F479958
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 768 | 378 | 1536 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0409349|Ga0373937_0409349_347_1189 |
| Length | 280 |
| Sequence | VAANDPPNLPGDASTKVLEIHAPGSFSLIICPSLVGWQGSMGRIFEVRKHTMFARWNRMAKQFAKIGKEITIAVKSGGGDPASNPALRRVIQNARAVNMPKDKVDAAIKRALGRDAANYTEVLYEGYAPHGVAVLVETATDNPTRTVANVRNLFTKGEGNLATSGSVSFMFRKMGVFRLAPDGVDQDDLELYLIDHGLDEMGEGTGEKGEPQLVVRCEFEKFGQLQHALEQRGVAVVSAAHEYICNAPTTLPEDQAAEVMALLDKLEQDEDVQNVYHTLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 84 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 175 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 180 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 181 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 189 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 192 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 193 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 196 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 197 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 198 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 199 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 207 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 208 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 209 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 213 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 218 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 222 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 232 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 233 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 234 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 235 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 236 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 237 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 238 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 239 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 240 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 241 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 242 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 243 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 244 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 245 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 246 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 247 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 248 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 249 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 250 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 251 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 252 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 287 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 290 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 291 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 292 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 293 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 294 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 295 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 296 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 297 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 298 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 299 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 300 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 301 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 330 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 341 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 343 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 344 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 345 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 346 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 347 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 348 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 349 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 350 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 351 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 353 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 355 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 357 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 359 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 360 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 361 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 362 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 363 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 364 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 365 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 366 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 367 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 368 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 369 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 370 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 371 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 372 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 373 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 374 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 375 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 376 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 377 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 378 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.14 |
| Metatranscriptomes | 0.26 |
| Isolates | 2.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.26 |
| Nodule | 0 |
| Rhizoplane | 3.78 |
| Rhizosphere | 88.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373937_0409349 | 3300036401 | Bacteria | 1287 |
| 2 | SwRhRL2b_contig_857857 | 2162886007 | Bacteria | 1346 |
| 3 | JGI24744J21845_10011345 | 3300002077 | Bacteria | 1823 |
| 4 | rootH1_10000284 | 3300003316 | Bacteria | 58926 |
| 5 | rootH2_10088031 | 3300003320 | Bacteria | 3393 |
| 6 | rootL2_10038226 | 3300003322 | Unclassified | 3186 |
| 7 | rootL2_10118395 | 3300003322 | Bacteria | 9328 |
| 8 | rootH1_10059569 | 3300003323 | Bacteria | 3193 |
| 9 | Ga0055536_1007237 | 3300003781 | Bacteria | 5004 |
| 10 | Ga0058692_1000033 | 3300003856 | Bacteria | 174393 |
| 11 | Ga0065704_10000377 | 3300005289 | Bacteria | 25325 |
| 12 | Ga0065704_10004068 | 3300005289 | Bacteria | 5659 |
| 13 | Ga0065704_10141904 | 3300005289 | Unclassified | 1509 |
| 14 | Ga0065707_10092373 | 3300005295 | Bacteria | 3782 |
| 15 | Ga0070658_10062502 | 3300005327 | Bacteria | 3035 |
| 16 | Ga0070690_100118984 | 3300005330 | Bacteria | 1771 |
| 17 | Ga0070670_100014994 | 3300005331 | Bacteria | 6651 |
| 18 | Ga0070670_100484579 | 3300005331 | Bacteria | 1098 |
| 19 | Ga0070670_100499455 | 3300005331 | Bacteria | 1082 |
| 20 | Ga0070670_100536268 | 3300005331 | Bacteria | 1043 |
| 21 | Ga0068869_100270298 | 3300005334 | Bacteria | 1364 |
| 22 | Ga0070666_10019216 | 3300005335 | Bacteria | 4407 |
| 23 | Ga0070666_10052239 | 3300005335 | Bacteria | 2754 |
| 24 | Ga0070680_100074940 | 3300005336 | Bacteria | 2785 |
| 25 | Ga0070680_100180567 | 3300005336 | Bacteria | 1777 |
| 26 | Ga0070682_100059298 | 3300005337 | Bacteria | 2417 |
| 27 | Ga0068868_100016001 | 3300005338 | Bacteria | 5562 |
| 28 | Ga0070660_100686634 | 3300005339 | Bacteria | 858 |
| 29 | Ga0070689_100249865 | 3300005340 | Bacteria | 1463 |
| 30 | Ga0070689_100261834 | 3300005340 | Bacteria | 1430 |
| 31 | Ga0070687_100161397 | 3300005343 | Bacteria | 1325 |
| 32 | Ga0070661_100018082 | 3300005344 | Bacteria | 5007 |
| 33 | Ga0070692_10058900 | 3300005345 | Bacteria | 2018 |
| 34 | Ga0070668_100003484 | 3300005347 | Bacteria | 11601 |
| 35 | Ga0070668_100143434 | 3300005347 | Bacteria | 1926 |
| 36 | Ga0070668_100281641 | 3300005347 | Bacteria | 1389 |
| 37 | Ga0070669_100000010 | 3300005353 | Bacteria | 222186 |
| 38 | Ga0070669_100007130 | 3300005353 | Bacteria | 8031 |
| 39 | Ga0070669_100027116 | 3300005353 | Bacteria | 4123 |
| 40 | Ga0070669_100062248 | 3300005353 | Bacteria | 2743 |
| 41 | Ga0070669_100407993 | 3300005353 | Bacteria | 1113 |
| 42 | Ga0070675_100014637 | 3300005354 | Bacteria | 6186 |
| 43 | Ga0070675_100042910 | 3300005354 | Bacteria | 3696 |
| 44 | Ga0070675_100045587 | 3300005354 | Bacteria | 3588 |
| 45 | Ga0070675_100203992 | 3300005354 | Bacteria | 1716 |
| 46 | Ga0070671_100040061 | 3300005355 | Bacteria | 3890 |
| 47 | Ga0070671_100277291 | 3300005355 | Bacteria | 1425 |
| 48 | Ga0070674_100027099 | 3300005356 | Bacteria | 3752 |
| 49 | Ga0070674_100183113 | 3300005356 | Bacteria | 1606 |
| 50 | Ga0070674_100249179 | 3300005356 | Bacteria | 1394 |
| 51 | Ga0070674_100370956 | 3300005356 | Unclassified | 1161 |
| 52 | Ga0070674_100653496 | 3300005356 | Bacteria | 894 |
| 53 | Ga0070673_100066843 | 3300005364 | Bacteria | 2873 |
| 54 | Ga0070673_100295350 | 3300005364 | Bacteria | 1425 |
| 55 | Ga0070688_100042495 | 3300005365 | Bacteria | 2797 |
| 56 | Ga0070688_100192851 | 3300005365 | Bacteria | 1421 |
| 57 | Ga0070688_100279620 | 3300005365 | Bacteria | 1198 |
| 58 | Ga0070667_100001093 | 3300005367 | Bacteria | 24858 |
| 59 | Ga0070667_100101567 | 3300005367 | Bacteria | 2485 |
| 60 | Ga0070667_100292567 | 3300005367 | Bacteria | 1465 |
| 61 | Ga0070667_100298619 | 3300005367 | Bacteria | 1450 |
| 62 | Ga0070703_10058983 | 3300005406 | Bacteria | 1250 |
| 63 | Ga0070709_10000052 | 3300005434 | Bacteria | 90029 |
| 64 | Ga0070709_10239341 | 3300005434 | Bacteria | 1303 |
| 65 | Ga0070701_10015140 | 3300005438 | Bacteria | 3554 |
| 66 | Ga0070701_10075654 | 3300005438 | Bacteria | 1811 |
| 67 | Ga0070701_10462321 | 3300005438 | Bacteria | 817 |
| 68 | Ga0070705_100002598 | 3300005440 | Bacteria | 9051 |
| 69 | Ga0070700_100012135 | 3300005441 | Bacteria | 4796 |
| 70 | Ga0070700_100065934 | 3300005441 | Bacteria | 2297 |
| 71 | Ga0070700_100106612 | 3300005441 | Bacteria | 1855 |
| 72 | Ga0070694_100162670 | 3300005444 | Bacteria | 1639 |
| 73 | Ga0070694_100296575 | 3300005444 | Bacteria | 1237 |
| 74 | Ga0070708_100059240 | 3300005445 | Bacteria | 3414 |
| 75 | Ga0070663_100512746 | 3300005455 | Bacteria | 997 |
| 76 | Ga0070678_100025822 | 3300005456 | Unclassified | 3960 |
| 77 | Ga0070678_100086028 | 3300005456 | Bacteria | 2397 |
| 78 | Ga0070662_100004289 | 3300005457 | Bacteria | 9004 |
| 79 | Ga0070662_100181647 | 3300005457 | Bacteria | 1659 |
| 80 | Ga0070681_10118926 | 3300005458 | Bacteria | 2578 |
| 81 | Ga0068867_100008692 | 3300005459 | Bacteria | 7169 |
| 82 | Ga0068867_100076250 | 3300005459 | Bacteria | 2517 |
| 83 | Ga0068867_100101523 | 3300005459 | Bacteria | 2198 |
| 84 | Ga0068867_100121848 | 3300005459 | Bacteria | 2017 |
| 85 | Ga0068867_100292275 | 3300005459 | Bacteria | 1340 |
| 86 | Ga0070685_10011642 | 3300005466 | Bacteria | 4609 |
| 87 | Ga0070706_100190772 | 3300005467 | Bacteria | 1915 |
| 88 | Ga0070698_100772589 | 3300005471 | Bacteria | 904 |
| 89 | Ga0070679_100042566 | 3300005530 | Bacteria | 4523 |
| 90 | Ga0070684_100037966 | 3300005535 | Bacteria | 4135 |
| 91 | Ga0068853_100278159 | 3300005539 | Bacteria | 1543 |
| 92 | Ga0070672_100016034 | 3300005543 | Bacteria | 5355 |
| 93 | Ga0070672_100025797 | 3300005543 | Bacteria | 4366 |
| 94 | Ga0070672_100057751 | 3300005543 | Bacteria | 3047 |
| 95 | Ga0070672_100140589 | 3300005543 | Bacteria | 1991 |
| 96 | Ga0070672_100617879 | 3300005543 | Bacteria | 945 |
| 97 | Ga0070686_100069479 | 3300005544 | Bacteria | 2301 |
| 98 | Ga0070695_100089407 | 3300005545 | Bacteria | 2053 |
| 99 | Ga0070696_100019044 | 3300005546 | Bacteria | 4647 |
| 100 | Ga0070665_100006995 | 3300005548 | Bacteria | 11462 |
| 101 | Ga0070665_100019521 | 3300005548 | Bacteria | 6805 |
| 102 | Ga0070665_100067071 | 3300005548 | Bacteria | 3599 |
| 103 | Ga0070665_100075009 | 3300005548 | Bacteria | 3388 |
| 104 | Ga0070665_100266124 | 3300005548 | Bacteria | 1716 |
| 105 | Ga0070665_100441307 | 3300005548 | Unclassified | 1311 |
| 106 | Ga0070704_100004298 | 3300005549 | Bacteria | 8234 |
| 107 | Ga0070704_100160662 | 3300005549 | Bacteria | 1777 |
| 108 | Ga0070704_100242065 | 3300005549 | Bacteria | 1477 |
| 109 | Ga0070664_100104009 | 3300005564 | Bacteria | 2472 |
| 110 | Ga0068857_100277286 | 3300005577 | Bacteria | 1542 |
| 111 | Ga0068857_100293737 | 3300005577 | Bacteria | 1497 |
| 112 | Ga0068856_100123837 | 3300005614 | Bacteria | 2588 |
| 113 | Ga0070702_100004301 | 3300005615 | Bacteria | 6489 |
| 114 | Ga0068859_100009838 | 3300005617 | Bacteria | 9653 |
| 115 | Ga0068859_100167266 | 3300005617 | Bacteria | 2279 |
| 116 | Ga0068859_100189176 | 3300005617 | Bacteria | 2143 |
| 117 | Ga0068864_100018642 | 3300005618 | Bacteria | 5799 |
| 118 | Ga0068864_100405247 | 3300005618 | Bacteria | 1297 |
| 119 | Ga0068864_100461066 | 3300005618 | Bacteria | 1217 |
| 120 | Ga0068861_100000527 | 3300005719 | Bacteria | 22405 |
| 121 | Ga0068861_100003035 | 3300005719 | Bacteria | 11088 |
| 122 | Ga0068861_100006749 | 3300005719 | Bacteria | 7843 |
| 123 | Ga0068861_100024936 | 3300005719 | Bacteria | 4330 |
| 124 | Ga0068861_100212659 | 3300005719 | Bacteria | 1630 |
| 125 | Ga0068861_100473530 | 3300005719 | Bacteria | 1127 |
| 126 | Ga0068870_10005087 | 3300005840 | Bacteria | 5717 |
| 127 | Ga0068870_10214234 | 3300005840 | Bacteria | 1175 |
| 128 | Ga0068863_100005076 | 3300005841 | Bacteria | 12985 |
| 129 | Ga0068863_100350956 | 3300005841 | Bacteria | 1436 |
| 130 | Ga0068863_100470753 | 3300005841 | Bacteria | 1235 |
| 131 | Ga0068858_100056981 | 3300005842 | Bacteria | 3611 |
| 132 | Ga0068860_100003807 | 3300005843 | Bacteria | 15524 |
| 133 | Ga0068860_100022709 | 3300005843 | Bacteria | 6065 |
| 134 | Ga0068860_100046759 | 3300005843 | Bacteria | 4126 |
| 135 | Ga0068860_100343893 | 3300005843 | Bacteria | 1467 |
| 136 | Ga0068862_100000397 | 3300005844 | Bacteria | 47021 |
| 137 | Ga0068862_100035410 | 3300005844 | Bacteria | 4228 |
| 138 | Ga0068862_100045592 | 3300005844 | Bacteria | 3741 |
| 139 | Ga0068862_100079883 | 3300005844 | Bacteria | 2835 |
| 140 | Ga0068862_100095027 | 3300005844 | Bacteria | 2600 |
| 141 | Ga0068862_100098520 | 3300005844 | Bacteria | 2554 |
| 142 | Ga0068862_100116080 | 3300005844 | Bacteria | 2355 |
| 143 | Ga0068862_100180405 | 3300005844 | Bacteria | 1895 |
| 144 | Ga0068862_100189060 | 3300005844 | Bacteria | 1852 |
| 145 | Ga0068862_100257892 | 3300005844 | Bacteria | 1591 |
| 146 | Ga0068862_100356609 | 3300005844 | Bacteria | 1358 |
| 147 | Ga0068862_100393179 | 3300005844 | Bacteria | 1295 |
| 148 | Ga0081539_10039309 | 3300005985 | Bacteria | 2793 |
| 149 | Ga0081539_10093321 | 3300005985 | Bacteria | 1550 |
| 150 | Ga0075364_10000088 | 3300006051 | Bacteria | 36693 |
| 151 | Ga0070712_100398543 | 3300006175 | Bacteria | 1136 |
| 152 | Ga0097621_100013787 | 3300006237 | Bacteria | 6034 |
| 153 | Ga0097621_100070263 | 3300006237 | Bacteria | 2891 |
| 154 | Ga0097621_100186538 | 3300006237 | Bacteria | 1794 |
| 155 | Ga0068871_100018590 | 3300006358 | Bacteria | 5287 |
| 156 | Ga0068871_100310291 | 3300006358 | Bacteria | 1387 |
| 157 | Ga0068871_100442695 | 3300006358 | Bacteria | 1163 |
| 158 | Ga0075428_100014839 | 3300006844 | Bacteria | 8658 |
| 159 | Ga0075428_100119918 | 3300006844 | Bacteria | 2863 |
| 160 | Ga0075428_100330775 | 3300006844 | Bacteria | 1636 |
| 161 | Ga0075430_100005316 | 3300006846 | Bacteria | 10867 |
| 162 | Ga0075430_100018414 | 3300006846 | Bacteria | 5942 |
| 163 | Ga0075430_100023730 | 3300006846 | Bacteria | 5224 |
| 164 | Ga0075430_100044827 | 3300006846 | Bacteria | 3738 |
| 165 | Ga0075430_100068661 | 3300006846 | Bacteria | 2973 |
| 166 | Ga0075430_100162601 | 3300006846 | Bacteria | 1858 |
| 167 | Ga0075431_100002456 | 3300006847 | Bacteria | 17843 |
| 168 | Ga0075431_100008015 | 3300006847 | Bacteria | 10540 |
| 169 | Ga0075431_100021583 | 3300006847 | Bacteria | 6586 |
| 170 | Ga0075431_100038262 | 3300006847 | Bacteria | 4939 |
| 171 | Ga0075431_100176502 | 3300006847 | Bacteria | 2194 |
| 172 | Ga0075433_10010361 | 3300006852 | Bacteria | 7477 |
| 173 | Ga0075433_10082411 | 3300006852 | Bacteria | 2837 |
| 174 | Ga0075434_100006583 | 3300006871 | Bacteria | 10657 |
| 175 | Ga0075429_100013156 | 3300006880 | Bacteria | 7178 |
| 176 | Ga0075429_100014907 | 3300006880 | Bacteria | 6741 |
| 177 | Ga0075429_100113491 | 3300006880 | Bacteria | 2368 |
| 178 | Ga0097620_100009838 | 3300006931 | Bacteria | 9653 |
| 179 | Ga0097620_100167255 | 3300006931 | Bacteria | 2279 |
| 180 | Ga0097620_100189155 | 3300006931 | Bacteria | 2143 |
| 181 | Ga0075435_100093548 | 3300007076 | Bacteria | 2484 |
| 182 | Ga0075435_100689390 | 3300007076 | Bacteria | 888 |
| 183 | Ga0099794_10009352 | 3300007265 | Bacteria | 4116 |
| 184 | Ga0099795_10022729 | 3300007788 | Bacteria | 2073 |
| 185 | Ga0105244_10016536 | 3300009036 | Bacteria | 4200 |
| 186 | Ga0105240_10018364 | 3300009093 | Bacteria | 9393 |
| 187 | Ga0105240_10033150 | 3300009093 | Bacteria | 6675 |
| 188 | Ga0105240_10046990 | 3300009093 | Bacteria | 5464 |
| 189 | Ga0105240_10053056 | 3300009093 | Bacteria | 5093 |
| 190 | Ga0105240_10463258 | 3300009093 | Bacteria | 1416 |
| 191 | Ga0111539_10013502 | 3300009094 | Bacteria | 10208 |
| 192 | Ga0111539_10187353 | 3300009094 | Bacteria | 2416 |
| 193 | Ga0111539_10210660 | 3300009094 | Unclassified | 2265 |
| 194 | Ga0111539_10219175 | 3300009094 | Bacteria | 2216 |
| 195 | Ga0111539_10306392 | 3300009094 | Bacteria | 1848 |
| 196 | Ga0111539_10370073 | 3300009094 | Bacteria | 1668 |
| 197 | Ga0111539_10536675 | 3300009094 | Bacteria | 1363 |
| 198 | Ga0111539_10599427 | 3300009094 | Bacteria | 1283 |
| 199 | Ga0105245_10015730 | 3300009098 | Bacteria | 6598 |
| 200 | Ga0105245_10476479 | 3300009098 | Bacteria | 1261 |
| 201 | Ga0114129_10034384 | 3300009147 | Bacteria | 7158 |
| 202 | Ga0114129_10494455 | 3300009147 | Bacteria | 1598 |
| 203 | Ga0105243_10007475 | 3300009148 | Bacteria | 8395 |
| 204 | Ga0105243_10014090 | 3300009148 | Bacteria | 6049 |
| 205 | Ga0105243_10863180 | 3300009148 | Bacteria | 897 |
| 206 | Ga0105241_10112410 | 3300009174 | Bacteria | 2182 |
| 207 | Ga0105241_10730364 | 3300009174 | Bacteria | 906 |
| 208 | Ga0105242_10008662 | 3300009176 | Bacteria | 7808 |
| 209 | Ga0105242_10788038 | 3300009176 | Bacteria | 940 |
| 210 | Ga0105248_10126371 | 3300009177 | Bacteria | 2884 |
| 211 | Ga0105248_10144479 | 3300009177 | Bacteria | 2684 |
| 212 | Ga0105248_10661627 | 3300009177 | Bacteria | 1178 |
| 213 | Ga0105238_10143320 | 3300009551 | Bacteria | 2366 |
| 214 | Ga0105238_10252680 | 3300009551 | Bacteria | 1741 |
| 215 | Ga0105238_10779387 | 3300009551 | Bacteria | 971 |
| 216 | Ga0105249_10025495 | 3300009553 | Bacteria | 5323 |
| 217 | Ga0105249_10050830 | 3300009553 | Bacteria | 3779 |
| 218 | Ga0105249_10086074 | 3300009553 | Bacteria | 2930 |
| 219 | Ga0099796_10001390 | 3300010159 | Bacteria | 4841 |
| 220 | Ga0105239_11337704 | 3300010375 | Bacteria | 827 |
| 221 | Ga0157373_10002057 | 3300013100 | Bacteria | 15242 |
| 222 | Ga0157373_10066987 | 3300013100 | Bacteria | 2539 |
| 223 | Ga0157371_10004109 | 3300013102 | Bacteria | 12851 |
| 224 | Ga0157371_10022846 | 3300013102 | Bacteria | 4576 |
| 225 | Ga0157371_10096541 | 3300013102 | Unclassified | 2095 |
| 226 | Ga0157370_10004297 | 3300013104 | Bacteria | 16392 |
| 227 | Ga0157370_10261642 | 3300013104 | Bacteria | 1599 |
| 228 | Ga0157370_10436996 | 3300013104 | Bacteria | 1203 |
| 229 | Ga0157369_10019662 | 3300013105 | Bacteria | 7558 |
| 230 | Ga0157369_10262320 | 3300013105 | Unclassified | 1802 |
| 231 | Ga0157374_10064416 | 3300013296 | Bacteria | 3439 |
| 232 | Ga0157374_10237711 | 3300013296 | Bacteria | 1791 |
| 233 | Ga0157374_10323687 | 3300013296 | Bacteria | 1528 |
| 234 | Ga0157374_10856207 | 3300013296 | Bacteria | 926 |
| 235 | Ga0157378_10031720 | 3300013297 | Bacteria | 4667 |
| 236 | Ga0157378_10262800 | 3300013297 | Bacteria | 1657 |
| 237 | Ga0163162_10001289 | 3300013306 | Bacteria | 23440 |
| 238 | Ga0163162_10025926 | 3300013306 | Bacteria | 5793 |
| 239 | Ga0163162_10037581 | 3300013306 | Bacteria | 4832 |
| 240 | Ga0163162_10058035 | 3300013306 | Bacteria | 3899 |
| 241 | Ga0163162_10213986 | 3300013306 | Bacteria | 2057 |
| 242 | Ga0157372_10073761 | 3300013307 | Bacteria | 3847 |
| 243 | Ga0157372_10210225 | 3300013307 | Bacteria | 2255 |
| 244 | Ga0157375_10027128 | 3300013308 | Bacteria | 5349 |
| 245 | Ga0157375_10105113 | 3300013308 | Bacteria | 2913 |
| 246 | Ga0157375_10217118 | 3300013308 | Bacteria | 2070 |
| 247 | Ga0157375_10309222 | 3300013308 | Bacteria | 1745 |
| 248 | Ga0157375_10848143 | 3300013308 | Bacteria | 1060 |
| 249 | Ga0157375_10848814 | 3300013308 | Bacteria | 1060 |
| 250 | Ga0163163_10012452 | 3300014325 | Bacteria | 7750 |
| 251 | Ga0163163_10015743 | 3300014325 | Bacteria | 7003 |
| 252 | Ga0163163_10036565 | 3300014325 | Bacteria | 4771 |
| 253 | Ga0157380_10000649 | 3300014326 | Bacteria | 21499 |
| 254 | Ga0157380_10007255 | 3300014326 | Bacteria | 7863 |
| 255 | Ga0157380_10347264 | 3300014326 | Bacteria | 1387 |
| 256 | Ga0157380_11105320 | 3300014326 | Bacteria | 832 |
| 257 | Ga0157377_10139962 | 3300014745 | Bacteria | 1486 |
| 258 | Ga0157379_10003603 | 3300014968 | Bacteria | 13138 |
| 259 | Ga0157379_10556404 | 3300014968 | Unclassified | 1068 |
| 260 | Ga0157376_10021376 | 3300014969 | Bacteria | 5026 |
| 261 | Ga0157376_10040278 | 3300014969 | Bacteria | 3818 |
| 262 | Ga0157376_10069544 | 3300014969 | Bacteria | 2985 |
| 263 | Ga0182006_1031091 | 3300015261 | Bacteria | 2154 |
| 264 | Ga0182007_10000026 | 3300015262 | Bacteria | 168694 |
| 265 | Ga0182005_1000232 | 3300015265 | Bacteria | 36038 |
| 266 | Ga0182005_1001956 | 3300015265 | Bacteria | 7750 |
| 267 | Ga0163161_10059141 | 3300017792 | Bacteria | 2786 |
| 268 | Ga0163161_10179039 | 3300017792 | Bacteria | 1624 |
| 269 | Ga0209676_1000037 | 3300025292 | Bacteria | 457562 |
| 270 | Ga0209050_1020249 | 3300025298 | Bacteria | 2483 |
| 271 | Ga0209257_1054537 | 3300025304 | Bacteria | 1112 |
| 272 | Ga0207697_10116586 | 3300025315 | Bacteria | 1147 |
| 273 | Ga0207653_10093170 | 3300025885 | Bacteria | 1057 |
| 274 | Ga0207682_10005346 | 3300025893 | Bacteria | 5242 |
| 275 | Ga0207682_10010687 | 3300025893 | Bacteria | 3592 |
| 276 | Ga0207682_10250758 | 3300025893 | Bacteria | 824 |
| 277 | Ga0207692_10065041 | 3300025898 | Bacteria | 1901 |
| 278 | Ga0207688_10295376 | 3300025901 | Bacteria | 990 |
| 279 | Ga0207680_10041328 | 3300025903 | Bacteria | 2689 |
| 280 | Ga0207699_10000060 | 3300025906 | Bacteria | 90017 |
| 281 | Ga0207645_10179480 | 3300025907 | Unclassified | 1389 |
| 282 | Ga0207643_10009847 | 3300025908 | Bacteria | 5135 |
| 283 | Ga0207643_10011227 | 3300025908 | Bacteria | 4837 |
| 284 | Ga0207643_10033567 | 3300025908 | Bacteria | 2871 |
| 285 | Ga0207643_10037939 | 3300025908 | Bacteria | 2705 |
| 286 | Ga0207705_10269071 | 3300025909 | Bacteria | 1303 |
| 287 | Ga0207695_10376332 | 3300025913 | Bacteria | 1306 |
| 288 | Ga0207695_10412040 | 3300025913 | Bacteria | 1236 |
| 289 | Ga0207693_10433162 | 3300025915 | Bacteria | 1028 |
| 290 | Ga0207660_10041060 | 3300025917 | Bacteria | 3241 |
| 291 | Ga0207660_10201559 | 3300025917 | Unclassified | 1554 |
| 292 | Ga0207660_10216753 | 3300025917 | Bacteria | 1501 |
| 293 | Ga0207649_10097394 | 3300025920 | Bacteria | 1940 |
| 294 | Ga0207652_10051046 | 3300025921 | Bacteria | 3545 |
| 295 | Ga0207652_10304735 | 3300025921 | Bacteria | 1438 |
| 296 | Ga0207681_10000011 | 3300025923 | Bacteria | 366878 |
| 297 | Ga0207681_10024601 | 3300025923 | Bacteria | 3866 |
| 298 | Ga0207681_10062120 | 3300025923 | Bacteria | 2570 |
| 299 | Ga0207694_10074230 | 3300025924 | Bacteria | 2662 |
| 300 | Ga0207650_10009064 | 3300025925 | Bacteria | 6801 |
| 301 | Ga0207650_10256458 | 3300025925 | Bacteria | 1417 |
| 302 | Ga0207650_10286844 | 3300025925 | Bacteria | 1341 |
| 303 | Ga0207650_10624504 | 3300025925 | Bacteria | 907 |
| 304 | Ga0207659_10025093 | 3300025926 | Unclassified | 4000 |
| 305 | Ga0207659_10093684 | 3300025926 | Bacteria | 2248 |
| 306 | Ga0207659_10355045 | 3300025926 | Bacteria | 1217 |
| 307 | Ga0207659_10798669 | 3300025926 | Bacteria | 811 |
| 308 | Ga0207706_10001385 | 3300025933 | Bacteria | 24183 |
| 309 | Ga0207706_10057595 | 3300025933 | Bacteria | 3423 |
| 310 | Ga0207706_10481649 | 3300025933 | Bacteria | 1072 |
| 311 | Ga0207706_10603181 | 3300025933 | Bacteria | 943 |
| 312 | Ga0207686_10144633 | 3300025934 | Bacteria | 1648 |
| 313 | Ga0207709_10007927 | 3300025935 | Bacteria | 5884 |
| 314 | Ga0207670_10009435 | 3300025936 | Bacteria | 5571 |
| 315 | Ga0207670_10016897 | 3300025936 | Bacteria | 4398 |
| 316 | Ga0207669_10108738 | 3300025937 | Bacteria | 1852 |
| 317 | Ga0207669_10163967 | 3300025937 | Bacteria | 1573 |
| 318 | Ga0207669_10198891 | 3300025937 | Bacteria | 1453 |
| 319 | Ga0207669_10233072 | 3300025937 | Unclassified | 1359 |
| 320 | Ga0207704_10125858 | 3300025938 | Bacteria | 1764 |
| 321 | Ga0207704_10295843 | 3300025938 | Bacteria | 1238 |
| 322 | Ga0207691_10005061 | 3300025940 | Bacteria | 12720 |
| 323 | Ga0207691_10006675 | 3300025940 | Bacteria | 11133 |
| 324 | Ga0207691_10032630 | 3300025940 | Bacteria | 4854 |
| 325 | Ga0207691_10043973 | 3300025940 | Bacteria | 4113 |
| 326 | Ga0207691_10073274 | 3300025940 | Bacteria | 3088 |
| 327 | Ga0207691_10278727 | 3300025940 | Bacteria | 1439 |
| 328 | Ga0207691_10604571 | 3300025940 | Bacteria | 928 |
| 329 | Ga0207711_10027197 | 3300025941 | Bacteria | 4804 |
| 330 | Ga0207689_10306675 | 3300025942 | Bacteria | 1316 |
| 331 | Ga0207689_10549740 | 3300025942 | Bacteria | 970 |
| 332 | Ga0207651_10076331 | 3300025960 | Bacteria | 2395 |
| 333 | Ga0207651_10144680 | 3300025960 | Bacteria | 1841 |
| 334 | Ga0207651_10256096 | 3300025960 | Bacteria | 1434 |
| 335 | Ga0207651_10372154 | 3300025960 | Bacteria | 1209 |
| 336 | Ga0207651_10493050 | 3300025960 | Bacteria | 1058 |
| 337 | Ga0207651_10517926 | 3300025960 | Bacteria | 1033 |
| 338 | Ga0207712_10022995 | 3300025961 | Bacteria | 4110 |
| 339 | Ga0207712_10307779 | 3300025961 | Bacteria | 1303 |
| 340 | Ga0207668_10071822 | 3300025972 | Bacteria | 2474 |
| 341 | Ga0207668_10082099 | 3300025972 | Bacteria | 2340 |
| 342 | Ga0207668_10709348 | 3300025972 | Bacteria | 885 |
| 343 | Ga0207668_10763008 | 3300025972 | Bacteria | 854 |
| 344 | Ga0207658_10392418 | 3300025986 | Bacteria | 1218 |
| 345 | Ga0207677_10088295 | 3300026023 | Bacteria | 2247 |
| 346 | Ga0207703_10179185 | 3300026035 | Bacteria | 1869 |
| 347 | Ga0207703_10580614 | 3300026035 | Bacteria | 1059 |
| 348 | Ga0207639_10061673 | 3300026041 | Bacteria | 2897 |
| 349 | Ga0207639_10676695 | 3300026041 | Bacteria | 956 |
| 350 | Ga0207678_10371859 | 3300026067 | Bacteria | 1235 |
| 351 | Ga0207678_10596419 | 3300026067 | Bacteria | 968 |
| 352 | Ga0207708_10024778 | 3300026075 | Bacteria | 4539 |
| 353 | Ga0207708_10049180 | 3300026075 | Bacteria | 3210 |
| 354 | Ga0207708_10593091 | 3300026075 | Bacteria | 938 |
| 355 | Ga0207702_10530960 | 3300026078 | Bacteria | 1149 |
| 356 | Ga0207641_10101208 | 3300026088 | Bacteria | 2539 |
| 357 | Ga0207641_10164574 | 3300026088 | Bacteria | 2019 |
| 358 | Ga0207648_10007351 | 3300026089 | Bacteria | 10848 |
| 359 | Ga0207648_10010933 | 3300026089 | Bacteria | 8577 |
| 360 | Ga0207648_10014871 | 3300026089 | Bacteria | 7176 |
| 361 | Ga0207648_10047085 | 3300026089 | Bacteria | 3780 |
| 362 | Ga0207648_10190062 | 3300026089 | Bacteria | 1819 |
| 363 | Ga0207676_10021615 | 3300026095 | Bacteria | 4722 |
| 364 | Ga0207674_10296554 | 3300026116 | Bacteria | 1565 |
| 365 | Ga0207674_10347363 | 3300026116 | Bacteria | 1434 |
| 366 | Ga0207674_10353520 | 3300026116 | Bacteria | 1420 |
| 367 | Ga0207675_100001153 | 3300026118 | Bacteria | 26238 |
| 368 | Ga0207675_100001619 | 3300026118 | Bacteria | 22569 |
| 369 | Ga0207675_100001636 | 3300026118 | Bacteria | 22459 |
| 370 | Ga0207675_100009878 | 3300026118 | Bacteria | 8927 |
| 371 | Ga0207675_100012041 | 3300026118 | Bacteria | 8081 |
| 372 | Ga0207675_100020026 | 3300026118 | Bacteria | 6242 |
| 373 | Ga0207675_100113857 | 3300026118 | Bacteria | 2554 |
| 374 | Ga0207675_100174545 | 3300026118 | Bacteria | 2056 |
| 375 | Ga0207683_10006218 | 3300026121 | Bacteria | 10235 |
| 376 | Ga0207683_10006907 | 3300026121 | Bacteria | 9716 |
| 377 | Ga0209973_1008604 | 3300027252 | Unclassified | 1168 |
| 378 | Ga0209371_1000088 | 3300027312 | Bacteria | 174446 |
| 379 | Ga0209984_1000372 | 3300027424 | Bacteria | 4916 |
| 380 | Ga0209179_1001962 | 3300027512 | Bacteria | 2671 |
| 381 | Ga0209999_1010195 | 3300027543 | Bacteria | 1697 |
| 382 | Ga0209970_1004873 | 3300027614 | Bacteria | 2216 |
| 383 | Ga0209970_1009220 | 3300027614 | Bacteria | 1613 |
| 384 | Ga0210002_1000883 | 3300027617 | Bacteria | 4117 |
| 385 | Ga0209588_1015449 | 3300027671 | Bacteria | 2347 |
| 386 | Ga0209971_1001139 | 3300027682 | Bacteria | 6733 |
| 387 | Ga0209971_1017080 | 3300027682 | Bacteria | 1722 |
| 388 | Ga0209998_10000488 | 3300027717 | Bacteria | 10909 |
| 389 | Ga0209974_10002247 | 3300027876 | Bacteria | 7022 |
| 390 | Ga0209974_10063985 | 3300027876 | Bacteria | 1248 |
| 391 | Ga0207428_10032490 | 3300027907 | Bacteria | 4292 |
| 392 | Ga0207428_10053091 | 3300027907 | Bacteria | 3233 |
| 393 | Ga0207428_10055124 | 3300027907 | Bacteria | 3162 |
| 394 | Ga0207428_10217787 | 3300027907 | Bacteria | 1432 |
| 395 | Ga0207428_10218302 | 3300027907 | Bacteria | 1430 |
| 396 | Ga0207428_10240179 | 3300027907 | Unclassified | 1354 |
| 397 | Ga0265354_1001125 | 3300028016 | Bacteria | 4095 |
| 398 | Ga0265355_1002000 | 3300028036 | Bacteria | 1387 |
| 399 | Ga0268266_10001818 | 3300028379 | Bacteria | 24143 |
| 400 | Ga0268266_10040597 | 3300028379 | Bacteria | 3966 |
| 401 | Ga0268266_10042978 | 3300028379 | Bacteria | 3861 |
| 402 | Ga0268266_10046509 | 3300028379 | Bacteria | 3715 |
| 403 | Ga0268266_10242556 | 3300028379 | Bacteria | 1664 |
| 404 | Ga0268266_10245244 | 3300028379 | Bacteria | 1655 |
| 405 | Ga0268266_10599526 | 3300028379 | Bacteria | 1058 |
| 406 | Ga0268265_10007851 | 3300028380 | Bacteria | 7201 |
| 407 | Ga0268265_10035296 | 3300028380 | Bacteria | 3652 |
| 408 | Ga0268265_10052595 | 3300028380 | Bacteria | 3081 |
| 409 | Ga0268265_10172775 | 3300028380 | Bacteria | 1849 |
| 410 | Ga0268265_10265581 | 3300028380 | Bacteria | 1528 |
| 411 | Ga0268265_10398571 | 3300028380 | Bacteria | 1271 |
| 412 | Ga0268264_10011925 | 3300028381 | Bacteria | 7160 |
| 413 | Ga0268264_10043460 | 3300028381 | Bacteria | 3724 |
| 414 | Ga0268264_10093183 | 3300028381 | Bacteria | 2602 |
| 415 | Ga0268264_10411185 | 3300028381 | Bacteria | 1303 |
| 416 | Ga0268264_10641488 | 3300028381 | Bacteria | 1050 |
| 417 | Ga0265323_10018643 | 3300028653 | Bacteria | 2684 |
| 418 | Ga0307515_10061597 | 3300028794 | Bacteria | 5318 |
| 419 | Ga0268256_1000079 | 3300030500 | Bacteria | 174445 |
| 420 | Ga0265770_1000303 | 3300030878 | Bacteria | 6670 |
| 421 | Ga0265760_10000729 | 3300031090 | Bacteria | 9376 |
| 422 | Ga0265330_10027038 | 3300031235 | Bacteria | 2593 |
| 423 | Ga0265328_10002990 | 3300031239 | Bacteria | 7544 |
| 424 | Ga0265340_10110169 | 3300031247 | Bacteria | 1274 |
| 425 | Ga0265316_10246068 | 3300031344 | Bacteria | 1314 |
| 426 | Ga0307513_10009164 | 3300031456 | Bacteria | 12535 |
| 427 | Ga0307513_10018384 | 3300031456 | Bacteria | 8353 |
| 428 | Ga0307513_10507026 | 3300031456 | Bacteria | 923 |
| 429 | Ga0307509_10000917 | 3300031507 | Bacteria | 50450 |
| 430 | Ga0307509_10079049 | 3300031507 | Bacteria | 3406 |
| 431 | Ga0307408_100033275 | 3300031548 | Bacteria | 3601 |
| 432 | Ga0307408_100450584 | 3300031548 | Bacteria | 1116 |
| 433 | Ga0307508_10030002 | 3300031616 | Bacteria | 4915 |
| 434 | Ga0307508_10315645 | 3300031616 | Bacteria | 1155 |
| 435 | Ga0316576_10011259 | 3300031727 | Bacteria | 5852 |
| 436 | Ga0316576_10120140 | 3300031727 | Bacteria | 1972 |
| 437 | Ga0316578_10017805 | 3300031728 | Bacteria | 3876 |
| 438 | Ga0316578_10204827 | 3300031728 | Unclassified | 1187 |
| 439 | Ga0307405_10333863 | 3300031731 | Bacteria | 1163 |
| 440 | Ga0316577_10063038 | 3300031733 | Bacteria | 2070 |
| 441 | Ga0307413_10028003 | 3300031824 | Bacteria | 3131 |
| 442 | Ga0307413_10052318 | 3300031824 | Bacteria | 2465 |
| 443 | Ga0307413_10110128 | 3300031824 | Bacteria | 1842 |
| 444 | Ga0307413_10167757 | 3300031824 | Bacteria | 1550 |
| 445 | Ga0307413_10203426 | 3300031824 | Bacteria | 1432 |
| 446 | Ga0307413_10519207 | 3300031824 | Bacteria | 960 |
| 447 | Ga0307410_10010554 | 3300031852 | Bacteria | 5240 |
| 448 | Ga0307410_10047747 | 3300031852 | Bacteria | 2863 |
| 449 | Ga0307410_10126978 | 3300031852 | Bacteria | 1868 |
| 450 | Ga0307410_10189512 | 3300031852 | Bacteria | 1563 |
| 451 | Ga0307410_10749127 | 3300031852 | Bacteria | 827 |
| 452 | Ga0307406_10125172 | 3300031901 | Bacteria | 1794 |
| 453 | Ga0307406_10614494 | 3300031901 | Bacteria | 898 |
| 454 | Ga0307407_10056575 | 3300031903 | Bacteria | 2272 |
| 455 | Ga0307407_10118171 | 3300031903 | Bacteria | 1676 |
| 456 | Ga0307407_10197336 | 3300031903 | Unclassified | 1346 |
| 457 | Ga0307407_10230918 | 3300031903 | Bacteria | 1257 |
| 458 | Ga0307407_10256096 | 3300031903 | Unclassified | 1202 |
| 459 | Ga0307407_10460577 | 3300031903 | Bacteria | 925 |
| 460 | Ga0307412_10019465 | 3300031911 | Bacteria | 4112 |
| 461 | Ga0307412_10045139 | 3300031911 | Bacteria | 2879 |
| 462 | Ga0307412_10189210 | 3300031911 | Bacteria | 1555 |
| 463 | Ga0307412_10200582 | 3300031911 | Bacteria | 1515 |
| 464 | Ga0307409_100003347 | 3300031995 | Bacteria | 8683 |
| 465 | Ga0307409_100016236 | 3300031995 | Bacteria | 4919 |
| 466 | Ga0307409_100160646 | 3300031995 | Bacteria | 1964 |
| 467 | Ga0307409_100301890 | 3300031995 | Bacteria | 1490 |
| 468 | Ga0307416_100393669 | 3300032002 | Bacteria | 1420 |
| 469 | Ga0307416_100545103 | 3300032002 | Bacteria | 1232 |
| 470 | Ga0307416_100876231 | 3300032002 | Bacteria | 997 |
| 471 | Ga0307414_10068010 | 3300032004 | Bacteria | 2554 |
| 472 | Ga0307414_10210782 | 3300032004 | Bacteria | 1588 |
| 473 | Ga0307414_10420650 | 3300032004 | Bacteria | 1165 |
| 474 | Ga0307411_10125570 | 3300032005 | Bacteria | 1865 |
| 475 | Ga0307411_10313493 | 3300032005 | Bacteria | 1263 |
| 476 | Ga0307411_10346498 | 3300032005 | Bacteria | 1209 |
| 477 | Ga0307411_10384073 | 3300032005 | Unclassified | 1156 |
| 478 | Ga0307411_10407819 | 3300032005 | Bacteria | 1125 |
| 479 | Ga0307415_100062571 | 3300032126 | Bacteria | 2582 |
| 480 | Ga0307415_100721902 | 3300032126 | Bacteria | 902 |
| 481 | Ga0316585_10010275 | 3300032137 | Bacteria | 2745 |
| 482 | Ga0316580_10017135 | 3300032139 | Bacteria | 2226 |
| 483 | Ga0373929_0000013 | 3300035085 | Bacteria | 159542 |
| 484 | Ga0373923_0113113 | 3300035111 | Bacteria | 1207 |
| 485 | Ga0373923_0116849 | 3300035111 | Bacteria | 1189 |
| 486 | Ga0373936_0142304 | 3300035113 | Bacteria | 1036 |
| 487 | Ga0373954_0190878 | 3300035118 | Bacteria | 1006 |
| 488 | Ga0316574_0000082 | 3300035398 | Bacteria | 26722 |
| 489 | Ga0316574_0051564 | 3300035398 | Bacteria | 2564 |
| 490 | Ga0316574_0077286 | 3300035398 | Bacteria | 2109 |
| 491 | Ga0373924_0258821 | 3300035410 | Bacteria | 771 |
| 492 | Ga0373935_0242959 | 3300035692 | Bacteria | 1258 |
| 493 | Ga0373927_0482534 | 3300035695 | Bacteria | 819 |
| 494 | Ga0373933_0051323 | 3300035724 | Bacteria | 2465 |
| 495 | Ga0373933_0151508 | 3300035724 | Bacteria | 1469 |
| 496 | Ga0373937_0049317 | 3300036401 | Bacteria | 3856 |
| 497 | Ga0373937_0072428 | 3300036401 | Unclassified | 3178 |
| 498 | Ga0373937_0172859 | 3300036401 | Bacteria | 2027 |
| 499 | Ga0316582_0053817 | 3300036647 | Bacteria | 2561 |
| 500 | Ga0316584_0015059 | 3300036712 | Bacteria | 5525 |
| 501 | Ga0316584_0278764 | 3300036712 | Bacteria | 1215 |
| 502 | Ga0373925_0128677 | 3300037068 | Bacteria | 1972 |
| 503 | Ga0395900_0086081 | 3300037418 | Bacteria | 3230 |
| 504 | Ga0395900_0320964 | 3300037418 | Bacteria | 1529 |
| 505 | Ga0439461_0031014 | 3300041410 | Bacteria | 1114 |
| 506 | Ga0451789_0547898 | 3300041443 | Bacteria | 852 |
| 507 | Ga0451793_0183807 | 3300041452 | Bacteria | 1589 |
| 508 | Ga0451793_0710391 | 3300041452 | Bacteria | 1193 |
| 509 | Ga0451797_0052733 | 3300041453 | Bacteria | 1043 |
| 510 | Ga0451798_1030345 | 3300041458 | Bacteria | 1641 |
| 511 | Ga0451800_0240496 | 3300041459 | Bacteria | 8749 |
| 512 | Ga0451802_0719910 | 3300041460 | Bacteria | 2349 |
| 513 | Ga0451802_1128143 | 3300041460 | Bacteria | 2954 |
| 514 | Ga0451806_181564 | 3300041462 | Bacteria | 4991 |
| 515 | Ga0451804_0695803 | 3300041463 | Bacteria | 1265 |
| 516 | Ga0451807_0587428 | 3300041486 | Bacteria | 3919 |
| 517 | Ga0451807_1394934 | 3300041486 | Bacteria | 1576 |
| 518 | Ga0451837_1124078 | 3300041494 | Bacteria | 1232 |
| 519 | Ga0451853_2462324 | 3300041512 | Bacteria | 1027 |
| 520 | Ga0439441_002426 | 3300042001 | Bacteria | 2625 |
| 521 | Ga0439442_025811 | 3300042002 | Bacteria | 1223 |
| 522 | Ga0439443_003965 | 3300042003 | Bacteria | 1902 |
| 523 | Ga0439457_027137 | 3300042014 | Bacteria | 1268 |
| 524 | Ga0450913_006547 | 3300042117 | Bacteria | 857 |
| 525 | Ga0450920_016177 | 3300042122 | Bacteria | 1421 |
| 526 | Ga0450923_000826 | 3300042125 | Bacteria | 3739 |
| 527 | Ga0450923_046524 | 3300042125 | Bacteria | 924 |
| 528 | Ga0450892_013414 | 3300042130 | Bacteria | 747 |
| 529 | Ga0450894_015048 | 3300042131 | Unclassified | 1024 |
| 530 | Ga0450910_008021 | 3300042147 | Bacteria | 1481 |
| 531 | Ga0439446_0003583 | 3300042156 | Bacteria | 3868 |
| 532 | Ga0450908_001374 | 3300042184 | Bacteria | 4718 |
| 533 | Ga0450908_008072 | 3300042184 | Bacteria | 1974 |
| 534 | Ga0439434_0012512 | 3300042435 | Bacteria | 2510 |
| 535 | Ga0439434_0020238 | 3300042435 | Bacteria | 1997 |
| 536 | Ga0439435_0010756 | 3300042436 | Bacteria | 2180 |
| 537 | Ga0439444_0002654 | 3300042437 | Bacteria | 2464 |
| 538 | Ga0439459_0050476 | 3300042438 | Bacteria | 912 |
| 539 | Ga0439459_0057928 | 3300042438 | Bacteria | 868 |
| 540 | Ga0439464_0054312 | 3300042439 | Bacteria | 1164 |
| 541 | Ga0451577_0004168 | 3300042876 | Bacteria | 15459 |
| 542 | Ga0451577_0019662 | 3300042876 | Bacteria | 6207 |
| 543 | Ga0451577_0064759 | 3300042876 | Bacteria | 3259 |
| 544 | Ga0451577_0087073 | 3300042876 | Bacteria | 2787 |
| 545 | Ga0451577_0115667 | 3300042876 | Bacteria | 2402 |
| 546 | Ga0451577_0133790 | 3300042876 | Bacteria | 2225 |
| 547 | Ga0451577_0388112 | 3300042876 | Bacteria | 1267 |
| 548 | Ga0453683_0004351 | 3300044673 | Bacteria | 10083 |
| 549 | Ga0453684_0011204 | 3300044712 | Bacteria | 15096 |
| 550 | Ga0453684_0070049 | 3300044712 | Bacteria | 4443 |
| 551 | Ga0453684_0111257 | 3300044712 | Bacteria | 3327 |
| 552 | Ga0451576_0018930 | 3300045051 | Bacteria | 7524 |
| 553 | Ga0451576_0035970 | 3300045051 | Bacteria | 5252 |
| 554 | Ga0451576_0084585 | 3300045051 | Bacteria | 3300 |
| 555 | Ga0451576_0682027 | 3300045051 | Bacteria | 1080 |
| 556 | Ga0466967_0084948 | 3300045976 | Bacteria | 2865 |
| 557 | Ga0466967_0267970 | 3300045976 | Bacteria | 1636 |
| 558 | Ga0495591_062448 | 3300046458 | Bacteria | 986 |
| 559 | Ga0495629_0162345 | 3300046459 | Unclassified | 1552 |
| 560 | Ga0495638_0003097 | 3300046460 | Bacteria | 13188 |
| 561 | Ga0495638_0004722 | 3300046460 | Bacteria | 10293 |
| 562 | Ga0495641_0082501 | 3300046461 | Unclassified | 1439 |
| 563 | Ga0495580_0121422 | 3300046472 | Bacteria | 1814 |
| 564 | Ga0495580_0239364 | 3300046472 | Bacteria | 1245 |
| 565 | Ga0495639_0264687 | 3300046475 | Bacteria | 852 |
| 566 | Ga0495662_0152760 | 3300046476 | Bacteria | 1137 |
| 567 | Ga0495594_0236721 | 3300046499 | Unclassified | 1041 |
| 568 | Ga0495596_0116669 | 3300046500 | Bacteria | 1037 |
| 569 | Ga0495620_0040095 | 3300046515 | Unclassified | 2064 |
| 570 | Ga0495644_0087007 | 3300046523 | Bacteria | 1178 |
| 571 | Ga0495663_0014292 | 3300046525 | Bacteria | 2224 |
| 572 | Ga0495621_0000461 | 3300046539 | Bacteria | 9955 |
| 573 | Ga0495633_0025356 | 3300046558 | Bacteria | 2920 |
| 574 | Ga0495633_0137794 | 3300046558 | Bacteria | 1129 |
| 575 | Ga0495668_0000301 | 3300046616 | Bacteria | 68097 |
| 576 | Ga0495611_0147289 | 3300046648 | Bacteria | 1099 |
| 577 | Ga0495625_0004196 | 3300046660 | Bacteria | 13729 |
| 578 | Ga0495625_0006418 | 3300046660 | Bacteria | 10476 |
| 579 | Ga0495635_0280715 | 3300046663 | Bacteria | 1119 |
| 580 | Ga0495647_0008140 | 3300046681 | Bacteria | 3524 |
| 581 | Ga0495647_0130099 | 3300046681 | Bacteria | 1066 |
| 582 | Ga0495658_0008463 | 3300046683 | Bacteria | 5099 |
| 583 | Ga0495649_0006367 | 3300046694 | Bacteria | 7347 |
| 584 | Ga0495600_0417447 | 3300046809 | Bacteria | 833 |
| 585 | Ga0495604_0159213 | 3300047317 | Bacteria | 1597 |
| 586 | Ga0495672_0053133 | 3300047320 | Bacteria | 2376 |
| 587 | Ga0495672_0209160 | 3300047320 | Bacteria | 970 |
| 588 | Ga0495680_0022654 | 3300047322 | Bacteria | 5233 |
| 589 | Ga0495686_0086557 | 3300047472 | Bacteria | 1907 |
| 590 | Ga0495686_0128273 | 3300047472 | Bacteria | 1506 |
| 591 | Ga0495615_0094842 | 3300048090 | Bacteria | 836 |
| 592 | Ga0496100_0088027 | 3300048903 | Bacteria | 2113 |
| 593 | Ga0496101_0210322 | 3300048904 | Bacteria | 1507 |
| 594 | Ga0496101_0675608 | 3300048904 | Bacteria | 816 |
| 595 | Ga0496104_0027158 | 3300048907 | Bacteria | 5295 |
| 596 | Ga0496104_0141811 | 3300048907 | Bacteria | 2309 |
| 597 | Ga0496104_0278849 | 3300048907 | Bacteria | 1584 |
| 598 | Ga0496105_0005317 | 3300048908 | Bacteria | 9757 |
| 599 | Ga0496107_0087823 | 3300048910 | Bacteria | 2270 |
| 600 | Ga0496108_0103481 | 3300048911 | Bacteria | 2429 |
| 601 | Ga0496109_0093010 | 3300048912 | Bacteria | 2789 |
| 602 | Ga0496110_0014082 | 3300048913 | Bacteria | 6630 |
| 603 | Ga0496110_0298768 | 3300048913 | Bacteria | 1467 |
| 604 | Ga0496111_0036773 | 3300048914 | Bacteria | 3502 |
| 605 | Ga0496114_0000012 | 3300048917 | Bacteria | 347477 |
| 606 | Ga0496114_0004286 | 3300048917 | Bacteria | 11042 |
| 607 | Ga0496114_0055180 | 3300048917 | Bacteria | 3314 |
| 608 | Ga0496115_0028254 | 3300048918 | Bacteria | 4395 |
| 609 | Ga0496118_0133750 | 3300048921 | Bacteria | 1586 |
| 610 | Ga0496118_0165031 | 3300048921 | Bacteria | 1362 |
| 611 | Ga0496119_0000654 | 3300048922 | Bacteria | 46601 |
| 612 | Ga0496120_0002845 | 3300048923 | Bacteria | 16670 |
| 613 | Ga0496121_0195671 | 3300048924 | Unclassified | 1445 |
| 614 | Ga0496124_0039548 | 3300048927 | Bacteria | 4087 |
| 615 | Ga0496124_0061500 | 3300048927 | Bacteria | 3147 |
| 616 | Ga0496124_0251499 | 3300048927 | Bacteria | 1307 |
| 617 | Ga0496125_0036816 | 3300048928 | Bacteria | 4264 |
| 618 | Ga0496126_0003314 | 3300048929 | Bacteria | 20493 |
| 619 | Ga0496126_0025761 | 3300048929 | Bacteria | 5651 |
| 620 | Ga0501299_003641 | 3300049522 | Bacteria | 2248 |
| 621 | Ga0501032_0071060 | 3300049569 | Bacteria | 2320 |
| 622 | Ga0501032_0249330 | 3300049569 | Bacteria | 1153 |
| 623 | Ga0501032_0435885 | 3300049569 | Bacteria | 840 |
| 624 | Ga0501034_0002645 | 3300049571 | Bacteria | 21210 |
| 625 | Ga0501034_0227623 | 3300049571 | Unclassified | 1815 |
| 626 | Ga0501034_0736583 | 3300049571 | Bacteria | 882 |
| 627 | Ga0501036_0030507 | 3300049572 | Bacteria | 4553 |
| 628 | Ga0501036_0466258 | 3300049572 | Bacteria | 1052 |
| 629 | Ga0501037_0105310 | 3300049573 | Bacteria | 2033 |
| 630 | Ga0501037_0282802 | 3300049573 | Bacteria | 1155 |
| 631 | Ga0501037_0416732 | 3300049573 | Bacteria | 920 |
| 632 | Ga0501038_0025830 | 3300049574 | Bacteria | 5233 |
| 633 | Ga0501038_0298140 | 3300049574 | Bacteria | 1266 |
| 634 | Ga0501038_0567121 | 3300049574 | Bacteria | 862 |
| 635 | Ga0501039_0044409 | 3300049575 | Bacteria | 3432 |
| 636 | Ga0501040_0055542 | 3300049576 | Bacteria | 2715 |
| 637 | Ga0501040_0084697 | 3300049576 | Bacteria | 2200 |
| 638 | Ga0501040_0146277 | 3300049576 | Bacteria | 1666 |
| 639 | Ga0501040_0322245 | 3300049576 | Bacteria | 1105 |
| 640 | Ga0501042_0133158 | 3300049578 | Bacteria | 1792 |
| 641 | Ga0501042_0213609 | 3300049578 | Bacteria | 1391 |
| 642 | Ga0501042_0289518 | 3300049578 | Bacteria | 1183 |
| 643 | Ga0501042_0345422 | 3300049578 | Bacteria | 1076 |
| 644 | Ga0501046_0527008 | 3300049580 | Bacteria | 844 |
| 645 | Ga0501047_0064156 | 3300049581 | Bacteria | 3543 |
| 646 | Ga0501048_0107002 | 3300049582 | Bacteria | 1974 |
| 647 | Ga0501067_0146389 | 3300049583 | Bacteria | 1316 |
| 648 | Ga0501068_0003038 | 3300049584 | Bacteria | 8961 |
| 649 | Ga0501068_0005358 | 3300049584 | Bacteria | 7011 |
| 650 | Ga0501068_0232203 | 3300049584 | Bacteria | 1173 |
| 651 | Ga0501068_0442858 | 3300049584 | Bacteria | 840 |
| 652 | Ga0501069_0153267 | 3300049585 | Bacteria | 1325 |
| 653 | Ga0501069_0168442 | 3300049585 | Bacteria | 1263 |
| 654 | Ga0501070_0162762 | 3300049586 | Bacteria | 1839 |
| 655 | Ga0501071_0018970 | 3300049587 | Bacteria | 4771 |
| 656 | Ga0501072_0035075 | 3300049588 | Bacteria | 3932 |
| 657 | Ga0501072_0233419 | 3300049588 | Bacteria | 1465 |
| 658 | Ga0501073_0006306 | 3300049589 | Bacteria | 8835 |
| 659 | Ga0501073_0018770 | 3300049589 | Bacteria | 4999 |
| 660 | Ga0501074_0006860 | 3300049590 | Bacteria | 8224 |
| 661 | Ga0501074_0085123 | 3300049590 | Bacteria | 2266 |
| 662 | Ga0501075_0115272 | 3300049591 | Bacteria | 2043 |
| 663 | Ga0501075_0159984 | 3300049591 | Bacteria | 1718 |
| 664 | Ga0501075_0212097 | 3300049591 | Bacteria | 1477 |
| 665 | Ga0501076_0109772 | 3300049592 | Bacteria | 2230 |
| 666 | Ga0501076_0166659 | 3300049592 | Bacteria | 1796 |
| 667 | Ga0501076_0222785 | 3300049592 | Bacteria | 1541 |
| 668 | Ga0501076_0250935 | 3300049592 | Bacteria | 1448 |
| 669 | Ga0501077_0000284 | 3300049593 | Bacteria | 30131 |
| 670 | Ga0501077_0058480 | 3300049593 | Bacteria | 2447 |
| 671 | Ga0501079_0181059 | 3300049741 | Bacteria | 1644 |
| 672 | Ga0501079_0619433 | 3300049741 | Bacteria | 852 |
| 673 | Ga0501080_0002960 | 3300049742 | Bacteria | 14936 |
| 674 | Ga0501080_0005108 | 3300049742 | Bacteria | 11690 |
| 675 | Ga0501080_0018349 | 3300049742 | Bacteria | 6475 |
| 676 | Ga0501080_0118364 | 3300049742 | Bacteria | 2456 |
| 677 | Ga0501081_0008371 | 3300049743 | Bacteria | 6713 |
| 678 | Ga0501081_0526982 | 3300049743 | Bacteria | 881 |
| 679 | Ga0501083_0006836 | 3300049744 | Bacteria | 8097 |
| 680 | Ga0501083_0044268 | 3300049744 | Bacteria | 3013 |
| 681 | Ga0501035_0150709 | 3300049822 | Bacteria | 2018 |
| 682 | Ga0501035_0444214 | 3300049822 | Bacteria | 1074 |
| 683 | Ga0501045_0123450 | 3300049824 | Bacteria | 1923 |
| 684 | Ga0501045_0125573 | 3300049824 | Bacteria | 1906 |
| 685 | nmdc:mga0k408_14294_c1 | 3300050493 | Bacteria | 4370 |
| 686 | nmdc:mga05p37_16649_c1 | 3300050507 | Bacteria | 8856 |
| 687 | nmdc:mga09592_111787_c1 | 3300050508 | Unclassified | 2344 |
| 688 | nmdc:mga09592_210152_c1 | 3300050508 | Bacteria | 1686 |
| 689 | nmdc:mga09592_21800_c1 | 3300050508 | Bacteria | 5282 |
| 690 | nmdc:mga09592_26339_c1 | 3300050508 | Bacteria | 4817 |
| 691 | nmdc:mga09592_99994_c1 | 3300050508 | Bacteria | 2483 |
| 692 | nmdc:mga0qj67_107240_c1 | 3300050509 | Unclassified | 2253 |
| 693 | nmdc:mga0qj67_12212_c1 | 3300050509 | Bacteria | 6465 |
| 694 | nmdc:mga0qj67_17995_c1 | 3300050509 | Bacteria | 5381 |
| 695 | nmdc:mga0qj67_18857_c1 | 3300050509 | Bacteria | 5263 |
| 696 | nmdc:mga0qj67_21133_c1 | 3300050509 | Bacteria | 4991 |
| 697 | nmdc:mga06r32_1582_c1 | 3300050510 | Bacteria | 20519 |
| 698 | nmdc:mga06r32_181759_c1 | 3300050510 | Bacteria | 2089 |
| 699 | nmdc:mga06r32_18542_c1 | 3300050510 | Bacteria | 6374 |
| 700 | nmdc:mga06r32_4811_c1 | 3300050510 | Bacteria | 12154 |
| 701 | nmdc:mga06r32_5847_c1 | 3300050510 | Bacteria | 11070 |
| 702 | nmdc:mga08y16_11594_c1 | 3300050511 | Bacteria | 9263 |
| 703 | nmdc:mga08y16_126944_c1 | 3300050511 | Bacteria | 2653 |
| 704 | nmdc:mga08y16_135236_c1 | 3300050511 | Bacteria | 2562 |
| 705 | nmdc:mga08y16_165697_c1 | 3300050511 | Bacteria | 2296 |
| 706 | nmdc:mga08y16_203617_c1 | 3300050511 | Bacteria | 2051 |
| 707 | nmdc:mga08y16_23930_c1 | 3300050511 | Bacteria | 6450 |
| 708 | nmdc:mga08y16_328726_c1 | 3300050511 | Bacteria | 1573 |
| 709 | nmdc:mga08y16_43919_c1 | 3300050511 | Bacteria | 4683 |
| 710 | nmdc:mga08y16_897251_c1 | 3300050511 | Bacteria | 873 |
| 711 | nmdc:mga0n895_12548_c1 | 3300050512 | Bacteria | 7603 |
| 712 | nmdc:mga0rr50_22787_c1 | 3300050513 | Bacteria | 4304 |
| 713 | nmdc:mga0a205_13295_c2 | 3300050515 | Bacteria | 6774 |
| 714 | nmdc:mga0a205_292515_c1 | 3300050515 | Bacteria | 1503 |
| 715 | nmdc:mga0a205_471083_c1 | 3300050515 | Bacteria | 1115 |
| 716 | Ga0495601_0230812 | 3300053077 | Bacteria | 1209 |
| 717 | Ga0495619_0360865 | 3300053085 | Bacteria | 1005 |
| 718 | Ga0500578_0000131 | 3300053086 | Bacteria | 89434 |
| 719 | Ga0500644_0048730 | 3300053088 | Bacteria | 1443 |
| 720 | Ga0500646_0006436 | 3300053090 | Bacteria | 2987 |
| 721 | Ga0500651_0067147 | 3300053093 | Bacteria | 2233 |
| 722 | Ga0500566_0270225 | 3300053094 | Bacteria | 816 |
| 723 | Ga0500641_0001484 | 3300053096 | Bacteria | 8369 |
| 724 | Ga0500556_0043776 | 3300053104 | Bacteria | 1591 |
| 725 | Ga0500652_058290 | 3300053131 | Bacteria | 1586 |
| 726 | Ga0500658_0038616 | 3300053134 | Bacteria | 1904 |
| 727 | Ga0500559_0037976 | 3300053136 | Bacteria | 2090 |
| 728 | Ga0500568_0014985 | 3300053139 | Bacteria | 3480 |
| 729 | Ga0500568_0094871 | 3300053139 | Bacteria | 1123 |
| 730 | Ga0500604_0003185 | 3300053151 | Unclassified | 4410 |
| 731 | Ga0500622_0000006 | 3300053156 | Bacteria | 464021 |
| 732 | Ga0500622_0000213 | 3300053156 | Bacteria | 61430 |
| 733 | Ga0500622_0001608 | 3300053156 | Bacteria | 17744 |
| 734 | Ga0500622_0010663 | 3300053156 | Bacteria | 5030 |
| 735 | Ga0500627_0114584 | 3300053158 | Unclassified | 1214 |
| 736 | Ga0500637_0009124 | 3300053178 | Bacteria | 5035 |
| 737 | Ga0501084_0010970 | 3300054114 | Bacteria | 7505 |
| 738 | Ga0501084_0038822 | 3300054114 | Bacteria | 3981 |
| 739 | Ga0501084_0202090 | 3300054114 | Bacteria | 1677 |
| 740 | Ga0590071_080189 | 3300059421 | Bacteria | 811 |
| 741 | Ga0501082_0000011 | 3300060353 | Bacteria | 121336 |
| 742 | Ga0501082_0007297 | 3300060353 | Bacteria | 9536 |
| 743 | Ga0501082_0181969 | 3300060353 | Bacteria | 1828 |
| 744 | Ga0530510_0032713 | 3300061734 | Bacteria | 3743 |
| 745 | Ga0530510_0046251 | 3300061734 | Bacteria | 3144 |
| 746 | Ga0530510_0352649 | 3300061734 | Bacteria | 1105 |
| 747 | Ga0530510_0442852 | 3300061734 | Bacteria | 982 |
| 748 | Ga0530510_0734589 | 3300061734 | Bacteria | 753 |
| 749 | 2525558092 | 2524614729 | Bacteria | 3091755 |
| 750 | 2547501404 | 2547132130 | Bacteria | 4660562 |
| 751 | 2578457287 | 2576861471 | Bacteria | 4648976 |
| 752 | 2630649895 | 2627854209 | Bacteria | 3093011 |
| 753 | 2747949418 | 2747842428 | Bacteria | 4689383 |
| 754 | 2765580203 | 2765235840 | Bacteria | 4663337 |
| 755 | 2819660884 | 2818991457 | Bacteria | 5323295 |
| 756 | 2842759981 | 2842757796 | Bacteria | 3981385 |
| 757 | 2852652403 | 2852649853 | Bacteria | 4036942 |
| 758 | 2852686760 | 2852684882 | Bacteria | 5463342 |
| 759 | 2914759885 | 2914759650 | Bacteria | 4701441 |
| 760 | 2919134034 | 2919130084 | Bacteria | 5301837 |
| 761 | 2919137780 | 2919134579 | Bacteria | 4480386 |
| 762 | 2923519394 | 2923516293 | Bacteria | 3716336 |
| 763 | 2929196684 | 2929195423 | Bacteria | 5325372 |
| 764 | 2941479022 | 2941475908 | Bacteria | 4145589 |
| 765 | 8003015161 | 8003014200 | Bacteria | 4059994 |
| 766 | 8021623627 | 8021622325 | Bacteria | 4844743 |
| 767 | 8021627451 | 8021626552 | Bacteria | 4665214 |
| 768 | 8021650582 | 8021648035 | Bacteria | 4772378 |
| 769 | Ga0373937_0409349 | |||
| 770 | SwRhRL2b_contig_857857 | |||
| 771 | JGI24744J21845_10011345 | |||
| 772 | rootH1_10000284 | |||
| 773 | rootH2_10088031 | |||
| 774 | rootL2_10038226 | |||
| 775 | rootL2_10118395 | |||
| 776 | rootH1_10059569 | |||
| 777 | Ga0055536_1007237 | |||
| 778 | Ga0058692_1000033 | |||
| 779 | Ga0065704_10000377 | |||
| 780 | Ga0065704_10004068 | |||
| 781 | Ga0065704_10141904 | |||
| 782 | Ga0065707_10092373 | |||
| 783 | Ga0070658_10062502 | |||
| 784 | Ga0070690_100118984 | |||
| 785 | Ga0070670_100014994 | |||
| 786 | Ga0070670_100484579 | |||
| 787 | Ga0070670_100499455 | |||
| 788 | Ga0070670_100536268 | |||
| 789 | Ga0068869_100270298 | |||
| 790 | Ga0070666_10019216 | |||
| 791 | Ga0070666_10052239 | |||
| 792 | Ga0070680_100074940 | |||
| 793 | Ga0070680_100180567 | |||
| 794 | Ga0070682_100059298 | |||
| 795 | Ga0068868_100016001 | |||
| 796 | Ga0070660_100686634 | |||
| 797 | Ga0070689_100249865 | |||
| 798 | Ga0070689_100261834 | |||
| 799 | Ga0070687_100161397 | |||
| 800 | Ga0070661_100018082 | |||
| 801 | Ga0070692_10058900 | |||
| 802 | Ga0070668_100003484 | |||
| 803 | Ga0070668_100143434 | |||
| 804 | Ga0070668_100281641 | |||
| 805 | Ga0070669_100000010 | |||
| 806 | Ga0070669_100007130 | |||
| 807 | Ga0070669_100027116 | |||
| 808 | Ga0070669_100062248 | |||
| 809 | Ga0070669_100407993 | |||
| 810 | Ga0070675_100014637 | |||
| 811 | Ga0070675_100042910 | |||
| 812 | Ga0070675_100045587 | |||
| 813 | Ga0070675_100203992 | |||
| 814 | Ga0070671_100040061 | |||
| 815 | Ga0070671_100277291 | |||
| 816 | Ga0070674_100027099 | |||
| 817 | Ga0070674_100183113 | |||
| 818 | Ga0070674_100249179 | |||
| 819 | Ga0070674_100370956 | |||
| 820 | Ga0070674_100653496 | |||
| 821 | Ga0070673_100066843 | |||
| 822 | Ga0070673_100295350 | |||
| 823 | Ga0070688_100042495 | |||
| 824 | Ga0070688_100192851 | |||
| 825 | Ga0070688_100279620 | |||
| 826 | Ga0070667_100001093 | |||
| 827 | Ga0070667_100101567 | |||
| 828 | Ga0070667_100292567 | |||
| 829 | Ga0070667_100298619 | |||
| 830 | Ga0070703_10058983 | |||
| 831 | Ga0070709_10000052 | |||
| 832 | Ga0070709_10239341 | |||
| 833 | Ga0070701_10015140 | |||
| 834 | Ga0070701_10075654 | |||
| 835 | Ga0070701_10462321 | |||
| 836 | Ga0070705_100002598 | |||
| 837 | Ga0070700_100012135 | |||
| 838 | Ga0070700_100065934 | |||
| 839 | Ga0070700_100106612 | |||
| 840 | Ga0070694_100162670 | |||
| 841 | Ga0070694_100296575 | |||
| 842 | Ga0070708_100059240 | |||
| 843 | Ga0070663_100512746 | |||
| 844 | Ga0070678_100025822 | |||
| 845 | Ga0070678_100086028 | |||
| 846 | Ga0070662_100004289 | |||
| 847 | Ga0070662_100181647 | |||
| 848 | Ga0070681_10118926 | |||
| 849 | Ga0068867_100008692 | |||
| 850 | Ga0068867_100076250 | |||
| 851 | Ga0068867_100101523 | |||
| 852 | Ga0068867_100121848 | |||
| 853 | Ga0068867_100292275 | |||
| 854 | Ga0070685_10011642 | |||
| 855 | Ga0070706_100190772 | |||
| 856 | Ga0070698_100772589 | |||
| 857 | Ga0070679_100042566 | |||
| 858 | Ga0070684_100037966 | |||
| 859 | Ga0068853_100278159 | |||
| 860 | Ga0070672_100016034 | |||
| 861 | Ga0070672_100025797 | |||
| 862 | Ga0070672_100057751 | |||
| 863 | Ga0070672_100140589 | |||
| 864 | Ga0070672_100617879 | |||
| 865 | Ga0070686_100069479 | |||
| 866 | Ga0070695_100089407 | |||
| 867 | Ga0070696_100019044 | |||
| 868 | Ga0070665_100006995 | |||
| 869 | Ga0070665_100019521 | |||
| 870 | Ga0070665_100067071 | |||
| 871 | Ga0070665_100075009 | |||
| 872 | Ga0070665_100266124 | |||
| 873 | Ga0070665_100441307 | |||
| 874 | Ga0070704_100004298 | |||
| 875 | Ga0070704_100160662 | |||
| 876 | Ga0070704_100242065 | |||
| 877 | Ga0070664_100104009 | |||
| 878 | Ga0068857_100277286 | |||
| 879 | Ga0068857_100293737 | |||
| 880 | Ga0068856_100123837 | |||
| 881 | Ga0070702_100004301 | |||
| 882 | Ga0068859_100009838 | |||
| 883 | Ga0068859_100167266 | |||
| 884 | Ga0068859_100189176 | |||
| 885 | Ga0068864_100018642 | |||
| 886 | Ga0068864_100405247 | |||
| 887 | Ga0068864_100461066 | |||
| 888 | Ga0068861_100000527 | |||
| 889 | Ga0068861_100003035 | |||
| 890 | Ga0068861_100006749 | |||
| 891 | Ga0068861_100024936 | |||
| 892 | Ga0068861_100212659 | |||
| 893 | Ga0068861_100473530 | |||
| 894 | Ga0068870_10005087 | |||
| 895 | Ga0068870_10214234 | |||
| 896 | Ga0068863_100005076 | |||
| 897 | Ga0068863_100350956 | |||
| 898 | Ga0068863_100470753 | |||
| 899 | Ga0068858_100056981 | |||
| 900 | Ga0068860_100003807 | |||
| 901 | Ga0068860_100022709 | |||
| 902 | Ga0068860_100046759 | |||
| 903 | Ga0068860_100343893 | |||
| 904 | Ga0068862_100000397 | |||
| 905 | Ga0068862_100035410 | |||
| 906 | Ga0068862_100045592 | |||
| 907 | Ga0068862_100079883 | |||
| 908 | Ga0068862_100095027 | |||
| 909 | Ga0068862_100098520 | |||
| 910 | Ga0068862_100116080 | |||
| 911 | Ga0068862_100180405 | |||
| 912 | Ga0068862_100189060 | |||
| 913 | Ga0068862_100257892 | |||
| 914 | Ga0068862_100356609 | |||
| 915 | Ga0068862_100393179 | |||
| 916 | Ga0081539_10039309 | |||
| 917 | Ga0081539_10093321 | |||
| 918 | Ga0075364_10000088 | |||
| 919 | Ga0070712_100398543 | |||
| 920 | Ga0097621_100013787 | |||
| 921 | Ga0097621_100070263 | |||
| 922 | Ga0097621_100186538 | |||
| 923 | Ga0068871_100018590 | |||
| 924 | Ga0068871_100310291 | |||
| 925 | Ga0068871_100442695 | |||
| 926 | Ga0075428_100014839 | |||
| 927 | Ga0075428_100119918 | |||
| 928 | Ga0075428_100330775 | |||
| 929 | Ga0075430_100005316 | |||
| 930 | Ga0075430_100018414 | |||
| 931 | Ga0075430_100023730 | |||
| 932 | Ga0075430_100044827 | |||
| 933 | Ga0075430_100068661 | |||
| 934 | Ga0075430_100162601 | |||
| 935 | Ga0075431_100002456 | |||
| 936 | Ga0075431_100008015 | |||
| 937 | Ga0075431_100021583 | |||
| 938 | Ga0075431_100038262 | |||
| 939 | Ga0075431_100176502 | |||
| 940 | Ga0075433_10010361 | |||
| 941 | Ga0075433_10082411 | |||
| 942 | Ga0075434_100006583 | |||
| 943 | Ga0075429_100013156 | |||
| 944 | Ga0075429_100014907 | |||
| 945 | Ga0075429_100113491 | |||
| 946 | Ga0097620_100009838 | |||
| 947 | Ga0097620_100167255 | |||
| 948 | Ga0097620_100189155 | |||
| 949 | Ga0075435_100093548 | |||
| 950 | Ga0075435_100689390 | |||
| 951 | Ga0099794_10009352 | |||
| 952 | Ga0099795_10022729 | |||
| 953 | Ga0105244_10016536 | |||
| 954 | Ga0105240_10018364 | |||
| 955 | Ga0105240_10033150 | |||
| 956 | Ga0105240_10046990 | |||
| 957 | Ga0105240_10053056 | |||
| 958 | Ga0105240_10463258 | |||
| 959 | Ga0111539_10013502 | |||
| 960 | Ga0111539_10187353 | |||
| 961 | Ga0111539_10210660 | |||
| 962 | Ga0111539_10219175 | |||
| 963 | Ga0111539_10306392 | |||
| 964 | Ga0111539_10370073 | |||
| 965 | Ga0111539_10536675 | |||
| 966 | Ga0111539_10599427 | |||
| 967 | Ga0105245_10015730 | |||
| 968 | Ga0105245_10476479 | |||
| 969 | Ga0114129_10034384 | |||
| 970 | Ga0114129_10494455 | |||
| 971 | Ga0105243_10007475 | |||
| 972 | Ga0105243_10014090 | |||
| 973 | Ga0105243_10863180 | |||
| 974 | Ga0105241_10112410 | |||
| 975 | Ga0105241_10730364 | |||
| 976 | Ga0105242_10008662 | |||
| 977 | Ga0105242_10788038 | |||
| 978 | Ga0105248_10126371 | |||
| 979 | Ga0105248_10144479 | |||
| 980 | Ga0105248_10661627 | |||
| 981 | Ga0105238_10143320 | |||
| 982 | Ga0105238_10252680 | |||
| 983 | Ga0105238_10779387 | |||
| 984 | Ga0105249_10025495 | |||
| 985 | Ga0105249_10050830 | |||
| 986 | Ga0105249_10086074 | |||
| 987 | Ga0099796_10001390 | |||
| 988 | Ga0105239_11337704 | |||
| 989 | Ga0157373_10002057 | |||
| 990 | Ga0157373_10066987 | |||
| 991 | Ga0157371_10004109 | |||
| 992 | Ga0157371_10022846 | |||
| 993 | Ga0157371_10096541 | |||
| 994 | Ga0157370_10004297 | |||
| 995 | Ga0157370_10261642 | |||
| 996 | Ga0157370_10436996 | |||
| 997 | Ga0157369_10019662 | |||
| 998 | Ga0157369_10262320 | |||
| 999 | Ga0157374_10064416 | |||
| 1000 | Ga0157374_10237711 | |||
| 1001 | Ga0157374_10323687 | |||
| 1002 | Ga0157374_10856207 | |||
| 1003 | Ga0157378_10031720 | |||
| 1004 | Ga0157378_10262800 | |||
| 1005 | Ga0163162_10001289 | |||
| 1006 | Ga0163162_10025926 | |||
| 1007 | Ga0163162_10037581 | |||
| 1008 | Ga0163162_10058035 | |||
| 1009 | Ga0163162_10213986 | |||
| 1010 | Ga0157372_10073761 | |||
| 1011 | Ga0157372_10210225 | |||
| 1012 | Ga0157375_10027128 | |||
| 1013 | Ga0157375_10105113 | |||
| 1014 | Ga0157375_10217118 | |||
| 1015 | Ga0157375_10309222 | |||
| 1016 | Ga0157375_10848143 | |||
| 1017 | Ga0157375_10848814 | |||
| 1018 | Ga0163163_10012452 | |||
| 1019 | Ga0163163_10015743 | |||
| 1020 | Ga0163163_10036565 | |||
| 1021 | Ga0157380_10000649 | |||
| 1022 | Ga0157380_10007255 | |||
| 1023 | Ga0157380_10347264 | |||
| 1024 | Ga0157380_11105320 | |||
| 1025 | Ga0157377_10139962 | |||
| 1026 | Ga0157379_10003603 | |||
| 1027 | Ga0157379_10556404 | |||
| 1028 | Ga0157376_10021376 | |||
| 1029 | Ga0157376_10040278 | |||
| 1030 | Ga0157376_10069544 | |||
| 1031 | Ga0182006_1031091 | |||
| 1032 | Ga0182007_10000026 | |||
| 1033 | Ga0182005_1000232 | |||
| 1034 | Ga0182005_1001956 | |||
| 1035 | Ga0163161_10059141 | |||
| 1036 | Ga0163161_10179039 | |||
| 1037 | Ga0209676_1000037 | |||
| 1038 | Ga0209050_1020249 | |||
| 1039 | Ga0209257_1054537 | |||
| 1040 | Ga0207697_10116586 | |||
| 1041 | Ga0207653_10093170 | |||
| 1042 | Ga0207682_10005346 | |||
| 1043 | Ga0207682_10010687 | |||
| 1044 | Ga0207682_10250758 | |||
| 1045 | Ga0207692_10065041 | |||
| 1046 | Ga0207688_10295376 | |||
| 1047 | Ga0207680_10041328 | |||
| 1048 | Ga0207699_10000060 | |||
| 1049 | Ga0207645_10179480 | |||
| 1050 | Ga0207643_10009847 | |||
| 1051 | Ga0207643_10011227 | |||
| 1052 | Ga0207643_10033567 | |||
| 1053 | Ga0207643_10037939 | |||
| 1054 | Ga0207705_10269071 | |||
| 1055 | Ga0207695_10376332 | |||
| 1056 | Ga0207695_10412040 | |||
| 1057 | Ga0207693_10433162 | |||
| 1058 | Ga0207660_10041060 | |||
| 1059 | Ga0207660_10201559 | |||
| 1060 | Ga0207660_10216753 | |||
| 1061 | Ga0207649_10097394 | |||
| 1062 | Ga0207652_10051046 | |||
| 1063 | Ga0207652_10304735 | |||
| 1064 | Ga0207681_10000011 | |||
| 1065 | Ga0207681_10024601 | |||
| 1066 | Ga0207681_10062120 | |||
| 1067 | Ga0207694_10074230 | |||
| 1068 | Ga0207650_10009064 | |||
| 1069 | Ga0207650_10256458 | |||
| 1070 | Ga0207650_10286844 | |||
| 1071 | Ga0207650_10624504 | |||
| 1072 | Ga0207659_10025093 | |||
| 1073 | Ga0207659_10093684 | |||
| 1074 | Ga0207659_10355045 | |||
| 1075 | Ga0207659_10798669 | |||
| 1076 | Ga0207706_10001385 | |||
| 1077 | Ga0207706_10057595 | |||
| 1078 | Ga0207706_10481649 | |||
| 1079 | Ga0207706_10603181 | |||
| 1080 | Ga0207686_10144633 | |||
| 1081 | Ga0207709_10007927 | |||
| 1082 | Ga0207670_10009435 | |||
| 1083 | Ga0207670_10016897 | |||
| 1084 | Ga0207669_10108738 | |||
| 1085 | Ga0207669_10163967 | |||
| 1086 | Ga0207669_10198891 | |||
| 1087 | Ga0207669_10233072 | |||
| 1088 | Ga0207704_10125858 | |||
| 1089 | Ga0207704_10295843 | |||
| 1090 | Ga0207691_10005061 | |||
| 1091 | Ga0207691_10006675 | |||
| 1092 | Ga0207691_10032630 | |||
| 1093 | Ga0207691_10043973 | |||
| 1094 | Ga0207691_10073274 | |||
| 1095 | Ga0207691_10278727 | |||
| 1096 | Ga0207691_10604571 | |||
| 1097 | Ga0207711_10027197 | |||
| 1098 | Ga0207689_10306675 | |||
| 1099 | Ga0207689_10549740 | |||
| 1100 | Ga0207651_10076331 | |||
| 1101 | Ga0207651_10144680 | |||
| 1102 | Ga0207651_10256096 | |||
| 1103 | Ga0207651_10372154 | |||
| 1104 | Ga0207651_10493050 | |||
| 1105 | Ga0207651_10517926 | |||
| 1106 | Ga0207712_10022995 | |||
| 1107 | Ga0207712_10307779 | |||
| 1108 | Ga0207668_10071822 | |||
| 1109 | Ga0207668_10082099 | |||
| 1110 | Ga0207668_10709348 | |||
| 1111 | Ga0207668_10763008 | |||
| 1112 | Ga0207658_10392418 | |||
| 1113 | Ga0207677_10088295 | |||
| 1114 | Ga0207703_10179185 | |||
| 1115 | Ga0207703_10580614 | |||
| 1116 | Ga0207639_10061673 | |||
| 1117 | Ga0207639_10676695 | |||
| 1118 | Ga0207678_10371859 | |||
| 1119 | Ga0207678_10596419 | |||
| 1120 | Ga0207708_10024778 | |||
| 1121 | Ga0207708_10049180 | |||
| 1122 | Ga0207708_10593091 | |||
| 1123 | Ga0207702_10530960 | |||
| 1124 | Ga0207641_10101208 | |||
| 1125 | Ga0207641_10164574 | |||
| 1126 | Ga0207648_10007351 | |||
| 1127 | Ga0207648_10010933 | |||
| 1128 | Ga0207648_10014871 | |||
| 1129 | Ga0207648_10047085 | |||
| 1130 | Ga0207648_10190062 | |||
| 1131 | Ga0207676_10021615 | |||
| 1132 | Ga0207674_10296554 | |||
| 1133 | Ga0207674_10347363 | |||
| 1134 | Ga0207674_10353520 | |||
| 1135 | Ga0207675_100001153 | |||
| 1136 | Ga0207675_100001619 | |||
| 1137 | Ga0207675_100001636 | |||
| 1138 | Ga0207675_100009878 | |||
| 1139 | Ga0207675_100012041 | |||
| 1140 | Ga0207675_100020026 | |||
| 1141 | Ga0207675_100113857 | |||
| 1142 | Ga0207675_100174545 | |||
| 1143 | Ga0207683_10006218 | |||
| 1144 | Ga0207683_10006907 | |||
| 1145 | Ga0209973_1008604 | |||
| 1146 | Ga0209371_1000088 | |||
| 1147 | Ga0209984_1000372 | |||
| 1148 | Ga0209179_1001962 | |||
| 1149 | Ga0209999_1010195 | |||
| 1150 | Ga0209970_1004873 | |||
| 1151 | Ga0209970_1009220 | |||
| 1152 | Ga0210002_1000883 | |||
| 1153 | Ga0209588_1015449 | |||
| 1154 | Ga0209971_1001139 | |||
| 1155 | Ga0209971_1017080 | |||
| 1156 | Ga0209998_10000488 | |||
| 1157 | Ga0209974_10002247 | |||
| 1158 | Ga0209974_10063985 | |||
| 1159 | Ga0207428_10032490 | |||
| 1160 | Ga0207428_10053091 | |||
| 1161 | Ga0207428_10055124 | |||
| 1162 | Ga0207428_10217787 | |||
| 1163 | Ga0207428_10218302 | |||
| 1164 | Ga0207428_10240179 | |||
| 1165 | Ga0265354_1001125 | |||
| 1166 | Ga0265355_1002000 | |||
| 1167 | Ga0268266_10001818 | |||
| 1168 | Ga0268266_10040597 | |||
| 1169 | Ga0268266_10042978 | |||
| 1170 | Ga0268266_10046509 | |||
| 1171 | Ga0268266_10242556 | |||
| 1172 | Ga0268266_10245244 | |||
| 1173 | Ga0268266_10599526 | |||
| 1174 | Ga0268265_10007851 | |||
| 1175 | Ga0268265_10035296 | |||
| 1176 | Ga0268265_10052595 | |||
| 1177 | Ga0268265_10172775 | |||
| 1178 | Ga0268265_10265581 | |||
| 1179 | Ga0268265_10398571 | |||
| 1180 | Ga0268264_10011925 | |||
| 1181 | Ga0268264_10043460 | |||
| 1182 | Ga0268264_10093183 | |||
| 1183 | Ga0268264_10411185 | |||
| 1184 | Ga0268264_10641488 | |||
| 1185 | Ga0265323_10018643 | |||
| 1186 | Ga0307515_10061597 | |||
| 1187 | Ga0268256_1000079 | |||
| 1188 | Ga0265770_1000303 | |||
| 1189 | Ga0265760_10000729 | |||
| 1190 | Ga0265330_10027038 | |||
| 1191 | Ga0265328_10002990 | |||
| 1192 | Ga0265340_10110169 | |||
| 1193 | Ga0265316_10246068 | |||
| 1194 | Ga0307513_10009164 | |||
| 1195 | Ga0307513_10018384 | |||
| 1196 | Ga0307513_10507026 | |||
| 1197 | Ga0307509_10000917 | |||
| 1198 | Ga0307509_10079049 | |||
| 1199 | Ga0307408_100033275 | |||
| 1200 | Ga0307408_100450584 | |||
| 1201 | Ga0307508_10030002 | |||
| 1202 | Ga0307508_10315645 | |||
| 1203 | Ga0316576_10011259 | |||
| 1204 | Ga0316576_10120140 | |||
| 1205 | Ga0316578_10017805 | |||
| 1206 | Ga0316578_10204827 | |||
| 1207 | Ga0307405_10333863 | |||
| 1208 | Ga0316577_10063038 | |||
| 1209 | Ga0307413_10028003 | |||
| 1210 | Ga0307413_10052318 | |||
| 1211 | Ga0307413_10110128 | |||
| 1212 | Ga0307413_10167757 | |||
| 1213 | Ga0307413_10203426 | |||
| 1214 | Ga0307413_10519207 | |||
| 1215 | Ga0307410_10010554 | |||
| 1216 | Ga0307410_10047747 | |||
| 1217 | Ga0307410_10126978 | |||
| 1218 | Ga0307410_10189512 | |||
| 1219 | Ga0307410_10749127 | |||
| 1220 | Ga0307406_10125172 | |||
| 1221 | Ga0307406_10614494 | |||
| 1222 | Ga0307407_10056575 | |||
| 1223 | Ga0307407_10118171 | |||
| 1224 | Ga0307407_10197336 | |||
| 1225 | Ga0307407_10230918 | |||
| 1226 | Ga0307407_10256096 | |||
| 1227 | Ga0307407_10460577 | |||
| 1228 | Ga0307412_10019465 | |||
| 1229 | Ga0307412_10045139 | |||
| 1230 | Ga0307412_10189210 | |||
| 1231 | Ga0307412_10200582 | |||
| 1232 | Ga0307409_100003347 | |||
| 1233 | Ga0307409_100016236 | |||
| 1234 | Ga0307409_100160646 | |||
| 1235 | Ga0307409_100301890 | |||
| 1236 | Ga0307416_100393669 | |||
| 1237 | Ga0307416_100545103 | |||
| 1238 | Ga0307416_100876231 | |||
| 1239 | Ga0307414_10068010 | |||
| 1240 | Ga0307414_10210782 | |||
| 1241 | Ga0307414_10420650 | |||
| 1242 | Ga0307411_10125570 | |||
| 1243 | Ga0307411_10313493 | |||
| 1244 | Ga0307411_10346498 | |||
| 1245 | Ga0307411_10384073 | |||
| 1246 | Ga0307411_10407819 | |||
| 1247 | Ga0307415_100062571 | |||
| 1248 | Ga0307415_100721902 | |||
| 1249 | Ga0316585_10010275 | |||
| 1250 | Ga0316580_10017135 | |||
| 1251 | Ga0373929_0000013 | |||
| 1252 | Ga0373923_0113113 | |||
| 1253 | Ga0373923_0116849 | |||
| 1254 | Ga0373936_0142304 | |||
| 1255 | Ga0373954_0190878 | |||
| 1256 | Ga0316574_0000082 | |||
| 1257 | Ga0316574_0051564 | |||
| 1258 | Ga0316574_0077286 | |||
| 1259 | Ga0373924_0258821 | |||
| 1260 | Ga0373935_0242959 | |||
| 1261 | Ga0373927_0482534 | |||
| 1262 | Ga0373933_0051323 | |||
| 1263 | Ga0373933_0151508 | |||
| 1264 | Ga0373937_0049317 | |||
| 1265 | Ga0373937_0072428 | |||
| 1266 | Ga0373937_0172859 | |||
| 1267 | Ga0316582_0053817 | |||
| 1268 | Ga0316584_0015059 | |||
| 1269 | Ga0316584_0278764 | |||
| 1270 | Ga0373925_0128677 | |||
| 1271 | Ga0395900_0086081 | |||
| 1272 | Ga0395900_0320964 | |||
| 1273 | Ga0439461_0031014 | |||
| 1274 | Ga0451789_0547898 | |||
| 1275 | Ga0451793_0183807 | |||
| 1276 | Ga0451793_0710391 | |||
| 1277 | Ga0451797_0052733 | |||
| 1278 | Ga0451798_1030345 | |||
| 1279 | Ga0451800_0240496 | |||
| 1280 | Ga0451802_0719910 | |||
| 1281 | Ga0451802_1128143 | |||
| 1282 | Ga0451806_181564 | |||
| 1283 | Ga0451804_0695803 | |||
| 1284 | Ga0451807_0587428 | |||
| 1285 | Ga0451807_1394934 | |||
| 1286 | Ga0451837_1124078 | |||
| 1287 | Ga0451853_2462324 | |||
| 1288 | Ga0439441_002426 | |||
| 1289 | Ga0439442_025811 | |||
| 1290 | Ga0439443_003965 | |||
| 1291 | Ga0439457_027137 | |||
| 1292 | Ga0450913_006547 | |||
| 1293 | Ga0450920_016177 | |||
| 1294 | Ga0450923_000826 | |||
| 1295 | Ga0450923_046524 | |||
| 1296 | Ga0450892_013414 | |||
| 1297 | Ga0450894_015048 | |||
| 1298 | Ga0450910_008021 | |||
| 1299 | Ga0439446_0003583 | |||
| 1300 | Ga0450908_001374 | |||
| 1301 | Ga0450908_008072 | |||
| 1302 | Ga0439434_0012512 | |||
| 1303 | Ga0439434_0020238 | |||
| 1304 | Ga0439435_0010756 | |||
| 1305 | Ga0439444_0002654 | |||
| 1306 | Ga0439459_0050476 | |||
| 1307 | Ga0439459_0057928 | |||
| 1308 | Ga0439464_0054312 | |||
| 1309 | Ga0451577_0004168 | |||
| 1310 | Ga0451577_0019662 | |||
| 1311 | Ga0451577_0064759 | |||
| 1312 | Ga0451577_0087073 | |||
| 1313 | Ga0451577_0115667 | |||
| 1314 | Ga0451577_0133790 | |||
| 1315 | Ga0451577_0388112 | |||
| 1316 | Ga0453683_0004351 | |||
| 1317 | Ga0453684_0011204 | |||
| 1318 | Ga0453684_0070049 | |||
| 1319 | Ga0453684_0111257 | |||
| 1320 | Ga0451576_0018930 | |||
| 1321 | Ga0451576_0035970 | |||
| 1322 | Ga0451576_0084585 | |||
| 1323 | Ga0451576_0682027 | |||
| 1324 | Ga0466967_0084948 | |||
| 1325 | Ga0466967_0267970 | |||
| 1326 | Ga0495591_062448 | |||
| 1327 | Ga0495629_0162345 | |||
| 1328 | Ga0495638_0003097 | |||
| 1329 | Ga0495638_0004722 | |||
| 1330 | Ga0495641_0082501 | |||
| 1331 | Ga0495580_0121422 | |||
| 1332 | Ga0495580_0239364 | |||
| 1333 | Ga0495639_0264687 | |||
| 1334 | Ga0495662_0152760 | |||
| 1335 | Ga0495594_0236721 | |||
| 1336 | Ga0495596_0116669 | |||
| 1337 | Ga0495620_0040095 | |||
| 1338 | Ga0495644_0087007 | |||
| 1339 | Ga0495663_0014292 | |||
| 1340 | Ga0495621_0000461 | |||
| 1341 | Ga0495633_0025356 | |||
| 1342 | Ga0495633_0137794 | |||
| 1343 | Ga0495668_0000301 | |||
| 1344 | Ga0495611_0147289 | |||
| 1345 | Ga0495625_0004196 | |||
| 1346 | Ga0495625_0006418 | |||
| 1347 | Ga0495635_0280715 | |||
| 1348 | Ga0495647_0008140 | |||
| 1349 | Ga0495647_0130099 | |||
| 1350 | Ga0495658_0008463 | |||
| 1351 | Ga0495649_0006367 | |||
| 1352 | Ga0495600_0417447 | |||
| 1353 | Ga0495604_0159213 | |||
| 1354 | Ga0495672_0053133 | |||
| 1355 | Ga0495672_0209160 | |||
| 1356 | Ga0495680_0022654 | |||
| 1357 | Ga0495686_0086557 | |||
| 1358 | Ga0495686_0128273 | |||
| 1359 | Ga0495615_0094842 | |||
| 1360 | Ga0496100_0088027 | |||
| 1361 | Ga0496101_0210322 | |||
| 1362 | Ga0496101_0675608 | |||
| 1363 | Ga0496104_0027158 | |||
| 1364 | Ga0496104_0141811 | |||
| 1365 | Ga0496104_0278849 | |||
| 1366 | Ga0496105_0005317 | |||
| 1367 | Ga0496107_0087823 | |||
| 1368 | Ga0496108_0103481 | |||
| 1369 | Ga0496109_0093010 | |||
| 1370 | Ga0496110_0014082 | |||
| 1371 | Ga0496110_0298768 | |||
| 1372 | Ga0496111_0036773 | |||
| 1373 | Ga0496114_0000012 | |||
| 1374 | Ga0496114_0004286 | |||
| 1375 | Ga0496114_0055180 | |||
| 1376 | Ga0496115_0028254 | |||
| 1377 | Ga0496118_0133750 | |||
| 1378 | Ga0496118_0165031 | |||
| 1379 | Ga0496119_0000654 | |||
| 1380 | Ga0496120_0002845 | |||
| 1381 | Ga0496121_0195671 | |||
| 1382 | Ga0496124_0039548 | |||
| 1383 | Ga0496124_0061500 | |||
| 1384 | Ga0496124_0251499 | |||
| 1385 | Ga0496125_0036816 | |||
| 1386 | Ga0496126_0003314 | |||
| 1387 | Ga0496126_0025761 | |||
| 1388 | Ga0501299_003641 | |||
| 1389 | Ga0501032_0071060 | |||
| 1390 | Ga0501032_0249330 | |||
| 1391 | Ga0501032_0435885 | |||
| 1392 | Ga0501034_0002645 | |||
| 1393 | Ga0501034_0227623 | |||
| 1394 | Ga0501034_0736583 | |||
| 1395 | Ga0501036_0030507 | |||
| 1396 | Ga0501036_0466258 | |||
| 1397 | Ga0501037_0105310 | |||
| 1398 | Ga0501037_0282802 | |||
| 1399 | Ga0501037_0416732 | |||
| 1400 | Ga0501038_0025830 | |||
| 1401 | Ga0501038_0298140 | |||
| 1402 | Ga0501038_0567121 | |||
| 1403 | Ga0501039_0044409 | |||
| 1404 | Ga0501040_0055542 | |||
| 1405 | Ga0501040_0084697 | |||
| 1406 | Ga0501040_0146277 | |||
| 1407 | Ga0501040_0322245 | |||
| 1408 | Ga0501042_0133158 | |||
| 1409 | Ga0501042_0213609 | |||
| 1410 | Ga0501042_0289518 | |||
| 1411 | Ga0501042_0345422 | |||
| 1412 | Ga0501046_0527008 | |||
| 1413 | Ga0501047_0064156 | |||
| 1414 | Ga0501048_0107002 | |||
| 1415 | Ga0501067_0146389 | |||
| 1416 | Ga0501068_0003038 | |||
| 1417 | Ga0501068_0005358 | |||
| 1418 | Ga0501068_0232203 | |||
| 1419 | Ga0501068_0442858 | |||
| 1420 | Ga0501069_0153267 | |||
| 1421 | Ga0501069_0168442 | |||
| 1422 | Ga0501070_0162762 | |||
| 1423 | Ga0501071_0018970 | |||
| 1424 | Ga0501072_0035075 | |||
| 1425 | Ga0501072_0233419 | |||
| 1426 | Ga0501073_0006306 | |||
| 1427 | Ga0501073_0018770 | |||
| 1428 | Ga0501074_0006860 | |||
| 1429 | Ga0501074_0085123 | |||
| 1430 | Ga0501075_0115272 | |||
| 1431 | Ga0501075_0159984 | |||
| 1432 | Ga0501075_0212097 | |||
| 1433 | Ga0501076_0109772 | |||
| 1434 | Ga0501076_0166659 | |||
| 1435 | Ga0501076_0222785 | |||
| 1436 | Ga0501076_0250935 | |||
| 1437 | Ga0501077_0000284 | |||
| 1438 | Ga0501077_0058480 | |||
| 1439 | Ga0501079_0181059 | |||
| 1440 | Ga0501079_0619433 | |||
| 1441 | Ga0501080_0002960 | |||
| 1442 | Ga0501080_0005108 | |||
| 1443 | Ga0501080_0018349 | |||
| 1444 | Ga0501080_0118364 | |||
| 1445 | Ga0501081_0008371 | |||
| 1446 | Ga0501081_0526982 | |||
| 1447 | Ga0501083_0006836 | |||
| 1448 | Ga0501083_0044268 | |||
| 1449 | Ga0501035_0150709 | |||
| 1450 | Ga0501035_0444214 | |||
| 1451 | Ga0501045_0123450 | |||
| 1452 | Ga0501045_0125573 | |||
| 1453 | nmdc:mga0k408_14294_c1 | |||
| 1454 | nmdc:mga05p37_16649_c1 | |||
| 1455 | nmdc:mga09592_111787_c1 | |||
| 1456 | nmdc:mga09592_210152_c1 | |||
| 1457 | nmdc:mga09592_21800_c1 | |||
| 1458 | nmdc:mga09592_26339_c1 | |||
| 1459 | nmdc:mga09592_99994_c1 | |||
| 1460 | nmdc:mga0qj67_107240_c1 | |||
| 1461 | nmdc:mga0qj67_12212_c1 | |||
| 1462 | nmdc:mga0qj67_17995_c1 | |||
| 1463 | nmdc:mga0qj67_18857_c1 | |||
| 1464 | nmdc:mga0qj67_21133_c1 | |||
| 1465 | nmdc:mga06r32_1582_c1 | |||
| 1466 | nmdc:mga06r32_181759_c1 | |||
| 1467 | nmdc:mga06r32_18542_c1 | |||
| 1468 | nmdc:mga06r32_4811_c1 | |||
| 1469 | nmdc:mga06r32_5847_c1 | |||
| 1470 | nmdc:mga08y16_11594_c1 | |||
| 1471 | nmdc:mga08y16_126944_c1 | |||
| 1472 | nmdc:mga08y16_135236_c1 | |||
| 1473 | nmdc:mga08y16_165697_c1 | |||
| 1474 | nmdc:mga08y16_203617_c1 | |||
| 1475 | nmdc:mga08y16_23930_c1 | |||
| 1476 | nmdc:mga08y16_328726_c1 | |||
| 1477 | nmdc:mga08y16_43919_c1 | |||
| 1478 | nmdc:mga08y16_897251_c1 | |||
| 1479 | nmdc:mga0n895_12548_c1 | |||
| 1480 | nmdc:mga0rr50_22787_c1 | |||
| 1481 | nmdc:mga0a205_13295_c2 | |||
| 1482 | nmdc:mga0a205_292515_c1 | |||
| 1483 | nmdc:mga0a205_471083_c1 | |||
| 1484 | Ga0495601_0230812 | |||
| 1485 | Ga0495619_0360865 | |||
| 1486 | Ga0500578_0000131 | |||
| 1487 | Ga0500644_0048730 | |||
| 1488 | Ga0500646_0006436 | |||
| 1489 | Ga0500651_0067147 | |||
| 1490 | Ga0500566_0270225 | |||
| 1491 | Ga0500641_0001484 | |||
| 1492 | Ga0500556_0043776 | |||
| 1493 | Ga0500652_058290 | |||
| 1494 | Ga0500658_0038616 | |||
| 1495 | Ga0500559_0037976 | |||
| 1496 | Ga0500568_0014985 | |||
| 1497 | Ga0500568_0094871 | |||
| 1498 | Ga0500604_0003185 | |||
| 1499 | Ga0500622_0000006 | |||
| 1500 | Ga0500622_0000213 | |||
| 1501 | Ga0500622_0001608 | |||
| 1502 | Ga0500622_0010663 | |||
| 1503 | Ga0500627_0114584 | |||
| 1504 | Ga0500637_0009124 | |||
| 1505 | Ga0501084_0010970 | |||
| 1506 | Ga0501084_0038822 | |||
| 1507 | Ga0501084_0202090 | |||
| 1508 | Ga0590071_080189 | |||
| 1509 | Ga0501082_0000011 | |||
| 1510 | Ga0501082_0007297 | |||
| 1511 | Ga0501082_0181969 | |||
| 1512 | Ga0530510_0032713 | |||
| 1513 | Ga0530510_0046251 | |||
| 1514 | Ga0530510_0352649 | |||
| 1515 | Ga0530510_0442852 | |||
| 1516 | Ga0530510_0734589 | |||
| 1517 | 2525558092 | |||
| 1518 | 2547501404 | |||
| 1519 | 2578457287 | |||
| 1520 | 2630649895 | |||
| 1521 | 2747949418 | |||
| 1522 | 2765580203 | |||
| 1523 | 2819660884 | |||
| 1524 | 2842759981 | |||
| 1525 | 2852652403 | |||
| 1526 | 2852686760 | |||
| 1527 | 2914759885 | |||
| 1528 | 2919134034 | |||
| 1529 | 2919137780 | |||
| 1530 | 2923519394 | |||
| 1531 | 2929196684 | |||
| 1532 | 2941479022 | |||
| 1533 | 8003015161 | |||
| 1534 | 8021623627 | |||
| 1535 | 8021627451 | |||
| 1536 | 8021650582 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mw7-assembly1.cif.gz_A | x-ray structure of y162_helpy northeast structural genomics consortium target pr6 | 0.9378 | 23 | 240 |
| 1mw7-assembly1.cif.gz_A | x-ray structure of y162_helpy northeast structural genomics consortium target pr6 | 0.9254 | 23 | 240 |
| 1lfp-assembly1.cif.gz_A | crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus | 0.8474 | 20 | 240 |
| 1kon-assembly1.cif.gz_A | crystal structure of e.coli yebc | 0.7894 | 9 | 239 |
| 1lfp-assembly1.cif.gz_A | crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus | 0.7738 | 20 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1mw7A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain | 0.9195 | 26 | 78 | 1.10.10.200 |
| af_P9WGA5_1_79_1.10.10.200 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain | 0.9124 | 18 | 76 | 1.10.10.200 |
| 1mw7A02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain | 0.9114 | 80 | 240 | 3.30.70.980 |
| 1mw7A02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain | 0.9014 | 80 | 240 | 3.30.70.980 |
| 1mw7A03 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain | 0.8872 | 131 | 205 | 3.30.70.980 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I5C779-F1-model_v4 | Probable transcriptional regulatory protein A3SI_05809 | 0.9843 | 21 | 240 |
GO:0003677
GO:0005829 GO:0006355 |
| AF-A0A7R9V5A2-F1-model_v4 | YebC/PmpR family DNA-binding transcriptional regulator | 0.9827 | 18 | 120 |
GO:0009507
|
| AF-A0A7Y4QAE0-F1-model_v4 | YebC/PmpR family DNA-binding transcriptional regulator | 0.9805 | 21 | 240 |
GO:0003677
GO:0005829 GO:0006355 |
| AF-A0A7Y4QAE0-F1-model_v4 | YebC/PmpR family DNA-binding transcriptional regulator | 0.9716 | 21 | 240 |
GO:0003677
GO:0005829 GO:0006355 |
| AF-I5C779-F1-model_v4 | Probable transcriptional regulatory protein A3SI_05809 | 0.9708 | 21 | 240 |
GO:0003677
GO:0005829 GO:0006355 |