F480257

General Info

Members Datasets Scaffolds Average Seq Length
775 316 755 109

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_11371068|Ga0114129_113710682
Length 124
Sequence MLALVLTFYLEERGMSDAATVHLTEANFDETLTGHQGLLMVDFWAEWCGPCRAIAPVLEDLARESAGRVTLAKVNVDENHTLAGRYGIRSIPTILFVKAGKVVDQVIGAIPKAKLKEKLDALAV

Samples

Sample ID Description Type Environment
1 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
2 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
3 2738541297 Duganella sp. GV083 Isolate Unclassified
4 2738541357 Duganella sp. GV053 Isolate Unclassified
5 2738543003 Duganella sp. GV066 Isolate Unclassified
6 2738543026 Duganella sp. GV089 Isolate Unclassified
7 2738543029 Duganella sp. GV039 Isolate Unclassified
8 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
9 2821131069 Duganella sp. 1224 Isolate Unclassified
10 2842711865 Duganella sp. R-73148 Isolate Unclassified
11 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
12 2857564685 Duganella sp. R-74599 Isolate Unclassified
13 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
14 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
15 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
16 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
17 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
18 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
19 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
20 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
29 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
129 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
135 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
177 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
190 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
191 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
197 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
204 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
205 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
206 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
207 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
208 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
209 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
218 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
221 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
222 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
232 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
233 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
252 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
303 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
304 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
305 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
308 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.77
Metatranscriptomes 4.65
Isolates 2.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 1.94
Rhizosphere 92.65
Stem 0
Stem Tuber 0
Unclassified 4.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10003171 3300002067 Bacteria 5625
2 Ga0006759J45824_1059206 3300003163 Bacteria 750
3 JGI25406J46586_10013729 3300003203 Bacteria 3466
4 rootL2_10164021 3300003322 Bacteria 2948
5 Ga0007417J51691_1051599 3300003544 Bacteria 1262
6 Ga0007410J51695_1035448 3300003574 Bacteria 586
7 Ga0007416J51690_1104318 3300003577 Bacteria 556
8 Ga0058860_11742682 3300004801 Bacteria 721
9 Ga0058862_12425548 3300004803 Bacteria 503
10 Ga0065714_10026164 3300005288 Bacteria 1660
11 Ga0065707_10012883 3300005295 Bacteria 1925
12 Ga0065707_10132300 3300005295 Bacteria 1899
13 Ga0065707_10153745 3300005295 Bacteria 1630
14 Ga0065707_10261562 3300005295 Bacteria 1096
15 Ga0065707_10444041 3300005295 Bacteria 807
16 Ga0070658_10060932 3300005327 Bacteria 3074
17 Ga0070676_10452395 3300005328 Bacteria 903
18 Ga0070690_100202217 3300005330 Bacteria 1383
19 Ga0070690_100336971 3300005330 Bacteria 1091
20 Ga0070690_100463167 3300005330 Bacteria 942
21 Ga0068869_100637188 3300005334 Bacteria 904
22 Ga0070680_100089298 3300005336 Bacteria 2550
23 Ga0070680_100260247 3300005336 Bacteria 1468
24 Ga0070682_100592502 3300005337 Bacteria 874
25 Ga0070660_101520589 3300005339 Bacteria 569
26 Ga0070689_100248841 3300005340 Bacteria 1466
27 Ga0070689_100895352 3300005340 Bacteria 785
28 Ga0070689_100905476 3300005340 Bacteria 781
29 Ga0070689_101185010 3300005340 Bacteria 685
30 Ga0070687_100331451 3300005343 Bacteria 976
31 Ga0070687_100404560 3300005343 Bacteria 896
32 Ga0070692_10036760 3300005345 Bacteria 2487
33 Ga0070692_11051185 3300005345 Bacteria 572
34 Ga0070668_100126770 3300005347 Bacteria 2045
35 Ga0070669_100032356 3300005353 Bacteria 3778
36 Ga0070669_100119199 3300005353 Bacteria 2011
37 Ga0070669_100294457 3300005353 Unclassified 1304
38 Ga0070675_100470062 3300005354 Unclassified 1130
39 Ga0070674_101179831 3300005356 Bacteria 679
40 Ga0070673_101285428 3300005364 Bacteria 687
41 Ga0070659_100437325 3300005366 Bacteria 1108
42 Ga0070703_10173814 3300005406 Bacteria 827
43 Ga0070701_10638138 3300005438 Unclassified 710
44 Ga0070701_11192322 3300005438 Bacteria 540
45 Ga0070705_100010699 3300005440 Bacteria 4601
46 Ga0070705_100029993 3300005440 Bacteria 2999
47 Ga0070705_100908666 3300005440 Bacteria 709
48 Ga0070700_100360579 3300005441 Bacteria 1081
49 Ga0070700_100600944 3300005441 Bacteria 862
50 Ga0070700_101923582 3300005441 Bacteria 512
51 Ga0070694_100076889 3300005444 Bacteria 2312
52 Ga0070694_100154711 3300005444 Bacteria 1678
53 Ga0070694_100189936 3300005444 Bacteria 1525
54 Ga0070694_100398024 3300005444 Bacteria 1077
55 Ga0070694_100474505 3300005444 Bacteria 992
56 Ga0070708_100000456 3300005445 Bacteria 30655
57 Ga0070708_100004479 3300005445 Bacteria 10986
58 Ga0070708_100034475 3300005445 Bacteria 4405
59 Ga0070708_100206866 3300005445 Bacteria 1838
60 Ga0070708_100251233 3300005445 Bacteria 1661
61 Ga0070708_100504070 3300005445 Unclassified 1142
62 Ga0070708_100839961 3300005445 Bacteria 863
63 Ga0070662_100014208 3300005457 Bacteria 5314
64 Ga0070662_100898119 3300005457 Bacteria 756
65 Ga0070681_10161989 3300005458 Bacteria 2161
66 Ga0068867_100036249 3300005459 Bacteria 3580
67 Ga0068867_100164969 3300005459 Bacteria 1750
68 Ga0070706_100027842 3300005467 Bacteria 5198
69 Ga0070706_100047435 3300005467 Bacteria 3963
70 Ga0070706_100159454 3300005467 Bacteria 2106
71 Ga0070706_100224521 3300005467 Bacteria 1753
72 Ga0070706_101012264 3300005467 Bacteria 766
73 Ga0070706_102097885 3300005467 Bacteria 511
74 Ga0070707_100000758 3300005468 Bacteria 31816
75 Ga0070707_100028839 3300005468 Bacteria 5282
76 Ga0070707_100033492 3300005468 Bacteria 4899
77 Ga0070698_100002218 3300005471 Bacteria 21496
78 Ga0070698_100319863 3300005471 Bacteria 1482
79 Ga0070698_100718095 3300005471 Bacteria 942
80 Ga0070698_101141686 3300005471 Bacteria 728
81 Ga0070699_100000498 3300005518 Bacteria 37320
82 Ga0070699_100033177 3300005518 Bacteria 4460
83 Ga0070699_100043461 3300005518 Bacteria 3889
84 Ga0070699_100151355 3300005518 Bacteria 2052
85 Ga0070699_100286899 3300005518 Bacteria 1475
86 Ga0070699_100556661 3300005518 Bacteria 1044
87 Ga0070699_100973751 3300005518 Bacteria 778
88 Ga0070679_100972905 3300005530 Bacteria 792
89 Ga0070697_100001129 3300005536 Bacteria 20201
90 Ga0070697_100017366 3300005536 Bacteria 5661
91 Ga0070697_100074426 3300005536 Bacteria 2790
92 Ga0070697_100116744 3300005536 Bacteria 2229
93 Ga0070697_100221432 3300005536 Unclassified 1613
94 Ga0070697_100700559 3300005536 Bacteria 894
95 Ga0070697_101232400 3300005536 Bacteria 667
96 Ga0068853_100699015 3300005539 Bacteria 967
97 Ga0068853_102453598 3300005539 Bacteria 505
98 Ga0070672_100810116 3300005543 Bacteria 824
99 Ga0070686_100418032 3300005544 Bacteria 1024
100 Ga0070686_101750835 3300005544 Bacteria 528
101 Ga0070695_100059011 3300005545 Bacteria 2483
102 Ga0070695_100145506 3300005545 Bacteria 1648
103 Ga0070695_100448793 3300005545 Bacteria 988
104 Ga0070695_100647699 3300005545 Bacteria 834
105 Ga0070695_100797224 3300005545 Bacteria 757
106 Ga0070695_101607339 3300005545 Bacteria 543
107 Ga0070696_100074115 3300005546 Bacteria 2400
108 Ga0070696_100170592 3300005546 Bacteria 1608
109 Ga0070696_101447942 3300005546 Bacteria 587
110 Ga0070704_100078316 3300005549 Bacteria 2425
111 Ga0070704_100555737 3300005549 Bacteria 1003
112 Ga0070704_100588603 3300005549 Bacteria 976
113 Ga0070704_101515582 3300005549 Bacteria 617
114 Ga0070704_101990577 3300005549 Bacteria 539
115 Ga0068857_100096186 3300005577 Bacteria 2654
116 Ga0068854_100514622 3300005578 Bacteria 1010
117 Ga0068854_100899105 3300005578 Bacteria 778
118 Ga0070702_100426204 3300005615 Bacteria 956
119 Ga0070702_100506494 3300005615 Bacteria 888
120 Ga0070702_101202331 3300005615 Bacteria 611
121 Ga0068859_100019419 3300005617 Bacteria 6826
122 Ga0068859_100063359 3300005617 Bacteria 3728
123 Ga0068859_100201133 3300005617 Bacteria 2077
124 Ga0068859_101527906 3300005617 Bacteria 737
125 Ga0068864_100195694 3300005618 Bacteria 1855
126 Ga0068864_101719118 3300005618 Bacteria 632
127 Ga0068866_10336332 3300005718 Bacteria 955
128 Ga0068866_10541919 3300005718 Bacteria 777
129 Ga0068861_100354774 3300005719 Bacteria 1288
130 Ga0068861_100692281 3300005719 Bacteria 946
131 Ga0068861_100961276 3300005719 Bacteria 813
132 Ga0068870_10685190 3300005840 Bacteria 706
133 Ga0068870_10775180 3300005840 Bacteria 668
134 Ga0068863_100156607 3300005841 Bacteria 2181
135 Ga0068863_100422415 3300005841 Bacteria 1306
136 Ga0068858_100051407 3300005842 Bacteria 3813
137 Ga0068858_101559214 3300005842 Bacteria 652
138 Ga0068860_100471376 3300005843 Unclassified 1250
139 Ga0068860_100558820 3300005843 Bacteria 1147
140 Ga0068860_100654788 3300005843 Bacteria 1058
141 Ga0068860_100680405 3300005843 Bacteria 1038
142 Ga0068860_102310457 3300005843 Bacteria 558
143 Ga0068862_100062629 3300005844 Unclassified 3199
144 Ga0068862_100072772 3300005844 Bacteria 2970
145 Ga0068862_100909682 3300005844 Bacteria 865
146 Ga0081455_10109316 3300005937 Bacteria 2200
147 Ga0081540_1043478 3300005983 Bacteria 2304
148 Ga0081539_10001809 3300005985 Bacteria 33796
149 Ga0075367_10180255 3300006178 Bacteria 1317
150 Ga0075427_10000681 3300006194 Bacteria 4052
151 Ga0075370_10751422 3300006353 Bacteria 594
152 Ga0075428_100001846 3300006844 Bacteria 22712
153 Ga0075428_100003298 3300006844 Bacteria 17657
154 Ga0075428_100005773 3300006844 Bacteria 13743
155 Ga0075428_100071462 3300006844 Bacteria 3793
156 Ga0075428_100210274 3300006844 Bacteria 2102
157 Ga0075428_100420289 3300006844 Bacteria 1432
158 Ga0075428_100464275 3300006844 Bacteria 1355
159 Ga0075428_100665376 3300006844 Bacteria 1110
160 Ga0075428_100961041 3300006844 Bacteria 905
161 Ga0075430_100000087 3300006846 Bacteria 52758
162 Ga0075430_100000851 3300006846 Bacteria 23937
163 Ga0075430_100034167 3300006846 Bacteria 4315
164 Ga0075430_100509418 3300006846 Bacteria 993
165 Ga0075430_101085859 3300006846 Bacteria 659
166 Ga0075430_101594603 3300006846 Bacteria 536
167 Ga0075430_101658453 3300006846 Bacteria 525
168 Ga0075431_100000280 3300006847 Bacteria 39760
169 Ga0075431_100000559 3300006847 Bacteria 31330
170 Ga0075431_100007752 3300006847 Bacteria 10694
171 Ga0075431_100039734 3300006847 Bacteria 4848
172 Ga0075431_100051697 3300006847 Bacteria 4237
173 Ga0075431_100068763 3300006847 Bacteria 3654
174 Ga0075431_100120761 3300006847 Bacteria 2704
175 Ga0075431_100126605 3300006847 Bacteria 2636
176 Ga0075431_100266142 3300006847 Bacteria 1738
177 Ga0075431_100551051 3300006847 Bacteria 1140
178 Ga0075431_101675951 3300006847 Bacteria 593
179 Ga0075433_10000147 3300006852 Bacteria 37403
180 Ga0075433_10000942 3300006852 Bacteria 20529
181 Ga0075433_10019113 3300006852 Bacteria 5700
182 Ga0075433_10024441 3300006852 Bacteria 5099
183 Ga0075433_10060713 3300006852 Bacteria 3311
184 Ga0075433_10234916 3300006852 Bacteria 1628
185 Ga0075433_10259002 3300006852 Bacteria 1542
186 Ga0075433_10297718 3300006852 Bacteria 1429
187 Ga0075433_10315471 3300006852 Bacteria 1383
188 Ga0075433_10781418 3300006852 Bacteria 835
189 Ga0075434_100000540 3300006871 Bacteria 28804
190 Ga0075434_100017703 3300006871 Bacteria 6869
191 Ga0075434_100114034 3300006871 Bacteria 2715
192 Ga0075434_100133256 3300006871 Bacteria 2504
193 Ga0075434_100536474 3300006871 Bacteria 1190
194 Ga0075434_101025856 3300006871 Bacteria 839
195 Ga0075429_100000843 3300006880 Bacteria 24082
196 Ga0075429_100000958 3300006880 Bacteria 22882
197 Ga0075429_100023270 3300006880 Bacteria 5373
198 Ga0075429_100053228 3300006880 Bacteria 3522
199 Ga0075429_100104139 3300006880 Bacteria 2478
200 Ga0075429_100219412 3300006880 Bacteria 1666
201 Ga0075429_100295710 3300006880 Bacteria 1418
202 Ga0075429_100334855 3300006880 Bacteria 1325
203 Ga0075429_100356463 3300006880 Bacteria 1281
204 Ga0075429_100722780 3300006880 Bacteria 872
205 Ga0068865_100070365 3300006881 Bacteria 2479
206 Ga0068865_100292113 3300006881 Bacteria 1301
207 Ga0075436_100000316 3300006914 Bacteria 30801
208 Ga0075436_100011766 3300006914 Bacteria 6006
209 Ga0075436_100051257 3300006914 Bacteria 2848
210 Ga0075436_100067904 3300006914 Bacteria 2463
211 Ga0075436_100746527 3300006914 Bacteria 727
212 Ga0097620_100019419 3300006931 Bacteria 6826
213 Ga0097620_100063359 3300006931 Bacteria 3728
214 Ga0097620_100201116 3300006931 Bacteria 2077
215 Ga0097620_101528306 3300006931 Bacteria 737
216 Ga0075435_100003722 3300007076 Bacteria 10386
217 Ga0075435_100015844 3300007076 Bacteria 5674
218 Ga0075435_100022826 3300007076 Bacteria 4830
219 Ga0075435_100076730 3300007076 Bacteria 2739
220 Ga0075435_101075912 3300007076 Bacteria 703
221 Ga0075435_102021957 3300007076 Bacteria 506
222 Ga0075435_102063376 3300007076 Bacteria 501
223 Ga0099794_10041868 3300007265 Bacteria 2182
224 Ga0099794_10493869 3300007265 Bacteria 644
225 Ga0105250_10208379 3300009092 Bacteria 826
226 Ga0105240_12569481 3300009093 Bacteria 526
227 Ga0111539_10000675 3300009094 Bacteria 44135
228 Ga0111539_10001562 3300009094 Bacteria 30480
229 Ga0111539_10594127 3300009094 Bacteria 1289
230 Ga0111539_10997441 3300009094 Bacteria 973
231 Ga0111539_11067343 3300009094 Bacteria 939
232 Ga0111539_11182412 3300009094 Bacteria 888
233 Ga0111539_11215873 3300009094 Bacteria 875
234 Ga0111539_11492152 3300009094 Bacteria 784
235 Ga0105247_10008646 3300009101 Bacteria 6207
236 Ga0105247_10589909 3300009101 Bacteria 822
237 Ga0114129_10000331 3300009147 Bacteria 55274
238 Ga0114129_10000487 3300009147 Bacteria 47969
239 Ga0114129_10001127 3300009147 Bacteria 35311
240 Ga0114129_10001268 3300009147 Bacteria 33724
241 Ga0114129_10005736 3300009147 Bacteria 17593
242 Ga0114129_10021639 3300009147 Bacteria 9125
243 Ga0114129_10056215 3300009147 Bacteria 5513
244 Ga0114129_10105186 3300009147 Bacteria 3901
245 Ga0114129_10184181 3300009147 Bacteria 2839
246 Ga0114129_10260766 3300009147 Bacteria 2323
247 Ga0114129_10338740 3300009147 Bacteria 1995
248 Ga0114129_10380485 3300009147 Bacteria 1864
249 Ga0114129_10395081 3300009147 Bacteria 1823
250 Ga0114129_10615478 3300009147 Bacteria 1405
251 Ga0114129_10949635 3300009147 Bacteria 1086
252 Ga0114129_11048358 3300009147 Bacteria 1024
253 Ga0114129_11371068 3300009147 Bacteria 874
254 Ga0114129_11575551 3300009147 Bacteria 805
255 Ga0105243_10159032 3300009148 Bacteria 1946
256 Ga0105243_10249501 3300009148 Bacteria 1584
257 Ga0105243_10584384 3300009148 Unclassified 1073
258 Ga0105241_10063776 3300009174 Bacteria 2844
259 Ga0105241_10653564 3300009174 Bacteria 955
260 Ga0105242_10360527 3300009176 Bacteria 1345
261 Ga0105242_10581274 3300009176 Bacteria 1079
262 Ga0105242_10666146 3300009176 Bacteria 1014
263 Ga0105242_11039901 3300009176 Bacteria 829
264 Ga0105248_10050018 3300009177 Bacteria 4687
265 Ga0105248_11046538 3300009177 Bacteria 922
266 Ga0105248_11239952 3300009177 Bacteria 843
267 Ga0105238_10849849 3300009551 Bacteria 930
268 Ga0105249_10159286 3300009553 Bacteria 2180
269 Ga0105249_10720544 3300009553 Bacteria 1058
270 Ga0105249_10872284 3300009553 Bacteria 966
271 Ga0105249_12246246 3300009553 Bacteria 618
272 Ga0105239_10745446 3300010375 Bacteria 1121
273 Ga0105246_11615608 3300011119 Bacteria 613
274 Ga0105246_11965356 3300011119 Bacteria 563
275 Ga0157373_10271315 3300013100 Bacteria 1201
276 Ga0157373_10274538 3300013100 Bacteria 1194
277 Ga0157370_11876273 3300013104 Bacteria 538
278 Ga0157369_10254394 3300013105 Bacteria 1833
279 Ga0157369_11631262 3300013105 Bacteria 656
280 Ga0157378_10154275 3300013297 Bacteria 2142
281 Ga0157378_10185814 3300013297 Bacteria 1957
282 Ga0157378_10403895 3300013297 Bacteria 1347
283 Ga0163162_10174171 3300013306 Bacteria 2276
284 Ga0163162_10276875 3300013306 Bacteria 1810
285 Ga0163162_10498904 3300013306 Bacteria 1348
286 Ga0163162_10731301 3300013306 Bacteria 1110
287 Ga0163162_12157351 3300013306 Bacteria 639
288 Ga0157372_11311620 3300013307 Bacteria 835
289 Ga0157375_11712207 3300013308 Bacteria 744
290 Ga0163163_12364864 3300014325 Bacteria 590
291 Ga0157380_10281802 3300014326 Bacteria 1521
292 Ga0157380_10415902 3300014326 Bacteria 1281
293 Ga0157380_11268875 3300014326 Bacteria 783
294 Ga0157380_11451023 3300014326 Bacteria 738
295 Ga0182008_10000154 3300014497 Bacteria 54086
296 Ga0157379_11579587 3300014968 Bacteria 640
297 Ga0182006_1000010 3300015261 Bacteria 413414
298 Ga0182007_10000030 3300015262 Bacteria 156866
299 Ga0182007_10306555 3300015262 Bacteria 584
300 Ga0182005_1000009 3300015265 Bacteria 455334
301 Ga0163161_10097797 3300017792 Unclassified 2180
302 Ga0163161_10277679 3300017792 Bacteria 1313
303 Ga0163161_10641556 3300017792 Bacteria 879
304 Ga0197907_10518326 3300020069 Bacteria 1019
305 Ga0197907_11509585 3300020069 Bacteria 1361
306 Ga0206356_11505530 3300020070 Bacteria 560
307 Ga0206356_11723322 3300020070 Bacteria 1362
308 Ga0206355_1045112 3300020076 Bacteria 1732
309 Ga0206355_1660841 3300020076 Bacteria 1362
310 Ga0206351_10349927 3300020077 Bacteria 532
311 Ga0206351_10717643 3300020077 Bacteria 1691
312 Ga0206350_10668403 3300020080 Bacteria 851
313 Ga0206350_10675512 3300020080 Bacteria 580
314 Ga0206354_10238434 3300020081 Bacteria 910
315 Ga0206353_11625478 3300020082 Bacteria 996
316 Ga0206353_11636605 3300020082 Bacteria 1857
317 Ga0154015_1649135 3300020610 Bacteria 621
318 Ga0213872_10045108 3300021361 Bacteria 2005
319 Ga0224712_10325278 3300022467 Bacteria 723
320 Ga0207653_10229060 3300025885 Bacteria 707
321 Ga0207653_10416094 3300025885 Bacteria 527
322 Ga0207642_10066530 3300025899 Bacteria 1697
323 Ga0207710_10009004 3300025900 Bacteria 4201
324 Ga0207710_10481757 3300025900 Bacteria 643
325 Ga0207647_10030040 3300025904 Bacteria 3510
326 Ga0207645_10584017 3300025907 Bacteria 758
327 Ga0207705_10829031 3300025909 Bacteria 717
328 Ga0207684_10000456 3300025910 Bacteria 53373
329 Ga0207684_10012314 3300025910 Bacteria 7444
330 Ga0207684_10100931 3300025910 Bacteria 2466
331 Ga0207684_10245616 3300025910 Bacteria 1544
332 Ga0207684_10377903 3300025910 Unclassified 1218
333 Ga0207684_10755786 3300025910 Bacteria 824
334 Ga0207654_10474226 3300025911 Bacteria 881
335 Ga0207654_11050256 3300025911 Bacteria 593
336 Ga0207707_10022676 3300025912 Bacteria 5491
337 Ga0207695_10018581 3300025913 Bacteria 8032
338 Ga0207660_10004184 3300025917 Bacteria 9390
339 Ga0207660_10163738 3300025917 Bacteria 1718
340 Ga0207662_10296709 3300025918 Bacteria 1073
341 Ga0207662_10422183 3300025918 Bacteria 908
342 Ga0207662_10478153 3300025918 Bacteria 855
343 Ga0207646_10000483 3300025922 Bacteria 53346
344 Ga0207646_10025881 3300025922 Bacteria 5365
345 Ga0207646_10691579 3300025922 Bacteria 912
346 Ga0207646_11083479 3300025922 Bacteria 706
347 Ga0207681_10027358 3300025923 Bacteria 3686
348 Ga0207681_10123915 3300025923 Bacteria 1900
349 Ga0207681_10727092 3300025923 Bacteria 826
350 Ga0207681_11425898 3300025923 Bacteria 581
351 Ga0207659_10348611 3300025926 Bacteria 1228
352 Ga0207659_10440834 3300025926 Bacteria 1095
353 Ga0207690_10400913 3300025932 Bacteria 1094
354 Ga0207690_10660973 3300025932 Bacteria 857
355 Ga0207706_10025259 3300025933 Bacteria 5325
356 Ga0207706_10513723 3300025933 Bacteria 1033
357 Ga0207706_10686269 3300025933 Bacteria 875
358 Ga0207686_10298763 3300025934 Bacteria 1195
359 Ga0207709_10048104 3300025935 Bacteria 2597
360 Ga0207709_11060097 3300025935 Bacteria 664
361 Ga0207709_11197348 3300025935 Bacteria 626
362 Ga0207670_10125627 3300025936 Bacteria 1871
363 Ga0207670_10167964 3300025936 Bacteria 1643
364 Ga0207670_10638097 3300025936 Bacteria 877
365 Ga0207670_11549867 3300025936 Bacteria 563
366 Ga0207704_10332817 3300025938 Bacteria 1176
367 Ga0207704_10625395 3300025938 Bacteria 884
368 Ga0207691_10506303 3300025940 Bacteria 1025
369 Ga0207711_10034666 3300025941 Bacteria 4275
370 Ga0207689_10193380 3300025942 Unclassified 1679
371 Ga0207712_10197938 3300025961 Bacteria 1591
372 Ga0207712_10346561 3300025961 Bacteria 1233
373 Ga0207668_10315614 3300025972 Bacteria 1295
374 Ga0207668_10398212 3300025972 Bacteria 1163
375 Ga0207658_11527172 3300025986 Bacteria 611
376 Ga0207639_11061188 3300026041 Bacteria 759
377 Ga0207708_11235640 3300026075 Bacteria 654
378 Ga0207648_10113523 3300026089 Bacteria 2379
379 Ga0207648_10194930 3300026089 Bacteria 1796
380 Ga0207648_10467731 3300026089 Bacteria 1150
381 Ga0207648_10770747 3300026089 Bacteria 894
382 Ga0207676_11254722 3300026095 Bacteria 735
383 Ga0207676_11310529 3300026095 Bacteria 719
384 Ga0207674_10259842 3300026116 Bacteria 1684
385 Ga0207675_100313294 3300026118 Bacteria 1531
386 Ga0207675_100525775 3300026118 Bacteria 1180
387 Ga0207675_101002170 3300026118 Bacteria 854
388 Ga0207675_101875580 3300026118 Bacteria 618
389 Ga0209968_1019566 3300027526 Bacteria 1090
390 Ga0210002_1009917 3300027617 Bacteria 1457
391 Ga0209588_1015659 3300027671 Bacteria 2333
392 Ga0207428_10000095 3300027907 Bacteria 123199
393 Ga0207428_10034391 3300027907 Bacteria 4153
394 Ga0207428_10119790 3300027907 Bacteria 2019
395 Ga0207428_10410040 3300027907 Bacteria 991
396 Ga0207428_10632903 3300027907 Bacteria 769
397 Ga0207428_10692369 3300027907 Bacteria 729
398 Ga0268266_10932088 3300028379 Bacteria 840
399 Ga0268265_10014082 3300028380 Bacteria 5450
400 Ga0268265_10193837 3300028380 Bacteria 1757
401 Ga0268265_10411269 3300028380 Bacteria 1253
402 Ga0268264_10433688 3300028381 Bacteria 1269
403 Ga0268264_10633397 3300028381 Bacteria 1057
404 Ga0268264_11742507 3300028381 Bacteria 633
405 Ga0265336_10068429 3300028666 Bacteria 1062
406 Ga0265324_10064446 3300029957 Bacteria 1250
407 Ga0307513_10515257 3300031456 Bacteria 912
408 Ga0307513_10913006 3300031456 Bacteria 586
409 Ga0307408_100000180 3300031548 Bacteria 70740
410 Ga0307408_100640253 3300031548 Bacteria 949
411 Ga0307405_11473073 3300031731 Bacteria 597
412 Ga0307413_10462485 3300031824 Bacteria 1010
413 Ga0307410_10436390 3300031852 Bacteria 1065
414 Ga0307406_10754048 3300031901 Bacteria 817
415 Ga0307406_12127202 3300031901 Bacteria 503
416 Ga0307407_10367490 3300031903 Bacteria 1023
417 Ga0307416_100158133 3300032002 Bacteria 2090
418 Ga0307416_101062386 3300032002 Bacteria 914
419 Ga0373958_0121516 3300034819 Bacteria 631
420 Ga0373928_0118662 3300035084 Bacteria 707
421 Ga0373940_0103220 3300035088 Bacteria 868
422 Ga0373940_0335680 3300035088 Bacteria 527
423 Ga0373949_0220662 3300035090 Bacteria 576
424 Ga0373951_0260370 3300035091 Bacteria 524
425 Ga0373952_0034016 3300035092 Bacteria 1147
426 Ga0373952_0117988 3300035092 Bacteria 717
427 Ga0373932_0095443 3300035112 Bacteria 960
428 Ga0373939_0109957 3300035114 Bacteria 958
429 Ga0373941_0148440 3300035115 Bacteria 858
430 Ga0373960_0106195 3300035121 Bacteria 916
431 Ga0373961_0102627 3300035241 Bacteria 928
432 Ga0373961_0274793 3300035241 Unclassified 616
433 Ga0373962_0175012 3300035242 Bacteria 715
434 Ga0373931_0000964 3300035691 Bacteria 12154
435 Ga0373931_0007284 3300035691 Bacteria 5206
436 Ga0373931_0693325 3300035691 Bacteria 672
437 Ga0395900_0001056 3300037418 Bacteria 35315
438 Ga0395898_0204071 3300037466 Bacteria 1886
439 Ga0395905_1484260 3300037471 Bacteria 582
440 Ga0395901_0792448 3300038443 Bacteria 937
441 Ga0436361_0216395 3300039447 Bacteria 3423
442 Ga0451793_0052380 3300041452 Bacteria 1169
443 Ga0451837_1531230 3300041494 Bacteria 589
444 Ga0439456_023753 3300042013 Bacteria 1300
445 Ga0439446_0109943 3300042156 Bacteria 878
446 Ga0439435_0023476 3300042436 Bacteria 1620
447 Ga0439435_0068112 3300042436 Bacteria 1049
448 Ga0439460_0057644 3300042461 Bacteria 1179
449 Ga0451577_0078197 3300042876 Bacteria 2950
450 Ga0453683_1069691 3300044673 Bacteria 537
451 Ga0466957_0096241 3300044842 Bacteria 1860
452 Ga0451576_0052534 3300045051 Bacteria 4270
453 Ga0451576_0434765 3300045051 Bacteria 1377
454 Ga0451576_0440113 3300045051 Bacteria 1368
455 Ga0451576_0641850 3300045051 Bacteria 1115
456 Ga0451576_1172289 3300045051 Bacteria 803
457 Ga0451576_1784002 3300045051 Bacteria 636
458 Ga0466958_0703481 3300045836 Bacteria 658
459 Ga0495638_0269228 3300046460 Bacteria 930
460 Ga0495580_0000020 3300046472 Bacteria 91314
461 Ga0495584_0097944 3300046491 Bacteria 1482
462 Ga0495610_0001145 3300046512 Bacteria 24124
463 Ga0495643_0000225 3300046522 Bacteria 86508
464 Ga0495648_0222952 3300046524 Bacteria 928
465 Ga0495648_0249888 3300046524 Bacteria 856
466 Ga0495663_0014636 3300046525 Bacteria 2200
467 Ga0495663_0184589 3300046525 Bacteria 724
468 Ga0495642_0070793 3300046528 Bacteria 1458
469 Ga0495642_0123422 3300046528 Bacteria 1112
470 Ga0495656_0117906 3300046615 Bacteria 1249
471 Ga0495656_0334379 3300046615 Bacteria 782
472 Ga0495668_0004430 3300046616 Bacteria 9974
473 Ga0495611_0130569 3300046648 Bacteria 1172
474 Ga0495625_0343933 3300046660 Bacteria 944
475 Ga0495669_0020303 3300046684 Bacteria 2874
476 Ga0495669_0068615 3300046684 Bacteria 1613
477 Ga0495669_0350258 3300046684 Bacteria 714
478 Ga0495670_0376326 3300046691 Bacteria 766
479 Ga0495670_0506212 3300046691 Bacteria 656
480 Ga0495649_0066771 3300046694 Bacteria 1930
481 Ga0495636_0408408 3300047318 Bacteria 648
482 Ga0495672_0000385 3300047320 Bacteria 54448
483 Ga0495677_0010939 3300047445 Bacteria 3324
484 Ga0495677_0430370 3300047445 Bacteria 523
485 Ga0495685_052074 3300047447 Bacteria 1387
486 Ga0496101_0613329 3300048904 Bacteria 860
487 Ga0496102_0000013 3300048905 Bacteria 311668
488 Ga0496102_0000107 3300048905 Bacteria 118250
489 Ga0496102_0076749 3300048905 Bacteria 3074
490 Ga0496102_0215505 3300048905 Bacteria 1810
491 Ga0496103_0000105 3300048906 Bacteria 92467
492 Ga0496103_0046899 3300048906 Bacteria 2668
493 Ga0496103_0251136 3300048906 Bacteria 1138
494 Ga0496106_0099984 3300048909 Bacteria 2249
495 Ga0496106_0671889 3300048909 Bacteria 827
496 Ga0496108_0079443 3300048911 Bacteria 2778
497 Ga0496109_0491050 3300048912 Bacteria 1159
498 Ga0496111_0088145 3300048914 Bacteria 2272
499 Ga0496111_0706247 3300048914 Bacteria 733
500 Ga0496116_0091628 3300048919 Bacteria 1846
501 Ga0496117_0000010 3300048920 Bacteria 611954
502 Ga0496117_0093728 3300048920 Bacteria 1925
503 Ga0496118_0000009 3300048921 Bacteria 611954
504 Ga0496118_0018871 3300048921 Bacteria 6189
505 Ga0496119_0051039 3300048922 Bacteria 2545
506 Ga0496121_0005651 3300048924 Bacteria 15909
507 Ga0496121_0053352 3300048924 Bacteria 3388
508 Ga0496122_0007348 3300048925 Bacteria 12286
509 Ga0496122_0015575 3300048925 Bacteria 7257
510 Ga0496123_0002281 3300048926 Bacteria 24132
511 Ga0496123_0007323 3300048926 Bacteria 10460
512 Ga0496124_0138974 3300048927 Bacteria 1919
513 Ga0496125_0018476 3300048928 Bacteria 6621
514 Ga0501307_009855 3300049162 Bacteria 1098
515 Ga0501307_048570 3300049162 Bacteria 633
516 Ga0495678_001252 3300049459 Bacteria 20667
517 Ga0501313_000344 3300049529 Bacteria 3016
518 Ga0501315_007556 3300049531 Bacteria 1241
519 Ga0501315_051933 3300049531 Bacteria 646
520 Ga0501316_003385 3300049532 Bacteria 1544
521 Ga0501317_030292 3300049533 Bacteria 782
522 Ga0501320_058998 3300049536 Bacteria 536
523 Ga0501031_0008878 3300049568 Bacteria 6535
524 Ga0501031_0924314 3300049568 Bacteria 558
525 Ga0501032_0022737 3300049569 Bacteria 4344
526 Ga0501032_0249933 3300049569 Bacteria 1151
527 Ga0501033_0006614 3300049570 Bacteria 9063
528 Ga0501033_0006638 3300049570 Bacteria 9048
529 Ga0501033_0015044 3300049570 Bacteria 5872
530 Ga0501033_0135413 3300049570 Bacteria 1782
531 Ga0501033_0247938 3300049570 Bacteria 1263
532 Ga0501033_1033618 3300049570 Bacteria 548
533 Ga0501034_0512181 3300049571 Bacteria 1112
534 Ga0501034_1020043 3300049571 Bacteria 711
535 Ga0501036_0000860 3300049572 Bacteria 22572
536 Ga0501036_0038196 3300049572 Bacteria 4063
537 Ga0501036_0061288 3300049572 Bacteria 3187
538 Ga0501037_0120915 3300049573 Bacteria 1883
539 Ga0501037_0133937 3300049573 Bacteria 1775
540 Ga0501038_0001811 3300049574 Bacteria 19789
541 Ga0501038_0007523 3300049574 Bacteria 10041
542 Ga0501038_0123383 3300049574 Bacteria 2134
543 Ga0501038_0863433 3300049574 Bacteria 670
544 Ga0501039_0003590 3300049575 Bacteria 11632
545 Ga0501039_0033847 3300049575 Bacteria 3942
546 Ga0501039_0084380 3300049575 Bacteria 2474
547 Ga0501039_0123796 3300049575 Bacteria 2027
548 Ga0501039_0496823 3300049575 Bacteria 958
549 Ga0501039_0800020 3300049575 Bacteria 735
550 Ga0501040_0006253 3300049576 Bacteria 7728
551 Ga0501040_0218857 3300049576 Bacteria 1355
552 Ga0501041_0002688 3300049577 Bacteria 10140
553 Ga0501041_0050199 3300049577 Bacteria 2542
554 Ga0501041_0148491 3300049577 Bacteria 1463
555 Ga0501041_0399930 3300049577 Bacteria 870
556 Ga0501041_0707705 3300049577 Bacteria 645
557 Ga0501042_0002889 3300049578 Bacteria 10663
558 Ga0501042_0002934 3300049578 Bacteria 10590
559 Ga0501042_0078030 3300049578 Bacteria 2372
560 Ga0501042_0089306 3300049578 Bacteria 2211
561 Ga0501042_0112374 3300049578 Bacteria 1961
562 Ga0501042_0162058 3300049578 Bacteria 1614
563 Ga0501043_0039590 3300049579 Bacteria 3704
564 Ga0501043_0105147 3300049579 Bacteria 2218
565 Ga0501046_0002460 3300049580 Bacteria 17375
566 Ga0501046_0110602 3300049580 Bacteria 2099
567 Ga0501046_0254075 3300049580 Bacteria 1293
568 Ga0501046_0260783 3300049580 Bacteria 1273
569 Ga0501047_0095003 3300049581 Bacteria 2860
570 Ga0501047_0384053 3300049581 Bacteria 1239
571 Ga0501048_0005635 3300049582 Bacteria 9524
572 Ga0501048_0023088 3300049582 Bacteria 4547
573 Ga0501048_0334812 3300049582 Bacteria 1079
574 Ga0501048_0597310 3300049582 Bacteria 792
575 Ga0501048_1354751 3300049582 Bacteria 511
576 Ga0501068_0038347 3300049584 Bacteria 2871
577 Ga0501068_0121565 3300049584 Bacteria 1628
578 Ga0501069_0082331 3300049585 Bacteria 1814
579 Ga0501069_0167170 3300049585 Bacteria 1268
580 Ga0501069_0332763 3300049585 Bacteria 893
581 Ga0501070_0018631 3300049586 Bacteria 5824
582 Ga0501071_0017331 3300049587 Bacteria 4964
583 Ga0501071_0033941 3300049587 Bacteria 3628
584 Ga0501071_0170689 3300049587 Bacteria 1628
585 Ga0501071_0222001 3300049587 Bacteria 1422
586 Ga0501072_0000876 3300049588 Bacteria 22065
587 Ga0501072_0004398 3300049588 Bacteria 10699
588 Ga0501072_0005377 3300049588 Bacteria 9749
589 Ga0501072_0086225 3300049588 Bacteria 2492
590 Ga0501072_0349008 3300049588 Bacteria 1175
591 Ga0501072_0861288 3300049588 Bacteria 708
592 Ga0501073_0252972 3300049589 Bacteria 1216
593 Ga0501074_0039136 3300049590 Bacteria 3434
594 Ga0501074_0116871 3300049590 Bacteria 1908
595 Ga0501074_0644176 3300049590 Bacteria 749
596 Ga0501075_0001775 3300049591 Bacteria 14190
597 Ga0501075_0005327 3300049591 Bacteria 8797
598 Ga0501075_0023711 3300049591 Bacteria 4494
599 Ga0501075_0039240 3300049591 Bacteria 3544
600 Ga0501075_0067030 3300049591 Bacteria 2710
601 Ga0501075_0204004 3300049591 Bacteria 1508
602 Ga0501076_0001726 3300049592 Bacteria 14781
603 Ga0501076_0019989 3300049592 Bacteria 5123
604 Ga0501076_0035681 3300049592 Bacteria 3891
605 Ga0501076_0041142 3300049592 Bacteria 3634
606 Ga0501076_0107003 3300049592 Bacteria 2258
607 Ga0501076_0236098 3300049592 Bacteria 1495
608 Ga0501077_0007786 3300049593 Bacteria 6612
609 Ga0501077_0082710 3300049593 Bacteria 2034
610 Ga0501234_016510 3300049707 Bacteria 1165
611 Ga0501079_0010767 3300049741 Bacteria 6964
612 Ga0501079_0024793 3300049741 Bacteria 4601
613 Ga0501079_0056411 3300049741 Bacteria 3031
614 Ga0501079_0166400 3300049741 Bacteria 1720
615 Ga0501079_0272792 3300049741 Bacteria 1322
616 Ga0501079_0748301 3300049741 Bacteria 769
617 Ga0501080_0001334 3300049742 Bacteria 20578
618 Ga0501080_0028797 3300049742 Bacteria 5171
619 Ga0501080_0384496 3300049742 Bacteria 1264
620 Ga0501080_0506151 3300049742 Bacteria 1079
621 Ga0501081_0001270 3300049743 Bacteria 15350
622 Ga0501081_0002641 3300049743 Bacteria 11330
623 Ga0501081_0267644 3300049743 Bacteria 1250
624 Ga0501081_0420267 3300049743 Bacteria 991
625 Ga0501081_0986286 3300049743 Bacteria 636
626 Ga0501081_1130775 3300049743 Bacteria 593
627 Ga0501083_0000990 3300049744 Bacteria 18870
628 Ga0501083_0008270 3300049744 Bacteria 7355
629 Ga0501083_0053510 3300049744 Bacteria 2710
630 Ga0501083_0548921 3300049744 Bacteria 752
631 Ga0501279_077216 3300049775 Bacteria 569
632 Ga0501035_0015293 3300049822 Bacteria 7081
633 Ga0501035_0044811 3300049822 Bacteria 3982
634 Ga0501035_0159266 3300049822 Bacteria 1955
635 Ga0501044_0444027 3300049823 Bacteria 1205
636 Ga0501044_0502036 3300049823 Bacteria 1114
637 Ga0501044_1106659 3300049823 Bacteria 661
638 Ga0501045_0000682 3300049824 Bacteria 21537
639 Ga0501045_0037058 3300049824 Bacteria 3544
640 Ga0501045_0190796 3300049824 Bacteria 1527
641 Ga0501045_0209394 3300049824 Bacteria 1452
642 Ga0501045_0282704 3300049824 Bacteria 1235
643 Ga0501045_0462802 3300049824 Bacteria 942
644 Ga0501045_0762528 3300049824 Bacteria 713
645 nmdc:mga0yw44_129854_c1 3300050492 Bacteria 1630
646 nmdc:mga06z11_119732_c1 3300050494 Bacteria 1467
647 nmdc:mga05p37_1143171_c1 3300050507 Bacteria 811
648 nmdc:mga05p37_1238102_c1 3300050507 Bacteria 767
649 nmdc:mga05p37_147312_c1 3300050507 Bacteria 2881
650 nmdc:mga05p37_149458_c1 3300050507 Bacteria 2858
651 nmdc:mga05p37_1616_c1 3300050507 Bacteria 26114
652 nmdc:mga05p37_340_c1 3300050507 Bacteria 50074
653 nmdc:mga05p37_352896_c1 3300050507 Bacteria 1731
654 nmdc:mga05p37_388885_c1 3300050507 Bacteria 1632
655 nmdc:mga05p37_481842_c1 3300050507 Bacteria 1429
656 nmdc:mga05p37_550978_c1 3300050507 Bacteria 1313
657 nmdc:mga05p37_56257_c1 3300050507 Bacteria 4843
658 nmdc:mga05p37_6620_c1 3300050507 Bacteria 13660
659 nmdc:mga05p37_75653_c1 3300050507 Bacteria 4145
660 nmdc:mga05p37_87904_c1 3300050507 Bacteria 3831
661 nmdc:mga09592_1107143_c1 3300050508 Bacteria 658
662 nmdc:mga09592_1439824_c1 3300050508 Bacteria 562
663 nmdc:mga09592_252445_c1 3300050508 Bacteria 1529
664 nmdc:mga09592_29671_c1 3300050508 Bacteria 4548
665 nmdc:mga09592_3243_c1 3300050508 Bacteria 13156
666 nmdc:mga09592_404324_c1 3300050508 Bacteria 1180
667 nmdc:mga09592_45640_c2 3300050508 Bacteria 2387
668 nmdc:mga09592_466896_c1 3300050508 Bacteria 1088
669 nmdc:mga09592_756837_c1 3300050508 Bacteria 824
670 nmdc:mga09592_810_c2 3300050508 Bacteria 15378
671 nmdc:mga09592_8581_c1 3300050508 Bacteria 8313
672 nmdc:mga0qj67_1003856_c1 3300050509 Bacteria 655
673 nmdc:mga0qj67_1133685_c1 3300050509 Bacteria 610
674 nmdc:mga0qj67_1552_c1 3300050509 Bacteria 16119
675 nmdc:mga0qj67_365_c1 3300050509 Bacteria 31254
676 nmdc:mga0qj67_466097_c1 3300050509 Bacteria 1017
677 nmdc:mga0qj67_652_c1 3300050509 Bacteria 23881
678 nmdc:mga0qj67_762495_c1 3300050509 Bacteria 767
679 nmdc:mga0qj67_78796_c1 3300050509 Bacteria 2637
680 nmdc:mga06r32_1869316_c1 3300050510 Bacteria 535
681 nmdc:mga06r32_219942_c1 3300050510 Bacteria 1887
682 nmdc:mga06r32_28487_c1 3300050510 Bacteria 5227
683 nmdc:mga06r32_321002_c1 3300050510 Bacteria 1534
684 nmdc:mga06r32_3383_c1 3300050510 Bacteria 14258
685 nmdc:mga06r32_345282_c1 3300050510 Bacteria 1473
686 nmdc:mga06r32_44913_c1 3300050510 Bacteria 4210
687 nmdc:mga06r32_45023_c1 3300050510 Bacteria 4204
688 nmdc:mga06r32_4899_c1 3300050510 Bacteria 12058
689 nmdc:mga06r32_7587_c1 3300050510 Bacteria 9750
690 nmdc:mga08y16_13153_c1 3300050511 Bacteria 8707
691 nmdc:mga08y16_52624_c1 3300050511 Bacteria 4259
692 nmdc:mga08y16_638229_c1 3300050511 Bacteria 1070
693 nmdc:mga08y16_670510_c1 3300050511 Bacteria 1039
694 nmdc:mga08y16_8137_c1 3300050511 Bacteria 10970
695 nmdc:mga0n895_131424_c1 3300050512 Bacteria 2528
696 nmdc:mga0n895_131480_c1 3300050512 Bacteria 2528
697 nmdc:mga0n895_215496_c1 3300050512 Bacteria 1950
698 nmdc:mga0n895_4841_c1 3300050512 Bacteria 11156
699 nmdc:mga0n895_58104_c1 3300050512 Bacteria 3814
700 nmdc:mga0n895_9114_c1 3300050512 Bacteria 8661
701 nmdc:mga0n895_98_c1 3300050512 Bacteria 51629
702 nmdc:mga0rr50_107578_c1 3300050513 Bacteria 2202
703 nmdc:mga0rr50_1348_c1 3300050513 Bacteria 13404
704 nmdc:mga0rr50_209820_c1 3300050513 Bacteria 1604
705 nmdc:mga0rr50_28036_c1 3300050513 Bacteria 3953
706 nmdc:mga0rr50_287865_c1 3300050513 Bacteria 1372
707 nmdc:mga0rr50_32889_c1 3300050513 Bacteria 3700
708 nmdc:mga0rr50_5113_c1 3300050513 Bacteria 7786
709 nmdc:mga0rr50_63038_c1 3300050513 Bacteria 2798
710 nmdc:mga08x19_16214_c1 3300050514 Bacteria 4541
711 nmdc:mga08x19_28871_c1 3300050514 Bacteria 3477
712 nmdc:mga08x19_560250_c1 3300050514 Bacteria 809
713 nmdc:mga08x19_77267_c1 3300050514 Bacteria 2180
714 nmdc:mga08x19_991_c1 3300050514 Bacteria 17725
715 nmdc:mga0a205_107177_c1 3300050515 Bacteria 2692
716 nmdc:mga0a205_107185_c1 3300050515 Bacteria 2692
717 nmdc:mga0a205_1206_c1 3300050515 Bacteria 21636
718 nmdc:mga0a205_15571_c1 3300050515 Bacteria 7107
719 nmdc:mga0a205_156652_c1 3300050515 Bacteria 2176
720 nmdc:mga0a205_285697_c1 3300050515 Bacteria 1525
721 nmdc:mga0a205_32330_c1 3300050515 Bacteria 5017
722 nmdc:mga0a205_342909_c1 3300050515 Bacteria 995
723 nmdc:mga0a205_55271_c1 3300050515 Bacteria 3835
724 nmdc:mga0a205_56850_c1 3300050515 Bacteria 3777
725 nmdc:mga0a205_650248_c1 3300050515 Bacteria 906
726 Ga0500643_000124 3300053087 Bacteria 79663
727 Ga0500646_0377385 3300053090 Bacteria 521
728 Ga0500559_0059398 3300053136 Bacteria 1702
729 Ga0500588_0041096 3300053146 Bacteria 1393
730 Ga0501084_0000677 3300054114 Bacteria 25964
731 Ga0501084_0002581 3300054114 Bacteria 14596
732 Ga0501084_0336243 3300054114 Bacteria 1276
733 Ga0501084_0352867 3300054114 Bacteria 1242
734 Ga0501084_1258735 3300054114 Bacteria 620
735 Ga0590077_069239 3300059426 Bacteria 805
736 Ga0587077_029740 3300059493 Bacteria 1032
737 Ga0587080_056077 3300059503 Bacteria 756
738 Ga0587083_0085422 3300059505 Bacteria 760
739 Ga0587086_113744 3300059507 Bacteria 511
740 Ga0587090_118483 3300059510 Bacteria 572
741 Ga0587068_029919 3300059641 Bacteria 939
742 Ga0587072_074696 3300059643 Bacteria 722
743 Ga0501082_0002693 3300060353 Bacteria 15524
744 Ga0501082_0005933 3300060353 Bacteria 10594
745 Ga0501082_0045078 3300060353 Bacteria 3803
746 Ga0501082_0683433 3300060353 Bacteria 898
747 Ga0501082_0799333 3300060353 Bacteria 825
748 Ga0501082_0909841 3300060353 Bacteria 769
749 Ga0530510_0001493 3300061734 Bacteria 15698
750 Ga0530510_0003925 3300061734 Bacteria 10260
751 Ga0530510_0037620 3300061734 Bacteria 3492
752 Ga0530510_0053697 3300061734 Bacteria 2911
753 Ga0530510_0056888 3300061734 Bacteria 2826
754 Ga0530510_0100486 3300061734 Bacteria 2115
755 Ga0530510_0316419 3300061734 Bacteria 1169

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_1033618 Ga0501033_1033618_25_342 103
2 3300049590 Ga0501074_0644176 Ga0501074_0644176_361_678 104
3 iso_pu_bacteria 2521172590 2521556782 104
4 iso_pu_bacteria 2551306416 2553004548 104
5 iso_pu_bacteria 2738541297 2738825669 104
6 iso_pu_bacteria 2738541357 2739149466 104
7 iso_pu_bacteria 2738543003 2739191385 104
8 iso_pu_bacteria 2738543026 2739317862 104
9 iso_pu_bacteria 2738543029 2739336103 104
10 iso_pu_bacteria 2818991449 2819618633 104
11 iso_pu_bacteria 2821131069 2821134265 104
12 iso_pu_bacteria 2842711865 2842712100 104
13 iso_pu_bacteria 2852643534 2852644008 104
14 iso_pu_bacteria 2857564685 2857566070 104
15 iso_pu_bacteria 2904439833 2904440641 104
16 iso_pu_bacteria 2904530477 2904535767 104
17 iso_pu_bacteria 2904584206 2904586049 104
18 iso_pu_bacteria 2904589729 2904592138 104
19 iso_pu_bacteria 2904601388 2904601705 104
20 iso_pu_bacteria 2919046199 2919049586 104
21 iso_pu_bacteria 2919079590 2919082574 104
22 iso_pu_bacteria 2923510766 2923515375 104
23 3300003203 JGI25406J46586_10013729 JGI25406J46586_100137292 105
24 3300005340 Ga0070689_101185010 Ga0070689_1011850101 105
25 3300005445 Ga0070708_100000456 Ga0070708_10000045618 105
26 3300005467 Ga0070706_100027842 Ga0070706_1000278421 105
27 3300005468 Ga0070707_100000758 Ga0070707_10000075818 105
28 3300005471 Ga0070698_100002218 Ga0070698_10000221818 105
29 3300005518 Ga0070699_100000498 Ga0070699_10000049811 105
30 3300005536 Ga0070697_100001129 Ga0070697_10000112911 105
31 3300005549 Ga0070704_100078316 Ga0070704_1000783162 105
32 3300005985 Ga0081539_10001809 Ga0081539_1000180943 105
33 3300006844 Ga0075428_100005773 Ga0075428_1000057735 105
34 3300006847 Ga0075431_100000280 Ga0075431_10000028010 105
35 3300006847 Ga0075431_100266142 Ga0075431_1002661422 105
36 3300006852 Ga0075433_10000147 Ga0075433_1000014720 105
37 3300006852 Ga0075433_10019113 Ga0075433_100191137 105
38 3300006871 Ga0075434_100114034 Ga0075434_1001140341 105
39 3300006880 Ga0075429_100334855 Ga0075429_1003348552 105
40 3300006914 Ga0075436_100000316 Ga0075436_1000003165 105
41 3300009094 Ga0111539_11492152 Ga0111539_114921521 105
42 3300009147 Ga0114129_10000331 Ga0114129_1000033140 105
43 3300009147 Ga0114129_10001127 Ga0114129_100011278 105
44 3300009147 Ga0114129_10001268 Ga0114129_1000126829 105
45 3300009147 Ga0114129_10380485 Ga0114129_103804851 105
46 3300025910 Ga0207684_10000456 Ga0207684_1000045643 105
47 3300025922 Ga0207646_10000483 Ga0207646_100004832 105
48 3300027907 Ga0207428_10632903 Ga0207428_106329031 105
49 3300028666 Ga0265336_10068429 Ga0265336_100684292 105
50 3300029957 Ga0265324_10064446 Ga0265324_100644463 105
51 3300031456 Ga0307513_10515257 Ga0307513_105152572 105
52 3300038443 Ga0395901_0792448 Ga0395901_0792448_516_839 105
53 3300046616 Ga0495668_0004430 Ga0495668_0004430_256_573 105
54 3300049577 Ga0501041_0707705 Ga0501041_0707705_185_502 105
55 3300049744 Ga0501083_0548921 Ga0501083_0548921_99_422 105
56 3300050507 nmdc:mga05p37_1616_c1 nmdc:mga05p37_1616_c1_4848_5171 105
57 3300050507 nmdc:mga05p37_340_c1 nmdc:mga05p37_340_c1_36846_37169 105
58 3300050508 nmdc:mga09592_810_c2 nmdc:mga09592_810_c2_478_801 105
59 3300050510 nmdc:mga06r32_28487_c1 nmdc:mga06r32_28487_c1_1050_1373 105
60 3300050510 nmdc:mga06r32_4899_c1 nmdc:mga06r32_4899_c1_8200_8523 105
61 3300050512 nmdc:mga0n895_98_c1 nmdc:mga0n895_98_c1_24204_24527 105
62 3300050513 nmdc:mga0rr50_1348_c1 nmdc:mga0rr50_1348_c1_8153_8476 105
63 3300050514 nmdc:mga08x19_991_c1 nmdc:mga08x19_991_c1_4659_4982 105
64 3300050515 nmdc:mga0a205_107177_c1 nmdc:mga0a205_107177_c1_493_816 105
65 3300050515 nmdc:mga0a205_1206_c1 nmdc:mga0a205_1206_c1_5290_5613 105
66 3300053090 Ga0500646_0377385 Ga0500646_0377385_149_466 105
67 3300053136 Ga0500559_0059398 Ga0500559_0059398_1089_1406 105
68 3300053146 Ga0500588_0041096 Ga0500588_0041096_281_598 105
69 3300005295 Ga0065707_10132300 Ga0065707_101323002 106
70 3300005295 Ga0065707_10444041 Ga0065707_104440412 106
71 3300005330 Ga0070690_100202217 Ga0070690_1002022172 106
72 3300005334 Ga0068869_100637188 Ga0068869_1006371882 106
73 3300005336 Ga0070680_100260247 Ga0070680_1002602471 106
74 3300005340 Ga0070689_100895352 Ga0070689_1008953522 106
75 3300005343 Ga0070687_100331451 Ga0070687_1003314511 106
76 3300005345 Ga0070692_10036760 Ga0070692_100367602 106
77 3300005353 Ga0070669_100294457 Ga0070669_1002944571 106
78 3300005354 Ga0070675_100470062 Ga0070675_1004700622 106
79 3300005438 Ga0070701_10638138 Ga0070701_106381381 106
80 3300005441 Ga0070700_100600944 Ga0070700_1006009442 106
81 3300005444 Ga0070694_100154711 Ga0070694_1001547111 106
82 3300005445 Ga0070708_100004479 Ga0070708_1000044793 106
83 3300005445 Ga0070708_100504070 Ga0070708_1005040702 106
84 3300005471 Ga0070698_100718095 Ga0070698_1007180952 106
85 3300005471 Ga0070698_101141686 Ga0070698_1011416861 106
86 3300005518 Ga0070699_100033177 Ga0070699_1000331772 106
87 3300005518 Ga0070699_100556661 Ga0070699_1005566611 106
88 3300005536 Ga0070697_100074426 Ga0070697_1000744264 106
89 3300005536 Ga0070697_100221432 Ga0070697_1002214322 106
90 3300005544 Ga0070686_100418032 Ga0070686_1004180321 106
91 3300005545 Ga0070695_100797224 Ga0070695_1007972242 106
92 3300005549 Ga0070704_100555737 Ga0070704_1005557372 106
93 3300005549 Ga0070704_100588603 Ga0070704_1005886032 106
94 3300005577 Ga0068857_100096186 Ga0068857_1000961862 106
95 3300005615 Ga0070702_101202331 Ga0070702_1012023311 106
96 3300005617 Ga0068859_100063359 Ga0068859_1000633592 106
97 3300005618 Ga0068864_100195694 Ga0068864_1001956942 106
98 3300005719 Ga0068861_100354774 Ga0068861_1003547742 106
99 3300005840 Ga0068870_10685190 Ga0068870_106851902 106
100 3300005842 Ga0068858_100051407 Ga0068858_1000514072 106
101 3300005843 Ga0068860_100471376 Ga0068860_1004713762 106
102 3300005843 Ga0068860_100654788 Ga0068860_1006547882 106
103 3300005844 Ga0068862_100062629 Ga0068862_1000626292 106
104 3300006844 Ga0075428_100665376 Ga0075428_1006653762 106
105 3300006844 Ga0075428_100961041 Ga0075428_1009610412 106
106 3300006847 Ga0075431_100039734 Ga0075431_1000397344 106
107 3300006847 Ga0075431_101675951 Ga0075431_1016759511 106
108 3300006871 Ga0075434_100536474 Ga0075434_1005364742 106
109 3300006880 Ga0075429_100219412 Ga0075429_1002194122 106
110 3300006881 Ga0068865_100292113 Ga0068865_1002921131 106
111 3300006931 Ga0097620_100063359 Ga0097620_1000633592 106
112 3300007076 Ga0075435_101075912 Ga0075435_1010759122 106
113 3300007265 Ga0099794_10041868 Ga0099794_100418682 106
114 3300009092 Ga0105250_10208379 Ga0105250_102083792 106
115 3300009101 Ga0105247_10589909 Ga0105247_105899092 106
116 3300009147 Ga0114129_10949635 Ga0114129_109496351 106
117 3300009148 Ga0105243_10584384 Ga0105243_105843842 106
118 3300009177 Ga0105248_10050018 Ga0105248_100500184 106
119 3300009177 Ga0105248_11046538 Ga0105248_110465382 106
120 3300013306 Ga0163162_10174171 Ga0163162_101741712 106
121 3300014326 Ga0157380_11268875 Ga0157380_112688751 106
122 3300017792 Ga0163161_10097797 Ga0163161_100977972 106
123 3300025885 Ga0207653_10229060 Ga0207653_102290601 106
124 3300025900 Ga0207710_10481757 Ga0207710_104817572 106
125 3300025904 Ga0207647_10030040 Ga0207647_100300404 106
126 3300025910 Ga0207684_10377903 Ga0207684_103779032 106
127 3300025917 Ga0207660_10163738 Ga0207660_101637381 106
128 3300025918 Ga0207662_10422183 Ga0207662_104221831 106
129 3300025922 Ga0207646_11083479 Ga0207646_110834792 106
130 3300025923 Ga0207681_10727092 Ga0207681_107270921 106
131 3300025926 Ga0207659_10348611 Ga0207659_103486112 106
132 3300025935 Ga0207709_11197348 Ga0207709_111973481 106
133 3300025936 Ga0207670_10638097 Ga0207670_106380971 106
134 3300025938 Ga0207704_10625395 Ga0207704_106253952 106
135 3300025941 Ga0207711_10034666 Ga0207711_100346662 106
136 3300025942 Ga0207689_10193380 Ga0207689_101933803 106
137 3300025961 Ga0207712_10197938 Ga0207712_101979382 106
138 3300026089 Ga0207648_10770747 Ga0207648_107707471 106
139 3300026095 Ga0207676_11310529 Ga0207676_113105291 106
140 3300026116 Ga0207674_10259842 Ga0207674_102598422 106
141 3300026118 Ga0207675_100313294 Ga0207675_1003132942 106
142 3300027671 Ga0209588_1015659 Ga0209588_10156592 106
143 3300028379 Ga0268266_10932088 Ga0268266_109320882 106
144 3300028380 Ga0268265_10014082 Ga0268265_100140822 106
145 3300028381 Ga0268264_10433688 Ga0268264_104336882 106
146 3300031731 Ga0307405_11473073 Ga0307405_114730731 106
147 3300031901 Ga0307406_10754048 Ga0307406_107540482 106
148 3300031903 Ga0307407_10367490 Ga0307407_103674902 106
149 3300032002 Ga0307416_100158133 Ga0307416_1001581332 106
150 3300035092 Ga0373952_0034016 Ga0373952_0034016_234_560 106
151 3300035115 Ga0373941_0148440 Ga0373941_0148440_413_739 106
152 3300045051 Ga0451576_1172289 Ga0451576_1172289_371_697 106
153 3300046691 Ga0495670_0376326 Ga0495670_0376326_102_428 106
154 3300049588 Ga0501072_0086225 Ga0501072_0086225_1630_1956 106
155 3300049741 Ga0501079_0166400 Ga0501079_0166400_1030_1356 106
156 3300050507 nmdc:mga05p37_147312_c1 nmdc:mga05p37_147312_c1_595_921 106
157 3300050507 nmdc:mga05p37_352896_c1 nmdc:mga05p37_352896_c1_764_1090 106
158 3300050508 nmdc:mga09592_756837_c1 nmdc:mga09592_756837_c1_16_342 106
159 3300050509 nmdc:mga0qj67_762495_c1 nmdc:mga0qj67_762495_c1_131_457 106
160 3300050510 nmdc:mga06r32_45023_c1 nmdc:mga06r32_45023_c1_1640_1966 106
161 3300050512 nmdc:mga0n895_131424_c1 nmdc:mga0n895_131424_c1_1582_1908 106
162 3300003163 Ga0006759J45824_1059206 Ga0006759J45824_10592062 107
163 3300003322 rootL2_10164021 rootL2_101640212 107
164 3300003544 Ga0007417J51691_1051599 Ga0007417J51691_10515992 107
165 3300003574 Ga0007410J51695_1035448 Ga0007410J51695_10354482 107
166 3300003577 Ga0007416J51690_1104318 Ga0007416J51690_11043181 107
167 3300004801 Ga0058860_11742682 Ga0058860_117426822 107
168 3300005288 Ga0065714_10026164 Ga0065714_100261642 107
169 3300005295 Ga0065707_10012883 Ga0065707_100128831 107
170 3300005295 Ga0065707_10153745 Ga0065707_101537452 107
171 3300005295 Ga0065707_10261562 Ga0065707_102615622 107
172 3300005328 Ga0070676_10452395 Ga0070676_104523952 107
173 3300005330 Ga0070690_100336971 Ga0070690_1003369711 107
174 3300005330 Ga0070690_100463167 Ga0070690_1004631672 107
175 3300005336 Ga0070680_100089298 Ga0070680_1000892983 107
176 3300005339 Ga0070660_101520589 Ga0070660_1015205891 107
177 3300005340 Ga0070689_100248841 Ga0070689_1002488412 107
178 3300005340 Ga0070689_100905476 Ga0070689_1009054762 107
179 3300005343 Ga0070687_100404560 Ga0070687_1004045602 107
180 3300005345 Ga0070692_11051185 Ga0070692_110511851 107
181 3300005347 Ga0070668_100126770 Ga0070668_1001267701 107
182 3300005353 Ga0070669_100032356 Ga0070669_1000323564 107
183 3300005353 Ga0070669_100119199 Ga0070669_1001191992 107
184 3300005356 Ga0070674_101179831 Ga0070674_1011798312 107
185 3300005364 Ga0070673_101285428 Ga0070673_1012854282 107
186 3300005366 Ga0070659_100437325 Ga0070659_1004373252 107
187 3300005406 Ga0070703_10173814 Ga0070703_101738141 107
188 3300005438 Ga0070701_11192322 Ga0070701_111923221 107
189 3300005440 Ga0070705_100010699 Ga0070705_1000106993 107
190 3300005440 Ga0070705_100029993 Ga0070705_1000299932 107
191 3300005440 Ga0070705_100908666 Ga0070705_1009086662 107
192 3300005441 Ga0070700_100360579 Ga0070700_1003605792 107
193 3300005441 Ga0070700_101923582 Ga0070700_1019235821 107
194 3300005444 Ga0070694_100076889 Ga0070694_1000768893 107
195 3300005444 Ga0070694_100189936 Ga0070694_1001899362 107
196 3300005444 Ga0070694_100398024 Ga0070694_1003980242 107
197 3300005444 Ga0070694_100474505 Ga0070694_1004745052 107
198 3300005445 Ga0070708_100034475 Ga0070708_1000344752 107
199 3300005445 Ga0070708_100206866 Ga0070708_1002068662 107
200 3300005445 Ga0070708_100251233 Ga0070708_1002512331 107
201 3300005445 Ga0070708_100839961 Ga0070708_1008399612 107
202 3300005457 Ga0070662_100014208 Ga0070662_1000142082 107
203 3300005457 Ga0070662_100898119 Ga0070662_1008981191 107
204 3300005458 Ga0070681_10161989 Ga0070681_101619892 107
205 3300005459 Ga0068867_100036249 Ga0068867_1000362493 107
206 3300005459 Ga0068867_100164969 Ga0068867_1001649692 107
207 3300005467 Ga0070706_100047435 Ga0070706_1000474355 107
208 3300005467 Ga0070706_100159454 Ga0070706_1001594542 107
209 3300005467 Ga0070706_100224521 Ga0070706_1002245211 107
210 3300005467 Ga0070706_101012264 Ga0070706_1010122641 107
211 3300005467 Ga0070706_102097885 Ga0070706_1020978851 107
212 3300005468 Ga0070707_100028839 Ga0070707_1000288395 107
213 3300005468 Ga0070707_100033492 Ga0070707_1000334924 107
214 3300005471 Ga0070698_100319863 Ga0070698_1003198632 107
215 3300005518 Ga0070699_100043461 Ga0070699_1000434613 107
216 3300005518 Ga0070699_100151355 Ga0070699_1001513552 107
217 3300005518 Ga0070699_100286899 Ga0070699_1002868992 107
218 3300005518 Ga0070699_100973751 Ga0070699_1009737511 107
219 3300005530 Ga0070679_100972905 Ga0070679_1009729051 107
220 3300005536 Ga0070697_100017366 Ga0070697_1000173665 107
221 3300005536 Ga0070697_100116744 Ga0070697_1001167442 107
222 3300005536 Ga0070697_100700559 Ga0070697_1007005592 107
223 3300005536 Ga0070697_101232400 Ga0070697_1012324001 107
224 3300005539 Ga0068853_100699015 Ga0068853_1006990152 107
225 3300005539 Ga0068853_102453598 Ga0068853_1024535981 107
226 3300005543 Ga0070672_100810116 Ga0070672_1008101162 107
227 3300005544 Ga0070686_101750835 Ga0070686_1017508351 107
228 3300005545 Ga0070695_100059011 Ga0070695_1000590111 107
229 3300005545 Ga0070695_100145506 Ga0070695_1001455062 107
230 3300005545 Ga0070695_100448793 Ga0070695_1004487932 107
231 3300005545 Ga0070695_100647699 Ga0070695_1006476992 107
232 3300005545 Ga0070695_101607339 Ga0070695_1016073391 107
233 3300005546 Ga0070696_100074115 Ga0070696_1000741152 107
234 3300005546 Ga0070696_100170592 Ga0070696_1001705922 107
235 3300005546 Ga0070696_101447942 Ga0070696_1014479422 107
236 3300005549 Ga0070704_101515582 Ga0070704_1015155822 107
237 3300005549 Ga0070704_101990577 Ga0070704_1019905771 107
238 3300005578 Ga0068854_100514622 Ga0068854_1005146222 107
239 3300005578 Ga0068854_100899105 Ga0068854_1008991052 107
240 3300005615 Ga0070702_100426204 Ga0070702_1004262042 107
241 3300005615 Ga0070702_100506494 Ga0070702_1005064942 107
242 3300005617 Ga0068859_100201133 Ga0068859_1002011332 107
243 3300005617 Ga0068859_101527906 Ga0068859_1015279062 107
244 3300005618 Ga0068864_101719118 Ga0068864_1017191181 107
245 3300005718 Ga0068866_10336332 Ga0068866_103363322 107
246 3300005718 Ga0068866_10541919 Ga0068866_105419192 107
247 3300005719 Ga0068861_100692281 Ga0068861_1006922812 107
248 3300005719 Ga0068861_100961276 Ga0068861_1009612761 107
249 3300005840 Ga0068870_10775180 Ga0068870_107751802 107
250 3300005841 Ga0068863_100156607 Ga0068863_1001566072 107
251 3300005841 Ga0068863_100422415 Ga0068863_1004224151 107
252 3300005842 Ga0068858_101559214 Ga0068858_1015592141 107
253 3300005843 Ga0068860_100558820 Ga0068860_1005588202 107
254 3300005843 Ga0068860_100680405 Ga0068860_1006804052 107
255 3300005843 Ga0068860_102310457 Ga0068860_1023104571 107
256 3300005844 Ga0068862_100072772 Ga0068862_1000727723 107
257 3300005844 Ga0068862_100909682 Ga0068862_1009096822 107
258 3300005937 Ga0081455_10109316 Ga0081455_101093161 107
259 3300005983 Ga0081540_1043478 Ga0081540_10434783 107
260 3300006194 Ga0075427_10000681 Ga0075427_100006814 107
261 3300006353 Ga0075370_10751422 Ga0075370_107514222 107
262 3300006844 Ga0075428_100001846 Ga0075428_1000018464 107
263 3300006844 Ga0075428_100003298 Ga0075428_1000032983 107
264 3300006844 Ga0075428_100071462 Ga0075428_1000714621 107
265 3300006844 Ga0075428_100210274 Ga0075428_1002102742 107
266 3300006844 Ga0075428_100420289 Ga0075428_1004202892 107
267 3300006844 Ga0075428_100464275 Ga0075428_1004642752 107
268 3300006846 Ga0075430_100000087 Ga0075430_10000008743 107
269 3300006846 Ga0075430_100000851 Ga0075430_1000008513 107
270 3300006846 Ga0075430_100034167 Ga0075430_1000341672 107
271 3300006846 Ga0075430_100509418 Ga0075430_1005094182 107
272 3300006846 Ga0075430_101085859 Ga0075430_1010858592 107
273 3300006846 Ga0075430_101594603 Ga0075430_1015946031 107
274 3300006846 Ga0075430_101658453 Ga0075430_1016584531 107
275 3300006847 Ga0075431_100000559 Ga0075431_1000005598 107
276 3300006847 Ga0075431_100007752 Ga0075431_1000077523 107
277 3300006847 Ga0075431_100051697 Ga0075431_1000516972 107
278 3300006847 Ga0075431_100068763 Ga0075431_1000687631 107
279 3300006847 Ga0075431_100120761 Ga0075431_1001207612 107
280 3300006847 Ga0075431_100126605 Ga0075431_1001266053 107
281 3300006847 Ga0075431_100551051 Ga0075431_1005510512 107
282 3300006852 Ga0075433_10000942 Ga0075433_100009422 107
283 3300006852 Ga0075433_10024441 Ga0075433_100244411 107
284 3300006852 Ga0075433_10060713 Ga0075433_100607132 107
285 3300006852 Ga0075433_10234916 Ga0075433_102349161 107
286 3300006852 Ga0075433_10259002 Ga0075433_102590022 107
287 3300006852 Ga0075433_10297718 Ga0075433_102977182 107
288 3300006852 Ga0075433_10315471 Ga0075433_103154712 107
289 3300006852 Ga0075433_10781418 Ga0075433_107814182 107
290 3300006871 Ga0075434_100000540 Ga0075434_10000054025 107
291 3300006871 Ga0075434_100017703 Ga0075434_1000177036 107
292 3300006871 Ga0075434_100133256 Ga0075434_1001332562 107
293 3300006871 Ga0075434_101025856 Ga0075434_1010258562 107
294 3300006880 Ga0075429_100000843 Ga0075429_10000084339 107
295 3300006880 Ga0075429_100000958 Ga0075429_1000009589 107
296 3300006880 Ga0075429_100023270 Ga0075429_1000232707 107
297 3300006880 Ga0075429_100053228 Ga0075429_1000532284 107
298 3300006880 Ga0075429_100104139 Ga0075429_1001041391 107
299 3300006880 Ga0075429_100295710 Ga0075429_1002957102 107
300 3300006880 Ga0075429_100356463 Ga0075429_1003564632 107
301 3300006880 Ga0075429_100722780 Ga0075429_1007227801 107
302 3300006881 Ga0068865_100070365 Ga0068865_1000703652 107
303 3300006914 Ga0075436_100011766 Ga0075436_1000117662 107
304 3300006914 Ga0075436_100051257 Ga0075436_1000512571 107
305 3300006914 Ga0075436_100067904 Ga0075436_1000679042 107
306 3300006914 Ga0075436_100746527 Ga0075436_1007465271 107
307 3300006931 Ga0097620_100201116 Ga0097620_1002011162 107
308 3300006931 Ga0097620_101528306 Ga0097620_1015283062 107
309 3300007076 Ga0075435_100003722 Ga0075435_1000037228 107
310 3300007076 Ga0075435_100015844 Ga0075435_1000158443 107
311 3300007076 Ga0075435_100022826 Ga0075435_1000228261 107
312 3300007076 Ga0075435_102021957 Ga0075435_1020219571 107
313 3300007076 Ga0075435_102063376 Ga0075435_1020633761 107
314 3300007265 Ga0099794_10493869 Ga0099794_104938691 107
315 3300009093 Ga0105240_12569481 Ga0105240_125694812 107
316 3300009094 Ga0111539_10000675 Ga0111539_1000067542 107
317 3300009094 Ga0111539_10001562 Ga0111539_1000156223 107
318 3300009094 Ga0111539_10594127 Ga0111539_105941272 107
319 3300009094 Ga0111539_10997441 Ga0111539_109974412 107
320 3300009094 Ga0111539_11067343 Ga0111539_110673432 107
321 3300009094 Ga0111539_11182412 Ga0111539_111824121 107
322 3300009094 Ga0111539_11215873 Ga0111539_112158732 107
323 3300009147 Ga0114129_10000487 Ga0114129_1000048731 107
324 3300009147 Ga0114129_10005736 Ga0114129_1000573623 107
325 3300009147 Ga0114129_10021639 Ga0114129_100216392 107
326 3300009147 Ga0114129_10056215 Ga0114129_100562156 107
327 3300009147 Ga0114129_10105186 Ga0114129_101051863 107
328 3300009147 Ga0114129_10184181 Ga0114129_101841812 107
329 3300009147 Ga0114129_10260766 Ga0114129_102607662 107
330 3300009147 Ga0114129_10338740 Ga0114129_103387402 107
331 3300009147 Ga0114129_10395081 Ga0114129_103950812 107
332 3300009147 Ga0114129_10615478 Ga0114129_106154782 107
333 3300009147 Ga0114129_11048358 Ga0114129_110483581 107
334 3300009147 Ga0114129_11371068 Ga0114129_113710682 107
335 3300009147 Ga0114129_11575551 Ga0114129_115755511 107
336 3300009148 Ga0105243_10159032 Ga0105243_101590322 107
337 3300009148 Ga0105243_10249501 Ga0105243_102495012 107
338 3300009174 Ga0105241_10063776 Ga0105241_100637762 107
339 3300009174 Ga0105241_10653564 Ga0105241_106535642 107
340 3300009176 Ga0105242_10360527 Ga0105242_103605272 107
341 3300009176 Ga0105242_10581274 Ga0105242_105812741 107
342 3300009176 Ga0105242_10666146 Ga0105242_106661461 107
343 3300009176 Ga0105242_11039901 Ga0105242_110399012 107
344 3300009177 Ga0105248_11239952 Ga0105248_112399522 107
345 3300009553 Ga0105249_10159286 Ga0105249_101592862 107
346 3300009553 Ga0105249_10720544 Ga0105249_107205442 107
347 3300009553 Ga0105249_10872284 Ga0105249_108722842 107
348 3300009553 Ga0105249_12246246 Ga0105249_122462461 107
349 3300010375 Ga0105239_10745446 Ga0105239_107454462 107
350 3300011119 Ga0105246_11615608 Ga0105246_116156082 107
351 3300011119 Ga0105246_11965356 Ga0105246_119653561 107
352 3300013100 Ga0157373_10271315 Ga0157373_102713152 107
353 3300013100 Ga0157373_10274538 Ga0157373_102745382 107
354 3300013297 Ga0157378_10154275 Ga0157378_101542752 107
355 3300013297 Ga0157378_10185814 Ga0157378_101858142 107
356 3300013297 Ga0157378_10403895 Ga0157378_104038952 107
357 3300013306 Ga0163162_10276875 Ga0163162_102768752 107
358 3300013306 Ga0163162_10498904 Ga0163162_104989042 107
359 3300013306 Ga0163162_10731301 Ga0163162_107313011 107
360 3300013306 Ga0163162_12157351 Ga0163162_121573512 107
361 3300013308 Ga0157375_11712207 Ga0157375_117122072 107
362 3300014325 Ga0163163_12364864 Ga0163163_123648641 107
363 3300014326 Ga0157380_10281802 Ga0157380_102818022 107
364 3300014326 Ga0157380_10415902 Ga0157380_104159022 107
365 3300014326 Ga0157380_11451023 Ga0157380_114510232 107
366 3300014497 Ga0182008_10000154 Ga0182008_1000015445 107
367 3300015261 Ga0182006_1000010 Ga0182006_100001085 107
368 3300015262 Ga0182007_10000030 Ga0182007_1000003089 107
369 3300015262 Ga0182007_10306555 Ga0182007_103065551 107
370 3300015265 Ga0182005_1000009 Ga0182005_1000009342 107
371 3300017792 Ga0163161_10277679 Ga0163161_102776792 107
372 3300017792 Ga0163161_10641556 Ga0163161_106415561 107
373 3300020070 Ga0206356_11505530 Ga0206356_115055302 107
374 3300021361 Ga0213872_10045108 Ga0213872_100451082 107
375 3300025885 Ga0207653_10416094 Ga0207653_104160941 107
376 3300025899 Ga0207642_10066530 Ga0207642_100665302 107
377 3300025907 Ga0207645_10584017 Ga0207645_105840172 107
378 3300025910 Ga0207684_10012314 Ga0207684_100123145 107
379 3300025910 Ga0207684_10100931 Ga0207684_101009313 107
380 3300025910 Ga0207684_10245616 Ga0207684_102456161 107
381 3300025910 Ga0207684_10755786 Ga0207684_107557862 107
382 3300025911 Ga0207654_10474226 Ga0207654_104742262 107
383 3300025911 Ga0207654_11050256 Ga0207654_110502562 107
384 3300025912 Ga0207707_10022676 Ga0207707_100226762 107
385 3300025913 Ga0207695_10018581 Ga0207695_100185812 107
386 3300025917 Ga0207660_10004184 Ga0207660_100041846 107
387 3300025918 Ga0207662_10296709 Ga0207662_102967092 107
388 3300025918 Ga0207662_10478153 Ga0207662_104781532 107
389 3300025922 Ga0207646_10025881 Ga0207646_100258815 107
390 3300025922 Ga0207646_10691579 Ga0207646_106915792 107
391 3300025923 Ga0207681_10027358 Ga0207681_100273583 107
392 3300025923 Ga0207681_10123915 Ga0207681_101239152 107
393 3300025923 Ga0207681_11425898 Ga0207681_114258981 107
394 3300025926 Ga0207659_10440834 Ga0207659_104408342 107
395 3300025932 Ga0207690_10400913 Ga0207690_104009131 107
396 3300025932 Ga0207690_10660973 Ga0207690_106609732 107
397 3300025933 Ga0207706_10025259 Ga0207706_100252595 107
398 3300025933 Ga0207706_10513723 Ga0207706_105137231 107
399 3300025933 Ga0207706_10686269 Ga0207706_106862692 107
400 3300025934 Ga0207686_10298763 Ga0207686_102987632 107
401 3300025935 Ga0207709_10048104 Ga0207709_100481042 107
402 3300025935 Ga0207709_11060097 Ga0207709_110600971 107
403 3300025936 Ga0207670_10125627 Ga0207670_101256272 107
404 3300025936 Ga0207670_10167964 Ga0207670_101679642 107
405 3300025936 Ga0207670_11549867 Ga0207670_115498672 107
406 3300025938 Ga0207704_10332817 Ga0207704_103328172 107
407 3300025940 Ga0207691_10506303 Ga0207691_105063032 107
408 3300025961 Ga0207712_10346561 Ga0207712_103465612 107
409 3300025972 Ga0207668_10315614 Ga0207668_103156141 107
410 3300025972 Ga0207668_10398212 Ga0207668_103982122 107
411 3300025986 Ga0207658_11527172 Ga0207658_115271721 107
412 3300026041 Ga0207639_11061188 Ga0207639_110611881 107
413 3300026075 Ga0207708_11235640 Ga0207708_112356402 107
414 3300026089 Ga0207648_10113523 Ga0207648_101135233 107
415 3300026089 Ga0207648_10194930 Ga0207648_101949302 107
416 3300026089 Ga0207648_10467731 Ga0207648_104677311 107
417 3300026095 Ga0207676_11254722 Ga0207676_112547222 107
418 3300026118 Ga0207675_100525775 Ga0207675_1005257752 107
419 3300026118 Ga0207675_101002170 Ga0207675_1010021702 107
420 3300026118 Ga0207675_101875580 Ga0207675_1018755801 107
421 3300027526 Ga0209968_1019566 Ga0209968_10195662 107
422 3300027617 Ga0210002_1009917 Ga0210002_10099172 107
423 3300027907 Ga0207428_10000095 Ga0207428_1000009538 107
424 3300027907 Ga0207428_10034391 Ga0207428_100343914 107
425 3300027907 Ga0207428_10119790 Ga0207428_101197902 107
426 3300027907 Ga0207428_10410040 Ga0207428_104100401 107
427 3300027907 Ga0207428_10692369 Ga0207428_106923691 107
428 3300028380 Ga0268265_10193837 Ga0268265_101938372 107
429 3300028380 Ga0268265_10411269 Ga0268265_104112692 107
430 3300028381 Ga0268264_10633397 Ga0268264_106333972 107
431 3300028381 Ga0268264_11742507 Ga0268264_117425072 107
432 3300031548 Ga0307408_100000180 Ga0307408_1000001803 107
433 3300031548 Ga0307408_100640253 Ga0307408_1006402532 107
434 3300031852 Ga0307410_10436390 Ga0307410_104363902 107
435 3300031901 Ga0307406_12127202 Ga0307406_121272021 107
436 3300032002 Ga0307416_101062386 Ga0307416_1010623861 107
437 3300034819 Ga0373958_0121516 Ga0373958_0121516_200_529 107
438 3300035084 Ga0373928_0118662 Ga0373928_0118662_323_652 107
439 3300035088 Ga0373940_0103220 Ga0373940_0103220_508_837 107
440 3300035088 Ga0373940_0335680 Ga0373940_0335680_183_515 107
441 3300035090 Ga0373949_0220662 Ga0373949_0220662_201_530 107
442 3300035091 Ga0373951_0260370 Ga0373951_0260370_19_351 107
443 3300035092 Ga0373952_0117988 Ga0373952_0117988_203_535 107
444 3300035112 Ga0373932_0095443 Ga0373932_0095443_89_418 107
445 3300035114 Ga0373939_0109957 Ga0373939_0109957_550_879 107
446 3300035121 Ga0373960_0106195 Ga0373960_0106195_49_381 107
447 3300035241 Ga0373961_0102627 Ga0373961_0102627_448_780 107
448 3300035241 Ga0373961_0274793 Ga0373961_0274793_218_547 107
449 3300035242 Ga0373962_0175012 Ga0373962_0175012_327_656 107
450 3300035691 Ga0373931_0000964 Ga0373931_0000964_3577_3909 107
451 3300035691 Ga0373931_0007284 Ga0373931_0007284_1484_1813 107
452 3300035691 Ga0373931_0693325 Ga0373931_0693325_54_386 107
453 3300037418 Ga0395900_0001056 Ga0395900_0001056_7604_7936 107
454 3300037466 Ga0395898_0204071 Ga0395898_0204071_1464_1796 107
455 3300037471 Ga0395905_1484260 Ga0395905_1484260_108_440 107
456 3300039447 Ga0436361_0216395 Ga0436361_0216395_3073_3399 107
457 3300042013 Ga0439456_023753 Ga0439456_023753_172_501 107
458 3300042156 Ga0439446_0109943 Ga0439446_0109943_468_854 107
459 3300042436 Ga0439435_0023476 Ga0439435_0023476_81_413 107
460 3300042436 Ga0439435_0068112 Ga0439435_0068112_436_765 107
461 3300042461 Ga0439460_0057644 Ga0439460_0057644_400_732 107
462 3300042876 Ga0451577_0078197 Ga0451577_0078197_1036_1365 107
463 3300044673 Ga0453683_1069691 Ga0453683_1069691_132_464 107
464 3300044842 Ga0466957_0096241 Ga0466957_0096241_840_1166 107
465 3300045051 Ga0451576_0052534 Ga0451576_0052534_2334_2663 107
466 3300045051 Ga0451576_0434765 Ga0451576_0434765_543_875 107
467 3300045051 Ga0451576_0440113 Ga0451576_0440113_448_777 107
468 3300045051 Ga0451576_0641850 Ga0451576_0641850_590_919 107
469 3300045051 Ga0451576_1784002 Ga0451576_1784002_168_500 107
470 3300046460 Ga0495638_0269228 Ga0495638_0269228_414_740 107
471 3300046472 Ga0495580_0000020 Ga0495580_0000020_66992_67321 107
472 3300046491 Ga0495584_0097944 Ga0495584_0097944_377_706 107
473 3300046512 Ga0495610_0001145 Ga0495610_0001145_464_790 107
474 3300046522 Ga0495643_0000225 Ga0495643_0000225_923_1249 107
475 3300046524 Ga0495648_0222952 Ga0495648_0222952_520_846 107
476 3300046524 Ga0495648_0249888 Ga0495648_0249888_176_502 107
477 3300046525 Ga0495663_0014636 Ga0495663_0014636_1786_2112 107
478 3300046525 Ga0495663_0184589 Ga0495663_0184589_41_370 107
479 3300046528 Ga0495642_0070793 Ga0495642_0070793_110_436 107
480 3300046528 Ga0495642_0123422 Ga0495642_0123422_228_560 107
481 3300046615 Ga0495656_0117906 Ga0495656_0117906_877_1203 107
482 3300046615 Ga0495656_0334379 Ga0495656_0334379_70_399 107
483 3300046648 Ga0495611_0130569 Ga0495611_0130569_806_1135 107
484 3300046660 Ga0495625_0343933 Ga0495625_0343933_584_910 107
485 3300046684 Ga0495669_0020303 Ga0495669_0020303_1325_1657 107
486 3300046684 Ga0495669_0068615 Ga0495669_0068615_673_1002 107
487 3300046684 Ga0495669_0350258 Ga0495669_0350258_198_530 107
488 3300046691 Ga0495670_0506212 Ga0495670_0506212_40_369 107
489 3300046694 Ga0495649_0066771 Ga0495649_0066771_747_1073 107
490 3300047318 Ga0495636_0408408 Ga0495636_0408408_220_549 107
491 3300047320 Ga0495672_0000385 Ga0495672_0000385_856_1182 107
492 3300047445 Ga0495677_0010939 Ga0495677_0010939_203_529 107
493 3300047445 Ga0495677_0430370 Ga0495677_0430370_177_506 107
494 3300047447 Ga0495685_052074 Ga0495685_052074_403_729 107
495 3300048904 Ga0496101_0613329 Ga0496101_0613329_37_369 107
496 3300048905 Ga0496102_0000107 Ga0496102_0000107_91953_92279 107
497 3300048905 Ga0496102_0076749 Ga0496102_0076749_789_1121 107
498 3300048905 Ga0496102_0215505 Ga0496102_0215505_32_361 107
499 3300048906 Ga0496103_0046899 Ga0496103_0046899_1801_2127 107
500 3300048906 Ga0496103_0251136 Ga0496103_0251136_31_363 107
501 3300048909 Ga0496106_0099984 Ga0496106_0099984_72_404 107
502 3300048909 Ga0496106_0671889 Ga0496106_0671889_428_757 107
503 3300048911 Ga0496108_0079443 Ga0496108_0079443_1447_1779 107
504 3300048912 Ga0496109_0491050 Ga0496109_0491050_71_403 107
505 3300048914 Ga0496111_0088145 Ga0496111_0088145_1002_1328 107
506 3300048919 Ga0496116_0091628 Ga0496116_0091628_745_1071 107
507 3300048920 Ga0496117_0000010 Ga0496117_0000010_279281_279607 107
508 3300048921 Ga0496118_0000009 Ga0496118_0000009_332348_332674 107
509 3300048924 Ga0496121_0005651 Ga0496121_0005651_15092_15418 107
510 3300048925 Ga0496122_0007348 Ga0496122_0007348_11157_11483 107
511 3300048926 Ga0496123_0007323 Ga0496123_0007323_965_1291 107
512 3300048927 Ga0496124_0138974 Ga0496124_0138974_1035_1361 107
513 3300048928 Ga0496125_0018476 Ga0496125_0018476_4555_4881 107
514 3300049162 Ga0501307_009855 Ga0501307_009855_230_556 107
515 3300049162 Ga0501307_048570 Ga0501307_048570_162_488 107
516 3300049459 Ga0495678_001252 Ga0495678_001252_845_1171 107
517 3300049529 Ga0501313_000344 Ga0501313_000344_734_1060 107
518 3300049531 Ga0501315_007556 Ga0501315_007556_431_757 107
519 3300049531 Ga0501315_051933 Ga0501315_051933_147_473 107
520 3300049532 Ga0501316_003385 Ga0501316_003385_800_1126 107
521 3300049533 Ga0501317_030292 Ga0501317_030292_170_496 107
522 3300049536 Ga0501320_058998 Ga0501320_058998_154_480 107
523 3300049568 Ga0501031_0008878 Ga0501031_0008878_641_970 107
524 3300049568 Ga0501031_0924314 Ga0501031_0924314_74_403 107
525 3300049569 Ga0501032_0022737 Ga0501032_0022737_1807_2136 107
526 3300049570 Ga0501033_0006638 Ga0501033_0006638_3516_3845 107
527 3300049570 Ga0501033_0015044 Ga0501033_0015044_3838_4167 107
528 3300049570 Ga0501033_0247938 Ga0501033_0247938_788_1120 107
529 3300049572 Ga0501036_0000860 Ga0501036_0000860_13093_13422 107
530 3300049572 Ga0501036_0038196 Ga0501036_0038196_641_970 107
531 3300049572 Ga0501036_0061288 Ga0501036_0061288_877_1206 107
532 3300049573 Ga0501037_0120915 Ga0501037_0120915_927_1256 107
533 3300049574 Ga0501038_0001811 Ga0501038_0001811_18419_18748 107
534 3300049574 Ga0501038_0007523 Ga0501038_0007523_9691_10020 107
535 3300049574 Ga0501038_0123383 Ga0501038_0123383_456_785 107
536 3300049574 Ga0501038_0863433 Ga0501038_0863433_38_370 107
537 3300049575 Ga0501039_0003590 Ga0501039_0003590_1620_1949 107
538 3300049575 Ga0501039_0033847 Ga0501039_0033847_2278_2607 107
539 3300049575 Ga0501039_0084380 Ga0501039_0084380_780_1109 107
540 3300049575 Ga0501039_0123796 Ga0501039_0123796_1110_1439 107
541 3300049575 Ga0501039_0496823 Ga0501039_0496823_136_468 107
542 3300049575 Ga0501039_0800020 Ga0501039_0800020_246_578 107
543 3300049576 Ga0501040_0006253 Ga0501040_0006253_944_1273 107
544 3300049576 Ga0501040_0218857 Ga0501040_0218857_884_1216 107
545 3300049577 Ga0501041_0002688 Ga0501041_0002688_9298_9627 107
546 3300049577 Ga0501041_0050199 Ga0501041_0050199_661_990 107
547 3300049577 Ga0501041_0148491 Ga0501041_0148491_803_1135 107
548 3300049577 Ga0501041_0399930 Ga0501041_0399930_107_436 107
549 3300049578 Ga0501042_0002889 Ga0501042_0002889_1543_1872 107
550 3300049578 Ga0501042_0078030 Ga0501042_0078030_1596_1925 107
551 3300049578 Ga0501042_0089306 Ga0501042_0089306_1353_1685 107
552 3300049578 Ga0501042_0112374 Ga0501042_0112374_1331_1660 107
553 3300049578 Ga0501042_0162058 Ga0501042_0162058_1250_1579 107
554 3300049579 Ga0501043_0039590 Ga0501043_0039590_1811_2140 107
555 3300049580 Ga0501046_0002460 Ga0501046_0002460_8317_8646 107
556 3300049580 Ga0501046_0110602 Ga0501046_0110602_219_548 107
557 3300049580 Ga0501046_0254075 Ga0501046_0254075_870_1199 107
558 3300049580 Ga0501046_0260783 Ga0501046_0260783_584_913 107
559 3300049582 Ga0501048_0005635 Ga0501048_0005635_1248_1577 107
560 3300049582 Ga0501048_0023088 Ga0501048_0023088_1301_1630 107
561 3300049582 Ga0501048_0334812 Ga0501048_0334812_577_906 107
562 3300049582 Ga0501048_0597310 Ga0501048_0597310_122_451 107
563 3300049582 Ga0501048_1354751 Ga0501048_1354751_17_349 107
564 3300049584 Ga0501068_0038347 Ga0501068_0038347_1530_1859 107
565 3300049584 Ga0501068_0121565 Ga0501068_0121565_106_435 107
566 3300049585 Ga0501069_0082331 Ga0501069_0082331_631_960 107
567 3300049585 Ga0501069_0332763 Ga0501069_0332763_454_783 107
568 3300049586 Ga0501070_0018631 Ga0501070_0018631_1616_1945 107
569 3300049587 Ga0501071_0017331 Ga0501071_0017331_3995_4324 107
570 3300049587 Ga0501071_0033941 Ga0501071_0033941_1796_2125 107
571 3300049587 Ga0501071_0170689 Ga0501071_0170689_1176_1508 107
572 3300049587 Ga0501071_0222001 Ga0501071_0222001_602_931 107
573 3300049588 Ga0501072_0000876 Ga0501072_0000876_19744_20073 107
574 3300049588 Ga0501072_0004398 Ga0501072_0004398_1387_1719 107
575 3300049588 Ga0501072_0005377 Ga0501072_0005377_9347_9676 107
576 3300049588 Ga0501072_0349008 Ga0501072_0349008_13_345 107
577 3300049588 Ga0501072_0861288 Ga0501072_0861288_132_461 107
578 3300049589 Ga0501073_0252972 Ga0501073_0252972_521_850 107
579 3300049590 Ga0501074_0039136 Ga0501074_0039136_2390_2719 107
580 3300049590 Ga0501074_0116871 Ga0501074_0116871_1272_1601 107
581 3300049591 Ga0501075_0001775 Ga0501075_0001775_4308_4637 107
582 3300049591 Ga0501075_0005327 Ga0501075_0005327_6566_6895 107
583 3300049591 Ga0501075_0023711 Ga0501075_0023711_2887_3219 107
584 3300049591 Ga0501075_0039240 Ga0501075_0039240_2698_3027 107
585 3300049591 Ga0501075_0067030 Ga0501075_0067030_777_1109 107
586 3300049591 Ga0501075_0204004 Ga0501075_0204004_93_422 107
587 3300049592 Ga0501076_0001726 Ga0501076_0001726_4413_4742 107
588 3300049592 Ga0501076_0019989 Ga0501076_0019989_2802_3131 107
589 3300049592 Ga0501076_0035681 Ga0501076_0035681_908_1240 107
590 3300049592 Ga0501076_0041142 Ga0501076_0041142_3103_3432 107
591 3300049592 Ga0501076_0107003 Ga0501076_0107003_800_1129 107
592 3300049592 Ga0501076_0236098 Ga0501076_0236098_735_1067 107
593 3300049593 Ga0501077_0007786 Ga0501077_0007786_5770_6099 107
594 3300049593 Ga0501077_0082710 Ga0501077_0082710_285_614 107
595 3300049707 Ga0501234_016510 Ga0501234_016510_588_914 107
596 3300049741 Ga0501079_0010767 Ga0501079_0010767_4364_4693 107
597 3300049741 Ga0501079_0024793 Ga0501079_0024793_2242_2571 107
598 3300049741 Ga0501079_0056411 Ga0501079_0056411_280_609 107
599 3300049741 Ga0501079_0272792 Ga0501079_0272792_144_473 107
600 3300049741 Ga0501079_0748301 Ga0501079_0748301_365_697 107
601 3300049742 Ga0501080_0001334 Ga0501080_0001334_9805_10134 107
602 3300049742 Ga0501080_0028797 Ga0501080_0028797_4073_4402 107
603 3300049742 Ga0501080_0384496 Ga0501080_0384496_288_617 107
604 3300049742 Ga0501080_0506151 Ga0501080_0506151_239_568 107
605 3300049743 Ga0501081_0001270 Ga0501081_0001270_4391_4720 107
606 3300049743 Ga0501081_0002641 Ga0501081_0002641_9332_9661 107
607 3300049743 Ga0501081_0267644 Ga0501081_0267644_658_990 107
608 3300049743 Ga0501081_0420267 Ga0501081_0420267_615_944 107
609 3300049743 Ga0501081_0986286 Ga0501081_0986286_200_532 107
610 3300049743 Ga0501081_1130775 Ga0501081_1130775_191_523 107
611 3300049744 Ga0501083_0053510 Ga0501083_0053510_1230_1559 107
612 3300049775 Ga0501279_077216 Ga0501279_077216_203_535 107
613 3300049822 Ga0501035_0015293 Ga0501035_0015293_3668_3997 107
614 3300049822 Ga0501035_0044811 Ga0501035_0044811_2447_2776 107
615 3300049823 Ga0501044_0444027 Ga0501044_0444027_54_383 107
616 3300049823 Ga0501044_1106659 Ga0501044_1106659_235_564 107
617 3300049824 Ga0501045_0000682 Ga0501045_0000682_1233_1562 107
618 3300049824 Ga0501045_0037058 Ga0501045_0037058_1667_1996 107
619 3300049824 Ga0501045_0190796 Ga0501045_0190796_1017_1346 107
620 3300049824 Ga0501045_0209394 Ga0501045_0209394_659_988 107
621 3300049824 Ga0501045_0282704 Ga0501045_0282704_848_1177 107
622 3300049824 Ga0501045_0462802 Ga0501045_0462802_196_528 107
623 3300050507 nmdc:mga05p37_1143171_c1 nmdc:mga05p37_1143171_c1_258_590 107
624 3300050507 nmdc:mga05p37_1238102_c1 nmdc:mga05p37_1238102_c1_145_477 107
625 3300050507 nmdc:mga05p37_149458_c1 nmdc:mga05p37_149458_c1_2017_2346 107
626 3300050507 nmdc:mga05p37_388885_c1 nmdc:mga05p37_388885_c1_899_1228 107
627 3300050507 nmdc:mga05p37_481842_c1 nmdc:mga05p37_481842_c1_509_841 107
628 3300050507 nmdc:mga05p37_550978_c1 nmdc:mga05p37_550978_c1_104_433 107
629 3300050507 nmdc:mga05p37_56257_c1 nmdc:mga05p37_56257_c1_3974_4303 107
630 3300050507 nmdc:mga05p37_6620_c1 nmdc:mga05p37_6620_c1_9366_9698 107
631 3300050507 nmdc:mga05p37_75653_c1 nmdc:mga05p37_75653_c1_437_766 107
632 3300050507 nmdc:mga05p37_87904_c1 nmdc:mga05p37_87904_c1_753_1085 107
633 3300050508 nmdc:mga09592_1107143_c1 nmdc:mga09592_1107143_c1_246_575 107
634 3300050508 nmdc:mga09592_1439824_c1 nmdc:mga09592_1439824_c1_152_484 107
635 3300050508 nmdc:mga09592_252445_c1 nmdc:mga09592_252445_c1_1145_1474 107
636 3300050508 nmdc:mga09592_29671_c1 nmdc:mga09592_29671_c1_749_1078 107
637 3300050508 nmdc:mga09592_3243_c1 nmdc:mga09592_3243_c1_12434_12763 107
638 3300050508 nmdc:mga09592_404324_c1 nmdc:mga09592_404324_c1_639_968 107
639 3300050508 nmdc:mga09592_45640_c2 nmdc:mga09592_45640_c2_102_434 107
640 3300050508 nmdc:mga09592_466896_c1 nmdc:mga09592_466896_c1_14_343 107
641 3300050508 nmdc:mga09592_8581_c1 nmdc:mga09592_8581_c1_2576_2908 107
642 3300050509 nmdc:mga0qj67_1003856_c1 nmdc:mga0qj67_1003856_c1_178_510 107
643 3300050509 nmdc:mga0qj67_1133685_c1 nmdc:mga0qj67_1133685_c1_122_454 107
644 3300050509 nmdc:mga0qj67_1552_c1 nmdc:mga0qj67_1552_c1_11831_12160 107
645 3300050509 nmdc:mga0qj67_365_c1 nmdc:mga0qj67_365_c1_22025_22357 107
646 3300050509 nmdc:mga0qj67_466097_c1 nmdc:mga0qj67_466097_c1_259_588 107
647 3300050509 nmdc:mga0qj67_652_c1 nmdc:mga0qj67_652_c1_20974_21306 107
648 3300050509 nmdc:mga0qj67_78796_c1 nmdc:mga0qj67_78796_c1_2219_2548 107
649 3300050510 nmdc:mga06r32_1869316_c1 nmdc:mga06r32_1869316_c1_82_411 107
650 3300050510 nmdc:mga06r32_219942_c1 nmdc:mga06r32_219942_c1_1139_1468 107
651 3300050510 nmdc:mga06r32_321002_c1 nmdc:mga06r32_321002_c1_695_1024 107
652 3300050510 nmdc:mga06r32_3383_c1 nmdc:mga06r32_3383_c1_10349_10681 107
653 3300050510 nmdc:mga06r32_345282_c1 nmdc:mga06r32_345282_c1_1059_1388 107
654 3300050510 nmdc:mga06r32_44913_c1 nmdc:mga06r32_44913_c1_749_1078 107
655 3300050510 nmdc:mga06r32_7587_c1 nmdc:mga06r32_7587_c1_204_536 107
656 3300050511 nmdc:mga08y16_13153_c1 nmdc:mga08y16_13153_c1_180_509 107
657 3300050511 nmdc:mga08y16_52624_c1 nmdc:mga08y16_52624_c1_3846_4175 107
658 3300050511 nmdc:mga08y16_638229_c1 nmdc:mga08y16_638229_c1_268_600 107
659 3300050511 nmdc:mga08y16_670510_c1 nmdc:mga08y16_670510_c1_343_675 107
660 3300050511 nmdc:mga08y16_8137_c1 nmdc:mga08y16_8137_c1_5229_5558 107
661 3300050512 nmdc:mga0n895_131480_c1 nmdc:mga0n895_131480_c1_910_1242 107
662 3300050512 nmdc:mga0n895_215496_c1 nmdc:mga0n895_215496_c1_826_1155 107
663 3300050512 nmdc:mga0n895_4841_c1 nmdc:mga0n895_4841_c1_10378_10710 107
664 3300050512 nmdc:mga0n895_58104_c1 nmdc:mga0n895_58104_c1_1431_1760 107
665 3300050512 nmdc:mga0n895_9114_c1 nmdc:mga0n895_9114_c1_6764_7093 107
666 3300050513 nmdc:mga0rr50_107578_c1 nmdc:mga0rr50_107578_c1_1233_1562 107
667 3300050513 nmdc:mga0rr50_209820_c1 nmdc:mga0rr50_209820_c1_550_882 107
668 3300050513 nmdc:mga0rr50_28036_c1 nmdc:mga0rr50_28036_c1_457_786 107
669 3300050513 nmdc:mga0rr50_287865_c1 nmdc:mga0rr50_287865_c1_118_450 107
670 3300050513 nmdc:mga0rr50_5113_c1 nmdc:mga0rr50_5113_c1_2399_2728 107
671 3300050514 nmdc:mga08x19_16214_c1 nmdc:mga08x19_16214_c1_1338_1670 107
672 3300050514 nmdc:mga08x19_28871_c1 nmdc:mga08x19_28871_c1_980_1309 107
673 3300050514 nmdc:mga08x19_560250_c1 nmdc:mga08x19_560250_c1_104_433 107
674 3300050514 nmdc:mga08x19_77267_c1 nmdc:mga08x19_77267_c1_957_1286 107
675 3300050515 nmdc:mga0a205_107185_c1 nmdc:mga0a205_107185_c1_971_1303 107
676 3300050515 nmdc:mga0a205_15571_c1 nmdc:mga0a205_15571_c1_176_505 107
677 3300050515 nmdc:mga0a205_156652_c1 nmdc:mga0a205_156652_c1_1189_1518 107
678 3300050515 nmdc:mga0a205_285697_c1 nmdc:mga0a205_285697_c1_1005_1337 107
679 3300050515 nmdc:mga0a205_32330_c1 nmdc:mga0a205_32330_c1_992_1321 107
680 3300050515 nmdc:mga0a205_342909_c1 nmdc:mga0a205_342909_c1_148_477 107
681 3300050515 nmdc:mga0a205_55271_c1 nmdc:mga0a205_55271_c1_2046_2375 107
682 3300050515 nmdc:mga0a205_56850_c1 nmdc:mga0a205_56850_c1_1903_2235 107
683 3300050515 nmdc:mga0a205_650248_c1 nmdc:mga0a205_650248_c1_184_513 107
684 3300053087 Ga0500643_000124 Ga0500643_000124_50651_50974 107
685 3300054114 Ga0501084_0000677 Ga0501084_0000677_4590_4919 107
686 3300054114 Ga0501084_0002581 Ga0501084_0002581_818_1147 107
687 3300054114 Ga0501084_0336243 Ga0501084_0336243_523_852 107
688 3300054114 Ga0501084_0352867 Ga0501084_0352867_637_966 107
689 3300054114 Ga0501084_1258735 Ga0501084_1258735_38_370 107
690 3300059426 Ga0590077_069239 Ga0590077_069239_118_450 107
691 3300059493 Ga0587077_029740 Ga0587077_029740_172_498 107
692 3300059503 Ga0587080_056077 Ga0587080_056077_292_618 107
693 3300059505 Ga0587083_0085422 Ga0587083_0085422_299_625 107
694 3300059507 Ga0587086_113744 Ga0587086_113744_63_389 107
695 3300059510 Ga0587090_118483 Ga0587090_118483_154_480 107
696 3300059641 Ga0587068_029919 Ga0587068_029919_419_745 107
697 3300059643 Ga0587072_074696 Ga0587072_074696_143_469 107
698 3300060353 Ga0501082_0002693 Ga0501082_0002693_1214_1543 107
699 3300060353 Ga0501082_0005933 Ga0501082_0005933_9507_9836 107
700 3300060353 Ga0501082_0045078 Ga0501082_0045078_2448_2777 107
701 3300060353 Ga0501082_0683433 Ga0501082_0683433_47_379 107
702 3300060353 Ga0501082_0799333 Ga0501082_0799333_416_745 107
703 3300060353 Ga0501082_0909841 Ga0501082_0909841_119_448 107
704 3300061734 Ga0530510_0001493 Ga0530510_0001493_5330_5659 107
705 3300061734 Ga0530510_0003925 Ga0530510_0003925_7130_7459 107
706 3300061734 Ga0530510_0037620 Ga0530510_0037620_308_637 107
707 3300061734 Ga0530510_0053697 Ga0530510_0053697_1497_1826 107
708 3300061734 Ga0530510_0056888 Ga0530510_0056888_333_662 107
709 3300061734 Ga0530510_0100486 Ga0530510_0100486_1312_1644 107
710 3300061734 Ga0530510_0316419 Ga0530510_0316419_765_1094 107
711 3300002067 JGI24735J21928_10003171 JGI24735J21928_100031712 108
712 3300004803 Ga0058862_12425548 Ga0058862_124255481 108
713 3300005327 Ga0070658_10060932 Ga0070658_100609323 108
714 3300005337 Ga0070682_100592502 Ga0070682_1005925022 108
715 3300005617 Ga0068859_100019419 Ga0068859_1000194196 108
716 3300006178 Ga0075367_10180255 Ga0075367_101802552 108
717 3300006931 Ga0097620_100019419 Ga0097620_1000194196 108
718 3300007076 Ga0075435_100076730 Ga0075435_1000767305 108
719 3300009101 Ga0105247_10008646 Ga0105247_100086464 108
720 3300009551 Ga0105238_10849849 Ga0105238_108498492 108
721 3300013104 Ga0157370_11876273 Ga0157370_118762731 108
722 3300013105 Ga0157369_10254394 Ga0157369_102543943 108
723 3300013105 Ga0157369_11631262 Ga0157369_116312621 108
724 3300013307 Ga0157372_11311620 Ga0157372_113116202 108
725 3300014968 Ga0157379_11579587 Ga0157379_115795871 108
726 3300020069 Ga0197907_10518326 Ga0197907_105183261 108
727 3300020069 Ga0197907_11509585 Ga0197907_115095851 108
728 3300020070 Ga0206356_11723322 Ga0206356_117233222 108
729 3300020076 Ga0206355_1045112 Ga0206355_10451122 108
730 3300020076 Ga0206355_1660841 Ga0206355_16608412 108
731 3300020077 Ga0206351_10349927 Ga0206351_103499271 108
732 3300020077 Ga0206351_10717643 Ga0206351_107176432 108
733 3300020080 Ga0206350_10668403 Ga0206350_106684032 108
734 3300020080 Ga0206350_10675512 Ga0206350_106755121 108
735 3300020081 Ga0206354_10238434 Ga0206354_102384342 108
736 3300020082 Ga0206353_11625478 Ga0206353_116254782 108
737 3300020082 Ga0206353_11636605 Ga0206353_116366053 108
738 3300020610 Ga0154015_1649135 Ga0154015_16491351 108
739 3300022467 Ga0224712_10325278 Ga0224712_103252781 108
740 3300025900 Ga0207710_10009004 Ga0207710_100090043 108
741 3300025909 Ga0207705_10829031 Ga0207705_108290311 108
742 3300031456 Ga0307513_10913006 Ga0307513_109130061 108
743 3300031824 Ga0307413_10462485 Ga0307413_104624851 108
744 3300041452 Ga0451793_0052380 Ga0451793_0052380_676_1002 108
745 3300041494 Ga0451837_1531230 Ga0451837_1531230_177_503 108
746 3300045836 Ga0466958_0703481 Ga0466958_0703481_203_547 108
747 3300048905 Ga0496102_0000013 Ga0496102_0000013_177836_178165 108
748 3300048906 Ga0496103_0000105 Ga0496103_0000105_5877_6206 108
749 3300048914 Ga0496111_0706247 Ga0496111_0706247_292_618 108
750 3300048920 Ga0496117_0093728 Ga0496117_0093728_718_1047 108
751 3300048921 Ga0496118_0018871 Ga0496118_0018871_396_725 108
752 3300048922 Ga0496119_0051039 Ga0496119_0051039_1335_1664 108
753 3300048924 Ga0496121_0053352 Ga0496121_0053352_2914_3243 108
754 3300048925 Ga0496122_0015575 Ga0496122_0015575_1095_1421 108
755 3300048926 Ga0496123_0002281 Ga0496123_0002281_13530_13856 108
756 3300049569 Ga0501032_0249933 Ga0501032_0249933_315_641 108
757 3300049570 Ga0501033_0006614 Ga0501033_0006614_7746_8072 108
758 3300049570 Ga0501033_0135413 Ga0501033_0135413_672_998 108
759 3300049571 Ga0501034_0512181 Ga0501034_0512181_75_401 108
760 3300049571 Ga0501034_1020043 Ga0501034_1020043_371_697 108
761 3300049573 Ga0501037_0133937 Ga0501037_0133937_660_986 108
762 3300049578 Ga0501042_0002934 Ga0501042_0002934_2980_3306 108
763 3300049579 Ga0501043_0105147 Ga0501043_0105147_18_344 108
764 3300049581 Ga0501047_0095003 Ga0501047_0095003_2483_2809 108
765 3300049581 Ga0501047_0384053 Ga0501047_0384053_358_684 108
766 3300049585 Ga0501069_0167170 Ga0501069_0167170_79_405 108
767 3300049744 Ga0501083_0000990 Ga0501083_0000990_18516_18842 108
768 3300049744 Ga0501083_0008270 Ga0501083_0008270_4501_4827 108
769 3300049822 Ga0501035_0159266 Ga0501035_0159266_138_464 108
770 3300049823 Ga0501044_0502036 Ga0501044_0502036_469_795 108
771 3300049824 Ga0501045_0762528 Ga0501045_0762528_169_495 108
772 3300050492 nmdc:mga0yw44_129854_c1 nmdc:mga0yw44_129854_c1_207_533 108
773 3300050494 nmdc:mga06z11_119732_c1 nmdc:mga06z11_119732_c1_676_1002 108
774 3300050513 nmdc:mga0rr50_32889_c1 nmdc:mga0rr50_32889_c1_2480_2830 108
775 3300050513 nmdc:mga0rr50_63038_c1 nmdc:mga0rr50_63038_c1_568_912 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

19

121

0.97

PF13098

Thioredoxin_2

Thioredoxin-like domain

32

119

0.87

PF14595

Thioredoxin_9

Thioredoxin

12

121

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wxt-assembly1.cif.gz_A x-ray crystal structure of thioredoxin from mycobacterium avium 0.9896 3 101
4pob-assembly1.cif.gz_B crystal structure of a thioredoxin rv1471 ortholog from mycobacterium abscessus 0.988 3 104
1t00-assembly1.cif.gz_A the structure of thioredoxin from s. coelicolor 0.9875 3 105
5hr1-assembly7.cif.gz_G crystal structure of thioredoxin l107a mutant 0.9857 26 99
3nof-assembly1.cif.gz_A mycobacterium tuberculosis thioredoxin c c40s mutant 0.9829 2 102
ID Description Score Start End Superfamily
5hr1G00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9857 26 99 3.40.30.10
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9729 3 104 3.40.30.10
3dieB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9649 30 104 3.40.30.10
1v98B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9634 22 105 3.40.30.10
af_A0A0R4IGN3_1_88_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9607 22 88 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A0M8UXE3-F1-model_v4 Thioredoxin 1 5 106 GO:0005829
GO:0015035
GO:0045454
AF-A0A7L5AFU1-F1-model_v4 Thioredoxin 0.9998 1 106 GO:0005829
GO:0015035
GO:0045454
AF-A0A4T2C8T4-F1-model_v4 Thioredoxin 0.9993 1 106 GO:0005829
GO:0015035
GO:0045454
AF-A0A2W1Z0G1-F1-model_v4 deleted 0.9993 1 106
AF-A0A0M8V7W5-F1-model_v4 Thioredoxin 0.9992 5 106 GO:0005829
GO:0015035
GO:0045454

Feature Viewer

pLDDT pTM Quality
94.08 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map