga0075428_1006653762 | 106 |
| 105 | 3300006844 | Ga0075428_100961041 | Ga0075428_1009610412 | 106 |
| 106 | 3300006847 | Ga0075431_100039734 | Ga0075431_1000397344 | 106 |
| 107 | 3300006847 | Ga0075431_101675951 | Ga0075431_1016759511 | 106 |
| 108 | 3300006871 | Ga0075434_100536474 | Ga0075434_1005364742 | 106 |
| 109 | 3300006880 | Ga0075429_100219412 | Ga0075429_1002194122 | 106 |
| 110 | 3300006881 | Ga0068865_100292113 | Ga0068865_1002921131 | 106 |
| 111 | 3300006931 | Ga0097620_100063359 | Ga0097620_1000633592 | 106 |
| 112 | 3300007076 | Ga0075435_101075912 | Ga0075435_1010759122 | 106 |
| 113 | 3300007265 | Ga0099794_10041868 | Ga0099794_100418682 | 106 |
| 114 | 3300009092 | Ga0105250_10208379 | Ga0105250_102083792 | 106 |
| 115 | 3300009101 | Ga0105247_10589909 | Ga0105247_105899092 | 106 |
| 116 | 3300009147 | Ga0114129_10949635 | Ga0114129_109496351 | 106 |
| 117 | 3300009148 | Ga0105243_10584384 | Ga0105243_105843842 | 106 |
| 118 | 3300009177 | Ga0105248_10050018 | Ga0105248_100500184 | 106 |
| 119 | 3300009177 | Ga0105248_11046538 | Ga0105248_110465382 | 106 |
| 120 | 3300013306 | Ga0163162_10174171 | Ga0163162_101741712 | 106 |
| 121 | 3300014326 | Ga0157380_11268875 | Ga0157380_112688751 | 106 |
| 122 | 3300017792 | Ga0163161_10097797 | Ga0163161_100977972 | 106 |
| 123 | 3300025885 | Ga0207653_10229060 | Ga0207653_102290601 | 106 |
| 124 | 3300025900 | Ga0207710_10481757 | Ga0207710_104817572 | 106 |
| 125 | 3300025904 | Ga0207647_10030040 | Ga0207647_100300404 | 106 |
| 126 | 3300025910 | Ga0207684_10377903 | Ga0207684_103779032 | 106 |
| 127 | 3300025917 | Ga0207660_10163738 | Ga0207660_101637381 | 106 |
| 128 | 3300025918 | Ga0207662_10422183 | Ga0207662_104221831 | 106 |
| 129 | 3300025922 | Ga0207646_11083479 | Ga0207646_110834792 | 106 |
| 130 | 3300025923 | Ga0207681_10727092 | Ga0207681_107270921 | 106 |
| 131 | 3300025926 | Ga0207659_10348611 | Ga0207659_103486112 | 106 |
| 132 | 3300025935 | Ga0207709_11197348 | Ga0207709_111973481 | 106 |
| 133 | 3300025936 | Ga0207670_10638097 | Ga0207670_106380971 | 106 |
| 134 | 3300025938 | Ga0207704_10625395 | Ga0207704_106253952 | 106 |
| 135 | 3300025941 | Ga0207711_10034666 | Ga0207711_100346662 | 106 |
| 136 | 3300025942 | Ga0207689_10193380 | Ga0207689_101933803 | 106 |
| 137 | 3300025961 | Ga0207712_10197938 | Ga0207712_101979382 | 106 |
| 138 | 3300026089 | Ga0207648_10770747 | Ga0207648_107707471 | 106 |
| 139 | 3300026095 | Ga0207676_11310529 | Ga0207676_113105291 | 106 |
| 140 | 3300026116 | Ga0207674_10259842 | Ga0207674_102598422 | 106 |
| 141 | 3300026118 | Ga0207675_100313294 | Ga0207675_1003132942 | 106 |
| 142 | 3300027671 | Ga0209588_1015659 | Ga0209588_10156592 | 106 |
| 143 | 3300028379 | Ga0268266_10932088 | Ga0268266_109320882 | 106 |
| 144 | 3300028380 | Ga0268265_10014082 | Ga0268265_100140822 | 106 |
| 145 | 3300028381 | Ga0268264_10433688 | Ga0268264_104336882 | 106 |
| 146 | 3300031731 | Ga0307405_11473073 | Ga0307405_114730731 | 106 |
| 147 | 3300031901 | Ga0307406_10754048 | Ga0307406_107540482 | 106 |
| 148 | 3300031903 | Ga0307407_10367490 | Ga0307407_103674902 | 106 |
| 149 | 3300032002 | Ga0307416_100158133 | Ga0307416_1001581332 | 106 |
| 150 | 3300035092 | Ga0373952_0034016 | Ga0373952_0034016_234_560 | 106 |
| 151 | 3300035115 | Ga0373941_0148440 | Ga0373941_0148440_413_739 | 106 |
| 152 | 3300045051 | Ga0451576_1172289 | Ga0451576_1172289_371_697 | 106 |
| 153 | 3300046691 | Ga0495670_0376326 | Ga0495670_0376326_102_428 | 106 |
| 154 | 3300049588 | Ga0501072_0086225 | Ga0501072_0086225_1630_1956 | 106 |
| 155 | 3300049741 | Ga0501079_0166400 | Ga0501079_0166400_1030_1356 | 106 |
| 156 | 3300050507 | nmdc:mga05p37_147312_c1 | nmdc:mga05p37_147312_c1_595_921 | 106 |
| 157 | 3300050507 | nmdc:mga05p37_352896_c1 | nmdc:mga05p37_352896_c1_764_1090 | 106 |
| 158 | 3300050508 | nmdc:mga09592_756837_c1 | nmdc:mga09592_756837_c1_16_342 | 106 |
| 159 | 3300050509 | nmdc:mga0qj67_762495_c1 | nmdc:mga0qj67_762495_c1_131_457 | 106 |
| 160 | 3300050510 | nmdc:mga06r32_45023_c1 | nmdc:mga06r32_45023_c1_1640_1966 | 106 |
| 161 | 3300050512 | nmdc:mga0n895_131424_c1 | nmdc:mga0n895_131424_c1_1582_1908 | 106 |
| 162 | 3300003163 | Ga0006759J45824_1059206 | Ga0006759J45824_10592062 | 107 |
| 163 | 3300003322 | rootL2_10164021 | rootL2_101640212 | 107 |
| 164 | 3300003544 | Ga0007417J51691_1051599 | Ga0007417J51691_10515992 | 107 |
| 165 | 3300003574 | Ga0007410J51695_1035448 | Ga0007410J51695_10354482 | 107 |
| 166 | 3300003577 | Ga0007416J51690_1104318 | Ga0007416J51690_11043181 | 107 |
| 167 | 3300004801 | Ga0058860_11742682 | Ga0058860_117426822 | 107 |
| 168 | 3300005288 | Ga0065714_10026164 | Ga0065714_100261642 | 107 |
| 169 | 3300005295 | Ga0065707_10012883 | Ga0065707_100128831 | 107 |
| 170 | 3300005295 | Ga0065707_10153745 | Ga0065707_101537452 | 107 |
| 171 | 3300005295 | Ga0065707_10261562 | Ga0065707_102615622 | 107 |
| 172 | 3300005328 | Ga0070676_10452395 | Ga0070676_104523952 | 107 |
| 173 | 3300005330 | Ga0070690_100336971 | Ga0070690_1003369711 | 107 |
| 174 | 3300005330 | Ga0070690_100463167 | Ga0070690_1004631672 | 107 |
| 175 | 3300005336 | Ga0070680_100089298 | Ga0070680_1000892983 | 107 |
| 176 | 3300005339 | Ga0070660_101520589 | Ga0070660_1015205891 | 107 |
| 177 | 3300005340 | Ga0070689_100248841 | Ga0070689_1002488412 | 107 |
| 178 | 3300005340 | Ga0070689_100905476 | Ga0070689_1009054762 | 107 |
| 179 | 3300005343 | Ga0070687_100404560 | Ga0070687_1004045602 | 107 |
| 180 | 3300005345 | Ga0070692_11051185 | Ga0070692_110511851 | 107 |
| 181 | 3300005347 | Ga0070668_100126770 | Ga0070668_1001267701 | 107 |
| 182 | 3300005353 | Ga0070669_100032356 | Ga0070669_1000323564 | 107 |
| 183 | 3300005353 | Ga0070669_100119199 | Ga0070669_1001191992 | 107 |
| 184 | 3300005356 | Ga0070674_101179831 | Ga0070674_1011798312 | 107 |
| 185 | 3300005364 | Ga0070673_101285428 | Ga0070673_1012854282 | 107 |
| 186 | 3300005366 | Ga0070659_100437325 | Ga0070659_1004373252 | 107 |
| 187 | 3300005406 | Ga0070703_10173814 | Ga0070703_101738141 | 107 |
| 188 | 3300005438 | Ga0070701_11192322 | Ga0070701_111923221 | 107 |
| 189 | 3300005440 | Ga0070705_100010699 | Ga0070705_1000106993 | 107 |
| 190 | 3300005440 | Ga0070705_100029993 | Ga0070705_1000299932 | 107 |
| 191 | 3300005440 | Ga0070705_100908666 | Ga0070705_1009086662 | 107 |
| 192 | 3300005441 | Ga0070700_100360579 | Ga0070700_1003605792 | 107 |
| 193 | 3300005441 | Ga0070700_101923582 | Ga0070700_1019235821 | 107 |
| 194 | 3300005444 | Ga0070694_100076889 | Ga0070694_1000768893 | 107 |
| 195 | 3300005444 | Ga0070694_100189936 | Ga0070694_1001899362 | 107 |
| 196 | 3300005444 | Ga0070694_100398024 | Ga0070694_1003980242 | 107 |
| 197 | 3300005444 | Ga0070694_100474505 | Ga0070694_1004745052 | 107 |
| 198 | 3300005445 | Ga0070708_100034475 | Ga0070708_1000344752 | 107 |
| 199 | 3300005445 | Ga0070708_100206866 | Ga0070708_1002068662 | 107 |
| 200 | 3300005445 | Ga0070708_100251233 | Ga0070708_1002512331 | 107 |
| 201 | 3300005445 | Ga0070708_100839961 | Ga0070708_1008399612 | 107 |
| 202 | 3300005457 | Ga0070662_100014208 | Ga0070662_1000142082 | 107 |
| 203 | 3300005457 | Ga0070662_100898119 | Ga0070662_1008981191 | 107 |
| 204 | 3300005458 | Ga0070681_10161989 | Ga0070681_101619892 | 107 |
| 205 | 3300005459 | Ga0068867_100036249 | Ga0068867_1000362493 | 107 |
| 206 | 3300005459 | Ga0068867_100164969 | Ga0068867_1001649692 | 107 |
| 207 | 3300005467 | Ga0070706_100047435 | Ga0070706_1000474355 | 107 |
| 208 | 3300005467 | Ga0070706_100159454 | Ga0070706_1001594542 | 107 |
| 209 | 3300005467 | Ga0070706_100224521 | Ga0070706_1002245211 | 107 |
| 210 | 3300005467 | Ga0070706_101012264 | Ga0070706_1010122641 | 107 |
| 211 | 3300005467 | Ga0070706_102097885 | Ga0070706_1020978851 | 107 |
| 212 | 3300005468 | Ga0070707_100028839 | Ga0070707_1000288395 | 107 |
| 213 | 3300005468 | Ga0070707_100033492 | Ga0070707_1000334924 | 107 |
| 214 | 3300005471 | Ga0070698_100319863 | Ga0070698_1003198632 | 107 |
| 215 | 3300005518 | Ga0070699_100043461 | Ga0070699_1000434613 | 107 |
| 216 | 3300005518 | Ga0070699_100151355 | Ga0070699_1001513552 | 107 |
| 217 | 3300005518 | Ga0070699_100286899 | Ga0070699_1002868992 | 107 |
| 218 | 3300005518 | Ga0070699_100973751 | Ga0070699_1009737511 | 107 |
| 219 | 3300005530 | Ga0070679_100972905 | Ga0070679_1009729051 | 107 |
| 220 | 3300005536 | Ga0070697_100017366 | Ga0070697_1000173665 | 107 |
| 221 | 3300005536 | Ga0070697_100116744 | Ga0070697_1001167442 | 107 |
| 222 | 3300005536 | Ga0070697_100700559 | Ga0070697_1007005592 | 107 |
| 223 | 3300005536 | Ga0070697_101232400 | Ga0070697_1012324001 | 107 |
| 224 | 3300005539 | Ga0068853_100699015 | Ga0068853_1006990152 | 107 |
| 225 | 3300005539 | Ga0068853_102453598 | Ga0068853_1024535981 | 107 |
| 226 | 3300005543 | Ga0070672_100810116 | Ga0070672_1008101162 | 107 |
| 227 | 3300005544 | Ga0070686_101750835 | Ga0070686_1017508351 | 107 |
| 228 | 3300005545 | Ga0070695_100059011 | Ga0070695_1000590111 | 107 |
| 229 | 3300005545 | Ga0070695_100145506 | Ga0070695_1001455062 | 107 |
| 230 | 3300005545 | Ga0070695_100448793 | Ga0070695_1004487932 | 107 |
| 231 | 3300005545 | Ga0070695_100647699 | Ga0070695_1006476992 | 107 |
| 232 | 3300005545 | Ga0070695_101607339 | Ga0070695_1016073391 | 107 |
| 233 | 3300005546 | Ga0070696_100074115 | Ga0070696_1000741152 | 107 |
| 234 | 3300005546 | Ga0070696_100170592 | Ga0070696_1001705922 | 107 |
| 235 | 3300005546 | Ga0070696_101447942 | Ga0070696_1014479422 | 107 |
| 236 | 3300005549 | Ga0070704_101515582 | Ga0070704_1015155822 | 107 |
| 237 | 3300005549 | Ga0070704_101990577 | Ga0070704_1019905771 | 107 |
| 238 | 3300005578 | Ga0068854_100514622 | Ga0068854_1005146222 | 107 |
| 239 | 3300005578 | Ga0068854_100899105 | Ga0068854_1008991052 | 107 |
| 240 | 3300005615 | Ga0070702_100426204 | Ga0070702_1004262042 | 107 |
| 241 | 3300005615 | Ga0070702_100506494 | Ga0070702_1005064942 | 107 |
| 242 | 3300005617 | Ga0068859_100201133 | Ga0068859_1002011332 | 107 |
| 243 | 3300005617 | Ga0068859_101527906 | Ga0068859_1015279062 | 107 |
| 244 | 3300005618 | Ga0068864_101719118 | Ga0068864_1017191181 | 107 |
| 245 | 3300005718 | Ga0068866_10336332 | Ga0068866_103363322 | 107 |
| 246 | 3300005718 | Ga0068866_10541919 | Ga0068866_105419192 | 107 |
| 247 | 3300005719 | Ga0068861_100692281 | Ga0068861_1006922812 | 107 |
| 248 | 3300005719 | Ga0068861_100961276 | Ga0068861_1009612761 | 107 |
| 249 | 3300005840 | Ga0068870_10775180 | Ga0068870_107751802 | 107 |
| 250 | 3300005841 | Ga0068863_100156607 | Ga0068863_1001566072 | 107 |
| 251 | 3300005841 | Ga0068863_100422415 | Ga0068863_1004224151 | 107 |
| 252 | 3300005842 | Ga0068858_101559214 | Ga0068858_1015592141 | 107 |
| 253 | 3300005843 | Ga0068860_100558820 | Ga0068860_1005588202 | 107 |
| 254 | 3300005843 | Ga0068860_100680405 | Ga0068860_1006804052 | 107 |
| 255 | 3300005843 | Ga0068860_102310457 | Ga0068860_1023104571 | 107 |
| 256 | 3300005844 | Ga0068862_100072772 | Ga0068862_1000727723 | 107 |
| 257 | 3300005844 | Ga0068862_100909682 | Ga0068862_1009096822 | 107 |
| 258 | 3300005937 | Ga0081455_10109316 | Ga0081455_101093161 | 107 |
| 259 | 3300005983 | Ga0081540_1043478 | Ga0081540_10434783 | 107 |
| 260 | 3300006194 | Ga0075427_10000681 | Ga0075427_100006814 | 107 |
| 261 | 3300006353 | Ga0075370_10751422 | Ga0075370_107514222 | 107 |
| 262 | 3300006844 | Ga0075428_100001846 | Ga0075428_1000018464 | 107 |
| 263 | 3300006844 | Ga0075428_100003298 | Ga0075428_1000032983 | 107 |
| 264 | 3300006844 | Ga0075428_100071462 | Ga0075428_1000714621 | 107 |
| 265 | 3300006844 | Ga0075428_100210274 | Ga0075428_1002102742 | 107 |
| 266 | 3300006844 | Ga0075428_100420289 | Ga0075428_1004202892 | 107 |
| 267 | 3300006844 | Ga0075428_100464275 | Ga0075428_1004642752 | 107 |
| 268 | 3300006846 | Ga0075430_100000087 | Ga0075430_10000008743 | 107 |
| 269 | 3300006846 | Ga0075430_100000851 | Ga0075430_1000008513 | 107 |
| 270 | 3300006846 | Ga0075430_100034167 | Ga0075430_1000341672 | 107 |
| 271 | 3300006846 | Ga0075430_100509418 | Ga0075430_1005094182 | 107 |
| 272 | 3300006846 | Ga0075430_101085859 | Ga0075430_1010858592 | 107 |
| 273 | 3300006846 | Ga0075430_101594603 | Ga0075430_1015946031 | 107 |
| 274 | 3300006846 | Ga0075430_101658453 | Ga0075430_1016584531 | 107 |
| 275 | 3300006847 | Ga0075431_100000559 | Ga0075431_1000005598 | 107 |
| 276 | 3300006847 | Ga0075431_100007752 | Ga0075431_1000077523 | 107 |
| 277 | 3300006847 | Ga0075431_100051697 | Ga0075431_1000516972 | 107 |
| 278 | 3300006847 | Ga0075431_100068763 | Ga0075431_1000687631 | 107 |
| 279 | 3300006847 | Ga0075431_100120761 | Ga0075431_1001207612 | 107 |
| 280 | 3300006847 | Ga0075431_100126605 | Ga0075431_1001266053 | 107 |
| 281 | 3300006847 | Ga0075431_100551051 | Ga0075431_1005510512 | 107 |
| 282 | 3300006852 | Ga0075433_10000942 | Ga0075433_100009422 | 107 |
| 283 | 3300006852 | Ga0075433_10024441 | Ga0075433_100244411 | 107 |
| 284 | 3300006852 | Ga0075433_10060713 | Ga0075433_100607132 | 107 |
| 285 | 3300006852 | Ga0075433_10234916 | Ga0075433_102349161 | 107 |
| 286 | 3300006852 | Ga0075433_10259002 | Ga0075433_102590022 | 107 |
| 287 | 3300006852 | Ga0075433_10297718 | Ga0075433_102977182 | 107 |
| 288 | 3300006852 | Ga0075433_10315471 | Ga0075433_103154712 | 107 |
| 289 | 3300006852 | Ga0075433_10781418 | Ga0075433_107814182 | 107 |
| 290 | 3300006871 | Ga0075434_100000540 | Ga0075434_10000054025 | 107 |
| 291 | 3300006871 | Ga0075434_100017703 | Ga0075434_1000177036 | 107 |
| 292 | 3300006871 | Ga0075434_100133256 | Ga0075434_1001332562 | 107 |
| 293 | 3300006871 | Ga0075434_101025856 | Ga0075434_1010258562 | 107 |
| 294 | 3300006880 | Ga0075429_100000843 | Ga0075429_10000084339 | 107 |
| 295 | 3300006880 | Ga0075429_100000958 | Ga0075429_1000009589 | 107 |
| 296 | 3300006880 | Ga0075429_100023270 | Ga0075429_1000232707 | 107 |
| 297 | 3300006880 | Ga0075429_100053228 | Ga0075429_1000532284 | 107 |
| 298 | 3300006880 | Ga0075429_100104139 | Ga0075429_1001041391 | 107 |
| 299 | 3300006880 | Ga0075429_100295710 | Ga0075429_1002957102 | 107 |
| 300 | 3300006880 | Ga0075429_100356463 | Ga0075429_1003564632 | 107 |
| 301 | 3300006880 | Ga0075429_100722780 | Ga0075429_1007227801 | 107 |
| 302 | 3300006881 | Ga0068865_100070365 | Ga0068865_1000703652 | 107 |
| 303 | 3300006914 | Ga0075436_100011766 | Ga0075436_1000117662 | 107 |
| 304 | 3300006914 | Ga0075436_100051257 | Ga0075436_1000512571 | 107 |
| 305 | 3300006914 | Ga0075436_100067904 | Ga0075436_1000679042 | 107 |
| 306 | 3300006914 | Ga0075436_100746527 | Ga0075436_1007465271 | 107 |
| 307 | 3300006931 | Ga0097620_100201116 | Ga0097620_1002011162 | 107 |
| 308 | 3300006931 | Ga0097620_101528306 | Ga0097620_1015283062 | 107 |
| 309 | 3300007076 | Ga0075435_100003722 | Ga0075435_1000037228 | 107 |
| 310 | 3300007076 | Ga0075435_100015844 | Ga0075435_1000158443 | 107 |
| 311 | 3300007076 | Ga0075435_100022826 | Ga0075435_1000228261 | 107 |
| 312 | 3300007076 | Ga0075435_102021957 | Ga0075435_1020219571 | 107 |
| 313 | 3300007076 | Ga0075435_102063376 | Ga0075435_1020633761 | 107 |
| 314 | 3300007265 | Ga0099794_10493869 | Ga0099794_104938691 | 107 |
| 315 | 3300009093 | Ga0105240_12569481 | Ga0105240_125694812 | 107 |
| 316 | 3300009094 | Ga0111539_10000675 | Ga0111539_1000067542 | 107 |
| 317 | 3300009094 | Ga0111539_10001562 | Ga0111539_1000156223 | 107 |
| 318 | 3300009094 | Ga0111539_10594127 | Ga0111539_105941272 | 107 |
| 319 | 3300009094 | Ga0111539_10997441 | Ga0111539_109974412 | 107 |
| 320 | 3300009094 | Ga0111539_11067343 | Ga0111539_110673432 | 107 |
| 321 | 3300009094 | Ga0111539_11182412 | Ga0111539_111824121 | 107 |
| 322 | 3300009094 | Ga0111539_11215873 | Ga0111539_112158732 | 107 |
| 323 | 3300009147 | Ga0114129_10000487 | Ga0114129_1000048731 | 107 |
| 324 | 3300009147 | Ga0114129_10005736 | Ga0114129_1000573623 | 107 |
| 325 | 3300009147 | Ga0114129_10021639 | Ga0114129_100216392 | 107 |
| 326 | 3300009147 | Ga0114129_10056215 | Ga0114129_100562156 | 107 |
| 327 | 3300009147 | Ga0114129_10105186 | Ga0114129_101051863 | 107 |
| 328 | 3300009147 | Ga0114129_10184181 | Ga0114129_101841812 | 107 |
| 329 | 3300009147 | Ga0114129_10260766 | Ga0114129_102607662 | 107 |
| 330 | 3300009147 | Ga0114129_10338740 | Ga0114129_103387402 | 107 |
| 331 | 3300009147 | Ga0114129_10395081 | Ga0114129_103950812 | 107 |
| 332 | 3300009147 | Ga0114129_10615478 | Ga0114129_106154782 | 107 |
| 333 | 3300009147 | Ga0114129_11048358 | Ga0114129_110483581 | 107 |
| 334 | 3300009147 | Ga0114129_11371068 | Ga0114129_113710682 | 107 |
| 335 | 3300009147 | Ga0114129_11575551 | Ga0114129_115755511 | 107 |
| 336 | 3300009148 | Ga0105243_10159032 | Ga0105243_101590322 | 107 |
| 337 | 3300009148 | Ga0105243_10249501 | Ga0105243_102495012 | 107 |
| 338 | 3300009174 | Ga0105241_10063776 | Ga0105241_100637762 | 107 |
| 339 | 3300009174 | Ga0105241_10653564 | Ga0105241_106535642 | 107 |
| 340 | 3300009176 | Ga0105242_10360527 | Ga0105242_103605272 | 107 |
| 341 | 3300009176 | Ga0105242_10581274 | Ga0105242_105812741 | 107 |
| 342 | 3300009176 | Ga0105242_10666146 | Ga0105242_106661461 | 107 |
| 343 | 3300009176 | Ga0105242_11039901 | Ga0105242_110399012 | 107 |
| 344 | 3300009177 | Ga0105248_11239952 | Ga0105248_112399522 | 107 |
| 345 | 3300009553 | Ga0105249_10159286 | Ga0105249_101592862 | 107 |
| 346 | 3300009553 | Ga0105249_10720544 | Ga0105249_107205442 | 107 |
| 347 | 3300009553 | Ga0105249_10872284 | Ga0105249_108722842 | 107 |
| 348 | 3300009553 | Ga0105249_12246246 | Ga0105249_122462461 | 107 |
| 349 | 3300010375 | Ga0105239_10745446 | Ga0105239_107454462 | 107 |
| 350 | 3300011119 | Ga0105246_11615608 | Ga0105246_116156082 | 107 |
| 351 | 3300011119 | Ga0105246_11965356 | Ga0105246_119653561 | 107 |
| 352 | 3300013100 | Ga0157373_10271315 | Ga0157373_102713152 | 107 |
| 353 | 3300013100 | Ga0157373_10274538 | Ga0157373_102745382 | 107 |
| 354 | 3300013297 | Ga0157378_10154275 | Ga0157378_101542752 | 107 |
| 355 | 3300013297 | Ga0157378_10185814 | Ga0157378_101858142 | 107 |
| 356 | 3300013297 | Ga0157378_10403895 | Ga0157378_104038952 | 107 |
| 357 | 3300013306 | Ga0163162_10276875 | Ga0163162_102768752 | 107 |
| 358 | 3300013306 | Ga0163162_10498904 | Ga0163162_104989042 | 107 |
| 359 | 3300013306 | Ga0163162_10731301 | Ga0163162_107313011 | 107 |
| 360 | 3300013306 | Ga0163162_12157351 | Ga0163162_121573512 | 107 |
| 361 | 3300013308 | Ga0157375_11712207 | Ga0157375_117122072 | 107 |
| 362 | 3300014325 | Ga0163163_12364864 | Ga0163163_123648641 | 107 |
| 363 | 3300014326 | Ga0157380_10281802 | Ga0157380_102818022 | 107 |
| 364 | 3300014326 | Ga0157380_10415902 | Ga0157380_104159022 | 107 |
| 365 | 3300014326 | Ga0157380_11451023 | Ga0157380_114510232 | 107 |
| 366 | 3300014497 | Ga0182008_10000154 | Ga0182008_1000015445 | 107 |
| 367 | 3300015261 | Ga0182006_1000010 | Ga0182006_100001085 | 107 |
| 368 | 3300015262 | Ga0182007_10000030 | Ga0182007_1000003089 | 107 |
| 369 | 3300015262 | Ga0182007_10306555 | Ga0182007_103065551 | 107 |
| 370 | 3300015265 | Ga0182005_1000009 | Ga0182005_1000009342 | 107 |
| 371 | 3300017792 | Ga0163161_10277679 | Ga0163161_102776792 | 107 |
| 372 | 3300017792 | Ga0163161_10641556 | Ga0163161_106415561 | 107 |
| 373 | 3300020070 | Ga0206356_11505530 | Ga0206356_115055302 | 107 |
| 374 | 3300021361 | Ga0213872_10045108 | Ga0213872_100451082 | 107 |
| 375 | 3300025885 | Ga0207653_10416094 | Ga0207653_104160941 | 107 |
| 376 | 3300025899 | Ga0207642_10066530 | Ga0207642_100665302 | 107 |
| 377 | 3300025907 | Ga0207645_10584017 | Ga0207645_105840172 | 107 |
| 378 | 3300025910 | Ga0207684_10012314 | Ga0207684_100123145 | 107 |
| 379 | 3300025910 | Ga0207684_10100931 | Ga0207684_101009313 | 107 |
| 380 | 3300025910 | Ga0207684_10245616 | Ga0207684_102456161 | 107 |
| 381 | 3300025910 | Ga0207684_10755786 | Ga0207684_107557862 | 107 |
| 382 | 3300025911 | Ga0207654_10474226 | Ga0207654_104742262 | 107 |
| 383 | 3300025911 | Ga0207654_11050256 | Ga0207654_110502562 | 107 |
| 384 | 3300025912 | Ga0207707_10022676 | Ga0207707_100226762 | 107 |
| 385 | 3300025913 | Ga0207695_10018581 | Ga0207695_100185812 | 107 |
| 386 | 3300025917 | Ga0207660_10004184 | Ga0207660_100041846 | 107 |
| 387 | 3300025918 | Ga0207662_10296709 | Ga0207662_102967092 | 107 |
| 388 | 3300025918 | Ga0207662_10478153 | Ga0207662_104781532 | 107 |
| 389 | 3300025922 | Ga0207646_10025881 | Ga0207646_100258815 | 107 |
| 390 | 3300025922 | Ga0207646_10691579 | Ga0207646_106915792 | 107 |
| 391 | 3300025923 | Ga0207681_10027358 | Ga0207681_100273583 | 107 |
| 392 | 3300025923 | Ga0207681_10123915 | Ga0207681_101239152 | 107 |
| 393 | 3300025923 | Ga0207681_11425898 | Ga0207681_114258981 | 107 |
| 394 | 3300025926 | Ga0207659_10440834 | Ga0207659_104408342 | 107 |
| 395 | 3300025932 | Ga0207690_10400913 | Ga0207690_104009131 | 107 |
| 396 | 3300025932 | Ga0207690_10660973 | Ga0207690_106609732 | 107 |
| 397 | 3300025933 | Ga0207706_10025259 | Ga0207706_100252595 | 107 |
| 398 | 3300025933 | Ga0207706_10513723 | Ga0207706_105137231 | 107 |
| 399 | 3300025933 | Ga0207706_10686269 | Ga0207706_106862692 | 107 |
| 400 | 3300025934 | Ga0207686_10298763 | Ga0207686_102987632 | 107 |
| 401 | 3300025935 | Ga0207709_10048104 | Ga0207709_100481042 | 107 |
| 402 | 3300025935 | Ga0207709_11060097 | Ga0207709_110600971 | 107 |
| 403 | 3300025936 | Ga0207670_10125627 | Ga0207670_101256272 | 107 |
| 404 | 3300025936 | Ga0207670_10167964 | Ga0207670_101679642 | 107 |
| 405 | 3300025936 | Ga0207670_11549867 | Ga0207670_115498672 | 107 |
| 406 | 3300025938 | Ga0207704_10332817 | Ga0207704_103328172 | 107 |
| 407 | 3300025940 | Ga0207691_10506303 | Ga0207691_105063032 | 107 |
| 408 | 3300025961 | Ga0207712_10346561 | Ga0207712_103465612 | 107 |
| 409 | 3300025972 | Ga0207668_10315614 | Ga0207668_103156141 | 107 |
| 410 | 3300025972 | Ga0207668_10398212 | Ga0207668_103982122 | 107 |
| 411 | 3300025986 | Ga0207658_11527172 | Ga0207658_115271721 | 107 |
| 412 | 3300026041 | Ga0207639_11061188 | Ga0207639_110611881 | 107 |
| 413 | 3300026075 | Ga0207708_11235640 | Ga0207708_112356402 | 107 |
| 414 | 3300026089 | Ga0207648_10113523 | Ga0207648_101135233 | 107 |
| 415 | 3300026089 | Ga0207648_10194930 | Ga0207648_101949302 | 107 |
| 416 | 3300026089 | Ga0207648_10467731 | Ga0207648_104677311 | 107 |
| 417 | 3300026095 | Ga0207676_11254722 | Ga0207676_112547222 | 107 |
| 418 | 3300026118 | Ga0207675_100525775 | Ga0207675_1005257752 | 107 |
| 419 | 3300026118 | Ga0207675_101002170 | Ga0207675_1010021702 | 107 |
| 420 | 3300026118 | Ga0207675_101875580 | Ga0207675_1018755801 | 107 |
| 421 | 3300027526 | Ga0209968_1019566 | Ga0209968_10195662 | 107 |
| 422 | 3300027617 | Ga0210002_1009917 | Ga0210002_10099172 | 107 |
| 423 | 3300027907 | Ga0207428_10000095 | Ga0207428_1000009538 | 107 |
| 424 | 3300027907 | Ga0207428_10034391 | Ga0207428_100343914 | 107 |
| 425 | 3300027907 | Ga0207428_10119790 | Ga0207428_101197902 | 107 |
| 426 | 3300027907 | Ga0207428_10410040 | Ga0207428_104100401 | 107 |
| 427 | 3300027907 | Ga0207428_10692369 | Ga0207428_106923691 | 107 |
| 428 | 3300028380 | Ga0268265_10193837 | Ga0268265_101938372 | 107 |
| 429 | 3300028380 | Ga0268265_10411269 | Ga0268265_104112692 | 107 |
| 430 | 3300028381 | Ga0268264_10633397 | Ga0268264_106333972 | 107 |
| 431 | 3300028381 | Ga0268264_11742507 | Ga0268264_117425072 | 107 |
| 432 | 3300031548 | Ga0307408_100000180 | Ga0307408_1000001803 | 107 |
| 433 | 3300031548 | Ga0307408_100640253 | Ga0307408_1006402532 | 107 |
| 434 | 3300031852 | Ga0307410_10436390 | Ga0307410_104363902 | 107 |
| 435 | 3300031901 | Ga0307406_12127202 | Ga0307406_121272021 | 107 |
| 436 | 3300032002 | Ga0307416_101062386 | Ga0307416_1010623861 | 107 |
| 437 | 3300034819 | Ga0373958_0121516 | Ga0373958_0121516_200_529 | 107 |
| 438 | 3300035084 | Ga0373928_0118662 | Ga0373928_0118662_323_652 | 107 |
| 439 | 3300035088 | Ga0373940_0103220 | Ga0373940_0103220_508_837 | 107 |
| 440 | 3300035088 | Ga0373940_0335680 | Ga0373940_0335680_183_515 | 107 |
| 441 | 3300035090 | Ga0373949_0220662 | Ga0373949_0220662_201_530 | 107 |
| 442 | 3300035091 | Ga0373951_0260370 | Ga0373951_0260370_19_351 | 107 |
| 443 | 3300035092 | Ga0373952_0117988 | Ga0373952_0117988_203_535 | 107 |
| 444 | 3300035112 | Ga0373932_0095443 | Ga0373932_0095443_89_418 | 107 |
| 445 | 3300035114 | Ga0373939_0109957 | Ga0373939_0109957_550_879 | 107 |
| 446 | 3300035121 | Ga0373960_0106195 | Ga0373960_0106195_49_381 | 107 |
| 447 | 3300035241 | Ga0373961_0102627 | Ga0373961_0102627_448_780 | 107 |
| 448 | 3300035241 | Ga0373961_0274793 | Ga0373961_0274793_218_547 | 107 |
| 449 | 3300035242 | Ga0373962_0175012 | Ga0373962_0175012_327_656 | 107 |
| 450 | 3300035691 | Ga0373931_0000964 | Ga0373931_0000964_3577_3909 | 107 |
| 451 | 3300035691 | Ga0373931_0007284 | Ga0373931_0007284_1484_1813 | 107 |
| 452 | 3300035691 | Ga0373931_0693325 | Ga0373931_0693325_54_386 | 107 |
| 453 | 3300037418 | Ga0395900_0001056 | Ga0395900_0001056_7604_7936 | 107 |
| 454 | 3300037466 | Ga0395898_0204071 | Ga0395898_0204071_1464_1796 | 107 |
| 455 | 3300037471 | Ga0395905_1484260 | Ga0395905_1484260_108_440 | 107 |
| 456 | 3300039447 | Ga0436361_0216395 | Ga0436361_0216395_3073_3399 | 107 |
| 457 | 3300042013 | Ga0439456_023753 | Ga0439456_023753_172_501 | 107 |
| 458 | 3300042156 | Ga0439446_0109943 | Ga0439446_0109943_468_854 | 107 |
| 459 | 3300042436 | Ga0439435_0023476 | Ga0439435_0023476_81_413 | 107 |
| 460 | 3300042436 | Ga0439435_0068112 | Ga0439435_0068112_436_765 | 107 |
| 461 | 3300042461 | Ga0439460_0057644 | Ga0439460_0057644_400_732 | 107 |
| 462 | 3300042876 | Ga0451577_0078197 | Ga0451577_0078197_1036_1365 | 107 |
| 463 | 3300044673 | Ga0453683_1069691 | Ga0453683_1069691_132_464 | 107 |
| 464 | 3300044842 | Ga0466957_0096241 | Ga0466957_0096241_840_1166 | 107 |
| 465 | 3300045051 | Ga0451576_0052534 | Ga0451576_0052534_2334_2663 | 107 |
| 466 | 3300045051 | Ga0451576_0434765 | Ga0451576_0434765_543_875 | 107 |
| 467 | 3300045051 | Ga0451576_0440113 | Ga0451576_0440113_448_777 | 107 |
| 468 | 3300045051 | Ga0451576_0641850 | Ga0451576_0641850_590_919 | 107 |
| 469 | 3300045051 | Ga0451576_1784002 | Ga0451576_1784002_168_500 | 107 |
| 470 | 3300046460 | Ga0495638_0269228 | Ga0495638_0269228_414_740 | 107 |
| 471 | 3300046472 | Ga0495580_0000020 | Ga0495580_0000020_66992_67321 | 107 |
| 472 | 3300046491 | Ga0495584_0097944 | Ga0495584_0097944_377_706 | 107 |
| 473 | 3300046512 | Ga0495610_0001145 | Ga0495610_0001145_464_790 | 107 |
| 474 | 3300046522 | Ga0495643_0000225 | Ga0495643_0000225_923_1249 | 107 |
| 475 | 3300046524 | Ga0495648_0222952 | Ga0495648_0222952_520_846 | 107 |
| 476 | 3300046524 | Ga0495648_0249888 | Ga0495648_0249888_176_502 | 107 |
| 477 | 3300046525 | Ga0495663_0014636 | Ga0495663_0014636_1786_2112 | 107 |
| 478 | 3300046525 | Ga0495663_0184589 | Ga0495663_0184589_41_370 | 107 |
| 479 | 3300046528 | Ga0495642_0070793 | Ga0495642_0070793_110_436 | 107 |
| 480 | 3300046528 | Ga0495642_0123422 | Ga0495642_0123422_228_560 | 107 |
| 481 | 3300046615 | Ga0495656_0117906 | Ga0495656_0117906_877_1203 | 107 |
| 482 | 3300046615 | Ga0495656_0334379 | Ga0495656_0334379_70_399 | 107 |
| 483 | 3300046648 | Ga0495611_0130569 | Ga0495611_0130569_806_1135 | 107 |
| 484 | 3300046660 | Ga0495625_0343933 | Ga0495625_0343933_584_910 | 107 |
| 485 | 3300046684 | Ga0495669_0020303 | Ga0495669_0020303_1325_1657 | 107 |
| 486 | 3300046684 | Ga0495669_0068615 | Ga0495669_0068615_673_1002 | 107 |
| 487 | 3300046684 | Ga0495669_0350258 | Ga0495669_0350258_198_530 | 107 |
| 488 | 3300046691 | Ga0495670_0506212 | Ga0495670_0506212_40_369 | 107 |
| 489 | 3300046694 | Ga0495649_0066771 | Ga0495649_0066771_747_1073 | 107 |
| 490 | 3300047318 | Ga0495636_0408408 | Ga0495636_0408408_220_549 | 107 |
| 491 | 3300047320 | Ga0495672_0000385 | Ga0495672_0000385_856_1182 | 107 |
| 492 | 3300047445 | Ga0495677_0010939 | Ga0495677_0010939_203_529 | 107 |
| 493 | 3300047445 | Ga0495677_0430370 | Ga0495677_0430370_177_506 | 107 |
| 494 | 3300047447 | Ga0495685_052074 | Ga0495685_052074_403_729 | 107 |
| 495 | 3300048904 | Ga0496101_0613329 | Ga0496101_0613329_37_369 | 107 |
| 496 | 3300048905 | Ga0496102_0000107 | Ga0496102_0000107_91953_92279 | 107 |
| 497 | 3300048905 | Ga0496102_0076749 | Ga0496102_0076749_789_1121 | 107 |
| 498 | 3300048905 | Ga0496102_0215505 | Ga0496102_0215505_32_361 | 107 |
| 499 | 3300048906 | Ga0496103_0046899 | Ga0496103_0046899_1801_2127 | 107 |
| 500 | 3300048906 | Ga0496103_0251136 | Ga0496103_0251136_31_363 | 107 |
| 501 | 3300048909 | Ga0496106_0099984 | Ga0496106_0099984_72_404 | 107 |
| 502 | 3300048909 | Ga0496106_0671889 | Ga0496106_0671889_428_757 | 107 |
| 503 | 3300048911 | Ga0496108_0079443 | Ga0496108_0079443_1447_1779 | 107 |
| 504 | 3300048912 | Ga0496109_0491050 | Ga0496109_0491050_71_403 | 107 |
| 505 | 3300048914 | Ga0496111_0088145 | Ga0496111_0088145_1002_1328 | 107 |
| 506 | 3300048919 | Ga0496116_0091628 | Ga0496116_0091628_745_1071 | 107 |
| 507 | 3300048920 | Ga0496117_0000010 | Ga0496117_0000010_279281_279607 | 107 |
| 508 | 3300048921 | Ga0496118_0000009 | Ga0496118_0000009_332348_332674 | 107 |
| 509 | 3300048924 | Ga0496121_0005651 | Ga0496121_0005651_15092_15418 | 107 |
| 510 | 3300048925 | Ga0496122_0007348 | Ga0496122_0007348_11157_11483 | 107 |
| 511 | 3300048926 | Ga0496123_0007323 | Ga0496123_0007323_965_1291 | 107 |
| 512 | 3300048927 | Ga0496124_0138974 | Ga0496124_0138974_1035_1361 | 107 |
| 513 | 3300048928 | Ga0496125_0018476 | Ga0496125_0018476_4555_4881 | 107 |
| 514 | 3300049162 | Ga0501307_009855 | Ga0501307_009855_230_556 | 107 |
| 515 | 3300049162 | Ga0501307_048570 | Ga0501307_048570_162_488 | 107 |
| 516 | 3300049459 | Ga0495678_001252 | Ga0495678_001252_845_1171 | 107 |
| 517 | 3300049529 | Ga0501313_000344 | Ga0501313_000344_734_1060 | 107 |
| 518 | 3300049531 | Ga0501315_007556 | Ga0501315_007556_431_757 | 107 |
| 519 | 3300049531 | Ga0501315_051933 | Ga0501315_051933_147_473 | 107 |
| 520 | 3300049532 | Ga0501316_003385 | Ga0501316_003385_800_1126 | 107 |
| 521 | 3300049533 | Ga0501317_030292 | Ga0501317_030292_170_496 | 107 |
| 522 | 3300049536 | Ga0501320_058998 | Ga0501320_058998_154_480 | 107 |
| 523 | 3300049568 | Ga0501031_0008878 | Ga0501031_0008878_641_970 | 107 |
| 524 | 3300049568 | Ga0501031_0924314 | Ga0501031_0924314_74_403 | 107 |
| 525 | 3300049569 | Ga0501032_0022737 | Ga0501032_0022737_1807_2136 | 107 |
| 526 | 3300049570 | Ga0501033_0006638 | Ga0501033_0006638_3516_3845 | 107 |
| 527 | 3300049570 | Ga0501033_0015044 | Ga0501033_0015044_3838_4167 | 107 |
| 528 | 3300049570 | Ga0501033_0247938 | Ga0501033_0247938_788_1120 | 107 |
| 529 | 3300049572 | Ga0501036_0000860 | Ga0501036_0000860_13093_13422 | 107 |
| 530 | 3300049572 | Ga0501036_0038196 | Ga0501036_0038196_641_970 | 107 |
| 531 | 3300049572 | Ga0501036_0061288 | Ga0501036_0061288_877_1206 | 107 |
| 532 | 3300049573 | Ga0501037_0120915 | Ga0501037_0120915_927_1256 | 107 |
| 533 | 3300049574 | Ga0501038_0001811 | Ga0501038_0001811_18419_18748 | 107 |
| 534 | 3300049574 | Ga0501038_0007523 | Ga0501038_0007523_9691_10020 | 107 |
| 535 | 3300049574 | Ga0501038_0123383 | Ga0501038_0123383_456_785 | 107 |
| 536 | 3300049574 | Ga0501038_0863433 | Ga0501038_0863433_38_370 | 107 |
| 537 | 3300049575 | Ga0501039_0003590 | Ga0501039_0003590_1620_1949 | 107 |
| 538 | 3300049575 | Ga0501039_0033847 | Ga0501039_0033847_2278_2607 | 107 |
| 539 | 3300049575 | Ga0501039_0084380 | Ga0501039_0084380_780_1109 | 107 |
| 540 | 3300049575 | Ga0501039_0123796 | Ga0501039_0123796_1110_1439 | 107 |
| 541 | 3300049575 | Ga0501039_0496823 | Ga0501039_0496823_136_468 | 107 |
| 542 | 3300049575 | Ga0501039_0800020 | Ga0501039_0800020_246_578 | 107 |
| 543 | 3300049576 | Ga0501040_0006253 | Ga0501040_0006253_944_1273 | 107 |
| 544 | 3300049576 | Ga0501040_0218857 | Ga0501040_0218857_884_1216 | 107 |
| 545 | 3300049577 | Ga0501041_0002688 | Ga0501041_0002688_9298_9627 | 107 |
| 546 | 3300049577 | Ga0501041_0050199 | Ga0501041_0050199_661_990 | 107 |
| 547 | 3300049577 | Ga0501041_0148491 | Ga0501041_0148491_803_1135 | 107 |
| 548 | 3300049577 | Ga0501041_0399930 | Ga0501041_0399930_107_436 | 107 |
| 549 | 3300049578 | Ga0501042_0002889 | Ga0501042_0002889_1543_1872 | 107 |
| 550 | 3300049578 | Ga0501042_0078030 | Ga0501042_0078030_1596_1925 | 107 |
| 551 | 3300049578 | Ga0501042_0089306 | Ga0501042_0089306_1353_1685 | 107 |
| 552 | 3300049578 | Ga0501042_0112374 | Ga0501042_0112374_1331_1660 | 107 |
| 553 | 3300049578 | Ga0501042_0162058 | Ga0501042_0162058_1250_1579 | 107 |
| 554 | 3300049579 | Ga0501043_0039590 | Ga0501043_0039590_1811_2140 | 107 |
| 555 | 3300049580 | Ga0501046_0002460 | Ga0501046_0002460_8317_8646 | 107 |
| 556 | 3300049580 | Ga0501046_0110602 | Ga0501046_0110602_219_548 | 107 |
| 557 | 3300049580 | Ga0501046_0254075 | Ga0501046_0254075_870_1199 | 107 |
| 558 | 3300049580 | Ga0501046_0260783 | Ga0501046_0260783_584_913 | 107 |
| 559 | 3300049582 | Ga0501048_0005635 | Ga0501048_0005635_1248_1577 | 107 |
| 560 | 3300049582 | Ga0501048_0023088 | Ga0501048_0023088_1301_1630 | 107 |
| 561 | 3300049582 | Ga0501048_0334812 | Ga0501048_0334812_577_906 | 107 |
| 562 | 3300049582 | Ga0501048_0597310 | Ga0501048_0597310_122_451 | 107 |
| 563 | 3300049582 | Ga0501048_1354751 | Ga0501048_1354751_17_349 | 107 |
| 564 | 3300049584 | Ga0501068_0038347 | Ga0501068_0038347_1530_1859 | 107 |
| 565 | 3300049584 | Ga0501068_0121565 | Ga0501068_0121565_106_435 | 107 |
| 566 | 3300049585 | Ga0501069_0082331 | Ga0501069_0082331_631_960 | 107 |
| 567 | 3300049585 | Ga0501069_0332763 | Ga0501069_0332763_454_783 | 107 |
| 568 | 3300049586 | Ga0501070_0018631 | Ga0501070_0018631_1616_1945 | 107 |
| 569 | 3300049587 | Ga0501071_0017331 | Ga0501071_0017331_3995_4324 | 107 |
| 570 | 3300049587 | Ga0501071_0033941 | Ga0501071_0033941_1796_2125 | 107 |
| 571 | 3300049587 | Ga0501071_0170689 | Ga0501071_0170689_1176_1508 | 107 |
| 572 | 3300049587 | Ga0501071_0222001 | Ga0501071_0222001_602_931 | 107 |
| 573 | 3300049588 | Ga0501072_0000876 | Ga0501072_0000876_19744_20073 | 107 |
| 574 | 3300049588 | Ga0501072_0004398 | Ga0501072_0004398_1387_1719 | 107 |
| 575 | 3300049588 | Ga0501072_0005377 | Ga0501072_0005377_9347_9676 | 107 |
| 576 | 3300049588 | Ga0501072_0349008 | Ga0501072_0349008_13_345 | 107 |
| 577 | 3300049588 | Ga0501072_0861288 | Ga0501072_0861288_132_461 | 107 |
| 578 | 3300049589 | Ga0501073_0252972 | Ga0501073_0252972_521_850 | 107 |
| 579 | 3300049590 | Ga0501074_0039136 | Ga0501074_0039136_2390_2719 | 107 |
| 580 | 3300049590 | Ga0501074_0116871 | Ga0501074_0116871_1272_1601 | 107 |
| 581 | 3300049591 | Ga0501075_0001775 | Ga0501075_0001775_4308_4637 | 107 |
| 582 | 3300049591 | Ga0501075_0005327 | Ga0501075_0005327_6566_6895 | 107 |
| 583 | 3300049591 | Ga0501075_0023711 | Ga0501075_0023711_2887_3219 | 107 |
| 584 | 3300049591 | Ga0501075_0039240 | Ga0501075_0039240_2698_3027 | 107 |
| 585 | 3300049591 | Ga0501075_0067030 | Ga0501075_0067030_777_1109 | 107 |
| 586 | 3300049591 | Ga0501075_0204004 | Ga0501075_0204004_93_422 | 107 |
| 587 | 3300049592 | Ga0501076_0001726 | Ga0501076_0001726_4413_4742 | 107 |
| 588 | 3300049592 | Ga0501076_0019989 | Ga0501076_0019989_2802_3131 | 107 |
| 589 | 3300049592 | Ga0501076_0035681 | Ga0501076_0035681_908_1240 | 107 |
| 590 | 3300049592 | Ga0501076_0041142 | Ga0501076_0041142_3103_3432 | 107 |
| 591 | 3300049592 | Ga0501076_0107003 | Ga0501076_0107003_800_1129 | 107 |
| 592 | 3300049592 | Ga0501076_0236098 | Ga0501076_0236098_735_1067 | 107 |
| 593 | 3300049593 | Ga0501077_0007786 | Ga0501077_0007786_5770_6099 | 107 |
| 594 | 3300049593 | Ga0501077_0082710 | Ga0501077_0082710_285_614 | 107 |
| 595 | 3300049707 | Ga0501234_016510 | Ga0501234_016510_588_914 | 107 |
| 596 | 3300049741 | Ga0501079_0010767 | Ga0501079_0010767_4364_4693 | 107 |
| 597 | 3300049741 | Ga0501079_0024793 | Ga0501079_0024793_2242_2571 | 107 |
| 598 | 3300049741 | Ga0501079_0056411 | Ga0501079_0056411_280_609 | 107 |
| 599 | 3300049741 | Ga0501079_0272792 | Ga0501079_0272792_144_473 | 107 |
| 600 | 3300049741 | Ga0501079_0748301 | Ga0501079_0748301_365_697 | 107 |
| 601 | 3300049742 | Ga0501080_0001334 | Ga0501080_0001334_9805_10134 | 107 |
| 602 | 3300049742 | Ga0501080_0028797 | Ga0501080_0028797_4073_4402 | 107 |
| 603 | 3300049742 | Ga0501080_0384496 | Ga0501080_0384496_288_617 | 107 |
| 604 | 3300049742 | Ga0501080_0506151 | Ga0501080_0506151_239_568 | 107 |
| 605 | 3300049743 | Ga0501081_0001270 | Ga0501081_0001270_4391_4720 | 107 |
| 606 | 3300049743 | Ga0501081_0002641 | Ga0501081_0002641_9332_9661 | 107 |
| 607 | 3300049743 | Ga0501081_0267644 | Ga0501081_0267644_658_990 | 107 |
| 608 | 3300049743 | Ga0501081_0420267 | Ga0501081_0420267_615_944 | 107 |
| 609 | 3300049743 | Ga0501081_0986286 | Ga0501081_0986286_200_532 | 107 |
| 610 | 3300049743 | Ga0501081_1130775 | Ga0501081_1130775_191_523 | 107 |
| 611 | 3300049744 | Ga0501083_0053510 | Ga0501083_0053510_1230_1559 | 107 |
| 612 | 3300049775 | Ga0501279_077216 | Ga0501279_077216_203_535 | 107 |
| 613 | 3300049822 | Ga0501035_0015293 | Ga0501035_0015293_3668_3997 | 107 |
| 614 | 3300049822 | Ga0501035_0044811 | Ga0501035_0044811_2447_2776 | 107 |
| 615 | 3300049823 | Ga0501044_0444027 | Ga0501044_0444027_54_383 | 107 |
| 616 | 3300049823 | Ga0501044_1106659 | Ga0501044_1106659_235_564 | 107 |
| 617 | 3300049824 | Ga0501045_0000682 | Ga0501045_0000682_1233_1562 | 107 |
| 618 | 3300049824 | Ga0501045_0037058 | Ga0501045_0037058_1667_1996 | 107 |
| 619 | 3300049824 | Ga0501045_0190796 | Ga0501045_0190796_1017_1346 | 107 |
| 620 | 3300049824 | Ga0501045_0209394 | Ga0501045_0209394_659_988 | 107 |
| 621 | 3300049824 | Ga0501045_0282704 | Ga0501045_0282704_848_1177 | 107 |
| 622 | 3300049824 | Ga0501045_0462802 | Ga0501045_0462802_196_528 | 107 |
| 623 | 3300050507 | nmdc:mga05p37_1143171_c1 | nmdc:mga05p37_1143171_c1_258_590 | 107 |
| 624 | 3300050507 | nmdc:mga05p37_1238102_c1 | nmdc:mga05p37_1238102_c1_145_477 | 107 |
| 625 | 3300050507 | nmdc:mga05p37_149458_c1 | nmdc:mga05p37_149458_c1_2017_2346 | 107 |
| 626 | 3300050507 | nmdc:mga05p37_388885_c1 | nmdc:mga05p37_388885_c1_899_1228 | 107 |
| 627 | 3300050507 | nmdc:mga05p37_481842_c1 | nmdc:mga05p37_481842_c1_509_841 | 107 |
| 628 | 3300050507 | nmdc:mga05p37_550978_c1 | nmdc:mga05p37_550978_c1_104_433 | 107 |
| 629 | 3300050507 | nmdc:mga05p37_56257_c1 | nmdc:mga05p37_56257_c1_3974_4303 | 107 |
| 630 | 3300050507 | nmdc:mga05p37_6620_c1 | nmdc:mga05p37_6620_c1_9366_9698 | 107 |
| 631 | 3300050507 | nmdc:mga05p37_75653_c1 | nmdc:mga05p37_75653_c1_437_766 | 107 |
| 632 | 3300050507 | nmdc:mga05p37_87904_c1 | nmdc:mga05p37_87904_c1_753_1085 | 107 |
| 633 | 3300050508 | nmdc:mga09592_1107143_c1 | nmdc:mga09592_1107143_c1_246_575 | 107 |
| 634 | 3300050508 | nmdc:mga09592_1439824_c1 | nmdc:mga09592_1439824_c1_152_484 | 107 |
| 635 | 3300050508 | nmdc:mga09592_252445_c1 | nmdc:mga09592_252445_c1_1145_1474 | 107 |
| 636 | 3300050508 | nmdc:mga09592_29671_c1 | nmdc:mga09592_29671_c1_749_1078 | 107 |
| 637 | 3300050508 | nmdc:mga09592_3243_c1 | nmdc:mga09592_3243_c1_12434_12763 | 107 |
| 638 | 3300050508 | nmdc:mga09592_404324_c1 | nmdc:mga09592_404324_c1_639_968 | 107 |
| 639 | 3300050508 | nmdc:mga09592_45640_c2 | nmdc:mga09592_45640_c2_102_434 | 107 |
| 640 | 3300050508 | nmdc:mga09592_466896_c1 | nmdc:mga09592_466896_c1_14_343 | 107 |
| 641 | 3300050508 | nmdc:mga09592_8581_c1 | nmdc:mga09592_8581_c1_2576_2908 | 107 |
| 642 | 3300050509 | nmdc:mga0qj67_1003856_c1 | nmdc:mga0qj67_1003856_c1_178_510 | 107 |
| 643 | 3300050509 | nmdc:mga0qj67_1133685_c1 | nmdc:mga0qj67_1133685_c1_122_454 | 107 |
| 644 | 3300050509 | nmdc:mga0qj67_1552_c1 | nmdc:mga0qj67_1552_c1_11831_12160 | 107 |
| 645 | 3300050509 | nmdc:mga0qj67_365_c1 | nmdc:mga0qj67_365_c1_22025_22357 | 107 |
| 646 | 3300050509 | nmdc:mga0qj67_466097_c1 | nmdc:mga0qj67_466097_c1_259_588 | 107 |
| 647 | 3300050509 | nmdc:mga0qj67_652_c1 | nmdc:mga0qj67_652_c1_20974_21306 | 107 |
| 648 | 3300050509 | nmdc:mga0qj67_78796_c1 | nmdc:mga0qj67_78796_c1_2219_2548 | 107 |
| 649 | 3300050510 | nmdc:mga06r32_1869316_c1 | nmdc:mga06r32_1869316_c1_82_411 | 107 |
| 650 | 3300050510 | nmdc:mga06r32_219942_c1 | nmdc:mga06r32_219942_c1_1139_1468 | 107 |
| 651 | 3300050510 | nmdc:mga06r32_321002_c1 | nmdc:mga06r32_321002_c1_695_1024 | 107 |
| 652 | 3300050510 | nmdc:mga06r32_3383_c1 | nmdc:mga06r32_3383_c1_10349_10681 | 107 |
| 653 | 3300050510 | nmdc:mga06r32_345282_c1 | nmdc:mga06r32_345282_c1_1059_1388 | 107 |
| 654 | 3300050510 | nmdc:mga06r32_44913_c1 | nmdc:mga06r32_44913_c1_749_1078 | 107 |
| 655 | 3300050510 | nmdc:mga06r32_7587_c1 | nmdc:mga06r32_7587_c1_204_536 | 107 |
| 656 | 3300050511 | nmdc:mga08y16_13153_c1 | nmdc:mga08y16_13153_c1_180_509 | 107 |
| 657 | 3300050511 | nmdc:mga08y16_52624_c1 | nmdc:mga08y16_52624_c1_3846_4175 | 107 |
| 658 | 3300050511 | nmdc:mga08y16_638229_c1 | nmdc:mga08y16_638229_c1_268_600 | 107 |
| 659 | 3300050511 | nmdc:mga08y16_670510_c1 | nmdc:mga08y16_670510_c1_343_675 | 107 |
| 660 | 3300050511 | nmdc:mga08y16_8137_c1 | nmdc:mga08y16_8137_c1_5229_5558 | 107 |
| 661 | 3300050512 | nmdc:mga0n895_131480_c1 | nmdc:mga0n895_131480_c1_910_1242 | 107 |
| 662 | 3300050512 | nmdc:mga0n895_215496_c1 | nmdc:mga0n895_215496_c1_826_1155 | 107 |
| 663 | 3300050512 | nmdc:mga0n895_4841_c1 | nmdc:mga0n895_4841_c1_10378_10710 | 107 |
| 664 | 3300050512 | nmdc:mga0n895_58104_c1 | nmdc:mga0n895_58104_c1_1431_1760 | 107 |
| 665 | 3300050512 | nmdc:mga0n895_9114_c1 | nmdc:mga0n895_9114_c1_6764_7093 | 107 |
| 666 | 3300050513 | nmdc:mga0rr50_107578_c1 | nmdc:mga0rr50_107578_c1_1233_1562 | 107 |
| 667 | 3300050513 | nmdc:mga0rr50_209820_c1 | nmdc:mga0rr50_209820_c1_550_882 | 107 |
| 668 | 3300050513 | nmdc:mga0rr50_28036_c1 | nmdc:mga0rr50_28036_c1_457_786 | 107 |
| 669 | 3300050513 | nmdc:mga0rr50_287865_c1 | nmdc:mga0rr50_287865_c1_118_450 | 107 |
| 670 | 3300050513 | nmdc:mga0rr50_5113_c1 | nmdc:mga0rr50_5113_c1_2399_2728 | 107 |
| 671 | 3300050514 | nmdc:mga08x19_16214_c1 | nmdc:mga08x19_16214_c1_1338_1670 | 107 |
| 672 | 3300050514 | nmdc:mga08x19_28871_c1 | nmdc:mga08x19_28871_c1_980_1309 | 107 |
| 673 | 3300050514 | nmdc:mga08x19_560250_c1 | nmdc:mga08x19_560250_c1_104_433 | 107 |
| 674 | 3300050514 | nmdc:mga08x19_77267_c1 | nmdc:mga08x19_77267_c1_957_1286 | 107 |
| 675 | 3300050515 | nmdc:mga0a205_107185_c1 | nmdc:mga0a205_107185_c1_971_1303 | 107 |
| 676 | 3300050515 | nmdc:mga0a205_15571_c1 | nmdc:mga0a205_15571_c1_176_505 | 107 |
| 677 | 3300050515 | nmdc:mga0a205_156652_c1 | nmdc:mga0a205_156652_c1_1189_1518 | 107 |
| 678 | 3300050515 | nmdc:mga0a205_285697_c1 | nmdc:mga0a205_285697_c1_1005_1337 | 107 |
| 679 | 3300050515 | nmdc:mga0a205_32330_c1 | nmdc:mga0a205_32330_c1_992_1321 | 107 |
| 680 | 3300050515 | nmdc:mga0a205_342909_c1 | nmdc:mga0a205_342909_c1_148_477 | 107 |
| 681 | 3300050515 | nmdc:mga0a205_55271_c1 | nmdc:mga0a205_55271_c1_2046_2375 | 107 |
| 682 | 3300050515 | nmdc:mga0a205_56850_c1 | nmdc:mga0a205_56850_c1_1903_2235 | 107 |
| 683 | 3300050515 | nmdc:mga0a205_650248_c1 | nmdc:mga0a205_650248_c1_184_513 | 107 |
| 684 | 3300053087 | Ga0500643_000124 | Ga0500643_000124_50651_50974 | 107 |
| 685 | 3300054114 | Ga0501084_0000677 | Ga0501084_0000677_4590_4919 | 107 |
| 686 | 3300054114 | Ga0501084_0002581 | Ga0501084_0002581_818_1147 | 107 |
| 687 | 3300054114 | Ga0501084_0336243 | Ga0501084_0336243_523_852 | 107 |
| 688 | 3300054114 | Ga0501084_0352867 | Ga0501084_0352867_637_966 | 107 |
| 689 | 3300054114 | Ga0501084_1258735 | Ga0501084_1258735_38_370 | 107 |
| 690 | 3300059426 | Ga0590077_069239 | Ga0590077_069239_118_450 | 107 |
| 691 | 3300059493 | Ga0587077_029740 | Ga0587077_029740_172_498 | 107 |
| 692 | 3300059503 | Ga0587080_056077 | Ga0587080_056077_292_618 | 107 |
| 693 | 3300059505 | Ga0587083_0085422 | Ga0587083_0085422_299_625 | 107 |
| 694 | 3300059507 | Ga0587086_113744 | Ga0587086_113744_63_389 | 107 |
| 695 | 3300059510 | Ga0587090_118483 | Ga0587090_118483_154_480 | 107 |
| 696 | 3300059641 | Ga0587068_029919 | Ga0587068_029919_419_745 | 107 |
| 697 | 3300059643 | Ga0587072_074696 | Ga0587072_074696_143_469 | 107 |
| 698 | 3300060353 | Ga0501082_0002693 | Ga0501082_0002693_1214_1543 | 107 |
| 699 | 3300060353 | Ga0501082_0005933 | Ga0501082_0005933_9507_9836 | 107 |
| 700 | 3300060353 | Ga0501082_0045078 | Ga0501082_0045078_2448_2777 | 107 |
| 701 | 3300060353 | Ga0501082_0683433 | Ga0501082_0683433_47_379 | 107 |
| 702 | 3300060353 | Ga0501082_0799333 | Ga0501082_0799333_416_745 | 107 |
| 703 | 3300060353 | Ga0501082_0909841 | Ga0501082_0909841_119_448 | 107 |
| 704 | 3300061734 | Ga0530510_0001493 | Ga0530510_0001493_5330_5659 | 107 |
| 705 | 3300061734 | Ga0530510_0003925 | Ga0530510_0003925_7130_7459 | 107 |
| 706 | 3300061734 | Ga0530510_0037620 | Ga0530510_0037620_308_637 | 107 |
| 707 | 3300061734 | Ga0530510_0053697 | Ga0530510_0053697_1497_1826 | 107 |
| 708 | 3300061734 | Ga0530510_0056888 | Ga0530510_0056888_333_662 | 107 |
| 709 | 3300061734 | Ga0530510_0100486 | Ga0530510_0100486_1312_1644 | 107 |
| 710 | 3300061734 | Ga0530510_0316419 | Ga0530510_0316419_765_1094 | 107 |
| 711 | 3300002067 | JGI24735J21928_10003171 | JGI24735J21928_100031712 | 108 |
| 712 | 3300004803 | Ga0058862_12425548 | Ga0058862_124255481 | 108 |
| 713 | 3300005327 | Ga0070658_10060932 | Ga0070658_100609323 | 108 |
| 714 | 3300005337 | Ga0070682_100592502 | Ga0070682_1005925022 | 108 |
| 715 | 3300005617 | Ga0068859_100019419 | Ga0068859_1000194196 | 108 |
| 716 | 3300006178 | Ga0075367_10180255 | Ga0075367_101802552 | 108 |
| 717 | 3300006931 | Ga0097620_100019419 | Ga0097620_1000194196 | 108 |
| 718 | 3300007076 | Ga0075435_100076730 | Ga0075435_1000767305 | 108 |
| 719 | 3300009101 | Ga0105247_10008646 | Ga0105247_100086464 | 108 |
| 720 | 3300009551 | Ga0105238_10849849 | Ga0105238_108498492 | 108 |
| 721 | 3300013104 | Ga0157370_11876273 | Ga0157370_118762731 | 108 |
| 722 | 3300013105 | Ga0157369_10254394 | Ga0157369_102543943 | 108 |
| 723 | 3300013105 | Ga0157369_11631262 | Ga0157369_116312621 | 108 |
| 724 | 3300013307 | Ga0157372_11311620 | Ga0157372_113116202 | 108 |
| 725 | 3300014968 | Ga0157379_11579587 | Ga0157379_115795871 | 108 |
| 726 | 3300020069 | Ga0197907_10518326 | Ga0197907_105183261 | 108 |
| 727 | 3300020069 | Ga0197907_11509585 | Ga0197907_115095851 | 108 |
| 728 | 3300020070 | Ga0206356_11723322 | Ga0206356_117233222 | 108 |
| 729 | 3300020076 | Ga0206355_1045112 | Ga0206355_10451122 | 108 |
| 730 | 3300020076 | Ga0206355_1660841 | Ga0206355_16608412 | 108 |
| 731 | 3300020077 | Ga0206351_10349927 | Ga0206351_103499271 | 108 |
| 732 | 3300020077 | Ga0206351_10717643 | Ga0206351_107176432 | 108 |
| 733 | 3300020080 | Ga0206350_10668403 | Ga0206350_106684032 | 108 |
| 734 | 3300020080 | Ga0206350_10675512 | Ga0206350_106755121 | 108 |
| 735 | 3300020081 | Ga0206354_10238434 | Ga0206354_102384342 | 108 |
| 736 | 3300020082 | Ga0206353_11625478 | Ga0206353_116254782 | 108 |
| 737 | 3300020082 | Ga0206353_11636605 | Ga0206353_116366053 | 108 |
| 738 | 3300020610 | Ga0154015_1649135 | Ga0154015_16491351 | 108 |
| 739 | 3300022467 | Ga0224712_10325278 | Ga0224712_103252781 | 108 |
| 740 | 3300025900 | Ga0207710_10009004 | Ga0207710_100090043 | 108 |
| 741 | 3300025909 | Ga0207705_10829031 | Ga0207705_108290311 | 108 |
| 742 | 3300031456 | Ga0307513_10913006 | Ga0307513_109130061 | 108 |
| 743 | 3300031824 | Ga0307413_10462485 | Ga0307413_104624851 | 108 |
| 744 | 3300041452 | Ga0451793_0052380 | Ga0451793_0052380_676_1002 | 108 |
| 745 | 3300041494 | Ga0451837_1531230 | Ga0451837_1531230_177_503 | 108 |
| 746 | 3300045836 | Ga0466958_0703481 | Ga0466958_0703481_203_547 | 108 |
| 747 | 3300048905 | Ga0496102_0000013 | Ga0496102_0000013_177836_178165 | 108 |
| 748 | 3300048906 | Ga0496103_0000105 | Ga0496103_0000105_5877_6206 | 108 |
| 749 | 3300048914 | Ga0496111_0706247 | Ga0496111_0706247_292_618 | 108 |
| 750 | 3300048920 | Ga0496117_0093728 | Ga0496117_0093728_718_1047 | 108 |
| 751 | 3300048921 | Ga0496118_0018871 | Ga0496118_0018871_396_725 | 108 |
| 752 | 3300048922 | Ga0496119_0051039 | Ga0496119_0051039_1335_1664 | 108 |
| 753 | 3300048924 | Ga0496121_0053352 | Ga0496121_0053352_2914_3243 | 108 |
| 754 | 3300048925 | Ga0496122_0015575 | Ga0496122_0015575_1095_1421 | 108 |
| 755 | 3300048926 | Ga0496123_0002281 | Ga0496123_0002281_13530_13856 | 108 |
| 756 | 3300049569 | Ga0501032_0249933 | Ga0501032_0249933_315_641 | 108 |
| 757 | 3300049570 | Ga0501033_0006614 | Ga0501033_0006614_7746_8072 | 108 |
| 758 | 3300049570 | Ga0501033_0135413 | Ga0501033_0135413_672_998 | 108 |
| 759 | 3300049571 | Ga0501034_0512181 | Ga0501034_0512181_75_401 | 108 |
| 760 | 3300049571 | Ga0501034_1020043 | Ga0501034_1020043_371_697 | 108 |
| 761 | 3300049573 | Ga0501037_0133937 | Ga0501037_0133937_660_986 | 108 |
| 762 | 3300049578 | Ga0501042_0002934 | Ga0501042_0002934_2980_3306 | 108 |
| 763 | 3300049579 | Ga0501043_0105147 | Ga0501043_0105147_18_344 | 108 |
| 764 | 3300049581 | Ga0501047_0095003 | Ga0501047_0095003_2483_2809 | 108 |
| 765 | 3300049581 | Ga0501047_0384053 | Ga0501047_0384053_358_684 | 108 |
| 766 | 3300049585 | Ga0501069_0167170 | Ga0501069_0167170_79_405 | 108 |
| 767 | 3300049744 | Ga0501083_0000990 | Ga0501083_0000990_18516_18842 | 108 |
| 768 | 3300049744 | Ga0501083_0008270 | Ga0501083_0008270_4501_4827 | 108 |
| 769 | 3300049822 | Ga0501035_0159266 | Ga0501035_0159266_138_464 | 108 |
| 770 | 3300049823 | Ga0501044_0502036 | Ga0501044_0502036_469_795 | 108 |
| 771 | 3300049824 | Ga0501045_0762528 | Ga0501045_0762528_169_495 | 108 |
| 772 | 3300050492 | nmdc:mga0yw44_129854_c1 | nmdc:mga0yw44_129854_c1_207_533 | 108 |
| 773 | 3300050494 | nmdc:mga06z11_119732_c1 | nmdc:mga06z11_119732_c1_676_1002 | 108 |
| 774 | 3300050513 | nmdc:mga0rr50_32889_c1 | nmdc:mga0rr50_32889_c1_2480_2830 | 108 |
| 775 | 3300050513 | nmdc:mga0rr50_63038_c1 | nmdc:mga0rr50_63038_c1_568_912 | 108 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wxt-assembly1.cif.gz_A | x-ray crystal structure of thioredoxin from mycobacterium avium | 0.9896 | 3 | 101 |
| 4pob-assembly1.cif.gz_B | crystal structure of a thioredoxin rv1471 ortholog from mycobacterium abscessus | 0.988 | 3 | 104 |
| 1t00-assembly1.cif.gz_A | the structure of thioredoxin from s. coelicolor | 0.9875 | 3 | 105 |
| 5hr1-assembly7.cif.gz_G | crystal structure of thioredoxin l107a mutant | 0.9857 | 26 | 99 |
| 3nof-assembly1.cif.gz_A | mycobacterium tuberculosis thioredoxin c c40s mutant | 0.9829 | 2 | 102 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hr1G00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9857 | 26 | 99 | 3.40.30.10 |
| 4ulxA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9729 | 3 | 104 | 3.40.30.10 |
| 3dieB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9649 | 30 | 104 | 3.40.30.10 |
| 1v98B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9634 | 22 | 105 | 3.40.30.10 |
| af_A0A0R4IGN3_1_88_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9607 | 22 | 88 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0M8UXE3-F1-model_v4 | Thioredoxin | 1 | 5 | 106 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A7L5AFU1-F1-model_v4 | Thioredoxin | 0.9998 | 1 | 106 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A4T2C8T4-F1-model_v4 | Thioredoxin | 0.9993 | 1 | 106 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A2W1Z0G1-F1-model_v4 | deleted | 0.9993 | 1 | 106 |
|
| AF-A0A0M8V7W5-F1-model_v4 | Thioredoxin | 0.9992 | 5 | 106 |
GO:0005829
GO:0015035 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar