F479958

General Info

Members Datasets Scaffolds Average Seq Length
768 378 1536 238

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0409349|Ga0373937_0409349_347_1189
Length 280
Sequence VAANDPPNLPGDASTKVLEIHAPGSFSLIICPSLVGWQGSMGRIFEVRKHTMFARWNRMAKQFAKIGKEITIAVKSGGGDPASNPALRRVIQNARAVNMPKDKVDAAIKRALGRDAANYTEVLYEGYAPHGVAVLVETATDNPTRTVANVRNLFTKGEGNLATSGSVSFMFRKMGVFRLAPDGVDQDDLELYLIDHGLDEMGEGTGEKGEPQLVVRCEFEKFGQLQHALEQRGVAVVSAAHEYICNAPTTLPEDQAAEVMALLDKLEQDEDVQNVYHTLA

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
175 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
182 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
185 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
186 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
193 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
207 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
208 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
209 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
213 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
218 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
222 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
223 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
224 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
225 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
226 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
227 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
228 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
229 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
230 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
231 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
232 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
233 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
234 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
235 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
236 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
237 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
238 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
239 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
240 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
241 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
242 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
243 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
244 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
245 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
246 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
247 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
248 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
249 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
252 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
256 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
257 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
258 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
264 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
265 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
266 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
267 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
274 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
275 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
278 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
281 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
294 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
295 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
296 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
301 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
313 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
314 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
315 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
316 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
317 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
318 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
319 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
320 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
321 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
322 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
326 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
329 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
332 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
333 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
334 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
335 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
336 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
337 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
338 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
341 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
342 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
343 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
344 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
345 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
346 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
347 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
348 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
349 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
350 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
351 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
352 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
353 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
354 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
357 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
358 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
359 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
360 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
361 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
362 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
363 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
364 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
365 2818991457 Xanthomonas translucens 569 Isolate Unclassified
366 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
367 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
368 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
369 2914759650 Rhizosphaericola mali Isolate Rhizosphere
370 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
371 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
372 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
373 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
374 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
375 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
376 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
377 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
378 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0.26
Isolates 2.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.26
Nodule 0
Rhizoplane 3.78
Rhizosphere 88.8
Stem 0
Stem Tuber 0
Unclassified 4.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0409349 3300036401 Bacteria 1287
2 SwRhRL2b_contig_857857 2162886007 Bacteria 1346
3 JGI24744J21845_10011345 3300002077 Bacteria 1823
4 rootH1_10000284 3300003316 Bacteria 58926
5 rootH2_10088031 3300003320 Bacteria 3393
6 rootL2_10038226 3300003322 Unclassified 3186
7 rootL2_10118395 3300003322 Bacteria 9328
8 rootH1_10059569 3300003323 Bacteria 3193
9 Ga0055536_1007237 3300003781 Bacteria 5004
10 Ga0058692_1000033 3300003856 Bacteria 174393
11 Ga0065704_10000377 3300005289 Bacteria 25325
12 Ga0065704_10004068 3300005289 Bacteria 5659
13 Ga0065704_10141904 3300005289 Unclassified 1509
14 Ga0065707_10092373 3300005295 Bacteria 3782
15 Ga0070658_10062502 3300005327 Bacteria 3035
16 Ga0070690_100118984 3300005330 Bacteria 1771
17 Ga0070670_100014994 3300005331 Bacteria 6651
18 Ga0070670_100484579 3300005331 Bacteria 1098
19 Ga0070670_100499455 3300005331 Bacteria 1082
20 Ga0070670_100536268 3300005331 Bacteria 1043
21 Ga0068869_100270298 3300005334 Bacteria 1364
22 Ga0070666_10019216 3300005335 Bacteria 4407
23 Ga0070666_10052239 3300005335 Bacteria 2754
24 Ga0070680_100074940 3300005336 Bacteria 2785
25 Ga0070680_100180567 3300005336 Bacteria 1777
26 Ga0070682_100059298 3300005337 Bacteria 2417
27 Ga0068868_100016001 3300005338 Bacteria 5562
28 Ga0070660_100686634 3300005339 Bacteria 858
29 Ga0070689_100249865 3300005340 Bacteria 1463
30 Ga0070689_100261834 3300005340 Bacteria 1430
31 Ga0070687_100161397 3300005343 Bacteria 1325
32 Ga0070661_100018082 3300005344 Bacteria 5007
33 Ga0070692_10058900 3300005345 Bacteria 2018
34 Ga0070668_100003484 3300005347 Bacteria 11601
35 Ga0070668_100143434 3300005347 Bacteria 1926
36 Ga0070668_100281641 3300005347 Bacteria 1389
37 Ga0070669_100000010 3300005353 Bacteria 222186
38 Ga0070669_100007130 3300005353 Bacteria 8031
39 Ga0070669_100027116 3300005353 Bacteria 4123
40 Ga0070669_100062248 3300005353 Bacteria 2743
41 Ga0070669_100407993 3300005353 Bacteria 1113
42 Ga0070675_100014637 3300005354 Bacteria 6186
43 Ga0070675_100042910 3300005354 Bacteria 3696
44 Ga0070675_100045587 3300005354 Bacteria 3588
45 Ga0070675_100203992 3300005354 Bacteria 1716
46 Ga0070671_100040061 3300005355 Bacteria 3890
47 Ga0070671_100277291 3300005355 Bacteria 1425
48 Ga0070674_100027099 3300005356 Bacteria 3752
49 Ga0070674_100183113 3300005356 Bacteria 1606
50 Ga0070674_100249179 3300005356 Bacteria 1394
51 Ga0070674_100370956 3300005356 Unclassified 1161
52 Ga0070674_100653496 3300005356 Bacteria 894
53 Ga0070673_100066843 3300005364 Bacteria 2873
54 Ga0070673_100295350 3300005364 Bacteria 1425
55 Ga0070688_100042495 3300005365 Bacteria 2797
56 Ga0070688_100192851 3300005365 Bacteria 1421
57 Ga0070688_100279620 3300005365 Bacteria 1198
58 Ga0070667_100001093 3300005367 Bacteria 24858
59 Ga0070667_100101567 3300005367 Bacteria 2485
60 Ga0070667_100292567 3300005367 Bacteria 1465
61 Ga0070667_100298619 3300005367 Bacteria 1450
62 Ga0070703_10058983 3300005406 Bacteria 1250
63 Ga0070709_10000052 3300005434 Bacteria 90029
64 Ga0070709_10239341 3300005434 Bacteria 1303
65 Ga0070701_10015140 3300005438 Bacteria 3554
66 Ga0070701_10075654 3300005438 Bacteria 1811
67 Ga0070701_10462321 3300005438 Bacteria 817
68 Ga0070705_100002598 3300005440 Bacteria 9051
69 Ga0070700_100012135 3300005441 Bacteria 4796
70 Ga0070700_100065934 3300005441 Bacteria 2297
71 Ga0070700_100106612 3300005441 Bacteria 1855
72 Ga0070694_100162670 3300005444 Bacteria 1639
73 Ga0070694_100296575 3300005444 Bacteria 1237
74 Ga0070708_100059240 3300005445 Bacteria 3414
75 Ga0070663_100512746 3300005455 Bacteria 997
76 Ga0070678_100025822 3300005456 Unclassified 3960
77 Ga0070678_100086028 3300005456 Bacteria 2397
78 Ga0070662_100004289 3300005457 Bacteria 9004
79 Ga0070662_100181647 3300005457 Bacteria 1659
80 Ga0070681_10118926 3300005458 Bacteria 2578
81 Ga0068867_100008692 3300005459 Bacteria 7169
82 Ga0068867_100076250 3300005459 Bacteria 2517
83 Ga0068867_100101523 3300005459 Bacteria 2198
84 Ga0068867_100121848 3300005459 Bacteria 2017
85 Ga0068867_100292275 3300005459 Bacteria 1340
86 Ga0070685_10011642 3300005466 Bacteria 4609
87 Ga0070706_100190772 3300005467 Bacteria 1915
88 Ga0070698_100772589 3300005471 Bacteria 904
89 Ga0070679_100042566 3300005530 Bacteria 4523
90 Ga0070684_100037966 3300005535 Bacteria 4135
91 Ga0068853_100278159 3300005539 Bacteria 1543
92 Ga0070672_100016034 3300005543 Bacteria 5355
93 Ga0070672_100025797 3300005543 Bacteria 4366
94 Ga0070672_100057751 3300005543 Bacteria 3047
95 Ga0070672_100140589 3300005543 Bacteria 1991
96 Ga0070672_100617879 3300005543 Bacteria 945
97 Ga0070686_100069479 3300005544 Bacteria 2301
98 Ga0070695_100089407 3300005545 Bacteria 2053
99 Ga0070696_100019044 3300005546 Bacteria 4647
100 Ga0070665_100006995 3300005548 Bacteria 11462
101 Ga0070665_100019521 3300005548 Bacteria 6805
102 Ga0070665_100067071 3300005548 Bacteria 3599
103 Ga0070665_100075009 3300005548 Bacteria 3388
104 Ga0070665_100266124 3300005548 Bacteria 1716
105 Ga0070665_100441307 3300005548 Unclassified 1311
106 Ga0070704_100004298 3300005549 Bacteria 8234
107 Ga0070704_100160662 3300005549 Bacteria 1777
108 Ga0070704_100242065 3300005549 Bacteria 1477
109 Ga0070664_100104009 3300005564 Bacteria 2472
110 Ga0068857_100277286 3300005577 Bacteria 1542
111 Ga0068857_100293737 3300005577 Bacteria 1497
112 Ga0068856_100123837 3300005614 Bacteria 2588
113 Ga0070702_100004301 3300005615 Bacteria 6489
114 Ga0068859_100009838 3300005617 Bacteria 9653
115 Ga0068859_100167266 3300005617 Bacteria 2279
116 Ga0068859_100189176 3300005617 Bacteria 2143
117 Ga0068864_100018642 3300005618 Bacteria 5799
118 Ga0068864_100405247 3300005618 Bacteria 1297
119 Ga0068864_100461066 3300005618 Bacteria 1217
120 Ga0068861_100000527 3300005719 Bacteria 22405
121 Ga0068861_100003035 3300005719 Bacteria 11088
122 Ga0068861_100006749 3300005719 Bacteria 7843
123 Ga0068861_100024936 3300005719 Bacteria 4330
124 Ga0068861_100212659 3300005719 Bacteria 1630
125 Ga0068861_100473530 3300005719 Bacteria 1127
126 Ga0068870_10005087 3300005840 Bacteria 5717
127 Ga0068870_10214234 3300005840 Bacteria 1175
128 Ga0068863_100005076 3300005841 Bacteria 12985
129 Ga0068863_100350956 3300005841 Bacteria 1436
130 Ga0068863_100470753 3300005841 Bacteria 1235
131 Ga0068858_100056981 3300005842 Bacteria 3611
132 Ga0068860_100003807 3300005843 Bacteria 15524
133 Ga0068860_100022709 3300005843 Bacteria 6065
134 Ga0068860_100046759 3300005843 Bacteria 4126
135 Ga0068860_100343893 3300005843 Bacteria 1467
136 Ga0068862_100000397 3300005844 Bacteria 47021
137 Ga0068862_100035410 3300005844 Bacteria 4228
138 Ga0068862_100045592 3300005844 Bacteria 3741
139 Ga0068862_100079883 3300005844 Bacteria 2835
140 Ga0068862_100095027 3300005844 Bacteria 2600
141 Ga0068862_100098520 3300005844 Bacteria 2554
142 Ga0068862_100116080 3300005844 Bacteria 2355
143 Ga0068862_100180405 3300005844 Bacteria 1895
144 Ga0068862_100189060 3300005844 Bacteria 1852
145 Ga0068862_100257892 3300005844 Bacteria 1591
146 Ga0068862_100356609 3300005844 Bacteria 1358
147 Ga0068862_100393179 3300005844 Bacteria 1295
148 Ga0081539_10039309 3300005985 Bacteria 2793
149 Ga0081539_10093321 3300005985 Bacteria 1550
150 Ga0075364_10000088 3300006051 Bacteria 36693
151 Ga0070712_100398543 3300006175 Bacteria 1136
152 Ga0097621_100013787 3300006237 Bacteria 6034
153 Ga0097621_100070263 3300006237 Bacteria 2891
154 Ga0097621_100186538 3300006237 Bacteria 1794
155 Ga0068871_100018590 3300006358 Bacteria 5287
156 Ga0068871_100310291 3300006358 Bacteria 1387
157 Ga0068871_100442695 3300006358 Bacteria 1163
158 Ga0075428_100014839 3300006844 Bacteria 8658
159 Ga0075428_100119918 3300006844 Bacteria 2863
160 Ga0075428_100330775 3300006844 Bacteria 1636
161 Ga0075430_100005316 3300006846 Bacteria 10867
162 Ga0075430_100018414 3300006846 Bacteria 5942
163 Ga0075430_100023730 3300006846 Bacteria 5224
164 Ga0075430_100044827 3300006846 Bacteria 3738
165 Ga0075430_100068661 3300006846 Bacteria 2973
166 Ga0075430_100162601 3300006846 Bacteria 1858
167 Ga0075431_100002456 3300006847 Bacteria 17843
168 Ga0075431_100008015 3300006847 Bacteria 10540
169 Ga0075431_100021583 3300006847 Bacteria 6586
170 Ga0075431_100038262 3300006847 Bacteria 4939
171 Ga0075431_100176502 3300006847 Bacteria 2194
172 Ga0075433_10010361 3300006852 Bacteria 7477
173 Ga0075433_10082411 3300006852 Bacteria 2837
174 Ga0075434_100006583 3300006871 Bacteria 10657
175 Ga0075429_100013156 3300006880 Bacteria 7178
176 Ga0075429_100014907 3300006880 Bacteria 6741
177 Ga0075429_100113491 3300006880 Bacteria 2368
178 Ga0097620_100009838 3300006931 Bacteria 9653
179 Ga0097620_100167255 3300006931 Bacteria 2279
180 Ga0097620_100189155 3300006931 Bacteria 2143
181 Ga0075435_100093548 3300007076 Bacteria 2484
182 Ga0075435_100689390 3300007076 Bacteria 888
183 Ga0099794_10009352 3300007265 Bacteria 4116
184 Ga0099795_10022729 3300007788 Bacteria 2073
185 Ga0105244_10016536 3300009036 Bacteria 4200
186 Ga0105240_10018364 3300009093 Bacteria 9393
187 Ga0105240_10033150 3300009093 Bacteria 6675
188 Ga0105240_10046990 3300009093 Bacteria 5464
189 Ga0105240_10053056 3300009093 Bacteria 5093
190 Ga0105240_10463258 3300009093 Bacteria 1416
191 Ga0111539_10013502 3300009094 Bacteria 10208
192 Ga0111539_10187353 3300009094 Bacteria 2416
193 Ga0111539_10210660 3300009094 Unclassified 2265
194 Ga0111539_10219175 3300009094 Bacteria 2216
195 Ga0111539_10306392 3300009094 Bacteria 1848
196 Ga0111539_10370073 3300009094 Bacteria 1668
197 Ga0111539_10536675 3300009094 Bacteria 1363
198 Ga0111539_10599427 3300009094 Bacteria 1283
199 Ga0105245_10015730 3300009098 Bacteria 6598
200 Ga0105245_10476479 3300009098 Bacteria 1261
201 Ga0114129_10034384 3300009147 Bacteria 7158
202 Ga0114129_10494455 3300009147 Bacteria 1598
203 Ga0105243_10007475 3300009148 Bacteria 8395
204 Ga0105243_10014090 3300009148 Bacteria 6049
205 Ga0105243_10863180 3300009148 Bacteria 897
206 Ga0105241_10112410 3300009174 Bacteria 2182
207 Ga0105241_10730364 3300009174 Bacteria 906
208 Ga0105242_10008662 3300009176 Bacteria 7808
209 Ga0105242_10788038 3300009176 Bacteria 940
210 Ga0105248_10126371 3300009177 Bacteria 2884
211 Ga0105248_10144479 3300009177 Bacteria 2684
212 Ga0105248_10661627 3300009177 Bacteria 1178
213 Ga0105238_10143320 3300009551 Bacteria 2366
214 Ga0105238_10252680 3300009551 Bacteria 1741
215 Ga0105238_10779387 3300009551 Bacteria 971
216 Ga0105249_10025495 3300009553 Bacteria 5323
217 Ga0105249_10050830 3300009553 Bacteria 3779
218 Ga0105249_10086074 3300009553 Bacteria 2930
219 Ga0099796_10001390 3300010159 Bacteria 4841
220 Ga0105239_11337704 3300010375 Bacteria 827
221 Ga0157373_10002057 3300013100 Bacteria 15242
222 Ga0157373_10066987 3300013100 Bacteria 2539
223 Ga0157371_10004109 3300013102 Bacteria 12851
224 Ga0157371_10022846 3300013102 Bacteria 4576
225 Ga0157371_10096541 3300013102 Unclassified 2095
226 Ga0157370_10004297 3300013104 Bacteria 16392
227 Ga0157370_10261642 3300013104 Bacteria 1599
228 Ga0157370_10436996 3300013104 Bacteria 1203
229 Ga0157369_10019662 3300013105 Bacteria 7558
230 Ga0157369_10262320 3300013105 Unclassified 1802
231 Ga0157374_10064416 3300013296 Bacteria 3439
232 Ga0157374_10237711 3300013296 Bacteria 1791
233 Ga0157374_10323687 3300013296 Bacteria 1528
234 Ga0157374_10856207 3300013296 Bacteria 926
235 Ga0157378_10031720 3300013297 Bacteria 4667
236 Ga0157378_10262800 3300013297 Bacteria 1657
237 Ga0163162_10001289 3300013306 Bacteria 23440
238 Ga0163162_10025926 3300013306 Bacteria 5793
239 Ga0163162_10037581 3300013306 Bacteria 4832
240 Ga0163162_10058035 3300013306 Bacteria 3899
241 Ga0163162_10213986 3300013306 Bacteria 2057
242 Ga0157372_10073761 3300013307 Bacteria 3847
243 Ga0157372_10210225 3300013307 Bacteria 2255
244 Ga0157375_10027128 3300013308 Bacteria 5349
245 Ga0157375_10105113 3300013308 Bacteria 2913
246 Ga0157375_10217118 3300013308 Bacteria 2070
247 Ga0157375_10309222 3300013308 Bacteria 1745
248 Ga0157375_10848143 3300013308 Bacteria 1060
249 Ga0157375_10848814 3300013308 Bacteria 1060
250 Ga0163163_10012452 3300014325 Bacteria 7750
251 Ga0163163_10015743 3300014325 Bacteria 7003
252 Ga0163163_10036565 3300014325 Bacteria 4771
253 Ga0157380_10000649 3300014326 Bacteria 21499
254 Ga0157380_10007255 3300014326 Bacteria 7863
255 Ga0157380_10347264 3300014326 Bacteria 1387
256 Ga0157380_11105320 3300014326 Bacteria 832
257 Ga0157377_10139962 3300014745 Bacteria 1486
258 Ga0157379_10003603 3300014968 Bacteria 13138
259 Ga0157379_10556404 3300014968 Unclassified 1068
260 Ga0157376_10021376 3300014969 Bacteria 5026
261 Ga0157376_10040278 3300014969 Bacteria 3818
262 Ga0157376_10069544 3300014969 Bacteria 2985
263 Ga0182006_1031091 3300015261 Bacteria 2154
264 Ga0182007_10000026 3300015262 Bacteria 168694
265 Ga0182005_1000232 3300015265 Bacteria 36038
266 Ga0182005_1001956 3300015265 Bacteria 7750
267 Ga0163161_10059141 3300017792 Bacteria 2786
268 Ga0163161_10179039 3300017792 Bacteria 1624
269 Ga0209676_1000037 3300025292 Bacteria 457562
270 Ga0209050_1020249 3300025298 Bacteria 2483
271 Ga0209257_1054537 3300025304 Bacteria 1112
272 Ga0207697_10116586 3300025315 Bacteria 1147
273 Ga0207653_10093170 3300025885 Bacteria 1057
274 Ga0207682_10005346 3300025893 Bacteria 5242
275 Ga0207682_10010687 3300025893 Bacteria 3592
276 Ga0207682_10250758 3300025893 Bacteria 824
277 Ga0207692_10065041 3300025898 Bacteria 1901
278 Ga0207688_10295376 3300025901 Bacteria 990
279 Ga0207680_10041328 3300025903 Bacteria 2689
280 Ga0207699_10000060 3300025906 Bacteria 90017
281 Ga0207645_10179480 3300025907 Unclassified 1389
282 Ga0207643_10009847 3300025908 Bacteria 5135
283 Ga0207643_10011227 3300025908 Bacteria 4837
284 Ga0207643_10033567 3300025908 Bacteria 2871
285 Ga0207643_10037939 3300025908 Bacteria 2705
286 Ga0207705_10269071 3300025909 Bacteria 1303
287 Ga0207695_10376332 3300025913 Bacteria 1306
288 Ga0207695_10412040 3300025913 Bacteria 1236
289 Ga0207693_10433162 3300025915 Bacteria 1028
290 Ga0207660_10041060 3300025917 Bacteria 3241
291 Ga0207660_10201559 3300025917 Unclassified 1554
292 Ga0207660_10216753 3300025917 Bacteria 1501
293 Ga0207649_10097394 3300025920 Bacteria 1940
294 Ga0207652_10051046 3300025921 Bacteria 3545
295 Ga0207652_10304735 3300025921 Bacteria 1438
296 Ga0207681_10000011 3300025923 Bacteria 366878
297 Ga0207681_10024601 3300025923 Bacteria 3866
298 Ga0207681_10062120 3300025923 Bacteria 2570
299 Ga0207694_10074230 3300025924 Bacteria 2662
300 Ga0207650_10009064 3300025925 Bacteria 6801
301 Ga0207650_10256458 3300025925 Bacteria 1417
302 Ga0207650_10286844 3300025925 Bacteria 1341
303 Ga0207650_10624504 3300025925 Bacteria 907
304 Ga0207659_10025093 3300025926 Unclassified 4000
305 Ga0207659_10093684 3300025926 Bacteria 2248
306 Ga0207659_10355045 3300025926 Bacteria 1217
307 Ga0207659_10798669 3300025926 Bacteria 811
308 Ga0207706_10001385 3300025933 Bacteria 24183
309 Ga0207706_10057595 3300025933 Bacteria 3423
310 Ga0207706_10481649 3300025933 Bacteria 1072
311 Ga0207706_10603181 3300025933 Bacteria 943
312 Ga0207686_10144633 3300025934 Bacteria 1648
313 Ga0207709_10007927 3300025935 Bacteria 5884
314 Ga0207670_10009435 3300025936 Bacteria 5571
315 Ga0207670_10016897 3300025936 Bacteria 4398
316 Ga0207669_10108738 3300025937 Bacteria 1852
317 Ga0207669_10163967 3300025937 Bacteria 1573
318 Ga0207669_10198891 3300025937 Bacteria 1453
319 Ga0207669_10233072 3300025937 Unclassified 1359
320 Ga0207704_10125858 3300025938 Bacteria 1764
321 Ga0207704_10295843 3300025938 Bacteria 1238
322 Ga0207691_10005061 3300025940 Bacteria 12720
323 Ga0207691_10006675 3300025940 Bacteria 11133
324 Ga0207691_10032630 3300025940 Bacteria 4854
325 Ga0207691_10043973 3300025940 Bacteria 4113
326 Ga0207691_10073274 3300025940 Bacteria 3088
327 Ga0207691_10278727 3300025940 Bacteria 1439
328 Ga0207691_10604571 3300025940 Bacteria 928
329 Ga0207711_10027197 3300025941 Bacteria 4804
330 Ga0207689_10306675 3300025942 Bacteria 1316
331 Ga0207689_10549740 3300025942 Bacteria 970
332 Ga0207651_10076331 3300025960 Bacteria 2395
333 Ga0207651_10144680 3300025960 Bacteria 1841
334 Ga0207651_10256096 3300025960 Bacteria 1434
335 Ga0207651_10372154 3300025960 Bacteria 1209
336 Ga0207651_10493050 3300025960 Bacteria 1058
337 Ga0207651_10517926 3300025960 Bacteria 1033
338 Ga0207712_10022995 3300025961 Bacteria 4110
339 Ga0207712_10307779 3300025961 Bacteria 1303
340 Ga0207668_10071822 3300025972 Bacteria 2474
341 Ga0207668_10082099 3300025972 Bacteria 2340
342 Ga0207668_10709348 3300025972 Bacteria 885
343 Ga0207668_10763008 3300025972 Bacteria 854
344 Ga0207658_10392418 3300025986 Bacteria 1218
345 Ga0207677_10088295 3300026023 Bacteria 2247
346 Ga0207703_10179185 3300026035 Bacteria 1869
347 Ga0207703_10580614 3300026035 Bacteria 1059
348 Ga0207639_10061673 3300026041 Bacteria 2897
349 Ga0207639_10676695 3300026041 Bacteria 956
350 Ga0207678_10371859 3300026067 Bacteria 1235
351 Ga0207678_10596419 3300026067 Bacteria 968
352 Ga0207708_10024778 3300026075 Bacteria 4539
353 Ga0207708_10049180 3300026075 Bacteria 3210
354 Ga0207708_10593091 3300026075 Bacteria 938
355 Ga0207702_10530960 3300026078 Bacteria 1149
356 Ga0207641_10101208 3300026088 Bacteria 2539
357 Ga0207641_10164574 3300026088 Bacteria 2019
358 Ga0207648_10007351 3300026089 Bacteria 10848
359 Ga0207648_10010933 3300026089 Bacteria 8577
360 Ga0207648_10014871 3300026089 Bacteria 7176
361 Ga0207648_10047085 3300026089 Bacteria 3780
362 Ga0207648_10190062 3300026089 Bacteria 1819
363 Ga0207676_10021615 3300026095 Bacteria 4722
364 Ga0207674_10296554 3300026116 Bacteria 1565
365 Ga0207674_10347363 3300026116 Bacteria 1434
366 Ga0207674_10353520 3300026116 Bacteria 1420
367 Ga0207675_100001153 3300026118 Bacteria 26238
368 Ga0207675_100001619 3300026118 Bacteria 22569
369 Ga0207675_100001636 3300026118 Bacteria 22459
370 Ga0207675_100009878 3300026118 Bacteria 8927
371 Ga0207675_100012041 3300026118 Bacteria 8081
372 Ga0207675_100020026 3300026118 Bacteria 6242
373 Ga0207675_100113857 3300026118 Bacteria 2554
374 Ga0207675_100174545 3300026118 Bacteria 2056
375 Ga0207683_10006218 3300026121 Bacteria 10235
376 Ga0207683_10006907 3300026121 Bacteria 9716
377 Ga0209973_1008604 3300027252 Unclassified 1168
378 Ga0209371_1000088 3300027312 Bacteria 174446
379 Ga0209984_1000372 3300027424 Bacteria 4916
380 Ga0209179_1001962 3300027512 Bacteria 2671
381 Ga0209999_1010195 3300027543 Bacteria 1697
382 Ga0209970_1004873 3300027614 Bacteria 2216
383 Ga0209970_1009220 3300027614 Bacteria 1613
384 Ga0210002_1000883 3300027617 Bacteria 4117
385 Ga0209588_1015449 3300027671 Bacteria 2347
386 Ga0209971_1001139 3300027682 Bacteria 6733
387 Ga0209971_1017080 3300027682 Bacteria 1722
388 Ga0209998_10000488 3300027717 Bacteria 10909
389 Ga0209974_10002247 3300027876 Bacteria 7022
390 Ga0209974_10063985 3300027876 Bacteria 1248
391 Ga0207428_10032490 3300027907 Bacteria 4292
392 Ga0207428_10053091 3300027907 Bacteria 3233
393 Ga0207428_10055124 3300027907 Bacteria 3162
394 Ga0207428_10217787 3300027907 Bacteria 1432
395 Ga0207428_10218302 3300027907 Bacteria 1430
396 Ga0207428_10240179 3300027907 Unclassified 1354
397 Ga0265354_1001125 3300028016 Bacteria 4095
398 Ga0265355_1002000 3300028036 Bacteria 1387
399 Ga0268266_10001818 3300028379 Bacteria 24143
400 Ga0268266_10040597 3300028379 Bacteria 3966
401 Ga0268266_10042978 3300028379 Bacteria 3861
402 Ga0268266_10046509 3300028379 Bacteria 3715
403 Ga0268266_10242556 3300028379 Bacteria 1664
404 Ga0268266_10245244 3300028379 Bacteria 1655
405 Ga0268266_10599526 3300028379 Bacteria 1058
406 Ga0268265_10007851 3300028380 Bacteria 7201
407 Ga0268265_10035296 3300028380 Bacteria 3652
408 Ga0268265_10052595 3300028380 Bacteria 3081
409 Ga0268265_10172775 3300028380 Bacteria 1849
410 Ga0268265_10265581 3300028380 Bacteria 1528
411 Ga0268265_10398571 3300028380 Bacteria 1271
412 Ga0268264_10011925 3300028381 Bacteria 7160
413 Ga0268264_10043460 3300028381 Bacteria 3724
414 Ga0268264_10093183 3300028381 Bacteria 2602
415 Ga0268264_10411185 3300028381 Bacteria 1303
416 Ga0268264_10641488 3300028381 Bacteria 1050
417 Ga0265323_10018643 3300028653 Bacteria 2684
418 Ga0307515_10061597 3300028794 Bacteria 5318
419 Ga0268256_1000079 3300030500 Bacteria 174445
420 Ga0265770_1000303 3300030878 Bacteria 6670
421 Ga0265760_10000729 3300031090 Bacteria 9376
422 Ga0265330_10027038 3300031235 Bacteria 2593
423 Ga0265328_10002990 3300031239 Bacteria 7544
424 Ga0265340_10110169 3300031247 Bacteria 1274
425 Ga0265316_10246068 3300031344 Bacteria 1314
426 Ga0307513_10009164 3300031456 Bacteria 12535
427 Ga0307513_10018384 3300031456 Bacteria 8353
428 Ga0307513_10507026 3300031456 Bacteria 923
429 Ga0307509_10000917 3300031507 Bacteria 50450
430 Ga0307509_10079049 3300031507 Bacteria 3406
431 Ga0307408_100033275 3300031548 Bacteria 3601
432 Ga0307408_100450584 3300031548 Bacteria 1116
433 Ga0307508_10030002 3300031616 Bacteria 4915
434 Ga0307508_10315645 3300031616 Bacteria 1155
435 Ga0316576_10011259 3300031727 Bacteria 5852
436 Ga0316576_10120140 3300031727 Bacteria 1972
437 Ga0316578_10017805 3300031728 Bacteria 3876
438 Ga0316578_10204827 3300031728 Unclassified 1187
439 Ga0307405_10333863 3300031731 Bacteria 1163
440 Ga0316577_10063038 3300031733 Bacteria 2070
441 Ga0307413_10028003 3300031824 Bacteria 3131
442 Ga0307413_10052318 3300031824 Bacteria 2465
443 Ga0307413_10110128 3300031824 Bacteria 1842
444 Ga0307413_10167757 3300031824 Bacteria 1550
445 Ga0307413_10203426 3300031824 Bacteria 1432
446 Ga0307413_10519207 3300031824 Bacteria 960
447 Ga0307410_10010554 3300031852 Bacteria 5240
448 Ga0307410_10047747 3300031852 Bacteria 2863
449 Ga0307410_10126978 3300031852 Bacteria 1868
450 Ga0307410_10189512 3300031852 Bacteria 1563
451 Ga0307410_10749127 3300031852 Bacteria 827
452 Ga0307406_10125172 3300031901 Bacteria 1794
453 Ga0307406_10614494 3300031901 Bacteria 898
454 Ga0307407_10056575 3300031903 Bacteria 2272
455 Ga0307407_10118171 3300031903 Bacteria 1676
456 Ga0307407_10197336 3300031903 Unclassified 1346
457 Ga0307407_10230918 3300031903 Bacteria 1257
458 Ga0307407_10256096 3300031903 Unclassified 1202
459 Ga0307407_10460577 3300031903 Bacteria 925
460 Ga0307412_10019465 3300031911 Bacteria 4112
461 Ga0307412_10045139 3300031911 Bacteria 2879
462 Ga0307412_10189210 3300031911 Bacteria 1555
463 Ga0307412_10200582 3300031911 Bacteria 1515
464 Ga0307409_100003347 3300031995 Bacteria 8683
465 Ga0307409_100016236 3300031995 Bacteria 4919
466 Ga0307409_100160646 3300031995 Bacteria 1964
467 Ga0307409_100301890 3300031995 Bacteria 1490
468 Ga0307416_100393669 3300032002 Bacteria 1420
469 Ga0307416_100545103 3300032002 Bacteria 1232
470 Ga0307416_100876231 3300032002 Bacteria 997
471 Ga0307414_10068010 3300032004 Bacteria 2554
472 Ga0307414_10210782 3300032004 Bacteria 1588
473 Ga0307414_10420650 3300032004 Bacteria 1165
474 Ga0307411_10125570 3300032005 Bacteria 1865
475 Ga0307411_10313493 3300032005 Bacteria 1263
476 Ga0307411_10346498 3300032005 Bacteria 1209
477 Ga0307411_10384073 3300032005 Unclassified 1156
478 Ga0307411_10407819 3300032005 Bacteria 1125
479 Ga0307415_100062571 3300032126 Bacteria 2582
480 Ga0307415_100721902 3300032126 Bacteria 902
481 Ga0316585_10010275 3300032137 Bacteria 2745
482 Ga0316580_10017135 3300032139 Bacteria 2226
483 Ga0373929_0000013 3300035085 Bacteria 159542
484 Ga0373923_0113113 3300035111 Bacteria 1207
485 Ga0373923_0116849 3300035111 Bacteria 1189
486 Ga0373936_0142304 3300035113 Bacteria 1036
487 Ga0373954_0190878 3300035118 Bacteria 1006
488 Ga0316574_0000082 3300035398 Bacteria 26722
489 Ga0316574_0051564 3300035398 Bacteria 2564
490 Ga0316574_0077286 3300035398 Bacteria 2109
491 Ga0373924_0258821 3300035410 Bacteria 771
492 Ga0373935_0242959 3300035692 Bacteria 1258
493 Ga0373927_0482534 3300035695 Bacteria 819
494 Ga0373933_0051323 3300035724 Bacteria 2465
495 Ga0373933_0151508 3300035724 Bacteria 1469
496 Ga0373937_0049317 3300036401 Bacteria 3856
497 Ga0373937_0072428 3300036401 Unclassified 3178
498 Ga0373937_0172859 3300036401 Bacteria 2027
499 Ga0316582_0053817 3300036647 Bacteria 2561
500 Ga0316584_0015059 3300036712 Bacteria 5525
501 Ga0316584_0278764 3300036712 Bacteria 1215
502 Ga0373925_0128677 3300037068 Bacteria 1972
503 Ga0395900_0086081 3300037418 Bacteria 3230
504 Ga0395900_0320964 3300037418 Bacteria 1529
505 Ga0439461_0031014 3300041410 Bacteria 1114
506 Ga0451789_0547898 3300041443 Bacteria 852
507 Ga0451793_0183807 3300041452 Bacteria 1589
508 Ga0451793_0710391 3300041452 Bacteria 1193
509 Ga0451797_0052733 3300041453 Bacteria 1043
510 Ga0451798_1030345 3300041458 Bacteria 1641
511 Ga0451800_0240496 3300041459 Bacteria 8749
512 Ga0451802_0719910 3300041460 Bacteria 2349
513 Ga0451802_1128143 3300041460 Bacteria 2954
514 Ga0451806_181564 3300041462 Bacteria 4991
515 Ga0451804_0695803 3300041463 Bacteria 1265
516 Ga0451807_0587428 3300041486 Bacteria 3919
517 Ga0451807_1394934 3300041486 Bacteria 1576
518 Ga0451837_1124078 3300041494 Bacteria 1232
519 Ga0451853_2462324 3300041512 Bacteria 1027
520 Ga0439441_002426 3300042001 Bacteria 2625
521 Ga0439442_025811 3300042002 Bacteria 1223
522 Ga0439443_003965 3300042003 Bacteria 1902
523 Ga0439457_027137 3300042014 Bacteria 1268
524 Ga0450913_006547 3300042117 Bacteria 857
525 Ga0450920_016177 3300042122 Bacteria 1421
526 Ga0450923_000826 3300042125 Bacteria 3739
527 Ga0450923_046524 3300042125 Bacteria 924
528 Ga0450892_013414 3300042130 Bacteria 747
529 Ga0450894_015048 3300042131 Unclassified 1024
530 Ga0450910_008021 3300042147 Bacteria 1481
531 Ga0439446_0003583 3300042156 Bacteria 3868
532 Ga0450908_001374 3300042184 Bacteria 4718
533 Ga0450908_008072 3300042184 Bacteria 1974
534 Ga0439434_0012512 3300042435 Bacteria 2510
535 Ga0439434_0020238 3300042435 Bacteria 1997
536 Ga0439435_0010756 3300042436 Bacteria 2180
537 Ga0439444_0002654 3300042437 Bacteria 2464
538 Ga0439459_0050476 3300042438 Bacteria 912
539 Ga0439459_0057928 3300042438 Bacteria 868
540 Ga0439464_0054312 3300042439 Bacteria 1164
541 Ga0451577_0004168 3300042876 Bacteria 15459
542 Ga0451577_0019662 3300042876 Bacteria 6207
543 Ga0451577_0064759 3300042876 Bacteria 3259
544 Ga0451577_0087073 3300042876 Bacteria 2787
545 Ga0451577_0115667 3300042876 Bacteria 2402
546 Ga0451577_0133790 3300042876 Bacteria 2225
547 Ga0451577_0388112 3300042876 Bacteria 1267
548 Ga0453683_0004351 3300044673 Bacteria 10083
549 Ga0453684_0011204 3300044712 Bacteria 15096
550 Ga0453684_0070049 3300044712 Bacteria 4443
551 Ga0453684_0111257 3300044712 Bacteria 3327
552 Ga0451576_0018930 3300045051 Bacteria 7524
553 Ga0451576_0035970 3300045051 Bacteria 5252
554 Ga0451576_0084585 3300045051 Bacteria 3300
555 Ga0451576_0682027 3300045051 Bacteria 1080
556 Ga0466967_0084948 3300045976 Bacteria 2865
557 Ga0466967_0267970 3300045976 Bacteria 1636
558 Ga0495591_062448 3300046458 Bacteria 986
559 Ga0495629_0162345 3300046459 Unclassified 1552
560 Ga0495638_0003097 3300046460 Bacteria 13188
561 Ga0495638_0004722 3300046460 Bacteria 10293
562 Ga0495641_0082501 3300046461 Unclassified 1439
563 Ga0495580_0121422 3300046472 Bacteria 1814
564 Ga0495580_0239364 3300046472 Bacteria 1245
565 Ga0495639_0264687 3300046475 Bacteria 852
566 Ga0495662_0152760 3300046476 Bacteria 1137
567 Ga0495594_0236721 3300046499 Unclassified 1041
568 Ga0495596_0116669 3300046500 Bacteria 1037
569 Ga0495620_0040095 3300046515 Unclassified 2064
570 Ga0495644_0087007 3300046523 Bacteria 1178
571 Ga0495663_0014292 3300046525 Bacteria 2224
572 Ga0495621_0000461 3300046539 Bacteria 9955
573 Ga0495633_0025356 3300046558 Bacteria 2920
574 Ga0495633_0137794 3300046558 Bacteria 1129
575 Ga0495668_0000301 3300046616 Bacteria 68097
576 Ga0495611_0147289 3300046648 Bacteria 1099
577 Ga0495625_0004196 3300046660 Bacteria 13729
578 Ga0495625_0006418 3300046660 Bacteria 10476
579 Ga0495635_0280715 3300046663 Bacteria 1119
580 Ga0495647_0008140 3300046681 Bacteria 3524
581 Ga0495647_0130099 3300046681 Bacteria 1066
582 Ga0495658_0008463 3300046683 Bacteria 5099
583 Ga0495649_0006367 3300046694 Bacteria 7347
584 Ga0495600_0417447 3300046809 Bacteria 833
585 Ga0495604_0159213 3300047317 Bacteria 1597
586 Ga0495672_0053133 3300047320 Bacteria 2376
587 Ga0495672_0209160 3300047320 Bacteria 970
588 Ga0495680_0022654 3300047322 Bacteria 5233
589 Ga0495686_0086557 3300047472 Bacteria 1907
590 Ga0495686_0128273 3300047472 Bacteria 1506
591 Ga0495615_0094842 3300048090 Bacteria 836
592 Ga0496100_0088027 3300048903 Bacteria 2113
593 Ga0496101_0210322 3300048904 Bacteria 1507
594 Ga0496101_0675608 3300048904 Bacteria 816
595 Ga0496104_0027158 3300048907 Bacteria 5295
596 Ga0496104_0141811 3300048907 Bacteria 2309
597 Ga0496104_0278849 3300048907 Bacteria 1584
598 Ga0496105_0005317 3300048908 Bacteria 9757
599 Ga0496107_0087823 3300048910 Bacteria 2270
600 Ga0496108_0103481 3300048911 Bacteria 2429
601 Ga0496109_0093010 3300048912 Bacteria 2789
602 Ga0496110_0014082 3300048913 Bacteria 6630
603 Ga0496110_0298768 3300048913 Bacteria 1467
604 Ga0496111_0036773 3300048914 Bacteria 3502
605 Ga0496114_0000012 3300048917 Bacteria 347477
606 Ga0496114_0004286 3300048917 Bacteria 11042
607 Ga0496114_0055180 3300048917 Bacteria 3314
608 Ga0496115_0028254 3300048918 Bacteria 4395
609 Ga0496118_0133750 3300048921 Bacteria 1586
610 Ga0496118_0165031 3300048921 Bacteria 1362
611 Ga0496119_0000654 3300048922 Bacteria 46601
612 Ga0496120_0002845 3300048923 Bacteria 16670
613 Ga0496121_0195671 3300048924 Unclassified 1445
614 Ga0496124_0039548 3300048927 Bacteria 4087
615 Ga0496124_0061500 3300048927 Bacteria 3147
616 Ga0496124_0251499 3300048927 Bacteria 1307
617 Ga0496125_0036816 3300048928 Bacteria 4264
618 Ga0496126_0003314 3300048929 Bacteria 20493
619 Ga0496126_0025761 3300048929 Bacteria 5651
620 Ga0501299_003641 3300049522 Bacteria 2248
621 Ga0501032_0071060 3300049569 Bacteria 2320
622 Ga0501032_0249330 3300049569 Bacteria 1153
623 Ga0501032_0435885 3300049569 Bacteria 840
624 Ga0501034_0002645 3300049571 Bacteria 21210
625 Ga0501034_0227623 3300049571 Unclassified 1815
626 Ga0501034_0736583 3300049571 Bacteria 882
627 Ga0501036_0030507 3300049572 Bacteria 4553
628 Ga0501036_0466258 3300049572 Bacteria 1052
629 Ga0501037_0105310 3300049573 Bacteria 2033
630 Ga0501037_0282802 3300049573 Bacteria 1155
631 Ga0501037_0416732 3300049573 Bacteria 920
632 Ga0501038_0025830 3300049574 Bacteria 5233
633 Ga0501038_0298140 3300049574 Bacteria 1266
634 Ga0501038_0567121 3300049574 Bacteria 862
635 Ga0501039_0044409 3300049575 Bacteria 3432
636 Ga0501040_0055542 3300049576 Bacteria 2715
637 Ga0501040_0084697 3300049576 Bacteria 2200
638 Ga0501040_0146277 3300049576 Bacteria 1666
639 Ga0501040_0322245 3300049576 Bacteria 1105
640 Ga0501042_0133158 3300049578 Bacteria 1792
641 Ga0501042_0213609 3300049578 Bacteria 1391
642 Ga0501042_0289518 3300049578 Bacteria 1183
643 Ga0501042_0345422 3300049578 Bacteria 1076
644 Ga0501046_0527008 3300049580 Bacteria 844
645 Ga0501047_0064156 3300049581 Bacteria 3543
646 Ga0501048_0107002 3300049582 Bacteria 1974
647 Ga0501067_0146389 3300049583 Bacteria 1316
648 Ga0501068_0003038 3300049584 Bacteria 8961
649 Ga0501068_0005358 3300049584 Bacteria 7011
650 Ga0501068_0232203 3300049584 Bacteria 1173
651 Ga0501068_0442858 3300049584 Bacteria 840
652 Ga0501069_0153267 3300049585 Bacteria 1325
653 Ga0501069_0168442 3300049585 Bacteria 1263
654 Ga0501070_0162762 3300049586 Bacteria 1839
655 Ga0501071_0018970 3300049587 Bacteria 4771
656 Ga0501072_0035075 3300049588 Bacteria 3932
657 Ga0501072_0233419 3300049588 Bacteria 1465
658 Ga0501073_0006306 3300049589 Bacteria 8835
659 Ga0501073_0018770 3300049589 Bacteria 4999
660 Ga0501074_0006860 3300049590 Bacteria 8224
661 Ga0501074_0085123 3300049590 Bacteria 2266
662 Ga0501075_0115272 3300049591 Bacteria 2043
663 Ga0501075_0159984 3300049591 Bacteria 1718
664 Ga0501075_0212097 3300049591 Bacteria 1477
665 Ga0501076_0109772 3300049592 Bacteria 2230
666 Ga0501076_0166659 3300049592 Bacteria 1796
667 Ga0501076_0222785 3300049592 Bacteria 1541
668 Ga0501076_0250935 3300049592 Bacteria 1448
669 Ga0501077_0000284 3300049593 Bacteria 30131
670 Ga0501077_0058480 3300049593 Bacteria 2447
671 Ga0501079_0181059 3300049741 Bacteria 1644
672 Ga0501079_0619433 3300049741 Bacteria 852
673 Ga0501080_0002960 3300049742 Bacteria 14936
674 Ga0501080_0005108 3300049742 Bacteria 11690
675 Ga0501080_0018349 3300049742 Bacteria 6475
676 Ga0501080_0118364 3300049742 Bacteria 2456
677 Ga0501081_0008371 3300049743 Bacteria 6713
678 Ga0501081_0526982 3300049743 Bacteria 881
679 Ga0501083_0006836 3300049744 Bacteria 8097
680 Ga0501083_0044268 3300049744 Bacteria 3013
681 Ga0501035_0150709 3300049822 Bacteria 2018
682 Ga0501035_0444214 3300049822 Bacteria 1074
683 Ga0501045_0123450 3300049824 Bacteria 1923
684 Ga0501045_0125573 3300049824 Bacteria 1906
685 nmdc:mga0k408_14294_c1 3300050493 Bacteria 4370
686 nmdc:mga05p37_16649_c1 3300050507 Bacteria 8856
687 nmdc:mga09592_111787_c1 3300050508 Unclassified 2344
688 nmdc:mga09592_210152_c1 3300050508 Bacteria 1686
689 nmdc:mga09592_21800_c1 3300050508 Bacteria 5282
690 nmdc:mga09592_26339_c1 3300050508 Bacteria 4817
691 nmdc:mga09592_99994_c1 3300050508 Bacteria 2483
692 nmdc:mga0qj67_107240_c1 3300050509 Unclassified 2253
693 nmdc:mga0qj67_12212_c1 3300050509 Bacteria 6465
694 nmdc:mga0qj67_17995_c1 3300050509 Bacteria 5381
695 nmdc:mga0qj67_18857_c1 3300050509 Bacteria 5263
696 nmdc:mga0qj67_21133_c1 3300050509 Bacteria 4991
697 nmdc:mga06r32_1582_c1 3300050510 Bacteria 20519
698 nmdc:mga06r32_181759_c1 3300050510 Bacteria 2089
699 nmdc:mga06r32_18542_c1 3300050510 Bacteria 6374
700 nmdc:mga06r32_4811_c1 3300050510 Bacteria 12154
701 nmdc:mga06r32_5847_c1 3300050510 Bacteria 11070
702 nmdc:mga08y16_11594_c1 3300050511 Bacteria 9263
703 nmdc:mga08y16_126944_c1 3300050511 Bacteria 2653
704 nmdc:mga08y16_135236_c1 3300050511 Bacteria 2562
705 nmdc:mga08y16_165697_c1 3300050511 Bacteria 2296
706 nmdc:mga08y16_203617_c1 3300050511 Bacteria 2051
707 nmdc:mga08y16_23930_c1 3300050511 Bacteria 6450
708 nmdc:mga08y16_328726_c1 3300050511 Bacteria 1573
709 nmdc:mga08y16_43919_c1 3300050511 Bacteria 4683
710 nmdc:mga08y16_897251_c1 3300050511 Bacteria 873
711 nmdc:mga0n895_12548_c1 3300050512 Bacteria 7603
712 nmdc:mga0rr50_22787_c1 3300050513 Bacteria 4304
713 nmdc:mga0a205_13295_c2 3300050515 Bacteria 6774
714 nmdc:mga0a205_292515_c1 3300050515 Bacteria 1503
715 nmdc:mga0a205_471083_c1 3300050515 Bacteria 1115
716 Ga0495601_0230812 3300053077 Bacteria 1209
717 Ga0495619_0360865 3300053085 Bacteria 1005
718 Ga0500578_0000131 3300053086 Bacteria 89434
719 Ga0500644_0048730 3300053088 Bacteria 1443
720 Ga0500646_0006436 3300053090 Bacteria 2987
721 Ga0500651_0067147 3300053093 Bacteria 2233
722 Ga0500566_0270225 3300053094 Bacteria 816
723 Ga0500641_0001484 3300053096 Bacteria 8369
724 Ga0500556_0043776 3300053104 Bacteria 1591
725 Ga0500652_058290 3300053131 Bacteria 1586
726 Ga0500658_0038616 3300053134 Bacteria 1904
727 Ga0500559_0037976 3300053136 Bacteria 2090
728 Ga0500568_0014985 3300053139 Bacteria 3480
729 Ga0500568_0094871 3300053139 Bacteria 1123
730 Ga0500604_0003185 3300053151 Unclassified 4410
731 Ga0500622_0000006 3300053156 Bacteria 464021
732 Ga0500622_0000213 3300053156 Bacteria 61430
733 Ga0500622_0001608 3300053156 Bacteria 17744
734 Ga0500622_0010663 3300053156 Bacteria 5030
735 Ga0500627_0114584 3300053158 Unclassified 1214
736 Ga0500637_0009124 3300053178 Bacteria 5035
737 Ga0501084_0010970 3300054114 Bacteria 7505
738 Ga0501084_0038822 3300054114 Bacteria 3981
739 Ga0501084_0202090 3300054114 Bacteria 1677
740 Ga0590071_080189 3300059421 Bacteria 811
741 Ga0501082_0000011 3300060353 Bacteria 121336
742 Ga0501082_0007297 3300060353 Bacteria 9536
743 Ga0501082_0181969 3300060353 Bacteria 1828
744 Ga0530510_0032713 3300061734 Bacteria 3743
745 Ga0530510_0046251 3300061734 Bacteria 3144
746 Ga0530510_0352649 3300061734 Bacteria 1105
747 Ga0530510_0442852 3300061734 Bacteria 982
748 Ga0530510_0734589 3300061734 Bacteria 753
749 2525558092 2524614729 Bacteria 3091755
750 2547501404 2547132130 Bacteria 4660562
751 2578457287 2576861471 Bacteria 4648976
752 2630649895 2627854209 Bacteria 3093011
753 2747949418 2747842428 Bacteria 4689383
754 2765580203 2765235840 Bacteria 4663337
755 2819660884 2818991457 Bacteria 5323295
756 2842759981 2842757796 Bacteria 3981385
757 2852652403 2852649853 Bacteria 4036942
758 2852686760 2852684882 Bacteria 5463342
759 2914759885 2914759650 Bacteria 4701441
760 2919134034 2919130084 Bacteria 5301837
761 2919137780 2919134579 Bacteria 4480386
762 2923519394 2923516293 Bacteria 3716336
763 2929196684 2929195423 Bacteria 5325372
764 2941479022 2941475908 Bacteria 4145589
765 8003015161 8003014200 Bacteria 4059994
766 8021623627 8021622325 Bacteria 4844743
767 8021627451 8021626552 Bacteria 4665214
768 8021650582 8021648035 Bacteria 4772378
769 Ga0373937_0409349
770 SwRhRL2b_contig_857857
771 JGI24744J21845_10011345
772 rootH1_10000284
773 rootH2_10088031
774 rootL2_10038226
775 rootL2_10118395
776 rootH1_10059569
777 Ga0055536_1007237
778 Ga0058692_1000033
779 Ga0065704_10000377
780 Ga0065704_10004068
781 Ga0065704_10141904
782 Ga0065707_10092373
783 Ga0070658_10062502
784 Ga0070690_100118984
785 Ga0070670_100014994
786 Ga0070670_100484579
787 Ga0070670_100499455
788 Ga0070670_100536268
789 Ga0068869_100270298
790 Ga0070666_10019216
791 Ga0070666_10052239
792 Ga0070680_100074940
793 Ga0070680_100180567
794 Ga0070682_100059298
795 Ga0068868_100016001
796 Ga0070660_100686634
797 Ga0070689_100249865
798 Ga0070689_100261834
799 Ga0070687_100161397
800 Ga0070661_100018082
801 Ga0070692_10058900
802 Ga0070668_100003484
803 Ga0070668_100143434
804 Ga0070668_100281641
805 Ga0070669_100000010
806 Ga0070669_100007130
807 Ga0070669_100027116
808 Ga0070669_100062248
809 Ga0070669_100407993
810 Ga0070675_100014637
811 Ga0070675_100042910
812 Ga0070675_100045587
813 Ga0070675_100203992
814 Ga0070671_100040061
815 Ga0070671_100277291
816 Ga0070674_100027099
817 Ga0070674_100183113
818 Ga0070674_100249179
819 Ga0070674_100370956
820 Ga0070674_100653496
821 Ga0070673_100066843
822 Ga0070673_100295350
823 Ga0070688_100042495
824 Ga0070688_100192851
825 Ga0070688_100279620
826 Ga0070667_100001093
827 Ga0070667_100101567
828 Ga0070667_100292567
829 Ga0070667_100298619
830 Ga0070703_10058983
831 Ga0070709_10000052
832 Ga0070709_10239341
833 Ga0070701_10015140
834 Ga0070701_10075654
835 Ga0070701_10462321
836 Ga0070705_100002598
837 Ga0070700_100012135
838 Ga0070700_100065934
839 Ga0070700_100106612
840 Ga0070694_100162670
841 Ga0070694_100296575
842 Ga0070708_100059240
843 Ga0070663_100512746
844 Ga0070678_100025822
845 Ga0070678_100086028
846 Ga0070662_100004289
847 Ga0070662_100181647
848 Ga0070681_10118926
849 Ga0068867_100008692
850 Ga0068867_100076250
851 Ga0068867_100101523
852 Ga0068867_100121848
853 Ga0068867_100292275
854 Ga0070685_10011642
855 Ga0070706_100190772
856 Ga0070698_100772589
857 Ga0070679_100042566
858 Ga0070684_100037966
859 Ga0068853_100278159
860 Ga0070672_100016034
861 Ga0070672_100025797
862 Ga0070672_100057751
863 Ga0070672_100140589
864 Ga0070672_100617879
865 Ga0070686_100069479
866 Ga0070695_100089407
867 Ga0070696_100019044
868 Ga0070665_100006995
869 Ga0070665_100019521
870 Ga0070665_100067071
871 Ga0070665_100075009
872 Ga0070665_100266124
873 Ga0070665_100441307
874 Ga0070704_100004298
875 Ga0070704_100160662
876 Ga0070704_100242065
877 Ga0070664_100104009
878 Ga0068857_100277286
879 Ga0068857_100293737
880 Ga0068856_100123837
881 Ga0070702_100004301
882 Ga0068859_100009838
883 Ga0068859_100167266
884 Ga0068859_100189176
885 Ga0068864_100018642
886 Ga0068864_100405247
887 Ga0068864_100461066
888 Ga0068861_100000527
889 Ga0068861_100003035
890 Ga0068861_100006749
891 Ga0068861_100024936
892 Ga0068861_100212659
893 Ga0068861_100473530
894 Ga0068870_10005087
895 Ga0068870_10214234
896 Ga0068863_100005076
897 Ga0068863_100350956
898 Ga0068863_100470753
899 Ga0068858_100056981
900 Ga0068860_100003807
901 Ga0068860_100022709
902 Ga0068860_100046759
903 Ga0068860_100343893
904 Ga0068862_100000397
905 Ga0068862_100035410
906 Ga0068862_100045592
907 Ga0068862_100079883
908 Ga0068862_100095027
909 Ga0068862_100098520
910 Ga0068862_100116080
911 Ga0068862_100180405
912 Ga0068862_100189060
913 Ga0068862_100257892
914 Ga0068862_100356609
915 Ga0068862_100393179
916 Ga0081539_10039309
917 Ga0081539_10093321
918 Ga0075364_10000088
919 Ga0070712_100398543
920 Ga0097621_100013787
921 Ga0097621_100070263
922 Ga0097621_100186538
923 Ga0068871_100018590
924 Ga0068871_100310291
925 Ga0068871_100442695
926 Ga0075428_100014839
927 Ga0075428_100119918
928 Ga0075428_100330775
929 Ga0075430_100005316
930 Ga0075430_100018414
931 Ga0075430_100023730
932 Ga0075430_100044827
933 Ga0075430_100068661
934 Ga0075430_100162601
935 Ga0075431_100002456
936 Ga0075431_100008015
937 Ga0075431_100021583
938 Ga0075431_100038262
939 Ga0075431_100176502
940 Ga0075433_10010361
941 Ga0075433_10082411
942 Ga0075434_100006583
943 Ga0075429_100013156
944 Ga0075429_100014907
945 Ga0075429_100113491
946 Ga0097620_100009838
947 Ga0097620_100167255
948 Ga0097620_100189155
949 Ga0075435_100093548
950 Ga0075435_100689390
951 Ga0099794_10009352
952 Ga0099795_10022729
953 Ga0105244_10016536
954 Ga0105240_10018364
955 Ga0105240_10033150
956 Ga0105240_10046990
957 Ga0105240_10053056
958 Ga0105240_10463258
959 Ga0111539_10013502
960 Ga0111539_10187353
961 Ga0111539_10210660
962 Ga0111539_10219175
963 Ga0111539_10306392
964 Ga0111539_10370073
965 Ga0111539_10536675
966 Ga0111539_10599427
967 Ga0105245_10015730
968 Ga0105245_10476479
969 Ga0114129_10034384
970 Ga0114129_10494455
971 Ga0105243_10007475
972 Ga0105243_10014090
973 Ga0105243_10863180
974 Ga0105241_10112410
975 Ga0105241_10730364
976 Ga0105242_10008662
977 Ga0105242_10788038
978 Ga0105248_10126371
979 Ga0105248_10144479
980 Ga0105248_10661627
981 Ga0105238_10143320
982 Ga0105238_10252680
983 Ga0105238_10779387
984 Ga0105249_10025495
985 Ga0105249_10050830
986 Ga0105249_10086074
987 Ga0099796_10001390
988 Ga0105239_11337704
989 Ga0157373_10002057
990 Ga0157373_10066987
991 Ga0157371_10004109
992 Ga0157371_10022846
993 Ga0157371_10096541
994 Ga0157370_10004297
995 Ga0157370_10261642
996 Ga0157370_10436996
997 Ga0157369_10019662
998 Ga0157369_10262320
999 Ga0157374_10064416
1000 Ga0157374_10237711
1001 Ga0157374_10323687
1002 Ga0157374_10856207
1003 Ga0157378_10031720
1004 Ga0157378_10262800
1005 Ga0163162_10001289
1006 Ga0163162_10025926
1007 Ga0163162_10037581
1008 Ga0163162_10058035
1009 Ga0163162_10213986
1010 Ga0157372_10073761
1011 Ga0157372_10210225
1012 Ga0157375_10027128
1013 Ga0157375_10105113
1014 Ga0157375_10217118
1015 Ga0157375_10309222
1016 Ga0157375_10848143
1017 Ga0157375_10848814
1018 Ga0163163_10012452
1019 Ga0163163_10015743
1020 Ga0163163_10036565
1021 Ga0157380_10000649
1022 Ga0157380_10007255
1023 Ga0157380_10347264
1024 Ga0157380_11105320
1025 Ga0157377_10139962
1026 Ga0157379_10003603
1027 Ga0157379_10556404
1028 Ga0157376_10021376
1029 Ga0157376_10040278
1030 Ga0157376_10069544
1031 Ga0182006_1031091
1032 Ga0182007_10000026
1033 Ga0182005_1000232
1034 Ga0182005_1001956
1035 Ga0163161_10059141
1036 Ga0163161_10179039
1037 Ga0209676_1000037
1038 Ga0209050_1020249
1039 Ga0209257_1054537
1040 Ga0207697_10116586
1041 Ga0207653_10093170
1042 Ga0207682_10005346
1043 Ga0207682_10010687
1044 Ga0207682_10250758
1045 Ga0207692_10065041
1046 Ga0207688_10295376
1047 Ga0207680_10041328
1048 Ga0207699_10000060
1049 Ga0207645_10179480
1050 Ga0207643_10009847
1051 Ga0207643_10011227
1052 Ga0207643_10033567
1053 Ga0207643_10037939
1054 Ga0207705_10269071
1055 Ga0207695_10376332
1056 Ga0207695_10412040
1057 Ga0207693_10433162
1058 Ga0207660_10041060
1059 Ga0207660_10201559
1060 Ga0207660_10216753
1061 Ga0207649_10097394
1062 Ga0207652_10051046
1063 Ga0207652_10304735
1064 Ga0207681_10000011
1065 Ga0207681_10024601
1066 Ga0207681_10062120
1067 Ga0207694_10074230
1068 Ga0207650_10009064
1069 Ga0207650_10256458
1070 Ga0207650_10286844
1071 Ga0207650_10624504
1072 Ga0207659_10025093
1073 Ga0207659_10093684
1074 Ga0207659_10355045
1075 Ga0207659_10798669
1076 Ga0207706_10001385
1077 Ga0207706_10057595
1078 Ga0207706_10481649
1079 Ga0207706_10603181
1080 Ga0207686_10144633
1081 Ga0207709_10007927
1082 Ga0207670_10009435
1083 Ga0207670_10016897
1084 Ga0207669_10108738
1085 Ga0207669_10163967
1086 Ga0207669_10198891
1087 Ga0207669_10233072
1088 Ga0207704_10125858
1089 Ga0207704_10295843
1090 Ga0207691_10005061
1091 Ga0207691_10006675
1092 Ga0207691_10032630
1093 Ga0207691_10043973
1094 Ga0207691_10073274
1095 Ga0207691_10278727
1096 Ga0207691_10604571
1097 Ga0207711_10027197
1098 Ga0207689_10306675
1099 Ga0207689_10549740
1100 Ga0207651_10076331
1101 Ga0207651_10144680
1102 Ga0207651_10256096
1103 Ga0207651_10372154
1104 Ga0207651_10493050
1105 Ga0207651_10517926
1106 Ga0207712_10022995
1107 Ga0207712_10307779
1108 Ga0207668_10071822
1109 Ga0207668_10082099
1110 Ga0207668_10709348
1111 Ga0207668_10763008
1112 Ga0207658_10392418
1113 Ga0207677_10088295
1114 Ga0207703_10179185
1115 Ga0207703_10580614
1116 Ga0207639_10061673
1117 Ga0207639_10676695
1118 Ga0207678_10371859
1119 Ga0207678_10596419
1120 Ga0207708_10024778
1121 Ga0207708_10049180
1122 Ga0207708_10593091
1123 Ga0207702_10530960
1124 Ga0207641_10101208
1125 Ga0207641_10164574
1126 Ga0207648_10007351
1127 Ga0207648_10010933
1128 Ga0207648_10014871
1129 Ga0207648_10047085
1130 Ga0207648_10190062
1131 Ga0207676_10021615
1132 Ga0207674_10296554
1133 Ga0207674_10347363
1134 Ga0207674_10353520
1135 Ga0207675_100001153
1136 Ga0207675_100001619
1137 Ga0207675_100001636
1138 Ga0207675_100009878
1139 Ga0207675_100012041
1140 Ga0207675_100020026
1141 Ga0207675_100113857
1142 Ga0207675_100174545
1143 Ga0207683_10006218
1144 Ga0207683_10006907
1145 Ga0209973_1008604
1146 Ga0209371_1000088
1147 Ga0209984_1000372
1148 Ga0209179_1001962
1149 Ga0209999_1010195
1150 Ga0209970_1004873
1151 Ga0209970_1009220
1152 Ga0210002_1000883
1153 Ga0209588_1015449
1154 Ga0209971_1001139
1155 Ga0209971_1017080
1156 Ga0209998_10000488
1157 Ga0209974_10002247
1158 Ga0209974_10063985
1159 Ga0207428_10032490
1160 Ga0207428_10053091
1161 Ga0207428_10055124
1162 Ga0207428_10217787
1163 Ga0207428_10218302
1164 Ga0207428_10240179
1165 Ga0265354_1001125
1166 Ga0265355_1002000
1167 Ga0268266_10001818
1168 Ga0268266_10040597
1169 Ga0268266_10042978
1170 Ga0268266_10046509
1171 Ga0268266_10242556
1172 Ga0268266_10245244
1173 Ga0268266_10599526
1174 Ga0268265_10007851
1175 Ga0268265_10035296
1176 Ga0268265_10052595
1177 Ga0268265_10172775
1178 Ga0268265_10265581
1179 Ga0268265_10398571
1180 Ga0268264_10011925
1181 Ga0268264_10043460
1182 Ga0268264_10093183
1183 Ga0268264_10411185
1184 Ga0268264_10641488
1185 Ga0265323_10018643
1186 Ga0307515_10061597
1187 Ga0268256_1000079
1188 Ga0265770_1000303
1189 Ga0265760_10000729
1190 Ga0265330_10027038
1191 Ga0265328_10002990
1192 Ga0265340_10110169
1193 Ga0265316_10246068
1194 Ga0307513_10009164
1195 Ga0307513_10018384
1196 Ga0307513_10507026
1197 Ga0307509_10000917
1198 Ga0307509_10079049
1199 Ga0307408_100033275
1200 Ga0307408_100450584
1201 Ga0307508_10030002
1202 Ga0307508_10315645
1203 Ga0316576_10011259
1204 Ga0316576_10120140
1205 Ga0316578_10017805
1206 Ga0316578_10204827
1207 Ga0307405_10333863
1208 Ga0316577_10063038
1209 Ga0307413_10028003
1210 Ga0307413_10052318
1211 Ga0307413_10110128
1212 Ga0307413_10167757
1213 Ga0307413_10203426
1214 Ga0307413_10519207
1215 Ga0307410_10010554
1216 Ga0307410_10047747
1217 Ga0307410_10126978
1218 Ga0307410_10189512
1219 Ga0307410_10749127
1220 Ga0307406_10125172
1221 Ga0307406_10614494
1222 Ga0307407_10056575
1223 Ga0307407_10118171
1224 Ga0307407_10197336
1225 Ga0307407_10230918
1226 Ga0307407_10256096
1227 Ga0307407_10460577
1228 Ga0307412_10019465
1229 Ga0307412_10045139
1230 Ga0307412_10189210
1231 Ga0307412_10200582
1232 Ga0307409_100003347
1233 Ga0307409_100016236
1234 Ga0307409_100160646
1235 Ga0307409_100301890
1236 Ga0307416_100393669
1237 Ga0307416_100545103
1238 Ga0307416_100876231
1239 Ga0307414_10068010
1240 Ga0307414_10210782
1241 Ga0307414_10420650
1242 Ga0307411_10125570
1243 Ga0307411_10313493
1244 Ga0307411_10346498
1245 Ga0307411_10384073
1246 Ga0307411_10407819
1247 Ga0307415_100062571
1248 Ga0307415_100721902
1249 Ga0316585_10010275
1250 Ga0316580_10017135
1251 Ga0373929_0000013
1252 Ga0373923_0113113
1253 Ga0373923_0116849
1254 Ga0373936_0142304
1255 Ga0373954_0190878
1256 Ga0316574_0000082
1257 Ga0316574_0051564
1258 Ga0316574_0077286
1259 Ga0373924_0258821
1260 Ga0373935_0242959
1261 Ga0373927_0482534
1262 Ga0373933_0051323
1263 Ga0373933_0151508
1264 Ga0373937_0049317
1265 Ga0373937_0072428
1266 Ga0373937_0172859
1267 Ga0316582_0053817
1268 Ga0316584_0015059
1269 Ga0316584_0278764
1270 Ga0373925_0128677
1271 Ga0395900_0086081
1272 Ga0395900_0320964
1273 Ga0439461_0031014
1274 Ga0451789_0547898
1275 Ga0451793_0183807
1276 Ga0451793_0710391
1277 Ga0451797_0052733
1278 Ga0451798_1030345
1279 Ga0451800_0240496
1280 Ga0451802_0719910
1281 Ga0451802_1128143
1282 Ga0451806_181564
1283 Ga0451804_0695803
1284 Ga0451807_0587428
1285 Ga0451807_1394934
1286 Ga0451837_1124078
1287 Ga0451853_2462324
1288 Ga0439441_002426
1289 Ga0439442_025811
1290 Ga0439443_003965
1291 Ga0439457_027137
1292 Ga0450913_006547
1293 Ga0450920_016177
1294 Ga0450923_000826
1295 Ga0450923_046524
1296 Ga0450892_013414
1297 Ga0450894_015048
1298 Ga0450910_008021
1299 Ga0439446_0003583
1300 Ga0450908_001374
1301 Ga0450908_008072
1302 Ga0439434_0012512
1303 Ga0439434_0020238
1304 Ga0439435_0010756
1305 Ga0439444_0002654
1306 Ga0439459_0050476
1307 Ga0439459_0057928
1308 Ga0439464_0054312
1309 Ga0451577_0004168
1310 Ga0451577_0019662
1311 Ga0451577_0064759
1312 Ga0451577_0087073
1313 Ga0451577_0115667
1314 Ga0451577_0133790
1315 Ga0451577_0388112
1316 Ga0453683_0004351
1317 Ga0453684_0011204
1318 Ga0453684_0070049
1319 Ga0453684_0111257
1320 Ga0451576_0018930
1321 Ga0451576_0035970
1322 Ga0451576_0084585
1323 Ga0451576_0682027
1324 Ga0466967_0084948
1325 Ga0466967_0267970
1326 Ga0495591_062448
1327 Ga0495629_0162345
1328 Ga0495638_0003097
1329 Ga0495638_0004722
1330 Ga0495641_0082501
1331 Ga0495580_0121422
1332 Ga0495580_0239364
1333 Ga0495639_0264687
1334 Ga0495662_0152760
1335 Ga0495594_0236721
1336 Ga0495596_0116669
1337 Ga0495620_0040095
1338 Ga0495644_0087007
1339 Ga0495663_0014292
1340 Ga0495621_0000461
1341 Ga0495633_0025356
1342 Ga0495633_0137794
1343 Ga0495668_0000301
1344 Ga0495611_0147289
1345 Ga0495625_0004196
1346 Ga0495625_0006418
1347 Ga0495635_0280715
1348 Ga0495647_0008140
1349 Ga0495647_0130099
1350 Ga0495658_0008463
1351 Ga0495649_0006367
1352 Ga0495600_0417447
1353 Ga0495604_0159213
1354 Ga0495672_0053133
1355 Ga0495672_0209160
1356 Ga0495680_0022654
1357 Ga0495686_0086557
1358 Ga0495686_0128273
1359 Ga0495615_0094842
1360 Ga0496100_0088027
1361 Ga0496101_0210322
1362 Ga0496101_0675608
1363 Ga0496104_0027158
1364 Ga0496104_0141811
1365 Ga0496104_0278849
1366 Ga0496105_0005317
1367 Ga0496107_0087823
1368 Ga0496108_0103481
1369 Ga0496109_0093010
1370 Ga0496110_0014082
1371 Ga0496110_0298768
1372 Ga0496111_0036773
1373 Ga0496114_0000012
1374 Ga0496114_0004286
1375 Ga0496114_0055180
1376 Ga0496115_0028254
1377 Ga0496118_0133750
1378 Ga0496118_0165031
1379 Ga0496119_0000654
1380 Ga0496120_0002845
1381 Ga0496121_0195671
1382 Ga0496124_0039548
1383 Ga0496124_0061500
1384 Ga0496124_0251499
1385 Ga0496125_0036816
1386 Ga0496126_0003314
1387 Ga0496126_0025761
1388 Ga0501299_003641
1389 Ga0501032_0071060
1390 Ga0501032_0249330
1391 Ga0501032_0435885
1392 Ga0501034_0002645
1393 Ga0501034_0227623
1394 Ga0501034_0736583
1395 Ga0501036_0030507
1396 Ga0501036_0466258
1397 Ga0501037_0105310
1398 Ga0501037_0282802
1399 Ga0501037_0416732
1400 Ga0501038_0025830
1401 Ga0501038_0298140
1402 Ga0501038_0567121
1403 Ga0501039_0044409
1404 Ga0501040_0055542
1405 Ga0501040_0084697
1406 Ga0501040_0146277
1407 Ga0501040_0322245
1408 Ga0501042_0133158
1409 Ga0501042_0213609
1410 Ga0501042_0289518
1411 Ga0501042_0345422
1412 Ga0501046_0527008
1413 Ga0501047_0064156
1414 Ga0501048_0107002
1415 Ga0501067_0146389
1416 Ga0501068_0003038
1417 Ga0501068_0005358
1418 Ga0501068_0232203
1419 Ga0501068_0442858
1420 Ga0501069_0153267
1421 Ga0501069_0168442
1422 Ga0501070_0162762
1423 Ga0501071_0018970
1424 Ga0501072_0035075
1425 Ga0501072_0233419
1426 Ga0501073_0006306
1427 Ga0501073_0018770
1428 Ga0501074_0006860
1429 Ga0501074_0085123
1430 Ga0501075_0115272
1431 Ga0501075_0159984
1432 Ga0501075_0212097
1433 Ga0501076_0109772
1434 Ga0501076_0166659
1435 Ga0501076_0222785
1436 Ga0501076_0250935
1437 Ga0501077_0000284
1438 Ga0501077_0058480
1439 Ga0501079_0181059
1440 Ga0501079_0619433
1441 Ga0501080_0002960
1442 Ga0501080_0005108
1443 Ga0501080_0018349
1444 Ga0501080_0118364
1445 Ga0501081_0008371
1446 Ga0501081_0526982
1447 Ga0501083_0006836
1448 Ga0501083_0044268
1449 Ga0501035_0150709
1450 Ga0501035_0444214
1451 Ga0501045_0123450
1452 Ga0501045_0125573
1453 nmdc:mga0k408_14294_c1
1454 nmdc:mga05p37_16649_c1
1455 nmdc:mga09592_111787_c1
1456 nmdc:mga09592_210152_c1
1457 nmdc:mga09592_21800_c1
1458 nmdc:mga09592_26339_c1
1459 nmdc:mga09592_99994_c1
1460 nmdc:mga0qj67_107240_c1
1461 nmdc:mga0qj67_12212_c1
1462 nmdc:mga0qj67_17995_c1
1463 nmdc:mga0qj67_18857_c1
1464 nmdc:mga0qj67_21133_c1
1465 nmdc:mga06r32_1582_c1
1466 nmdc:mga06r32_181759_c1
1467 nmdc:mga06r32_18542_c1
1468 nmdc:mga06r32_4811_c1
1469 nmdc:mga06r32_5847_c1
1470 nmdc:mga08y16_11594_c1
1471 nmdc:mga08y16_126944_c1
1472 nmdc:mga08y16_135236_c1
1473 nmdc:mga08y16_165697_c1
1474 nmdc:mga08y16_203617_c1
1475 nmdc:mga08y16_23930_c1
1476 nmdc:mga08y16_328726_c1
1477 nmdc:mga08y16_43919_c1
1478 nmdc:mga08y16_897251_c1
1479 nmdc:mga0n895_12548_c1
1480 nmdc:mga0rr50_22787_c1
1481 nmdc:mga0a205_13295_c2
1482 nmdc:mga0a205_292515_c1
1483 nmdc:mga0a205_471083_c1
1484 Ga0495601_0230812
1485 Ga0495619_0360865
1486 Ga0500578_0000131
1487 Ga0500644_0048730
1488 Ga0500646_0006436
1489 Ga0500651_0067147
1490 Ga0500566_0270225
1491 Ga0500641_0001484
1492 Ga0500556_0043776
1493 Ga0500652_058290
1494 Ga0500658_0038616
1495 Ga0500559_0037976
1496 Ga0500568_0014985
1497 Ga0500568_0094871
1498 Ga0500604_0003185
1499 Ga0500622_0000006
1500 Ga0500622_0000213
1501 Ga0500622_0001608
1502 Ga0500622_0010663
1503 Ga0500627_0114584
1504 Ga0500637_0009124
1505 Ga0501084_0010970
1506 Ga0501084_0038822
1507 Ga0501084_0202090
1508 Ga0590071_080189
1509 Ga0501082_0000011
1510 Ga0501082_0007297
1511 Ga0501082_0181969
1512 Ga0530510_0032713
1513 Ga0530510_0046251
1514 Ga0530510_0352649
1515 Ga0530510_0442852
1516 Ga0530510_0734589
1517 2525558092
1518 2547501404
1519 2578457287
1520 2630649895
1521 2747949418
1522 2765580203
1523 2819660884
1524 2842759981
1525 2852652403
1526 2852686760
1527 2914759885
1528 2919134034
1529 2919137780
1530 2923519394
1531 2929196684
1532 2941479022
1533 8003015161
1534 8021623627
1535 8021627451
1536 8021650582

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

43

114

0.96

PF01709

Transcrip_reg

TACO1/YebC second and third domain

119

279

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.9378 23 240
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.9254 23 240
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8474 20 240
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.7894 9 239
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.7738 20 240
ID Description Score Start End Superfamily
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9195 26 78 1.10.10.200
af_P9WGA5_1_79_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9124 18 76 1.10.10.200
1mw7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9114 80 240 3.30.70.980
1mw7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9014 80 240 3.30.70.980
1mw7A03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.8872 131 205 3.30.70.980
ID Description Score Start End GO Terms
AF-I5C779-F1-model_v4 Probable transcriptional regulatory protein A3SI_05809 0.9843 21 240 GO:0003677
GO:0005829
GO:0006355
AF-A0A7R9V5A2-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9827 18 120 GO:0009507
AF-A0A7Y4QAE0-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9805 21 240 GO:0003677
GO:0005829
GO:0006355
AF-A0A7Y4QAE0-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9716 21 240 GO:0003677
GO:0005829
GO:0006355
AF-I5C779-F1-model_v4 Probable transcriptional regulatory protein A3SI_05809 0.9708 21 240 GO:0003677
GO:0005829
GO:0006355

Map