F479825
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 766 | 348 | 766 | 50 |
Family's Representative Sequence
| Representative Sequence | 3300005367|Ga0070667_101720809|Ga0070667_1017208091 |
| Length | 60 |
| Sequence | MIRKLSTGKYRLYSRKLNPKTGRRRNLGTFATRAAAEKHERAVQYFKRGGAMSRGGARRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 111 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013875 | Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 208 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 210 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 212 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 216 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 217 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 220 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 221 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 222 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 223 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 224 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 225 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 226 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 228 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 237 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 240 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 247 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 250 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 251 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 253 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 255 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 259 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 260 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 261 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 262 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 299 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 300 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 301 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 302 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 303 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 304 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 307 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 308 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 309 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 310 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 311 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 312 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 313 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 314 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 315 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 325 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 337 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 338 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 339 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 340 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 341 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 342 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 343 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 344 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 345 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 346 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 347 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.22 |
| Metatranscriptomes | 0.78 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.05 |
| Nodule | 0 |
| Rhizoplane | 4.31 |
| Rhizosphere | 88.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_1291068 | 2162886006 | Bacteria | 847 |
| 2 | CNBas_1000908 | 3300000531 | Unclassified | 1464 |
| 3 | JGI25156J39149_1000376 | 3300002705 | Bacteria | 28411 |
| 4 | JGI25154J39366_1000488 | 3300002738 | Bacteria | 20416 |
| 5 | JGI25157J39369_1000199 | 3300002741 | Bacteria | 50810 |
| 6 | rootH1_10037156 | 3300003316 | Bacteria | 4740 |
| 7 | rootH1_10014388 | 3300003323 | Unclassified | 2421 |
| 8 | rootH1_10020809 | 3300003323 | Bacteria | 47178 |
| 9 | rootH1_10039540 | 3300003323 | Bacteria | 5790 |
| 10 | rootH1_10174920 | 3300003323 | Bacteria | 8591 |
| 11 | rootH1_10243980 | 3300003323 | Bacteria | 6658 |
| 12 | Ga0055539_1000312 | 3300003752 | Bacteria | 25513 |
| 13 | Ga0055539_1000659 | 3300003752 | Bacteria | 9147 |
| 14 | Ga0055533_1000033 | 3300003756 | Bacteria | 265716 |
| 15 | Ga0055525_1001535 | 3300003759 | Bacteria | 3871 |
| 16 | Ga0065704_10793649 | 3300005289 | Bacteria | 527 |
| 17 | Ga0065707_10087312 | 3300005295 | Bacteria | 5069 |
| 18 | Ga0070683_100098687 | 3300005329 | Bacteria | 2749 |
| 19 | Ga0070683_100454450 | 3300005329 | Bacteria | 1222 |
| 20 | Ga0070683_100741457 | 3300005329 | Bacteria | 941 |
| 21 | Ga0070690_100012931 | 3300005330 | Bacteria | 4922 |
| 22 | Ga0070690_100016783 | 3300005330 | Bacteria | 4394 |
| 23 | Ga0070690_100037072 | 3300005330 | Bacteria | 3070 |
| 24 | Ga0070690_100758269 | 3300005330 | Bacteria | 750 |
| 25 | Ga0070670_100042702 | 3300005331 | Bacteria | 3898 |
| 26 | Ga0070670_100115598 | 3300005331 | Bacteria | 2313 |
| 27 | Ga0070670_100308670 | 3300005331 | Bacteria | 1384 |
| 28 | Ga0070670_100750172 | 3300005331 | Unclassified | 879 |
| 29 | Ga0070670_101411098 | 3300005331 | Bacteria | 638 |
| 30 | Ga0070677_10122527 | 3300005333 | Bacteria | 1176 |
| 31 | Ga0068869_100534220 | 3300005334 | Bacteria | 983 |
| 32 | Ga0068869_100643224 | 3300005334 | Bacteria | 899 |
| 33 | Ga0068869_100788966 | 3300005334 | Unclassified | 816 |
| 34 | Ga0068869_101242201 | 3300005334 | Bacteria | 656 |
| 35 | Ga0068869_101267466 | 3300005334 | Unclassified | 649 |
| 36 | Ga0068869_101561124 | 3300005334 | Unclassified | 587 |
| 37 | Ga0070666_10010458 | 3300005335 | Bacteria | 5806 |
| 38 | Ga0070666_10156316 | 3300005335 | Bacteria | 1592 |
| 39 | Ga0070680_100127802 | 3300005336 | Unclassified | 2124 |
| 40 | Ga0068868_100108494 | 3300005338 | Bacteria | 2253 |
| 41 | Ga0068868_100969875 | 3300005338 | Unclassified | 776 |
| 42 | Ga0068868_101014780 | 3300005338 | Bacteria | 760 |
| 43 | Ga0070660_100445724 | 3300005339 | Bacteria | 1074 |
| 44 | Ga0070660_100632600 | 3300005339 | Bacteria | 896 |
| 45 | Ga0070689_100052468 | 3300005340 | Bacteria | 3154 |
| 46 | Ga0070689_100079004 | 3300005340 | Bacteria | 2580 |
| 47 | Ga0070689_100617293 | 3300005340 | Bacteria | 940 |
| 48 | Ga0070691_10070822 | 3300005341 | Bacteria | 1692 |
| 49 | Ga0070691_10476470 | 3300005341 | Bacteria | 717 |
| 50 | Ga0070687_100235321 | 3300005343 | Bacteria | 1129 |
| 51 | Ga0070661_100021587 | 3300005344 | Bacteria | 4600 |
| 52 | Ga0070661_100487964 | 3300005344 | Bacteria | 985 |
| 53 | Ga0070669_100255557 | 3300005353 | Bacteria | 1396 |
| 54 | Ga0070669_100533868 | 3300005353 | Bacteria | 976 |
| 55 | Ga0070675_100181617 | 3300005354 | Bacteria | 1819 |
| 56 | Ga0070675_100317263 | 3300005354 | Bacteria | 1376 |
| 57 | Ga0070675_100868855 | 3300005354 | Bacteria | 826 |
| 58 | Ga0070671_100005134 | 3300005355 | Bacteria | 10421 |
| 59 | Ga0070671_101709104 | 3300005355 | Unclassified | 558 |
| 60 | Ga0070674_100303386 | 3300005356 | Bacteria | 1274 |
| 61 | Ga0070674_100678334 | 3300005356 | Bacteria | 879 |
| 62 | Ga0070674_100767368 | 3300005356 | Bacteria | 830 |
| 63 | Ga0070674_101786869 | 3300005356 | Bacteria | 557 |
| 64 | Ga0070673_100154246 | 3300005364 | Bacteria | 1948 |
| 65 | Ga0070673_100350617 | 3300005364 | Bacteria | 1310 |
| 66 | Ga0070688_100084307 | 3300005365 | Bacteria | 2064 |
| 67 | Ga0070688_101020111 | 3300005365 | Unclassified | 658 |
| 68 | Ga0070667_100018405 | 3300005367 | Bacteria | 5793 |
| 69 | Ga0070667_100076221 | 3300005367 | Bacteria | 2863 |
| 70 | Ga0070667_100365916 | 3300005367 | Bacteria | 1308 |
| 71 | Ga0070667_101720809 | 3300005367 | Unclassified | 590 |
| 72 | Ga0070703_10423898 | 3300005406 | Bacteria | 584 |
| 73 | Ga0070709_10098408 | 3300005434 | Bacteria | 1944 |
| 74 | Ga0070709_10254684 | 3300005434 | Bacteria | 1266 |
| 75 | Ga0070709_11458253 | 3300005434 | Bacteria | 555 |
| 76 | Ga0070713_100427433 | 3300005436 | Bacteria | 1241 |
| 77 | Ga0070713_100887561 | 3300005436 | Bacteria | 857 |
| 78 | Ga0070701_10000224 | 3300005438 | Bacteria | 17823 |
| 79 | Ga0070701_10070516 | 3300005438 | Bacteria | 1867 |
| 80 | Ga0070701_10144942 | 3300005438 | Bacteria | 1362 |
| 81 | Ga0070701_10432605 | 3300005438 | Bacteria | 841 |
| 82 | Ga0070711_100886887 | 3300005439 | Bacteria | 761 |
| 83 | Ga0070705_100971525 | 3300005440 | Bacteria | 688 |
| 84 | Ga0070700_100013454 | 3300005441 | Bacteria | 4596 |
| 85 | Ga0070694_100523279 | 3300005444 | Bacteria | 946 |
| 86 | Ga0070663_100343948 | 3300005455 | Bacteria | 1206 |
| 87 | Ga0070663_101024812 | 3300005455 | Bacteria | 719 |
| 88 | Ga0070678_100069355 | 3300005456 | Bacteria | 2632 |
| 89 | Ga0070678_100402741 | 3300005456 | Bacteria | 1189 |
| 90 | Ga0070678_100594055 | 3300005456 | Bacteria | 987 |
| 91 | Ga0070678_100838132 | 3300005456 | Bacteria | 837 |
| 92 | Ga0070678_101282596 | 3300005456 | Bacteria | 681 |
| 93 | Ga0070662_101048876 | 3300005457 | Bacteria | 699 |
| 94 | Ga0070662_101186666 | 3300005457 | Bacteria | 656 |
| 95 | Ga0070681_10100377 | 3300005458 | Unclassified | 2840 |
| 96 | Ga0068867_100176559 | 3300005459 | Bacteria | 1695 |
| 97 | Ga0068867_100511371 | 3300005459 | Bacteria | 1034 |
| 98 | Ga0070685_10042237 | 3300005466 | Bacteria | 2601 |
| 99 | Ga0070685_10667764 | 3300005466 | Bacteria | 755 |
| 100 | Ga0070706_100546096 | 3300005467 | Bacteria | 1078 |
| 101 | Ga0070698_101645983 | 3300005471 | Bacteria | 594 |
| 102 | Ga0070699_101090581 | 3300005518 | Unclassified | 732 |
| 103 | Ga0070679_101437343 | 3300005530 | Bacteria | 636 |
| 104 | Ga0070684_100076468 | 3300005535 | Bacteria | 2955 |
| 105 | Ga0070684_100508384 | 3300005535 | Bacteria | 1116 |
| 106 | Ga0070697_100500657 | 3300005536 | Bacteria | 1062 |
| 107 | Ga0070697_101147305 | 3300005536 | Bacteria | 692 |
| 108 | Ga0068853_100375901 | 3300005539 | Bacteria | 1326 |
| 109 | Ga0070672_100103961 | 3300005543 | Bacteria | 2307 |
| 110 | Ga0070672_100145268 | 3300005543 | Unclassified | 1960 |
| 111 | Ga0070672_100209171 | 3300005543 | Bacteria | 1633 |
| 112 | Ga0070672_100426687 | 3300005543 | Bacteria | 1139 |
| 113 | Ga0070672_100683231 | 3300005543 | Bacteria | 898 |
| 114 | Ga0070686_100054036 | 3300005544 | Bacteria | 2568 |
| 115 | Ga0070686_100333262 | 3300005544 | Bacteria | 1135 |
| 116 | Ga0070695_100000207 | 3300005545 | Bacteria | 28678 |
| 117 | Ga0070695_100227998 | 3300005545 | Unclassified | 1345 |
| 118 | Ga0070695_100847925 | 3300005545 | Unclassified | 735 |
| 119 | Ga0070696_100000958 | 3300005546 | Bacteria | 18702 |
| 120 | Ga0070696_100035272 | 3300005546 | Bacteria | 3443 |
| 121 | Ga0070693_100022202 | 3300005547 | Bacteria | 3370 |
| 122 | Ga0070693_100091139 | 3300005547 | Bacteria | 1838 |
| 123 | Ga0070693_100145648 | 3300005547 | Bacteria | 1495 |
| 124 | Ga0070665_100002191 | 3300005548 | Bacteria | 21789 |
| 125 | Ga0070665_100008155 | 3300005548 | Bacteria | 10604 |
| 126 | Ga0070665_100371530 | 3300005548 | Bacteria | 1437 |
| 127 | Ga0070665_101630736 | 3300005548 | Unclassified | 653 |
| 128 | Ga0070704_100979400 | 3300005549 | Bacteria | 764 |
| 129 | Ga0068855_100074235 | 3300005563 | Bacteria | 3950 |
| 130 | Ga0068855_100331510 | 3300005563 | Bacteria | 1680 |
| 131 | Ga0068855_100724255 | 3300005563 | Bacteria | 1063 |
| 132 | Ga0070664_100008795 | 3300005564 | Bacteria | 8180 |
| 133 | Ga0070664_100120598 | 3300005564 | Bacteria | 2296 |
| 134 | Ga0070664_100297286 | 3300005564 | Unclassified | 1458 |
| 135 | Ga0070664_100527352 | 3300005564 | Bacteria | 1091 |
| 136 | Ga0068857_100001581 | 3300005577 | Bacteria | 18238 |
| 137 | Ga0068857_101212413 | 3300005577 | Unclassified | 731 |
| 138 | Ga0068854_100047175 | 3300005578 | Bacteria | 3069 |
| 139 | Ga0068854_100449821 | 3300005578 | Bacteria | 1075 |
| 140 | Ga0068856_100001069 | 3300005614 | Bacteria | 29002 |
| 141 | Ga0068856_100291434 | 3300005614 | Unclassified | 1649 |
| 142 | Ga0068856_100885385 | 3300005614 | Bacteria | 912 |
| 143 | Ga0070702_100026229 | 3300005615 | Bacteria | 3129 |
| 144 | Ga0070702_100287372 | 3300005615 | Bacteria | 1131 |
| 145 | Ga0070702_100587302 | 3300005615 | Bacteria | 833 |
| 146 | Ga0068852_100159346 | 3300005616 | Bacteria | 2106 |
| 147 | Ga0068852_101272840 | 3300005616 | Bacteria | 757 |
| 148 | Ga0068859_100006635 | 3300005617 | Bacteria | 11754 |
| 149 | Ga0068859_100042745 | 3300005617 | Bacteria | 4552 |
| 150 | Ga0068859_100793842 | 3300005617 | Bacteria | 1035 |
| 151 | Ga0068859_102077725 | 3300005617 | Bacteria | 627 |
| 152 | Ga0068859_102752483 | 3300005617 | Unclassified | 540 |
| 153 | Ga0068864_100003997 | 3300005618 | Bacteria | 12141 |
| 154 | Ga0068864_100054444 | 3300005618 | Unclassified | 3453 |
| 155 | Ga0068864_100076085 | 3300005618 | Bacteria | 2932 |
| 156 | Ga0068864_100128578 | 3300005618 | Bacteria | 2273 |
| 157 | Ga0068864_100337885 | 3300005618 | Bacteria | 1418 |
| 158 | Ga0068864_101265186 | 3300005618 | Bacteria | 737 |
| 159 | Ga0068866_10000950 | 3300005718 | Bacteria | 12744 |
| 160 | Ga0068866_10040043 | 3300005718 | Bacteria | 2317 |
| 161 | Ga0068866_10430335 | 3300005718 | Unclassified | 858 |
| 162 | Ga0068861_100064223 | 3300005719 | Bacteria | 2824 |
| 163 | Ga0068861_100171921 | 3300005719 | Bacteria | 1796 |
| 164 | Ga0068861_100709911 | 3300005719 | Bacteria | 935 |
| 165 | Ga0068861_101641634 | 3300005719 | Bacteria | 634 |
| 166 | Ga0068851_10173382 | 3300005834 | Bacteria | 1191 |
| 167 | Ga0068851_10178843 | 3300005834 | Bacteria | 1174 |
| 168 | Ga0068870_10008184 | 3300005840 | Bacteria | 4691 |
| 169 | Ga0068870_10549094 | 3300005840 | Bacteria | 777 |
| 170 | Ga0068863_100026788 | 3300005841 | Bacteria | 5497 |
| 171 | Ga0068863_100121249 | 3300005841 | Bacteria | 2493 |
| 172 | Ga0068863_100238093 | 3300005841 | Unclassified | 1757 |
| 173 | Ga0068863_100297975 | 3300005841 | Bacteria | 1564 |
| 174 | Ga0068863_100352186 | 3300005841 | Bacteria | 1434 |
| 175 | Ga0068863_100361801 | 3300005841 | Bacteria | 1414 |
| 176 | Ga0068863_100445754 | 3300005841 | Bacteria | 1270 |
| 177 | Ga0068858_100018730 | 3300005842 | Bacteria | 6479 |
| 178 | Ga0068858_100045414 | 3300005842 | Bacteria | 4071 |
| 179 | Ga0068858_100549270 | 3300005842 | Unclassified | 1118 |
| 180 | Ga0068860_100106666 | 3300005843 | Bacteria | 2676 |
| 181 | Ga0068860_100288293 | 3300005843 | Bacteria | 1606 |
| 182 | Ga0068860_100399336 | 3300005843 | Bacteria | 1360 |
| 183 | Ga0068860_100573807 | 3300005843 | Bacteria | 1132 |
| 184 | Ga0068862_100014905 | 3300005844 | Bacteria | 6457 |
| 185 | Ga0081540_1314338 | 3300005983 | Bacteria | 537 |
| 186 | Ga0070717_11631897 | 3300006028 | Bacteria | 584 |
| 187 | Ga0075363_100344347 | 3300006048 | Bacteria | 870 |
| 188 | Ga0075364_10122909 | 3300006051 | Bacteria | 1738 |
| 189 | Ga0070716_100704541 | 3300006173 | Bacteria | 772 |
| 190 | Ga0070716_101840193 | 3300006173 | Unclassified | 502 |
| 191 | Ga0075362_10377651 | 3300006177 | Bacteria | 712 |
| 192 | Ga0097621_100018098 | 3300006237 | Bacteria | 5372 |
| 193 | Ga0097621_100198062 | 3300006237 | Bacteria | 1742 |
| 194 | Ga0097621_102373466 | 3300006237 | Bacteria | 507 |
| 195 | Ga0075370_10034887 | 3300006353 | Bacteria | 2821 |
| 196 | Ga0068871_100039244 | 3300006358 | Bacteria | 3787 |
| 197 | Ga0068871_100074998 | 3300006358 | Bacteria | 2792 |
| 198 | Ga0068871_100304365 | 3300006358 | Bacteria | 1400 |
| 199 | Ga0068871_102147308 | 3300006358 | Bacteria | 532 |
| 200 | Ga0075428_100005195 | 3300006844 | Bacteria | 14462 |
| 201 | Ga0075428_100051828 | 3300006844 | Bacteria | 4500 |
| 202 | Ga0075428_100317286 | 3300006844 | Bacteria | 1675 |
| 203 | Ga0075428_100325599 | 3300006844 | Bacteria | 1651 |
| 204 | Ga0075430_100766684 | 3300006846 | Unclassified | 795 |
| 205 | Ga0075430_101368850 | 3300006846 | Bacteria | 582 |
| 206 | Ga0075431_100359524 | 3300006847 | Bacteria | 1462 |
| 207 | Ga0075431_102036922 | 3300006847 | Bacteria | 529 |
| 208 | Ga0075433_10248315 | 3300006852 | Bacteria | 1579 |
| 209 | Ga0075433_10667477 | 3300006852 | Bacteria | 911 |
| 210 | Ga0075434_100125217 | 3300006871 | Bacteria | 2587 |
| 211 | Ga0075434_100261417 | 3300006871 | Bacteria | 1750 |
| 212 | Ga0075434_100460740 | 3300006871 | Bacteria | 1292 |
| 213 | Ga0075434_101317087 | 3300006871 | Bacteria | 733 |
| 214 | Ga0075434_102050655 | 3300006871 | Bacteria | 577 |
| 215 | Ga0075429_100000103 | 3300006880 | Bacteria | 47421 |
| 216 | Ga0075429_101336131 | 3300006880 | Unclassified | 625 |
| 217 | Ga0075429_101455327 | 3300006880 | Unclassified | 596 |
| 218 | Ga0075429_101783568 | 3300006880 | Bacteria | 534 |
| 219 | Ga0068865_100000447 | 3300006881 | Bacteria | 22945 |
| 220 | Ga0068865_100034173 | 3300006881 | Bacteria | 3410 |
| 221 | Ga0068865_100794248 | 3300006881 | Bacteria | 816 |
| 222 | Ga0068865_102160080 | 3300006881 | Bacteria | 506 |
| 223 | Ga0097620_100006635 | 3300006931 | Bacteria | 11754 |
| 224 | Ga0097620_100042744 | 3300006931 | Bacteria | 4552 |
| 225 | Ga0097620_100793875 | 3300006931 | Bacteria | 1035 |
| 226 | Ga0097620_102077897 | 3300006931 | Bacteria | 627 |
| 227 | Ga0097620_102753001 | 3300006931 | Unclassified | 540 |
| 228 | Ga0075435_100159920 | 3300007076 | Bacteria | 1897 |
| 229 | Ga0075435_100397106 | 3300007076 | Bacteria | 1186 |
| 230 | Ga0075435_101378832 | 3300007076 | Bacteria | 618 |
| 231 | Ga0075435_102013796 | 3300007076 | Bacteria | 507 |
| 232 | Ga0099795_10005750 | 3300007788 | Bacteria | 3326 |
| 233 | Ga0105251_10445248 | 3300009011 | Bacteria | 600 |
| 234 | Ga0105240_10024844 | 3300009093 | Bacteria | 7889 |
| 235 | Ga0105240_10088742 | 3300009093 | Bacteria | 3783 |
| 236 | Ga0105240_10267903 | 3300009093 | Bacteria | 1968 |
| 237 | Ga0105240_11354289 | 3300009093 | Bacteria | 749 |
| 238 | Ga0111539_10049570 | 3300009094 | Bacteria | 5006 |
| 239 | Ga0111539_10156092 | 3300009094 | Bacteria | 2670 |
| 240 | Ga0111539_11805659 | 3300009094 | Bacteria | 709 |
| 241 | Ga0105245_10004425 | 3300009098 | Bacteria | 12431 |
| 242 | Ga0105245_10016905 | 3300009098 | Bacteria | 6369 |
| 243 | Ga0105245_10025899 | 3300009098 | Bacteria | 5159 |
| 244 | Ga0105245_10032189 | 3300009098 | Bacteria | 4642 |
| 245 | Ga0105245_10198636 | 3300009098 | Bacteria | 1925 |
| 246 | Ga0105245_10651099 | 3300009098 | Bacteria | 1084 |
| 247 | Ga0105245_12468450 | 3300009098 | Bacteria | 573 |
| 248 | Ga0105247_10006029 | 3300009101 | Bacteria | 7543 |
| 249 | Ga0114129_10001184 | 3300009147 | Bacteria | 34627 |
| 250 | Ga0114129_10082380 | 3300009147 | Bacteria | 4471 |
| 251 | Ga0105243_10003720 | 3300009148 | Bacteria | 12240 |
| 252 | Ga0105243_10369812 | 3300009148 | Bacteria | 1322 |
| 253 | Ga0105243_10434238 | 3300009148 | Bacteria | 1228 |
| 254 | Ga0105243_10955059 | 3300009148 | Bacteria | 857 |
| 255 | Ga0105241_10013741 | 3300009174 | Bacteria | 5931 |
| 256 | Ga0105241_10672307 | 3300009174 | Bacteria | 942 |
| 257 | Ga0105241_11341688 | 3300009174 | Unclassified | 683 |
| 258 | Ga0105242_10003302 | 3300009176 | Bacteria | 12562 |
| 259 | Ga0105242_10019833 | 3300009176 | Bacteria | 5267 |
| 260 | Ga0105242_10042075 | 3300009176 | Bacteria | 3687 |
| 261 | Ga0105242_10042982 | 3300009176 | Bacteria | 3653 |
| 262 | Ga0105242_10169989 | 3300009176 | Bacteria | 1915 |
| 263 | Ga0105242_10641591 | 3300009176 | Bacteria | 1031 |
| 264 | Ga0105242_13122072 | 3300009176 | Bacteria | 514 |
| 265 | Ga0105248_10001702 | 3300009177 | Bacteria | 24467 |
| 266 | Ga0105248_10031622 | 3300009177 | Bacteria | 5912 |
| 267 | Ga0105248_10270660 | 3300009177 | Bacteria | 1913 |
| 268 | Ga0105248_10758255 | 3300009177 | Unclassified | 1095 |
| 269 | Ga0105248_11038997 | 3300009177 | Bacteria | 926 |
| 270 | Ga0105248_11199894 | 3300009177 | Bacteria | 858 |
| 271 | Ga0105237_11196352 | 3300009545 | Bacteria | 767 |
| 272 | Ga0105238_10009832 | 3300009551 | Bacteria | 9580 |
| 273 | Ga0105238_10272777 | 3300009551 | Bacteria | 1672 |
| 274 | Ga0105238_10317410 | 3300009551 | Bacteria | 1544 |
| 275 | Ga0105249_10000917 | 3300009553 | Bacteria | 26070 |
| 276 | Ga0105249_10087083 | 3300009553 | Bacteria | 2914 |
| 277 | Ga0105249_10317194 | 3300009553 | Bacteria | 1569 |
| 278 | Ga0105249_10636704 | 3300009553 | Bacteria | 1123 |
| 279 | Ga0105249_11455869 | 3300009553 | Bacteria | 757 |
| 280 | Ga0105035_100653 | 3300009988 | Bacteria | 2171 |
| 281 | Ga0099796_10004786 | 3300010159 | Bacteria | 3312 |
| 282 | Ga0105239_10008582 | 3300010375 | Bacteria | 11592 |
| 283 | Ga0105239_10021524 | 3300010375 | Bacteria | 7109 |
| 284 | Ga0105239_10245376 | 3300010375 | Bacteria | 2011 |
| 285 | Ga0105239_12476551 | 3300010375 | Bacteria | 605 |
| 286 | Ga0105246_10000277 | 3300011119 | Bacteria | 26747 |
| 287 | Ga0105246_10007067 | 3300011119 | Bacteria | 6871 |
| 288 | Ga0105246_10576291 | 3300011119 | Bacteria | 969 |
| 289 | Ga0105246_11758534 | 3300011119 | Bacteria | 591 |
| 290 | Ga0157371_10805608 | 3300013102 | Bacteria | 708 |
| 291 | Ga0157371_11633628 | 3300013102 | Bacteria | 505 |
| 292 | Ga0157369_10168044 | 3300013105 | Bacteria | 2312 |
| 293 | Ga0157369_10455716 | 3300013105 | Bacteria | 1324 |
| 294 | Ga0157374_10020454 | 3300013296 | Bacteria | 5871 |
| 295 | Ga0157374_10242013 | 3300013296 | Bacteria | 1774 |
| 296 | Ga0157374_11917478 | 3300013296 | Unclassified | 618 |
| 297 | Ga0157378_10004581 | 3300013297 | Bacteria | 12120 |
| 298 | Ga0157378_10037143 | 3300013297 | Bacteria | 4314 |
| 299 | Ga0157378_10626394 | 3300013297 | Bacteria | 1089 |
| 300 | Ga0157378_10965388 | 3300013297 | Bacteria | 885 |
| 301 | Ga0157378_11327365 | 3300013297 | Unclassified | 761 |
| 302 | Ga0157378_12033908 | 3300013297 | Bacteria | 625 |
| 303 | Ga0163162_10011159 | 3300013306 | Bacteria | 8752 |
| 304 | Ga0163162_10207068 | 3300013306 | Bacteria | 2091 |
| 305 | Ga0163162_10280467 | 3300013306 | Bacteria | 1798 |
| 306 | Ga0163162_10302154 | 3300013306 | Bacteria | 1732 |
| 307 | Ga0163162_10869008 | 3300013306 | Bacteria | 1016 |
| 308 | Ga0163162_11954690 | 3300013306 | Bacteria | 672 |
| 309 | Ga0163162_12115502 | 3300013306 | Unclassified | 646 |
| 310 | Ga0157372_10418032 | 3300013307 | Bacteria | 1563 |
| 311 | Ga0157372_11160790 | 3300013307 | Bacteria | 893 |
| 312 | Ga0157375_10034433 | 3300013308 | Bacteria | 4825 |
| 313 | Ga0157375_10397427 | 3300013308 | Bacteria | 1545 |
| 314 | Ga0157375_10559189 | 3300013308 | Bacteria | 1305 |
| 315 | Ga0157375_10678674 | 3300013308 | Bacteria | 1185 |
| 316 | Ga0157375_11455364 | 3300013308 | Bacteria | 808 |
| 317 | Ga0157515_138793 | 3300013875 | Bacteria | 726 |
| 318 | Ga0163163_10019210 | 3300014325 | Bacteria | 6415 |
| 319 | Ga0163163_10097357 | 3300014325 | Unclassified | 2962 |
| 320 | Ga0163163_10436111 | 3300014325 | Unclassified | 1369 |
| 321 | Ga0163163_11154742 | 3300014325 | Bacteria | 837 |
| 322 | Ga0163163_12352574 | 3300014325 | Bacteria | 591 |
| 323 | Ga0157380_10017894 | 3300014326 | Bacteria | 5254 |
| 324 | Ga0157380_10138310 | 3300014326 | Bacteria | 2088 |
| 325 | Ga0157380_10898826 | 3300014326 | Bacteria | 911 |
| 326 | Ga0157377_10673086 | 3300014745 | Bacteria | 748 |
| 327 | Ga0157379_10089278 | 3300014968 | Bacteria | 2765 |
| 328 | Ga0157379_10104777 | 3300014968 | Bacteria | 2538 |
| 329 | Ga0157379_10126181 | 3300014968 | Bacteria | 2302 |
| 330 | Ga0157379_10162033 | 3300014968 | Bacteria | 2019 |
| 331 | Ga0157379_10436452 | 3300014968 | Bacteria | 1207 |
| 332 | Ga0157379_10881527 | 3300014968 | Bacteria | 848 |
| 333 | Ga0157379_11117554 | 3300014968 | Unclassified | 755 |
| 334 | Ga0157379_11195893 | 3300014968 | Bacteria | 731 |
| 335 | Ga0157376_10004392 | 3300014969 | Bacteria | 9818 |
| 336 | Ga0157376_10012986 | 3300014969 | Bacteria | 6203 |
| 337 | Ga0157376_10023467 | 3300014969 | Bacteria | 4827 |
| 338 | Ga0157376_10562491 | 3300014969 | Bacteria | 1130 |
| 339 | Ga0157376_10644289 | 3300014969 | Bacteria | 1059 |
| 340 | Ga0157376_12556270 | 3300014969 | Bacteria | 550 |
| 341 | Ga0163161_10127479 | 3300017792 | Bacteria | 1917 |
| 342 | Ga0206349_1455567 | 3300020075 | Bacteria | 866 |
| 343 | Ga0206352_10955745 | 3300020078 | Bacteria | 751 |
| 344 | Ga0206350_10501895 | 3300020080 | Bacteria | 703 |
| 345 | Ga0224712_10470241 | 3300022467 | Bacteria | 605 |
| 346 | Ga0224712_10517530 | 3300022467 | Bacteria | 578 |
| 347 | Ga0209674_100064 | 3300025226 | Bacteria | 265769 |
| 348 | Ga0209563_100099 | 3300025230 | Bacteria | 153336 |
| 349 | Ga0209646_1000060 | 3300025246 | Bacteria | 256386 |
| 350 | Ga0209026_1000049 | 3300025250 | Bacteria | 255273 |
| 351 | Ga0209677_100253 | 3300025253 | Bacteria | 36497 |
| 352 | Ga0209677_100469 | 3300025253 | Bacteria | 23221 |
| 353 | Ga0209759_1000272 | 3300025256 | Bacteria | 73495 |
| 354 | Ga0209759_1059340 | 3300025256 | Bacteria | 544 |
| 355 | Ga0207666_1054748 | 3300025271 | Unclassified | 635 |
| 356 | Ga0209051_1004411 | 3300025303 | Bacteria | 8688 |
| 357 | Ga0209051_1006125 | 3300025303 | Bacteria | 6838 |
| 358 | Ga0207697_10006511 | 3300025315 | Bacteria | 5278 |
| 359 | Ga0207656_10153551 | 3300025321 | Bacteria | 1092 |
| 360 | Ga0207653_10004063 | 3300025885 | Bacteria | 4604 |
| 361 | Ga0207653_10347876 | 3300025885 | Bacteria | 579 |
| 362 | Ga0207682_10439108 | 3300025893 | Unclassified | 618 |
| 363 | Ga0207692_11124656 | 3300025898 | Bacteria | 520 |
| 364 | Ga0207642_10001134 | 3300025899 | Bacteria | 8234 |
| 365 | Ga0207642_10332143 | 3300025899 | Unclassified | 891 |
| 366 | Ga0207710_10013245 | 3300025900 | Bacteria | 3474 |
| 367 | Ga0207688_10090865 | 3300025901 | Bacteria | 1753 |
| 368 | Ga0207688_10442548 | 3300025901 | Bacteria | 809 |
| 369 | Ga0207680_10009688 | 3300025903 | Bacteria | 4791 |
| 370 | Ga0207680_10030488 | 3300025903 | Bacteria | 3042 |
| 371 | Ga0207680_10190943 | 3300025903 | Bacteria | 1390 |
| 372 | Ga0207680_10643521 | 3300025903 | Bacteria | 759 |
| 373 | Ga0207699_10467179 | 3300025906 | Bacteria | 907 |
| 374 | Ga0207699_11442702 | 3300025906 | Bacteria | 509 |
| 375 | Ga0207645_10027314 | 3300025907 | Bacteria | 3686 |
| 376 | Ga0207645_10470805 | 3300025907 | Unclassified | 849 |
| 377 | Ga0207643_10034561 | 3300025908 | Bacteria | 2832 |
| 378 | Ga0207643_10108138 | 3300025908 | Bacteria | 1636 |
| 379 | Ga0207654_10013963 | 3300025911 | Bacteria | 4140 |
| 380 | Ga0207707_10314799 | 3300025912 | Bacteria | 1352 |
| 381 | Ga0207695_10011114 | 3300025913 | Bacteria | 10930 |
| 382 | Ga0207695_10077046 | 3300025913 | Bacteria | 3388 |
| 383 | Ga0207695_10311931 | 3300025913 | Bacteria | 1463 |
| 384 | Ga0207693_10467793 | 3300025915 | Bacteria | 985 |
| 385 | Ga0207660_10008341 | 3300025917 | Bacteria | 6699 |
| 386 | Ga0207660_10972769 | 3300025917 | Bacteria | 692 |
| 387 | Ga0207662_10000215 | 3300025918 | Bacteria | 26901 |
| 388 | Ga0207662_10015862 | 3300025918 | Bacteria | 4244 |
| 389 | Ga0207662_10199449 | 3300025918 | Bacteria | 1295 |
| 390 | Ga0207662_10598499 | 3300025918 | Bacteria | 767 |
| 391 | Ga0207657_10339426 | 3300025919 | Bacteria | 1186 |
| 392 | Ga0207649_10933594 | 3300025920 | Bacteria | 681 |
| 393 | Ga0207652_10058107 | 3300025921 | Bacteria | 3332 |
| 394 | Ga0207652_10205627 | 3300025921 | Bacteria | 1772 |
| 395 | Ga0207681_10413495 | 3300025923 | Bacteria | 1091 |
| 396 | Ga0207681_11166189 | 3300025923 | Bacteria | 647 |
| 397 | Ga0207694_10137213 | 3300025924 | Bacteria | 1965 |
| 398 | Ga0207694_10898249 | 3300025924 | Unclassified | 749 |
| 399 | Ga0207650_10009243 | 3300025925 | Bacteria | 6735 |
| 400 | Ga0207650_10009343 | 3300025925 | Bacteria | 6702 |
| 401 | Ga0207650_10082067 | 3300025925 | Bacteria | 2446 |
| 402 | Ga0207650_11076722 | 3300025925 | Unclassified | 684 |
| 403 | Ga0207659_10305219 | 3300025926 | Bacteria | 1309 |
| 404 | Ga0207659_10633490 | 3300025926 | Bacteria | 913 |
| 405 | Ga0207659_10764001 | 3300025926 | Bacteria | 829 |
| 406 | Ga0207659_11648940 | 3300025926 | Unclassified | 547 |
| 407 | Ga0207687_10001049 | 3300025927 | Bacteria | 18747 |
| 408 | Ga0207687_10017744 | 3300025927 | Bacteria | 4692 |
| 409 | Ga0207687_10039884 | 3300025927 | Bacteria | 3217 |
| 410 | Ga0207687_10357875 | 3300025927 | Bacteria | 1191 |
| 411 | Ga0207687_11530252 | 3300025927 | Bacteria | 573 |
| 412 | Ga0207700_10775053 | 3300025928 | Bacteria | 857 |
| 413 | Ga0207700_11058742 | 3300025928 | Bacteria | 725 |
| 414 | Ga0207644_10040540 | 3300025931 | Bacteria | 3291 |
| 415 | Ga0207644_10044810 | 3300025931 | Bacteria | 3144 |
| 416 | Ga0207644_10047149 | 3300025931 | Bacteria | 3073 |
| 417 | Ga0207644_10425140 | 3300025931 | Bacteria | 1089 |
| 418 | Ga0207690_10579789 | 3300025932 | Unclassified | 914 |
| 419 | Ga0207706_10052009 | 3300025933 | Bacteria | 3617 |
| 420 | Ga0207706_10100596 | 3300025933 | Bacteria | 2543 |
| 421 | Ga0207706_10861389 | 3300025933 | Bacteria | 767 |
| 422 | Ga0207706_11654995 | 3300025933 | Bacteria | 517 |
| 423 | Ga0207686_10002720 | 3300025934 | Bacteria | 9588 |
| 424 | Ga0207686_10030105 | 3300025934 | Bacteria | 3210 |
| 425 | Ga0207686_10653580 | 3300025934 | Unclassified | 832 |
| 426 | Ga0207686_10874155 | 3300025934 | Bacteria | 724 |
| 427 | Ga0207709_10003890 | 3300025935 | Bacteria | 8729 |
| 428 | Ga0207709_10057388 | 3300025935 | Bacteria | 2414 |
| 429 | Ga0207709_10094705 | 3300025935 | Bacteria | 1961 |
| 430 | Ga0207709_10311331 | 3300025935 | Bacteria | 1175 |
| 431 | Ga0207709_11104617 | 3300025935 | Unclassified | 651 |
| 432 | Ga0207670_10002408 | 3300025936 | Bacteria | 9804 |
| 433 | Ga0207670_10615099 | 3300025936 | Bacteria | 893 |
| 434 | Ga0207669_10414928 | 3300025937 | Bacteria | 1058 |
| 435 | Ga0207669_10439651 | 3300025937 | Bacteria | 1031 |
| 436 | Ga0207704_10001044 | 3300025938 | Bacteria | 12293 |
| 437 | Ga0207704_10029962 | 3300025938 | Bacteria | 3044 |
| 438 | Ga0207665_11165065 | 3300025939 | Bacteria | 615 |
| 439 | Ga0207691_10143872 | 3300025940 | Bacteria | 2100 |
| 440 | Ga0207691_10144385 | 3300025940 | Bacteria | 2096 |
| 441 | Ga0207691_10223480 | 3300025940 | Unclassified | 1632 |
| 442 | Ga0207691_10465546 | 3300025940 | Bacteria | 1075 |
| 443 | Ga0207691_10756065 | 3300025940 | Bacteria | 818 |
| 444 | Ga0207691_10980261 | 3300025940 | Unclassified | 706 |
| 445 | Ga0207711_10016454 | 3300025941 | Bacteria | 6146 |
| 446 | Ga0207711_10083677 | 3300025941 | Bacteria | 2791 |
| 447 | Ga0207711_10499001 | 3300025941 | Bacteria | 1134 |
| 448 | Ga0207711_11069651 | 3300025941 | Bacteria | 747 |
| 449 | Ga0207689_10000007 | 3300025942 | Bacteria | 132362 |
| 450 | Ga0207689_10008236 | 3300025942 | Bacteria | 9082 |
| 451 | Ga0207689_10339469 | 3300025942 | Bacteria | 1248 |
| 452 | Ga0207689_11265761 | 3300025942 | Bacteria | 620 |
| 453 | Ga0207689_11367469 | 3300025942 | Unclassified | 594 |
| 454 | Ga0207661_10118183 | 3300025944 | Bacteria | 2253 |
| 455 | Ga0207661_10264495 | 3300025944 | Bacteria | 1533 |
| 456 | Ga0207679_10082442 | 3300025945 | Bacteria | 2462 |
| 457 | Ga0207679_10587265 | 3300025945 | Bacteria | 1002 |
| 458 | Ga0207679_10807423 | 3300025945 | Bacteria | 855 |
| 459 | Ga0207667_10012993 | 3300025949 | Bacteria | 9558 |
| 460 | Ga0207667_10060280 | 3300025949 | Bacteria | 3972 |
| 461 | Ga0207667_10823972 | 3300025949 | Bacteria | 923 |
| 462 | Ga0207667_11233703 | 3300025949 | Unclassified | 726 |
| 463 | Ga0207651_10009087 | 3300025960 | Bacteria | 5411 |
| 464 | Ga0207651_10173306 | 3300025960 | Unclassified | 1704 |
| 465 | Ga0207651_10197137 | 3300025960 | Bacteria | 1610 |
| 466 | Ga0207651_10414800 | 3300025960 | Bacteria | 1148 |
| 467 | Ga0207651_10674205 | 3300025960 | Bacteria | 909 |
| 468 | Ga0207712_10032651 | 3300025961 | Bacteria | 3514 |
| 469 | Ga0207712_10233697 | 3300025961 | Bacteria | 1477 |
| 470 | Ga0207712_10741936 | 3300025961 | Bacteria | 860 |
| 471 | Ga0207712_10958383 | 3300025961 | Bacteria | 758 |
| 472 | Ga0207712_11657557 | 3300025961 | Bacteria | 573 |
| 473 | Ga0207712_12020673 | 3300025961 | Unclassified | 516 |
| 474 | Ga0207668_11426800 | 3300025972 | Bacteria | 624 |
| 475 | Ga0207640_10010129 | 3300025981 | Bacteria | 5301 |
| 476 | Ga0207640_10016053 | 3300025981 | Bacteria | 4347 |
| 477 | Ga0207640_10982809 | 3300025981 | Bacteria | 742 |
| 478 | Ga0207658_10157931 | 3300025986 | Bacteria | 1855 |
| 479 | Ga0207677_10002194 | 3300026023 | Bacteria | 10259 |
| 480 | Ga0207677_10027567 | 3300026023 | Bacteria | 3580 |
| 481 | Ga0207677_10646874 | 3300026023 | Unclassified | 933 |
| 482 | Ga0207677_10986842 | 3300026023 | Unclassified | 763 |
| 483 | Ga0207703_10004921 | 3300026035 | Bacteria | 10839 |
| 484 | Ga0207703_10097679 | 3300026035 | Bacteria | 2482 |
| 485 | Ga0207703_10339003 | 3300026035 | Bacteria | 1381 |
| 486 | Ga0207703_11805899 | 3300026035 | Bacteria | 587 |
| 487 | Ga0207639_10029407 | 3300026041 | Bacteria | 4022 |
| 488 | Ga0207678_10301870 | 3300026067 | Bacteria | 1376 |
| 489 | Ga0207678_10432906 | 3300026067 | Bacteria | 1142 |
| 490 | Ga0207708_10001220 | 3300026075 | Bacteria | 19421 |
| 491 | Ga0207708_10002375 | 3300026075 | Bacteria | 13829 |
| 492 | Ga0207708_10006335 | 3300026075 | Bacteria | 8771 |
| 493 | Ga0207702_10000395 | 3300026078 | Bacteria | 49788 |
| 494 | Ga0207702_10503337 | 3300026078 | Bacteria | 1181 |
| 495 | Ga0207702_10770601 | 3300026078 | Bacteria | 950 |
| 496 | Ga0207702_11127755 | 3300026078 | Bacteria | 778 |
| 497 | Ga0207641_10015662 | 3300026088 | Bacteria | 6213 |
| 498 | Ga0207641_10149261 | 3300026088 | Bacteria | 2116 |
| 499 | Ga0207641_10249782 | 3300026088 | Bacteria | 1656 |
| 500 | Ga0207641_10257838 | 3300026088 | Bacteria | 1631 |
| 501 | Ga0207641_10335859 | 3300026088 | Bacteria | 1436 |
| 502 | Ga0207641_10412223 | 3300026088 | Bacteria | 1299 |
| 503 | Ga0207641_11372390 | 3300026088 | Bacteria | 708 |
| 504 | Ga0207641_12560300 | 3300026088 | Bacteria | 508 |
| 505 | Ga0207648_10000135 | 3300026089 | Bacteria | 73544 |
| 506 | Ga0207648_10006030 | 3300026089 | Bacteria | 12086 |
| 507 | Ga0207676_10007204 | 3300026095 | Bacteria | 7872 |
| 508 | Ga0207676_10029815 | 3300026095 | Bacteria | 4088 |
| 509 | Ga0207676_10063599 | 3300026095 | Bacteria | 2931 |
| 510 | Ga0207676_10485683 | 3300026095 | Bacteria | 1170 |
| 511 | Ga0207676_12015997 | 3300026095 | Bacteria | 576 |
| 512 | Ga0207676_12193768 | 3300026095 | Unclassified | 550 |
| 513 | Ga0207674_10011974 | 3300026116 | Bacteria | 9722 |
| 514 | Ga0207674_10169401 | 3300026116 | Bacteria | 2137 |
| 515 | Ga0207674_10992626 | 3300026116 | Unclassified | 809 |
| 516 | Ga0207675_100000825 | 3300026118 | Bacteria | 30861 |
| 517 | Ga0207675_100009738 | 3300026118 | Bacteria | 8998 |
| 518 | Ga0207675_100028360 | 3300026118 | Bacteria | 5213 |
| 519 | Ga0207675_100031263 | 3300026118 | Bacteria | 4959 |
| 520 | Ga0207675_100032021 | 3300026118 | Bacteria | 4899 |
| 521 | Ga0207675_100612113 | 3300026118 | Bacteria | 1093 |
| 522 | Ga0207675_102106483 | 3300026118 | Unclassified | 580 |
| 523 | Ga0207675_102393153 | 3300026118 | Unclassified | 540 |
| 524 | Ga0207683_10015743 | 3300026121 | Bacteria | 6436 |
| 525 | Ga0207683_10400751 | 3300026121 | Bacteria | 1262 |
| 526 | Ga0207683_10750847 | 3300026121 | Bacteria | 905 |
| 527 | Ga0207683_10841291 | 3300026121 | Bacteria | 852 |
| 528 | Ga0207683_10900203 | 3300026121 | Unclassified | 822 |
| 529 | Ga0207698_10128807 | 3300026142 | Bacteria | 2159 |
| 530 | Ga0207698_10311825 | 3300026142 | Bacteria | 1469 |
| 531 | Ga0207698_10610024 | 3300026142 | Unclassified | 1077 |
| 532 | Ga0209179_1001504 | 3300027512 | Bacteria | 2878 |
| 533 | Ga0207428_10000265 | 3300027907 | Bacteria | 70984 |
| 534 | Ga0207428_10531619 | 3300027907 | Bacteria | 852 |
| 535 | Ga0268266_10000808 | 3300028379 | Bacteria | 41511 |
| 536 | Ga0268266_10169068 | 3300028379 | Bacteria | 1983 |
| 537 | Ga0268266_10436893 | 3300028379 | Bacteria | 1242 |
| 538 | Ga0268266_10850716 | 3300028379 | Bacteria | 882 |
| 539 | Ga0268265_10003652 | 3300028380 | Bacteria | 10970 |
| 540 | Ga0268264_10042993 | 3300028381 | Bacteria | 3742 |
| 541 | Ga0268264_10237783 | 3300028381 | Bacteria | 1686 |
| 542 | Ga0268264_10323441 | 3300028381 | Bacteria | 1459 |
| 543 | Ga0268264_10488912 | 3300028381 | Bacteria | 1198 |
| 544 | Ga0268264_10791071 | 3300028381 | Bacteria | 947 |
| 545 | Ga0268264_11663475 | 3300028381 | Bacteria | 649 |
| 546 | Ga0265336_10002580 | 3300028666 | Bacteria | 7405 |
| 547 | Ga0265338_10023488 | 3300028800 | Bacteria | 6336 |
| 548 | Ga0307512_10464740 | 3300030522 | Bacteria | 506 |
| 549 | Ga0265332_10077008 | 3300031238 | Bacteria | 1417 |
| 550 | Ga0265332_10254171 | 3300031238 | Bacteria | 727 |
| 551 | Ga0265328_10000640 | 3300031239 | Bacteria | 16218 |
| 552 | Ga0265320_10001511 | 3300031240 | Bacteria | 16937 |
| 553 | Ga0265320_10026887 | 3300031240 | Bacteria | 3006 |
| 554 | Ga0265325_10083101 | 3300031241 | Bacteria | 1589 |
| 555 | Ga0265329_10055164 | 3300031242 | Bacteria | 1261 |
| 556 | Ga0265339_10028033 | 3300031249 | Bacteria | 3206 |
| 557 | Ga0265339_10148516 | 3300031249 | Bacteria | 1187 |
| 558 | Ga0265339_10409900 | 3300031249 | Bacteria | 632 |
| 559 | Ga0265331_10077555 | 3300031250 | Bacteria | 1548 |
| 560 | Ga0265331_10532620 | 3300031250 | Bacteria | 529 |
| 561 | Ga0265316_11018615 | 3300031344 | Bacteria | 576 |
| 562 | Ga0307509_10209315 | 3300031507 | Bacteria | 1777 |
| 563 | Ga0265314_10004255 | 3300031711 | Bacteria | 13407 |
| 564 | Ga0265314_10041451 | 3300031711 | Bacteria | 3295 |
| 565 | Ga0265342_10000136 | 3300031712 | Bacteria | 82368 |
| 566 | Ga0265342_10028108 | 3300031712 | Bacteria | 3507 |
| 567 | Ga0307510_10077392 | 3300033180 | Bacteria | 3263 |
| 568 | Ga0307510_10205875 | 3300033180 | Bacteria | 1496 |
| 569 | Ga0373930_0064337 | 3300034816 | Bacteria | 823 |
| 570 | Ga0373948_0007910 | 3300034817 | Bacteria | 1800 |
| 571 | Ga0373950_0012776 | 3300034818 | Bacteria | 1392 |
| 572 | Ga0373958_0013783 | 3300034819 | Bacteria | 1405 |
| 573 | Ga0373938_0022610 | 3300034957 | Bacteria | 1286 |
| 574 | Ga0373926_0162274 | 3300035083 | Unclassified | 853 |
| 575 | Ga0373928_0025020 | 3300035084 | Bacteria | 1284 |
| 576 | Ga0373928_0074017 | 3300035084 | Unclassified | 848 |
| 577 | Ga0373928_0272939 | 3300035084 | Bacteria | 510 |
| 578 | Ga0373929_0009977 | 3300035085 | Bacteria | 1767 |
| 579 | Ga0373934_0207549 | 3300035086 | Unclassified | 807 |
| 580 | Ga0373940_0283094 | 3300035088 | Bacteria | 567 |
| 581 | Ga0373944_0164194 | 3300035089 | Unclassified | 789 |
| 582 | Ga0373949_0025002 | 3300035090 | Bacteria | 1391 |
| 583 | Ga0373949_0091353 | 3300035090 | Unclassified | 824 |
| 584 | Ga0373951_0016205 | 3300035091 | Bacteria | 1680 |
| 585 | Ga0373952_0032093 | 3300035092 | Bacteria | 1171 |
| 586 | Ga0373952_0157757 | 3300035092 | Bacteria | 641 |
| 587 | Ga0373923_0353262 | 3300035111 | Unclassified | 702 |
| 588 | Ga0373923_0616945 | 3300035111 | Unclassified | 535 |
| 589 | Ga0373936_0019200 | 3300035113 | Bacteria | 2648 |
| 590 | Ga0373936_0226308 | 3300035113 | Bacteria | 831 |
| 591 | Ga0373939_0009948 | 3300035114 | Bacteria | 2367 |
| 592 | Ga0373939_0210011 | 3300035114 | Bacteria | 740 |
| 593 | Ga0373941_0005618 | 3300035115 | Bacteria | 2965 |
| 594 | Ga0373945_0224593 | 3300035116 | Bacteria | 786 |
| 595 | Ga0373957_0356394 | 3300035120 | Unclassified | 625 |
| 596 | Ga0373960_0024238 | 3300035121 | Bacteria | 1639 |
| 597 | Ga0373943_0133035 | 3300035170 | Unclassified | 1332 |
| 598 | Ga0373943_0460567 | 3300035170 | Bacteria | 740 |
| 599 | Ga0373946_0010654 | 3300035171 | Bacteria | 3409 |
| 600 | Ga0373946_0550713 | 3300035171 | Bacteria | 595 |
| 601 | Ga0373955_0604163 | 3300035172 | Bacteria | 672 |
| 602 | Ga0373942_0015824 | 3300035207 | Bacteria | 1843 |
| 603 | Ga0373942_0056169 | 3300035207 | Bacteria | 1117 |
| 604 | Ga0373961_0106592 | 3300035241 | Bacteria | 913 |
| 605 | Ga0373962_0065055 | 3300035242 | Bacteria | 1078 |
| 606 | Ga0373931_0001607 | 3300035691 | Bacteria | 9780 |
| 607 | Ga0373931_0075361 | 3300035691 | Bacteria | 1850 |
| 608 | Ga0373931_0096028 | 3300035691 | Bacteria | 1660 |
| 609 | Ga0373931_0211548 | 3300035691 | Bacteria | 1163 |
| 610 | Ga0373931_0464982 | 3300035691 | Bacteria | 811 |
| 611 | Ga0373935_0312352 | 3300035692 | Unclassified | 1113 |
| 612 | Ga0373935_0574461 | 3300035692 | Unclassified | 823 |
| 613 | Ga0373927_0097863 | 3300035695 | Bacteria | 1907 |
| 614 | Ga0373927_0426475 | 3300035695 | Unclassified | 875 |
| 615 | Ga0373927_0436447 | 3300035695 | Bacteria | 865 |
| 616 | Ga0373927_0646816 | 3300035695 | Unclassified | 699 |
| 617 | Ga0373927_0906721 | 3300035695 | Bacteria | 582 |
| 618 | Ga0373947_0175536 | 3300035725 | Bacteria | 1392 |
| 619 | Ga0373947_0194527 | 3300035725 | Unclassified | 1324 |
| 620 | Ga0373937_0412469 | 3300036401 | Unclassified | 1282 |
| 621 | Ga0310109_048745 | 3300036534 | Bacteria | 546 |
| 622 | Ga0373925_0019590 | 3300037068 | Bacteria | 4923 |
| 623 | Ga0373925_0154573 | 3300037068 | Bacteria | 1803 |
| 624 | Ga0373925_0229906 | 3300037068 | Bacteria | 1483 |
| 625 | Ga0373925_0825369 | 3300037068 | Bacteria | 764 |
| 626 | Ga0395899_0092302 | 3300037312 | Bacteria | 2193 |
| 627 | Ga0395900_0412387 | 3300037418 | Bacteria | 1313 |
| 628 | Ga0395900_0520188 | 3300037418 | Unclassified | 1138 |
| 629 | Ga0395905_0889784 | 3300037471 | Unclassified | 793 |
| 630 | Ga0395905_1286755 | 3300037471 | Bacteria | 635 |
| 631 | Ga0395901_0002178 | 3300038443 | Bacteria | 19994 |
| 632 | Ga0395901_0702983 | 3300038443 | Bacteria | 1008 |
| 633 | Ga0466963_0705477 | 3300044694 | Bacteria | 712 |
| 634 | Ga0466957_0026643 | 3300044842 | Bacteria | 3431 |
| 635 | Ga0451576_0022710 | 3300045051 | Bacteria | 6796 |
| 636 | Ga0451576_0287673 | 3300045051 | Bacteria | 1718 |
| 637 | Ga0451576_0492236 | 3300045051 | Bacteria | 1288 |
| 638 | Ga0451576_0800716 | 3300045051 | Bacteria | 989 |
| 639 | Ga0451576_1324134 | 3300045051 | Bacteria | 751 |
| 640 | Ga0466967_2595679 | 3300045976 | Bacteria | 501 |
| 641 | Ga0495603_0063676 | 3300046455 | Bacteria | 2175 |
| 642 | Ga0495603_0764523 | 3300046455 | Archaea | 552 |
| 643 | Ga0495590_0152714 | 3300046457 | Bacteria | 837 |
| 644 | Ga0495591_113339 | 3300046458 | Bacteria | 665 |
| 645 | Ga0495629_0479333 | 3300046459 | Bacteria | 840 |
| 646 | Ga0495629_0597844 | 3300046459 | Bacteria | 738 |
| 647 | Ga0495629_0610729 | 3300046459 | Unclassified | 729 |
| 648 | Ga0495653_0629689 | 3300046463 | Bacteria | 657 |
| 649 | Ga0495580_0124396 | 3300046472 | Bacteria | 1790 |
| 650 | Ga0495580_0248400 | 3300046472 | Bacteria | 1218 |
| 651 | Ga0495580_1052106 | 3300046472 | Unclassified | 517 |
| 652 | Ga0495582_0225425 | 3300046473 | Unclassified | 1073 |
| 653 | Ga0495639_0210291 | 3300046475 | Unclassified | 954 |
| 654 | Ga0495639_0368947 | 3300046475 | Unclassified | 722 |
| 655 | Ga0495594_0531963 | 3300046499 | Archaea | 667 |
| 656 | Ga0495610_0207833 | 3300046512 | Bacteria | 798 |
| 657 | Ga0495618_0392284 | 3300046514 | Bacteria | 850 |
| 658 | Ga0495620_0212425 | 3300046515 | Bacteria | 742 |
| 659 | Ga0495632_0010119 | 3300046519 | Bacteria | 5615 |
| 660 | Ga0495663_0153948 | 3300046525 | Bacteria | 786 |
| 661 | Ga0495666_0305368 | 3300046526 | Unclassified | 719 |
| 662 | Ga0495642_0085475 | 3300046528 | Bacteria | 1332 |
| 663 | Ga0495586_0221304 | 3300046535 | Bacteria | 1076 |
| 664 | Ga0495598_0086816 | 3300046537 | Bacteria | 1013 |
| 665 | Ga0495621_0153139 | 3300046539 | Bacteria | 908 |
| 666 | Ga0495621_0311831 | 3300046539 | Bacteria | 654 |
| 667 | Ga0495597_0178152 | 3300046542 | Bacteria | 860 |
| 668 | Ga0495645_0410919 | 3300046543 | Unclassified | 861 |
| 669 | Ga0495634_0035998 | 3300046642 | Bacteria | 3387 |
| 670 | Ga0495611_0350817 | 3300046648 | Bacteria | 677 |
| 671 | Ga0495635_0308925 | 3300046663 | Unclassified | 1060 |
| 672 | Ga0495647_0033520 | 3300046681 | Bacteria | 1920 |
| 673 | Ga0495658_0008063 | 3300046683 | Bacteria | 5216 |
| 674 | Ga0495658_0069779 | 3300046683 | Bacteria | 2037 |
| 675 | Ga0495658_0547064 | 3300046683 | Unclassified | 741 |
| 676 | Ga0495613_0119076 | 3300046689 | Bacteria | 1897 |
| 677 | Ga0495624_0420262 | 3300046690 | Unclassified | 802 |
| 678 | Ga0495671_0475191 | 3300046692 | Bacteria | 597 |
| 679 | Ga0495649_0000767 | 3300046694 | Bacteria | 25825 |
| 680 | Ga0495660_0069900 | 3300046810 | Bacteria | 1865 |
| 681 | Ga0495674_0360140 | 3300047319 | Bacteria | 1179 |
| 682 | Ga0495674_1076683 | 3300047319 | Unclassified | 613 |
| 683 | Ga0495687_014089 | 3300047443 | Bacteria | 4134 |
| 684 | Ga0495626_0050285 | 3300048091 | Bacteria | 1926 |
| 685 | Ga0496100_1417500 | 3300048903 | Bacteria | 548 |
| 686 | Ga0496101_0370511 | 3300048904 | Unclassified | 1126 |
| 687 | Ga0496101_1146933 | 3300048904 | Bacteria | 610 |
| 688 | Ga0496102_0555631 | 3300048905 | Bacteria | 1071 |
| 689 | Ga0496102_1438399 | 3300048905 | Bacteria | 608 |
| 690 | Ga0496103_0662982 | 3300048906 | Unclassified | 662 |
| 691 | Ga0496103_1057418 | 3300048906 | Bacteria | 503 |
| 692 | Ga0496104_0065053 | 3300048907 | Bacteria | 3460 |
| 693 | Ga0496104_0095935 | 3300048907 | Bacteria | 2837 |
| 694 | Ga0496105_0168693 | 3300048908 | Bacteria | 1795 |
| 695 | Ga0496106_0222897 | 3300048909 | Bacteria | 1504 |
| 696 | Ga0496106_0245626 | 3300048909 | Bacteria | 1430 |
| 697 | Ga0496107_0773014 | 3300048910 | Bacteria | 704 |
| 698 | Ga0496107_1109222 | 3300048910 | Bacteria | 571 |
| 699 | Ga0496108_0029402 | 3300048911 | Bacteria | 4550 |
| 700 | Ga0496108_0324828 | 3300048911 | Bacteria | 1341 |
| 701 | Ga0496108_0996473 | 3300048911 | Bacteria | 716 |
| 702 | Ga0496109_0163088 | 3300048912 | Bacteria | 2088 |
| 703 | Ga0496109_1508694 | 3300048912 | Bacteria | 607 |
| 704 | Ga0496109_1840550 | 3300048912 | Unclassified | 538 |
| 705 | Ga0496110_0206878 | 3300048913 | Bacteria | 1784 |
| 706 | Ga0496110_0466209 | 3300048913 | Bacteria | 1151 |
| 707 | Ga0496111_0936021 | 3300048914 | Bacteria | 623 |
| 708 | Ga0496112_0108698 | 3300048915 | Bacteria | 2743 |
| 709 | Ga0496112_0116953 | 3300048915 | Bacteria | 2636 |
| 710 | Ga0496113_0098483 | 3300048916 | Bacteria | 2263 |
| 711 | Ga0496113_0365210 | 3300048916 | Bacteria | 1158 |
| 712 | Ga0496114_0064970 | 3300048917 | Unclassified | 3056 |
| 713 | Ga0496114_0363306 | 3300048917 | Unclassified | 1281 |
| 714 | Ga0496114_1263445 | 3300048917 | Bacteria | 625 |
| 715 | Ga0496115_0056052 | 3300048918 | Unclassified | 3167 |
| 716 | Ga0496115_0081226 | 3300048918 | Unclassified | 2640 |
| 717 | Ga0496115_0246041 | 3300048918 | Bacteria | 1473 |
| 718 | Ga0496119_0284154 | 3300048922 | Bacteria | 821 |
| 719 | Ga0496122_0148921 | 3300048925 | Bacteria | 1448 |
| 720 | Ga0496123_0121635 | 3300048926 | Bacteria | 1467 |
| 721 | Ga0495678_126007 | 3300049459 | Bacteria | 854 |
| 722 | Ga0501034_0094491 | 3300049571 | Bacteria | 2986 |
| 723 | Ga0501048_0272093 | 3300049582 | Bacteria | 1204 |
| 724 | Ga0501070_0229587 | 3300049586 | Bacteria | 1521 |
| 725 | Ga0501072_1263295 | 3300049588 | Bacteria | 573 |
| 726 | Ga0501073_0007406 | 3300049589 | Bacteria | 8158 |
| 727 | Ga0501080_0094703 | 3300049742 | Bacteria | 2773 |
| 728 | Ga0501044_1120184 | 3300049823 | Bacteria | 656 |
| 729 | nmdc:mga03683_84444_c1 | 3300050489 | Bacteria | 1376 |
| 730 | nmdc:mga03n38_716471_c1 | 3300050490 | Bacteria | 578 |
| 731 | nmdc:mga03n38_878602_c1 | 3300050490 | Bacteria | 526 |
| 732 | nmdc:mga00v17_150773_c1 | 3300050491 | Bacteria | 1494 |
| 733 | nmdc:mga05p37_2222976_c1 | 3300050507 | Unclassified | 508 |
| 734 | nmdc:mga05p37_25428_c1 | 3300050507 | Bacteria | 7200 |
| 735 | nmdc:mga05p37_2836_c1 | 3300050507 | Bacteria | 20144 |
| 736 | nmdc:mga09592_1731629_c1 | 3300050508 | Unclassified | 503 |
| 737 | nmdc:mga09592_20267_c1 | 3300050508 | Bacteria | 5466 |
| 738 | nmdc:mga09592_206267_c1 | 3300050508 | Bacteria | 1702 |
| 739 | nmdc:mga0qj67_234818_c1 | 3300050509 | Bacteria | 1488 |
| 740 | nmdc:mga0qj67_977756_c1 | 3300050509 | Bacteria | 665 |
| 741 | nmdc:mga06r32_1287897_c1 | 3300050510 | Unclassified | 675 |
| 742 | nmdc:mga06r32_64989_c1 | 3300050510 | Bacteria | 3518 |
| 743 | nmdc:mga08y16_465879_c1 | 3300050511 | Bacteria | 1287 |
| 744 | nmdc:mga08y16_494575_c1 | 3300050511 | Bacteria | 1243 |
| 745 | nmdc:mga08y16_5446_c1 | 3300050511 | Bacteria | 13305 |
| 746 | nmdc:mga0n895_105890_c1 | 3300050512 | Bacteria | 2825 |
| 747 | nmdc:mga0n895_564976_c1 | 3300050512 | Bacteria | 1142 |
| 748 | nmdc:mga0rr50_1107364_c1 | 3300050513 | Bacteria | 674 |
| 749 | nmdc:mga08x19_433400_c1 | 3300050514 | Bacteria | 924 |
| 750 | nmdc:mga0a205_411098_c1 | 3300050515 | Bacteria | 1216 |
| 751 | Ga0495601_0188492 | 3300053077 | Bacteria | 1348 |
| 752 | Ga0500578_0081618 | 3300053086 | Bacteria | 2056 |
| 753 | Ga0500646_0097200 | 3300053090 | Bacteria | 920 |
| 754 | Ga0500651_0465321 | 3300053093 | Bacteria | 701 |
| 755 | Ga0500650_0155682 | 3300053098 | Bacteria | 1055 |
| 756 | Ga0500650_0461993 | 3300053098 | Bacteria | 543 |
| 757 | Ga0500650_0492547 | 3300053098 | Unclassified | 522 |
| 758 | Ga0500614_059055 | 3300053123 | Unclassified | 1027 |
| 759 | Ga0500621_290116 | 3300053126 | Bacteria | 529 |
| 760 | Ga0500642_0359989 | 3300053130 | Bacteria | 644 |
| 761 | Ga0500603_003095 | 3300053150 | Bacteria | 3591 |
| 762 | Ga0500616_0087441 | 3300053153 | Unclassified | 1551 |
| 763 | Ga0500638_165053 | 3300053162 | Bacteria | 971 |
| 764 | Ga0500637_0068936 | 3300053178 | Bacteria | 2032 |
| 765 | Ga0501084_1156846 | 3300054114 | Bacteria | 649 |
| 766 | Ga0501082_0461270 | 3300060353 | Bacteria | 1110 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026142 | Ga0207698_10610024 | Ga0207698_106100241 | 42 |
| 2 | 3300002705 | JGI25156J39149_1000376 | JGI25156J39149_100037621 | 49 |
| 3 | 3300002738 | JGI25154J39366_1000488 | JGI25154J39366_10004887 | 49 |
| 4 | 3300002741 | JGI25157J39369_1000199 | JGI25157J39369_100019927 | 49 |
| 5 | 3300003316 | rootH1_10037156 | rootH1_100371562 | 49 |
| 6 | 3300003323 | rootH1_10014388 | rootH1_100143882 | 49 |
| 7 | 3300003323 | rootH1_10020809 | rootH1_100208093 | 49 |
| 8 | 3300003323 | rootH1_10039540 | rootH1_100395407 | 49 |
| 9 | 3300003323 | rootH1_10174920 | rootH1_1017492010 | 49 |
| 10 | 3300003323 | rootH1_10243980 | rootH1_102439809 | 49 |
| 11 | 3300003752 | Ga0055539_1000312 | Ga0055539_10003129 | 49 |
| 12 | 3300003752 | Ga0055539_1000659 | Ga0055539_10006593 | 49 |
| 13 | 3300003756 | Ga0055533_1000033 | Ga0055533_1000033221 | 49 |
| 14 | 3300003759 | Ga0055525_1001535 | Ga0055525_10015354 | 49 |
| 15 | 3300005289 | Ga0065704_10793649 | Ga0065704_107936492 | 49 |
| 16 | 3300005295 | Ga0065707_10087312 | Ga0065707_100873123 | 49 |
| 17 | 3300005329 | Ga0070683_100098687 | Ga0070683_1000986874 | 49 |
| 18 | 3300005329 | Ga0070683_100454450 | Ga0070683_1004544503 | 49 |
| 19 | 3300005329 | Ga0070683_100741457 | Ga0070683_1007414571 | 49 |
| 20 | 3300005330 | Ga0070690_100012931 | Ga0070690_1000129316 | 49 |
| 21 | 3300005330 | Ga0070690_100037072 | Ga0070690_1000370722 | 49 |
| 22 | 3300005331 | Ga0070670_100042702 | Ga0070670_1000427024 | 49 |
| 23 | 3300005331 | Ga0070670_100750172 | Ga0070670_1007501722 | 49 |
| 24 | 3300005331 | Ga0070670_101411098 | Ga0070670_1014110982 | 49 |
| 25 | 3300005333 | Ga0070677_10122527 | Ga0070677_101225272 | 49 |
| 26 | 3300005334 | Ga0068869_100534220 | Ga0068869_1005342202 | 49 |
| 27 | 3300005334 | Ga0068869_101242201 | Ga0068869_1012422011 | 49 |
| 28 | 3300005334 | Ga0068869_101267466 | Ga0068869_1012674662 | 49 |
| 29 | 3300005334 | Ga0068869_101561124 | Ga0068869_1015611241 | 49 |
| 30 | 3300005335 | Ga0070666_10010458 | Ga0070666_100104584 | 49 |
| 31 | 3300005336 | Ga0070680_100127802 | Ga0070680_1001278024 | 49 |
| 32 | 3300005338 | Ga0068868_100108494 | Ga0068868_1001084942 | 49 |
| 33 | 3300005338 | Ga0068868_100969875 | Ga0068868_1009698752 | 49 |
| 34 | 3300005339 | Ga0070660_100445724 | Ga0070660_1004457243 | 49 |
| 35 | 3300005339 | Ga0070660_100632600 | Ga0070660_1006326001 | 49 |
| 36 | 3300005340 | Ga0070689_100079004 | Ga0070689_1000790042 | 49 |
| 37 | 3300005341 | Ga0070691_10476470 | Ga0070691_104764702 | 49 |
| 38 | 3300005344 | Ga0070661_100021587 | Ga0070661_1000215874 | 49 |
| 39 | 3300005354 | Ga0070675_100868855 | Ga0070675_1008688551 | 49 |
| 40 | 3300005355 | Ga0070671_100005134 | Ga0070671_1000051346 | 49 |
| 41 | 3300005355 | Ga0070671_101709104 | Ga0070671_1017091041 | 49 |
| 42 | 3300005356 | Ga0070674_100678334 | Ga0070674_1006783341 | 49 |
| 43 | 3300005356 | Ga0070674_100767368 | Ga0070674_1007673682 | 49 |
| 44 | 3300005356 | Ga0070674_101786869 | Ga0070674_1017868692 | 49 |
| 45 | 3300005364 | Ga0070673_100154246 | Ga0070673_1001542464 | 49 |
| 46 | 3300005364 | Ga0070673_100350617 | Ga0070673_1003506172 | 49 |
| 47 | 3300005365 | Ga0070688_101020111 | Ga0070688_1010201112 | 49 |
| 48 | 3300005367 | Ga0070667_100018405 | Ga0070667_1000184054 | 49 |
| 49 | 3300005367 | Ga0070667_100365916 | Ga0070667_1003659162 | 49 |
| 50 | 3300005434 | Ga0070709_10098408 | Ga0070709_100984081 | 49 |
| 51 | 3300005436 | Ga0070713_100427433 | Ga0070713_1004274332 | 49 |
| 52 | 3300005436 | Ga0070713_100887561 | Ga0070713_1008875612 | 49 |
| 53 | 3300005438 | Ga0070701_10144942 | Ga0070701_101449423 | 49 |
| 54 | 3300005444 | Ga0070694_100523279 | Ga0070694_1005232792 | 49 |
| 55 | 3300005455 | Ga0070663_100343948 | Ga0070663_1003439482 | 49 |
| 56 | 3300005455 | Ga0070663_101024812 | Ga0070663_1010248121 | 49 |
| 57 | 3300005456 | Ga0070678_100838132 | Ga0070678_1008381322 | 49 |
| 58 | 3300005456 | Ga0070678_101282596 | Ga0070678_1012825962 | 49 |
| 59 | 3300005457 | Ga0070662_101186666 | Ga0070662_1011866662 | 49 |
| 60 | 3300005458 | Ga0070681_10100377 | Ga0070681_101003774 | 49 |
| 61 | 3300005466 | Ga0070685_10042237 | Ga0070685_100422373 | 49 |
| 62 | 3300005471 | Ga0070698_101645983 | Ga0070698_1016459832 | 49 |
| 63 | 3300005518 | Ga0070699_101090581 | Ga0070699_1010905812 | 49 |
| 64 | 3300005535 | Ga0070684_100076468 | Ga0070684_1000764682 | 49 |
| 65 | 3300005535 | Ga0070684_100508384 | Ga0070684_1005083841 | 49 |
| 66 | 3300005536 | Ga0070697_101147305 | Ga0070697_1011473051 | 49 |
| 67 | 3300005539 | Ga0068853_100375901 | Ga0068853_1003759011 | 49 |
| 68 | 3300005543 | Ga0070672_100145268 | Ga0070672_1001452684 | 49 |
| 69 | 3300005543 | Ga0070672_100683231 | Ga0070672_1006832312 | 49 |
| 70 | 3300005544 | Ga0070686_100054036 | Ga0070686_1000540362 | 49 |
| 71 | 3300005544 | Ga0070686_100333262 | Ga0070686_1003332623 | 49 |
| 72 | 3300005545 | Ga0070695_100847925 | Ga0070695_1008479252 | 49 |
| 73 | 3300005546 | Ga0070696_100035272 | Ga0070696_1000352724 | 49 |
| 74 | 3300005547 | Ga0070693_100022202 | Ga0070693_1000222023 | 49 |
| 75 | 3300005547 | Ga0070693_100091139 | Ga0070693_1000911392 | 49 |
| 76 | 3300005547 | Ga0070693_100145648 | Ga0070693_1001456482 | 49 |
| 77 | 3300005548 | Ga0070665_100002191 | Ga0070665_10000219110 | 49 |
| 78 | 3300005548 | Ga0070665_100008155 | Ga0070665_1000081558 | 49 |
| 79 | 3300005548 | Ga0070665_100371530 | Ga0070665_1003715302 | 49 |
| 80 | 3300005549 | Ga0070704_100979400 | Ga0070704_1009794002 | 49 |
| 81 | 3300005563 | Ga0068855_100074235 | Ga0068855_1000742358 | 49 |
| 82 | 3300005563 | Ga0068855_100331510 | Ga0068855_1003315103 | 49 |
| 83 | 3300005564 | Ga0070664_100008795 | Ga0070664_1000087953 | 49 |
| 84 | 3300005564 | Ga0070664_100120598 | Ga0070664_1001205983 | 49 |
| 85 | 3300005564 | Ga0070664_100297286 | Ga0070664_1002972863 | 49 |
| 86 | 3300005577 | Ga0068857_100001581 | Ga0068857_1000015815 | 49 |
| 87 | 3300005577 | Ga0068857_101212413 | Ga0068857_1012124132 | 49 |
| 88 | 3300005578 | Ga0068854_100047175 | Ga0068854_1000471751 | 49 |
| 89 | 3300005578 | Ga0068854_100449821 | Ga0068854_1004498211 | 49 |
| 90 | 3300005614 | Ga0068856_100001069 | Ga0068856_10000106922 | 49 |
| 91 | 3300005614 | Ga0068856_100291434 | Ga0068856_1002914342 | 49 |
| 92 | 3300005614 | Ga0068856_100885385 | Ga0068856_1008853852 | 49 |
| 93 | 3300005615 | Ga0070702_100026229 | Ga0070702_1000262294 | 49 |
| 94 | 3300005616 | Ga0068852_100159346 | Ga0068852_1001593463 | 49 |
| 95 | 3300005617 | Ga0068859_100006635 | Ga0068859_1000066354 | 49 |
| 96 | 3300005617 | Ga0068859_102077725 | Ga0068859_1020777252 | 49 |
| 97 | 3300005617 | Ga0068859_102752483 | Ga0068859_1027524831 | 49 |
| 98 | 3300005618 | Ga0068864_100003997 | Ga0068864_1000039974 | 49 |
| 99 | 3300005618 | Ga0068864_100128578 | Ga0068864_1001285781 | 49 |
| 100 | 3300005618 | Ga0068864_101265186 | Ga0068864_1012651861 | 49 |
| 101 | 3300005718 | Ga0068866_10430335 | Ga0068866_104303352 | 49 |
| 102 | 3300005719 | Ga0068861_100064223 | Ga0068861_1000642232 | 49 |
| 103 | 3300005719 | Ga0068861_100709911 | Ga0068861_1007099112 | 49 |
| 104 | 3300005719 | Ga0068861_101641634 | Ga0068861_1016416342 | 49 |
| 105 | 3300005834 | Ga0068851_10173382 | Ga0068851_101733822 | 49 |
| 106 | 3300005834 | Ga0068851_10178843 | Ga0068851_101788433 | 49 |
| 107 | 3300005840 | Ga0068870_10008184 | Ga0068870_100081843 | 49 |
| 108 | 3300005841 | Ga0068863_100121249 | Ga0068863_1001212493 | 49 |
| 109 | 3300005841 | Ga0068863_100238093 | Ga0068863_1002380934 | 49 |
| 110 | 3300005841 | Ga0068863_100352186 | Ga0068863_1003521861 | 49 |
| 111 | 3300005841 | Ga0068863_100361801 | Ga0068863_1003618011 | 49 |
| 112 | 3300005842 | Ga0068858_100018730 | Ga0068858_1000187303 | 49 |
| 113 | 3300005842 | Ga0068858_100549270 | Ga0068858_1005492702 | 49 |
| 114 | 3300005843 | Ga0068860_100288293 | Ga0068860_1002882932 | 49 |
| 115 | 3300005843 | Ga0068860_100399336 | Ga0068860_1003993363 | 49 |
| 116 | 3300005983 | Ga0081540_1314338 | Ga0081540_13143381 | 49 |
| 117 | 3300006048 | Ga0075363_100344347 | Ga0075363_1003443472 | 49 |
| 118 | 3300006051 | Ga0075364_10122909 | Ga0075364_101229093 | 49 |
| 119 | 3300006173 | Ga0070716_100704541 | Ga0070716_1007045412 | 49 |
| 120 | 3300006173 | Ga0070716_101840193 | Ga0070716_1018401932 | 49 |
| 121 | 3300006177 | Ga0075362_10377651 | Ga0075362_103776512 | 49 |
| 122 | 3300006237 | Ga0097621_100018098 | Ga0097621_1000180987 | 49 |
| 123 | 3300006353 | Ga0075370_10034887 | Ga0075370_100348872 | 49 |
| 124 | 3300006358 | Ga0068871_100074998 | Ga0068871_1000749984 | 49 |
| 125 | 3300006358 | Ga0068871_100304365 | Ga0068871_1003043652 | 49 |
| 126 | 3300006844 | Ga0075428_100051828 | Ga0075428_1000518282 | 49 |
| 127 | 3300006844 | Ga0075428_100317286 | Ga0075428_1003172862 | 49 |
| 128 | 3300006846 | Ga0075430_100766684 | Ga0075430_1007666842 | 49 |
| 129 | 3300006847 | Ga0075431_100359524 | Ga0075431_1003595242 | 49 |
| 130 | 3300006871 | Ga0075434_100125217 | Ga0075434_1001252173 | 49 |
| 131 | 3300006871 | Ga0075434_100460740 | Ga0075434_1004607401 | 49 |
| 132 | 3300006871 | Ga0075434_101317087 | Ga0075434_1013170872 | 49 |
| 133 | 3300006880 | Ga0075429_101455327 | Ga0075429_1014553272 | 49 |
| 134 | 3300006880 | Ga0075429_101783568 | Ga0075429_1017835682 | 49 |
| 135 | 3300006881 | Ga0068865_100794248 | Ga0068865_1007942482 | 49 |
| 136 | 3300006931 | Ga0097620_100006635 | Ga0097620_1000066354 | 49 |
| 137 | 3300006931 | Ga0097620_102077897 | Ga0097620_1020778972 | 49 |
| 138 | 3300006931 | Ga0097620_102753001 | Ga0097620_1027530011 | 49 |
| 139 | 3300007076 | Ga0075435_100397106 | Ga0075435_1003971062 | 49 |
| 140 | 3300007076 | Ga0075435_102013796 | Ga0075435_1020137962 | 49 |
| 141 | 3300007788 | Ga0099795_10005750 | Ga0099795_100057503 | 49 |
| 142 | 3300009093 | Ga0105240_10024844 | Ga0105240_100248447 | 49 |
| 143 | 3300009093 | Ga0105240_10088742 | Ga0105240_100887424 | 49 |
| 144 | 3300009094 | Ga0111539_10156092 | Ga0111539_101560923 | 49 |
| 145 | 3300009098 | Ga0105245_10016905 | Ga0105245_100169057 | 49 |
| 146 | 3300009098 | Ga0105245_10032189 | Ga0105245_100321893 | 49 |
| 147 | 3300009098 | Ga0105245_10198636 | Ga0105245_101986362 | 49 |
| 148 | 3300009098 | Ga0105245_12468450 | Ga0105245_124684501 | 49 |
| 149 | 3300009101 | Ga0105247_10006029 | Ga0105247_100060299 | 49 |
| 150 | 3300009148 | Ga0105243_10434238 | Ga0105243_104342383 | 49 |
| 151 | 3300009148 | Ga0105243_10955059 | Ga0105243_109550591 | 49 |
| 152 | 3300009174 | Ga0105241_11341688 | Ga0105241_113416882 | 49 |
| 153 | 3300009176 | Ga0105242_10019833 | Ga0105242_100198332 | 49 |
| 154 | 3300009176 | Ga0105242_10042982 | Ga0105242_100429822 | 49 |
| 155 | 3300009176 | Ga0105242_10641591 | Ga0105242_106415912 | 49 |
| 156 | 3300009176 | Ga0105242_13122072 | Ga0105242_131220722 | 49 |
| 157 | 3300009177 | Ga0105248_10031622 | Ga0105248_100316223 | 49 |
| 158 | 3300009177 | Ga0105248_10758255 | Ga0105248_107582552 | 49 |
| 159 | 3300009545 | Ga0105237_11196352 | Ga0105237_111963522 | 49 |
| 160 | 3300009551 | Ga0105238_10009832 | Ga0105238_100098324 | 49 |
| 161 | 3300009551 | Ga0105238_10272777 | Ga0105238_102727771 | 49 |
| 162 | 3300009551 | Ga0105238_10317410 | Ga0105238_103174103 | 49 |
| 163 | 3300009553 | Ga0105249_10317194 | Ga0105249_103171942 | 49 |
| 164 | 3300009988 | Ga0105035_100653 | Ga0105035_1006533 | 49 |
| 165 | 3300010159 | Ga0099796_10004786 | Ga0099796_100047865 | 49 |
| 166 | 3300010375 | Ga0105239_10021524 | Ga0105239_100215246 | 49 |
| 167 | 3300010375 | Ga0105239_10245376 | Ga0105239_102453764 | 49 |
| 168 | 3300011119 | Ga0105246_10000277 | Ga0105246_100002775 | 49 |
| 169 | 3300011119 | Ga0105246_10007067 | Ga0105246_1000706710 | 49 |
| 170 | 3300013102 | Ga0157371_10805608 | Ga0157371_108056081 | 49 |
| 171 | 3300013102 | Ga0157371_11633628 | Ga0157371_116336282 | 49 |
| 172 | 3300013105 | Ga0157369_10168044 | Ga0157369_101680441 | 49 |
| 173 | 3300013105 | Ga0157369_10455716 | Ga0157369_104557162 | 49 |
| 174 | 3300013296 | Ga0157374_10020454 | Ga0157374_100204543 | 49 |
| 175 | 3300013296 | Ga0157374_11917478 | Ga0157374_119174781 | 49 |
| 176 | 3300013297 | Ga0157378_10626394 | Ga0157378_106263942 | 49 |
| 177 | 3300013297 | Ga0157378_10965388 | Ga0157378_109653882 | 49 |
| 178 | 3300013297 | Ga0157378_11327365 | Ga0157378_113273652 | 49 |
| 179 | 3300013306 | Ga0163162_10011159 | Ga0163162_100111598 | 49 |
| 180 | 3300013306 | Ga0163162_11954690 | Ga0163162_119546902 | 49 |
| 181 | 3300013306 | Ga0163162_12115502 | Ga0163162_121155022 | 49 |
| 182 | 3300013307 | Ga0157372_10418032 | Ga0157372_104180321 | 49 |
| 183 | 3300013308 | Ga0157375_10034433 | Ga0157375_100344333 | 49 |
| 184 | 3300013308 | Ga0157375_10559189 | Ga0157375_105591891 | 49 |
| 185 | 3300013875 | Ga0157515_138793 | Ga0157515_1387932 | 49 |
| 186 | 3300014325 | Ga0163163_10019210 | Ga0163163_100192107 | 49 |
| 187 | 3300014325 | Ga0163163_10436111 | Ga0163163_104361113 | 49 |
| 188 | 3300014325 | Ga0163163_11154742 | Ga0163163_111547422 | 49 |
| 189 | 3300014968 | Ga0157379_10089278 | Ga0157379_100892783 | 49 |
| 190 | 3300014968 | Ga0157379_10104777 | Ga0157379_101047772 | 49 |
| 191 | 3300014968 | Ga0157379_10881527 | Ga0157379_108815271 | 49 |
| 192 | 3300014968 | Ga0157379_11117554 | Ga0157379_111175542 | 49 |
| 193 | 3300014968 | Ga0157379_11195893 | Ga0157379_111958931 | 49 |
| 194 | 3300014969 | Ga0157376_10023467 | Ga0157376_100234672 | 49 |
| 195 | 3300014969 | Ga0157376_10562491 | Ga0157376_105624911 | 49 |
| 196 | 3300014969 | Ga0157376_10644289 | Ga0157376_106442891 | 49 |
| 197 | 3300014969 | Ga0157376_12556270 | Ga0157376_125562701 | 49 |
| 198 | 3300020075 | Ga0206349_1455567 | Ga0206349_14555672 | 49 |
| 199 | 3300020078 | Ga0206352_10955745 | Ga0206352_109557451 | 49 |
| 200 | 3300020080 | Ga0206350_10501895 | Ga0206350_105018952 | 49 |
| 201 | 3300022467 | Ga0224712_10470241 | Ga0224712_104702411 | 49 |
| 202 | 3300022467 | Ga0224712_10517530 | Ga0224712_105175301 | 49 |
| 203 | 3300025226 | Ga0209674_100064 | Ga0209674_10006427 | 49 |
| 204 | 3300025230 | Ga0209563_100099 | Ga0209563_10009927 | 49 |
| 205 | 3300025246 | Ga0209646_1000060 | Ga0209646_1000060218 | 49 |
| 206 | 3300025250 | Ga0209026_1000049 | Ga0209026_1000049216 | 49 |
| 207 | 3300025253 | Ga0209677_100253 | Ga0209677_10025313 | 49 |
| 208 | 3300025253 | Ga0209677_100469 | Ga0209677_10046912 | 49 |
| 209 | 3300025256 | Ga0209759_1000272 | Ga0209759_100027247 | 49 |
| 210 | 3300025256 | Ga0209759_1059340 | Ga0209759_10593401 | 49 |
| 211 | 3300025303 | Ga0209051_1004411 | Ga0209051_10044115 | 49 |
| 212 | 3300025303 | Ga0209051_1006125 | Ga0209051_10061255 | 49 |
| 213 | 3300025321 | Ga0207656_10153551 | Ga0207656_101535512 | 49 |
| 214 | 3300025885 | Ga0207653_10347876 | Ga0207653_103478762 | 49 |
| 215 | 3300025893 | Ga0207682_10439108 | Ga0207682_104391082 | 49 |
| 216 | 3300025898 | Ga0207692_11124656 | Ga0207692_111246561 | 49 |
| 217 | 3300025899 | Ga0207642_10332143 | Ga0207642_103321432 | 49 |
| 218 | 3300025900 | Ga0207710_10013245 | Ga0207710_100132452 | 49 |
| 219 | 3300025903 | Ga0207680_10009688 | Ga0207680_100096881 | 49 |
| 220 | 3300025907 | Ga0207645_10470805 | Ga0207645_104708053 | 49 |
| 221 | 3300025912 | Ga0207707_10314799 | Ga0207707_103147992 | 49 |
| 222 | 3300025913 | Ga0207695_10011114 | Ga0207695_1001111411 | 49 |
| 223 | 3300025913 | Ga0207695_10077046 | Ga0207695_100770463 | 49 |
| 224 | 3300025915 | Ga0207693_10467793 | Ga0207693_104677931 | 49 |
| 225 | 3300025917 | Ga0207660_10972769 | Ga0207660_109727692 | 49 |
| 226 | 3300025918 | Ga0207662_10199449 | Ga0207662_101994493 | 49 |
| 227 | 3300025918 | Ga0207662_10598499 | Ga0207662_105984992 | 49 |
| 228 | 3300025919 | Ga0207657_10339426 | Ga0207657_103394263 | 49 |
| 229 | 3300025921 | Ga0207652_10205627 | Ga0207652_102056274 | 49 |
| 230 | 3300025924 | Ga0207694_10137213 | Ga0207694_101372135 | 49 |
| 231 | 3300025924 | Ga0207694_10898249 | Ga0207694_108982492 | 49 |
| 232 | 3300025925 | Ga0207650_10009243 | Ga0207650_100092432 | 49 |
| 233 | 3300025925 | Ga0207650_10082067 | Ga0207650_100820672 | 49 |
| 234 | 3300025925 | Ga0207650_11076722 | Ga0207650_110767222 | 49 |
| 235 | 3300025926 | Ga0207659_10633490 | Ga0207659_106334902 | 49 |
| 236 | 3300025926 | Ga0207659_10764001 | Ga0207659_107640013 | 49 |
| 237 | 3300025927 | Ga0207687_10017744 | Ga0207687_100177443 | 49 |
| 238 | 3300025927 | Ga0207687_10357875 | Ga0207687_103578753 | 49 |
| 239 | 3300025927 | Ga0207687_11530252 | Ga0207687_115302521 | 49 |
| 240 | 3300025928 | Ga0207700_10775053 | Ga0207700_107750532 | 49 |
| 241 | 3300025928 | Ga0207700_11058742 | Ga0207700_110587422 | 49 |
| 242 | 3300025931 | Ga0207644_10040540 | Ga0207644_100405401 | 49 |
| 243 | 3300025932 | Ga0207690_10579789 | Ga0207690_105797891 | 49 |
| 244 | 3300025933 | Ga0207706_10100596 | Ga0207706_101005964 | 49 |
| 245 | 3300025933 | Ga0207706_10861389 | Ga0207706_108613892 | 49 |
| 246 | 3300025933 | Ga0207706_11654995 | Ga0207706_116549951 | 49 |
| 247 | 3300025934 | Ga0207686_10653580 | Ga0207686_106535802 | 49 |
| 248 | 3300025934 | Ga0207686_10874155 | Ga0207686_108741552 | 49 |
| 249 | 3300025935 | Ga0207709_10057388 | Ga0207709_100573883 | 49 |
| 250 | 3300025935 | Ga0207709_11104617 | Ga0207709_111046172 | 49 |
| 251 | 3300025937 | Ga0207669_10414928 | Ga0207669_104149282 | 49 |
| 252 | 3300025937 | Ga0207669_10439651 | Ga0207669_104396513 | 49 |
| 253 | 3300025939 | Ga0207665_11165065 | Ga0207665_111650651 | 49 |
| 254 | 3300025940 | Ga0207691_10223480 | Ga0207691_102234803 | 49 |
| 255 | 3300025940 | Ga0207691_10756065 | Ga0207691_107560651 | 49 |
| 256 | 3300025940 | Ga0207691_10980261 | Ga0207691_109802612 | 49 |
| 257 | 3300025941 | Ga0207711_10016454 | Ga0207711_100164544 | 49 |
| 258 | 3300025942 | Ga0207689_10339469 | Ga0207689_103394692 | 49 |
| 259 | 3300025942 | Ga0207689_11265761 | Ga0207689_112657612 | 49 |
| 260 | 3300025942 | Ga0207689_11367469 | Ga0207689_113674692 | 49 |
| 261 | 3300025944 | Ga0207661_10118183 | Ga0207661_101181833 | 49 |
| 262 | 3300025944 | Ga0207661_10264495 | Ga0207661_102644951 | 49 |
| 263 | 3300025945 | Ga0207679_10082442 | Ga0207679_100824424 | 49 |
| 264 | 3300025945 | Ga0207679_10807423 | Ga0207679_108074232 | 49 |
| 265 | 3300025949 | Ga0207667_10060280 | Ga0207667_100602803 | 49 |
| 266 | 3300025949 | Ga0207667_10823972 | Ga0207667_108239722 | 49 |
| 267 | 3300025960 | Ga0207651_10173306 | Ga0207651_101733062 | 49 |
| 268 | 3300025960 | Ga0207651_10414800 | Ga0207651_104148001 | 49 |
| 269 | 3300025960 | Ga0207651_10674205 | Ga0207651_106742052 | 49 |
| 270 | 3300025961 | Ga0207712_10233697 | Ga0207712_102336972 | 49 |
| 271 | 3300025961 | Ga0207712_11657557 | Ga0207712_116575572 | 49 |
| 272 | 3300025981 | Ga0207640_10016053 | Ga0207640_100160533 | 49 |
| 273 | 3300025981 | Ga0207640_10982809 | Ga0207640_109828091 | 49 |
| 274 | 3300025986 | Ga0207658_10157931 | Ga0207658_101579312 | 49 |
| 275 | 3300026023 | Ga0207677_10027567 | Ga0207677_100275674 | 49 |
| 276 | 3300026023 | Ga0207677_10646874 | Ga0207677_106468742 | 49 |
| 277 | 3300026035 | Ga0207703_10097679 | Ga0207703_100976792 | 49 |
| 278 | 3300026067 | Ga0207678_10301870 | Ga0207678_103018702 | 49 |
| 279 | 3300026067 | Ga0207678_10432906 | Ga0207678_104329062 | 49 |
| 280 | 3300026078 | Ga0207702_10000395 | Ga0207702_1000039513 | 49 |
| 281 | 3300026078 | Ga0207702_10503337 | Ga0207702_105033371 | 49 |
| 282 | 3300026078 | Ga0207702_10770601 | Ga0207702_107706012 | 49 |
| 283 | 3300026088 | Ga0207641_10015662 | Ga0207641_100156622 | 49 |
| 284 | 3300026088 | Ga0207641_10257838 | Ga0207641_102578382 | 49 |
| 285 | 3300026088 | Ga0207641_12560300 | Ga0207641_125603001 | 49 |
| 286 | 3300026095 | Ga0207676_10007204 | Ga0207676_100072043 | 49 |
| 287 | 3300026095 | Ga0207676_12015997 | Ga0207676_120159971 | 49 |
| 288 | 3300026095 | Ga0207676_12193768 | Ga0207676_121937682 | 49 |
| 289 | 3300026116 | Ga0207674_10011974 | Ga0207674_100119741 | 49 |
| 290 | 3300026116 | Ga0207674_10169401 | Ga0207674_101694011 | 49 |
| 291 | 3300026118 | Ga0207675_100009738 | Ga0207675_1000097383 | 49 |
| 292 | 3300026118 | Ga0207675_100032021 | Ga0207675_1000320215 | 49 |
| 293 | 3300026118 | Ga0207675_100612113 | Ga0207675_1006121132 | 49 |
| 294 | 3300026118 | Ga0207675_102106483 | Ga0207675_1021064832 | 49 |
| 295 | 3300026118 | Ga0207675_102393153 | Ga0207675_1023931531 | 49 |
| 296 | 3300026121 | Ga0207683_10750847 | Ga0207683_107508473 | 49 |
| 297 | 3300026142 | Ga0207698_10311825 | Ga0207698_103118252 | 49 |
| 298 | 3300027512 | Ga0209179_1001504 | Ga0209179_10015044 | 49 |
| 299 | 3300027907 | Ga0207428_10531619 | Ga0207428_105316191 | 49 |
| 300 | 3300028379 | Ga0268266_10000808 | Ga0268266_1000080820 | 49 |
| 301 | 3300028379 | Ga0268266_10169068 | Ga0268266_101690682 | 49 |
| 302 | 3300028379 | Ga0268266_10436893 | Ga0268266_104368931 | 49 |
| 303 | 3300028381 | Ga0268264_10237783 | Ga0268264_102377834 | 49 |
| 304 | 3300028381 | Ga0268264_10488912 | Ga0268264_104889121 | 49 |
| 305 | 3300028666 | Ga0265336_10002580 | Ga0265336_100025806 | 49 |
| 306 | 3300028800 | Ga0265338_10023488 | Ga0265338_100234883 | 49 |
| 307 | 3300030522 | Ga0307512_10464740 | Ga0307512_104647402 | 49 |
| 308 | 3300031238 | Ga0265332_10077008 | Ga0265332_100770083 | 49 |
| 309 | 3300031238 | Ga0265332_10254171 | Ga0265332_102541711 | 49 |
| 310 | 3300031239 | Ga0265328_10000640 | Ga0265328_100006408 | 49 |
| 311 | 3300031240 | Ga0265320_10001511 | Ga0265320_100015117 | 49 |
| 312 | 3300031240 | Ga0265320_10026887 | Ga0265320_100268873 | 49 |
| 313 | 3300031241 | Ga0265325_10083101 | Ga0265325_100831012 | 49 |
| 314 | 3300031242 | Ga0265329_10055164 | Ga0265329_100551642 | 49 |
| 315 | 3300031249 | Ga0265339_10028033 | Ga0265339_100280332 | 49 |
| 316 | 3300031249 | Ga0265339_10148516 | Ga0265339_101485163 | 49 |
| 317 | 3300031249 | Ga0265339_10409900 | Ga0265339_104099002 | 49 |
| 318 | 3300031250 | Ga0265331_10077555 | Ga0265331_100775552 | 49 |
| 319 | 3300031250 | Ga0265331_10532620 | Ga0265331_105326202 | 49 |
| 320 | 3300031507 | Ga0307509_10209315 | Ga0307509_102093152 | 49 |
| 321 | 3300031711 | Ga0265314_10004255 | Ga0265314_100042552 | 49 |
| 322 | 3300031711 | Ga0265314_10041451 | Ga0265314_100414512 | 49 |
| 323 | 3300031712 | Ga0265342_10000136 | Ga0265342_1000013664 | 49 |
| 324 | 3300031712 | Ga0265342_10028108 | Ga0265342_100281084 | 49 |
| 325 | 3300033180 | Ga0307510_10077392 | Ga0307510_100773924 | 49 |
| 326 | 3300033180 | Ga0307510_10205875 | Ga0307510_102058752 | 49 |
| 327 | 3300035084 | Ga0373928_0074017 | Ga0373928_0074017_391_540 | 49 |
| 328 | 3300035086 | Ga0373934_0207549 | Ga0373934_0207549_159_308 | 49 |
| 329 | 3300035088 | Ga0373940_0283094 | Ga0373940_0283094_242_400 | 49 |
| 330 | 3300035089 | Ga0373944_0164194 | Ga0373944_0164194_135_284 | 49 |
| 331 | 3300035090 | Ga0373949_0091353 | Ga0373949_0091353_484_633 | 49 |
| 332 | 3300035092 | Ga0373952_0157757 | Ga0373952_0157757_259_408 | 49 |
| 333 | 3300035111 | Ga0373923_0616945 | Ga0373923_0616945_305_454 | 49 |
| 334 | 3300035113 | Ga0373936_0226308 | Ga0373936_0226308_217_366 | 49 |
| 335 | 3300035114 | Ga0373939_0210011 | Ga0373939_0210011_176_334 | 49 |
| 336 | 3300035120 | Ga0373957_0356394 | Ga0373957_0356394_297_446 | 49 |
| 337 | 3300035170 | Ga0373943_0460567 | Ga0373943_0460567_491_640 | 49 |
| 338 | 3300035172 | Ga0373955_0604163 | Ga0373955_0604163_423_572 | 49 |
| 339 | 3300035691 | Ga0373931_0075361 | Ga0373931_0075361_206_355 | 49 |
| 340 | 3300035691 | Ga0373931_0464982 | Ga0373931_0464982_186_344 | 49 |
| 341 | 3300035692 | Ga0373935_0574461 | Ga0373935_0574461_158_307 | 49 |
| 342 | 3300035695 | Ga0373927_0436447 | Ga0373927_0436447_654_803 | 49 |
| 343 | 3300035695 | Ga0373927_0646816 | Ga0373927_0646816_51_200 | 49 |
| 344 | 3300035695 | Ga0373927_0906721 | Ga0373927_0906721_103_252 | 49 |
| 345 | 3300036401 | Ga0373937_0412469 | Ga0373937_0412469_350_499 | 49 |
| 346 | 3300036534 | Ga0310109_048745 | Ga0310109_048745_93_242 | 49 |
| 347 | 3300037068 | Ga0373925_0229906 | Ga0373925_0229906_160_309 | 49 |
| 348 | 3300037312 | Ga0395899_0092302 | Ga0395899_0092302_1570_1719 | 49 |
| 349 | 3300037418 | Ga0395900_0412387 | Ga0395900_0412387_777_926 | 49 |
| 350 | 3300037471 | Ga0395905_1286755 | Ga0395905_1286755_472_621 | 49 |
| 351 | 3300038443 | Ga0395901_0002178 | Ga0395901_0002178_683_832 | 49 |
| 352 | 3300044694 | Ga0466963_0705477 | Ga0466963_0705477_188_337 | 49 |
| 353 | 3300044842 | Ga0466957_0026643 | Ga0466957_0026643_900_1049 | 49 |
| 354 | 3300045051 | Ga0451576_0287673 | Ga0451576_0287673_1159_1317 | 49 |
| 355 | 3300045051 | Ga0451576_0492236 | Ga0451576_0492236_485_634 | 49 |
| 356 | 3300045976 | Ga0466967_2595679 | Ga0466967_2595679_193_342 | 49 |
| 357 | 3300046455 | Ga0495603_0063676 | Ga0495603_0063676_616_765 | 49 |
| 358 | 3300046455 | Ga0495603_0764523 | Ga0495603_0764523_132_281 | 49 |
| 359 | 3300046457 | Ga0495590_0152714 | Ga0495590_0152714_549_698 | 49 |
| 360 | 3300046459 | Ga0495629_0479333 | Ga0495629_0479333_231_380 | 49 |
| 361 | 3300046459 | Ga0495629_0597844 | Ga0495629_0597844_119_268 | 49 |
| 362 | 3300046459 | Ga0495629_0610729 | Ga0495629_0610729_431_580 | 49 |
| 363 | 3300046463 | Ga0495653_0629689 | Ga0495653_0629689_496_645 | 49 |
| 364 | 3300046472 | Ga0495580_0124396 | Ga0495580_0124396_1365_1514 | 49 |
| 365 | 3300046472 | Ga0495580_1052106 | Ga0495580_1052106_104_253 | 49 |
| 366 | 3300046473 | Ga0495582_0225425 | Ga0495582_0225425_642_791 | 49 |
| 367 | 3300046475 | Ga0495639_0210291 | Ga0495639_0210291_568_717 | 49 |
| 368 | 3300046475 | Ga0495639_0368947 | Ga0495639_0368947_376_525 | 49 |
| 369 | 3300046499 | Ga0495594_0531963 | Ga0495594_0531963_313_462 | 49 |
| 370 | 3300046512 | Ga0495610_0207833 | Ga0495610_0207833_323_472 | 49 |
| 371 | 3300046514 | Ga0495618_0392284 | Ga0495618_0392284_102_251 | 49 |
| 372 | 3300046515 | Ga0495620_0212425 | Ga0495620_0212425_530_679 | 49 |
| 373 | 3300046519 | Ga0495632_0010119 | Ga0495632_0010119_2907_3056 | 49 |
| 374 | 3300046535 | Ga0495586_0221304 | Ga0495586_0221304_578_727 | 49 |
| 375 | 3300046542 | Ga0495597_0178152 | Ga0495597_0178152_179_328 | 49 |
| 376 | 3300046543 | Ga0495645_0410919 | Ga0495645_0410919_223_372 | 49 |
| 377 | 3300046642 | Ga0495634_0035998 | Ga0495634_0035998_2328_2477 | 49 |
| 378 | 3300046648 | Ga0495611_0350817 | Ga0495611_0350817_38_187 | 49 |
| 379 | 3300046663 | Ga0495635_0308925 | Ga0495635_0308925_99_248 | 49 |
| 380 | 3300046681 | Ga0495647_0033520 | Ga0495647_0033520_58_207 | 49 |
| 381 | 3300046683 | Ga0495658_0069779 | Ga0495658_0069779_1168_1317 | 49 |
| 382 | 3300046683 | Ga0495658_0547064 | Ga0495658_0547064_549_698 | 49 |
| 383 | 3300046689 | Ga0495613_0119076 | Ga0495613_0119076_1631_1780 | 49 |
| 384 | 3300046690 | Ga0495624_0420262 | Ga0495624_0420262_241_390 | 49 |
| 385 | 3300046692 | Ga0495671_0475191 | Ga0495671_0475191_422_571 | 49 |
| 386 | 3300046694 | Ga0495649_0000767 | Ga0495649_0000767_1673_1822 | 49 |
| 387 | 3300046810 | Ga0495660_0069900 | Ga0495660_0069900_1531_1680 | 49 |
| 388 | 3300047319 | Ga0495674_0360140 | Ga0495674_0360140_10_159 | 49 |
| 389 | 3300047319 | Ga0495674_1076683 | Ga0495674_1076683_431_580 | 49 |
| 390 | 3300047443 | Ga0495687_014089 | Ga0495687_014089_1279_1428 | 49 |
| 391 | 3300048091 | Ga0495626_0050285 | Ga0495626_0050285_1641_1790 | 49 |
| 392 | 3300048903 | Ga0496100_1417500 | Ga0496100_1417500_357_506 | 49 |
| 393 | 3300048904 | Ga0496101_0370511 | Ga0496101_0370511_497_646 | 49 |
| 394 | 3300048905 | Ga0496102_0555631 | Ga0496102_0555631_670_819 | 49 |
| 395 | 3300048907 | Ga0496104_0095935 | Ga0496104_0095935_1233_1382 | 49 |
| 396 | 3300048909 | Ga0496106_0222897 | Ga0496106_0222897_230_379 | 49 |
| 397 | 3300048909 | Ga0496106_0245626 | Ga0496106_0245626_1221_1370 | 49 |
| 398 | 3300048910 | Ga0496107_0773014 | Ga0496107_0773014_516_665 | 49 |
| 399 | 3300048910 | Ga0496107_1109222 | Ga0496107_1109222_31_180 | 49 |
| 400 | 3300048911 | Ga0496108_0324828 | Ga0496108_0324828_730_879 | 49 |
| 401 | 3300048912 | Ga0496109_0163088 | Ga0496109_0163088_870_1019 | 49 |
| 402 | 3300048912 | Ga0496109_1840550 | Ga0496109_1840550_69_218 | 49 |
| 403 | 3300048913 | Ga0496110_0466209 | Ga0496110_0466209_626_775 | 49 |
| 404 | 3300048915 | Ga0496112_0116953 | Ga0496112_0116953_2294_2443 | 49 |
| 405 | 3300048916 | Ga0496113_0098483 | Ga0496113_0098483_88_237 | 49 |
| 406 | 3300048917 | Ga0496114_0064970 | Ga0496114_0064970_254_403 | 49 |
| 407 | 3300048917 | Ga0496114_1263445 | Ga0496114_1263445_419_568 | 49 |
| 408 | 3300048918 | Ga0496115_0056052 | Ga0496115_0056052_1027_1176 | 49 |
| 409 | 3300048918 | Ga0496115_0081226 | Ga0496115_0081226_207_356 | 49 |
| 410 | 3300048918 | Ga0496115_0246041 | Ga0496115_0246041_590_739 | 49 |
| 411 | 3300048922 | Ga0496119_0284154 | Ga0496119_0284154_457_606 | 49 |
| 412 | 3300048925 | Ga0496122_0148921 | Ga0496122_0148921_639_788 | 49 |
| 413 | 3300048926 | Ga0496123_0121635 | Ga0496123_0121635_320_469 | 49 |
| 414 | 3300049459 | Ga0495678_126007 | Ga0495678_126007_274_423 | 49 |
| 415 | 3300049588 | Ga0501072_1263295 | Ga0501072_1263295_191_340 | 49 |
| 416 | 3300049823 | Ga0501044_1120184 | Ga0501044_1120184_279_428 | 49 |
| 417 | 3300050489 | nmdc:mga03683_84444_c1 | nmdc:mga03683_84444_c1_688_837 | 49 |
| 418 | 3300050490 | nmdc:mga03n38_716471_c1 | nmdc:mga03n38_716471_c1_74_223 | 49 |
| 419 | 3300050490 | nmdc:mga03n38_878602_c1 | nmdc:mga03n38_878602_c1_278_451 | 49 |
| 420 | 3300050491 | nmdc:mga00v17_150773_c1 | nmdc:mga00v17_150773_c1_297_446 | 49 |
| 421 | 3300050509 | nmdc:mga0qj67_234818_c1 | nmdc:mga0qj67_234818_c1_579_728 | 49 |
| 422 | 3300050510 | nmdc:mga06r32_1287897_c1 | nmdc:mga06r32_1287897_c1_461_610 | 49 |
| 423 | 3300050511 | nmdc:mga08y16_465879_c1 | nmdc:mga08y16_465879_c1_493_642 | 49 |
| 424 | 3300050512 | nmdc:mga0n895_105890_c1 | nmdc:mga0n895_105890_c1_142_291 | 49 |
| 425 | 3300053077 | Ga0495601_0188492 | Ga0495601_0188492_31_180 | 49 |
| 426 | 3300053086 | Ga0500578_0081618 | Ga0500578_0081618_253_402 | 49 |
| 427 | 3300053090 | Ga0500646_0097200 | Ga0500646_0097200_561_710 | 49 |
| 428 | 3300053093 | Ga0500651_0465321 | Ga0500651_0465321_354_503 | 49 |
| 429 | 3300053098 | Ga0500650_0155682 | Ga0500650_0155682_232_381 | 49 |
| 430 | 3300053098 | Ga0500650_0461993 | Ga0500650_0461993_169_318 | 49 |
| 431 | 3300053123 | Ga0500614_059055 | Ga0500614_059055_606_755 | 49 |
| 432 | 3300053126 | Ga0500621_290116 | Ga0500621_290116_265_414 | 49 |
| 433 | 3300053130 | Ga0500642_0359989 | Ga0500642_0359989_217_366 | 49 |
| 434 | 3300053150 | Ga0500603_003095 | Ga0500603_003095_2639_2788 | 49 |
| 435 | 3300053162 | Ga0500638_165053 | Ga0500638_165053_42_191 | 49 |
| 436 | 3300053178 | Ga0500637_0068936 | Ga0500637_0068936_1250_1399 | 49 |
| 437 | 3300060353 | Ga0501082_0461270 | Ga0501082_0461270_813_962 | 49 |
| 438 | 2162886006 | SwRhRL3b_contig_1291068 | SwRhRL3b_0647.00001160 | 50 |
| 439 | 3300000531 | CNBas_1000908 | CNBas_10009081 | 50 |
| 440 | 3300005330 | Ga0070690_100016783 | Ga0070690_1000167836 | 50 |
| 441 | 3300005330 | Ga0070690_100758269 | Ga0070690_1007582693 | 50 |
| 442 | 3300005331 | Ga0070670_100115598 | Ga0070670_1001155983 | 50 |
| 443 | 3300005331 | Ga0070670_100308670 | Ga0070670_1003086702 | 50 |
| 444 | 3300005334 | Ga0068869_100643224 | Ga0068869_1006432242 | 50 |
| 445 | 3300005334 | Ga0068869_100788966 | Ga0068869_1007889662 | 50 |
| 446 | 3300005335 | Ga0070666_10156316 | Ga0070666_101563162 | 50 |
| 447 | 3300005338 | Ga0068868_101014780 | Ga0068868_1010147801 | 50 |
| 448 | 3300005340 | Ga0070689_100052468 | Ga0070689_1000524681 | 50 |
| 449 | 3300005340 | Ga0070689_100617293 | Ga0070689_1006172932 | 50 |
| 450 | 3300005341 | Ga0070691_10070822 | Ga0070691_100708222 | 50 |
| 451 | 3300005343 | Ga0070687_100235321 | Ga0070687_1002353213 | 50 |
| 452 | 3300005344 | Ga0070661_100487964 | Ga0070661_1004879642 | 50 |
| 453 | 3300005353 | Ga0070669_100255557 | Ga0070669_1002555572 | 50 |
| 454 | 3300005353 | Ga0070669_100533868 | Ga0070669_1005338682 | 50 |
| 455 | 3300005354 | Ga0070675_100181617 | Ga0070675_1001816173 | 50 |
| 456 | 3300005354 | Ga0070675_100317263 | Ga0070675_1003172632 | 50 |
| 457 | 3300005356 | Ga0070674_100303386 | Ga0070674_1003033863 | 50 |
| 458 | 3300005365 | Ga0070688_100084307 | Ga0070688_1000843073 | 50 |
| 459 | 3300005367 | Ga0070667_100076221 | Ga0070667_1000762213 | 50 |
| 460 | 3300005367 | Ga0070667_101720809 | Ga0070667_1017208091 | 50 |
| 461 | 3300005406 | Ga0070703_10423898 | Ga0070703_104238982 | 50 |
| 462 | 3300005434 | Ga0070709_10254684 | Ga0070709_102546842 | 50 |
| 463 | 3300005434 | Ga0070709_11458253 | Ga0070709_114582532 | 50 |
| 464 | 3300005438 | Ga0070701_10000224 | Ga0070701_1000022419 | 50 |
| 465 | 3300005438 | Ga0070701_10070516 | Ga0070701_100705163 | 50 |
| 466 | 3300005438 | Ga0070701_10432605 | Ga0070701_104326052 | 50 |
| 467 | 3300005439 | Ga0070711_100886887 | Ga0070711_1008868872 | 50 |
| 468 | 3300005440 | Ga0070705_100971525 | Ga0070705_1009715251 | 50 |
| 469 | 3300005441 | Ga0070700_100013454 | Ga0070700_1000134542 | 50 |
| 470 | 3300005456 | Ga0070678_100069355 | Ga0070678_1000693553 | 50 |
| 471 | 3300005456 | Ga0070678_100402741 | Ga0070678_1004027411 | 50 |
| 472 | 3300005456 | Ga0070678_100594055 | Ga0070678_1005940552 | 50 |
| 473 | 3300005457 | Ga0070662_101048876 | Ga0070662_1010488762 | 50 |
| 474 | 3300005459 | Ga0068867_100176559 | Ga0068867_1001765593 | 50 |
| 475 | 3300005459 | Ga0068867_100511371 | Ga0068867_1005113712 | 50 |
| 476 | 3300005466 | Ga0070685_10667764 | Ga0070685_106677642 | 50 |
| 477 | 3300005467 | Ga0070706_100546096 | Ga0070706_1005460961 | 50 |
| 478 | 3300005530 | Ga0070679_101437343 | Ga0070679_1014373432 | 50 |
| 479 | 3300005536 | Ga0070697_100500657 | Ga0070697_1005006573 | 50 |
| 480 | 3300005543 | Ga0070672_100103961 | Ga0070672_1001039615 | 50 |
| 481 | 3300005543 | Ga0070672_100209171 | Ga0070672_1002091713 | 50 |
| 482 | 3300005543 | Ga0070672_100426687 | Ga0070672_1004266872 | 50 |
| 483 | 3300005545 | Ga0070695_100000207 | Ga0070695_10000020712 | 50 |
| 484 | 3300005545 | Ga0070695_100227998 | Ga0070695_1002279982 | 50 |
| 485 | 3300005546 | Ga0070696_100000958 | Ga0070696_1000009582 | 50 |
| 486 | 3300005548 | Ga0070665_101630736 | Ga0070665_1016307362 | 50 |
| 487 | 3300005563 | Ga0068855_100724255 | Ga0068855_1007242552 | 50 |
| 488 | 3300005564 | Ga0070664_100527352 | Ga0070664_1005273522 | 50 |
| 489 | 3300005615 | Ga0070702_100287372 | Ga0070702_1002873722 | 50 |
| 490 | 3300005615 | Ga0070702_100587302 | Ga0070702_1005873022 | 50 |
| 491 | 3300005616 | Ga0068852_101272840 | Ga0068852_1012728402 | 50 |
| 492 | 3300005617 | Ga0068859_100042745 | Ga0068859_1000427457 | 50 |
| 493 | 3300005617 | Ga0068859_100793842 | Ga0068859_1007938423 | 50 |
| 494 | 3300005618 | Ga0068864_100054444 | Ga0068864_1000544445 | 50 |
| 495 | 3300005618 | Ga0068864_100076085 | Ga0068864_1000760852 | 50 |
| 496 | 3300005618 | Ga0068864_100337885 | Ga0068864_1003378852 | 50 |
| 497 | 3300005718 | Ga0068866_10000950 | Ga0068866_1000095013 | 50 |
| 498 | 3300005718 | Ga0068866_10040043 | Ga0068866_100400432 | 50 |
| 499 | 3300005719 | Ga0068861_100171921 | Ga0068861_1001719213 | 50 |
| 500 | 3300005840 | Ga0068870_10549094 | Ga0068870_105490942 | 50 |
| 501 | 3300005841 | Ga0068863_100026788 | Ga0068863_1000267885 | 50 |
| 502 | 3300005841 | Ga0068863_100297975 | Ga0068863_1002979752 | 50 |
| 503 | 3300005841 | Ga0068863_100445754 | Ga0068863_1004457541 | 50 |
| 504 | 3300005842 | Ga0068858_100045414 | Ga0068858_1000454145 | 50 |
| 505 | 3300005843 | Ga0068860_100106666 | Ga0068860_1001066662 | 50 |
| 506 | 3300005843 | Ga0068860_100573807 | Ga0068860_1005738073 | 50 |
| 507 | 3300005844 | Ga0068862_100014905 | Ga0068862_1000149057 | 50 |
| 508 | 3300006028 | Ga0070717_11631897 | Ga0070717_116318972 | 50 |
| 509 | 3300006237 | Ga0097621_100198062 | Ga0097621_1001980623 | 50 |
| 510 | 3300006237 | Ga0097621_102373466 | Ga0097621_1023734661 | 50 |
| 511 | 3300006358 | Ga0068871_100039244 | Ga0068871_1000392444 | 50 |
| 512 | 3300006358 | Ga0068871_102147308 | Ga0068871_1021473082 | 50 |
| 513 | 3300006844 | Ga0075428_100005195 | Ga0075428_1000051954 | 50 |
| 514 | 3300006844 | Ga0075428_100325599 | Ga0075428_1003255992 | 50 |
| 515 | 3300006846 | Ga0075430_101368850 | Ga0075430_1013688502 | 50 |
| 516 | 3300006847 | Ga0075431_102036922 | Ga0075431_1020369222 | 50 |
| 517 | 3300006852 | Ga0075433_10248315 | Ga0075433_102483152 | 50 |
| 518 | 3300006852 | Ga0075433_10667477 | Ga0075433_106674772 | 50 |
| 519 | 3300006871 | Ga0075434_100261417 | Ga0075434_1002614174 | 50 |
| 520 | 3300006871 | Ga0075434_102050655 | Ga0075434_1020506551 | 50 |
| 521 | 3300006880 | Ga0075429_100000103 | Ga0075429_10000010329 | 50 |
| 522 | 3300006880 | Ga0075429_101336131 | Ga0075429_1013361312 | 50 |
| 523 | 3300006881 | Ga0068865_100000447 | Ga0068865_10000044715 | 50 |
| 524 | 3300006881 | Ga0068865_100034173 | Ga0068865_1000341731 | 50 |
| 525 | 3300006881 | Ga0068865_102160080 | Ga0068865_1021600802 | 50 |
| 526 | 3300006931 | Ga0097620_100042744 | Ga0097620_1000427442 | 50 |
| 527 | 3300006931 | Ga0097620_100793875 | Ga0097620_1007938753 | 50 |
| 528 | 3300007076 | Ga0075435_100159920 | Ga0075435_1001599204 | 50 |
| 529 | 3300007076 | Ga0075435_101378832 | Ga0075435_1013788322 | 50 |
| 530 | 3300009011 | Ga0105251_10445248 | Ga0105251_104452481 | 50 |
| 531 | 3300009093 | Ga0105240_10267903 | Ga0105240_102679033 | 50 |
| 532 | 3300009093 | Ga0105240_11354289 | Ga0105240_113542892 | 50 |
| 533 | 3300009094 | Ga0111539_10049570 | Ga0111539_100495704 | 50 |
| 534 | 3300009094 | Ga0111539_11805659 | Ga0111539_118056592 | 50 |
| 535 | 3300009098 | Ga0105245_10004425 | Ga0105245_100044255 | 50 |
| 536 | 3300009098 | Ga0105245_10025899 | Ga0105245_100258992 | 50 |
| 537 | 3300009098 | Ga0105245_10651099 | Ga0105245_106510992 | 50 |
| 538 | 3300009147 | Ga0114129_10001184 | Ga0114129_1000118417 | 50 |
| 539 | 3300009147 | Ga0114129_10082380 | Ga0114129_100823802 | 50 |
| 540 | 3300009148 | Ga0105243_10003720 | Ga0105243_1000372012 | 50 |
| 541 | 3300009148 | Ga0105243_10369812 | Ga0105243_103698122 | 50 |
| 542 | 3300009174 | Ga0105241_10013741 | Ga0105241_100137417 | 50 |
| 543 | 3300009174 | Ga0105241_10672307 | Ga0105241_106723073 | 50 |
| 544 | 3300009176 | Ga0105242_10003302 | Ga0105242_1000330212 | 50 |
| 545 | 3300009176 | Ga0105242_10042075 | Ga0105242_100420753 | 50 |
| 546 | 3300009176 | Ga0105242_10169989 | Ga0105242_101699892 | 50 |
| 547 | 3300009177 | Ga0105248_10001702 | Ga0105248_1000170223 | 50 |
| 548 | 3300009177 | Ga0105248_10270660 | Ga0105248_102706602 | 50 |
| 549 | 3300009177 | Ga0105248_11038997 | Ga0105248_110389972 | 50 |
| 550 | 3300009177 | Ga0105248_11199894 | Ga0105248_111998942 | 50 |
| 551 | 3300009553 | Ga0105249_10000917 | Ga0105249_1000091731 | 50 |
| 552 | 3300009553 | Ga0105249_10087083 | Ga0105249_100870832 | 50 |
| 553 | 3300009553 | Ga0105249_10636704 | Ga0105249_106367042 | 50 |
| 554 | 3300009553 | Ga0105249_11455869 | Ga0105249_114558693 | 50 |
| 555 | 3300010375 | Ga0105239_10008582 | Ga0105239_1000858212 | 50 |
| 556 | 3300010375 | Ga0105239_12476551 | Ga0105239_124765512 | 50 |
| 557 | 3300011119 | Ga0105246_10576291 | Ga0105246_105762911 | 50 |
| 558 | 3300011119 | Ga0105246_11758534 | Ga0105246_117585342 | 50 |
| 559 | 3300013296 | Ga0157374_10242013 | Ga0157374_102420133 | 50 |
| 560 | 3300013297 | Ga0157378_10004581 | Ga0157378_1000458112 | 50 |
| 561 | 3300013297 | Ga0157378_10037143 | Ga0157378_100371432 | 50 |
| 562 | 3300013297 | Ga0157378_12033908 | Ga0157378_120339081 | 50 |
| 563 | 3300013306 | Ga0163162_10207068 | Ga0163162_102070683 | 50 |
| 564 | 3300013306 | Ga0163162_10280467 | Ga0163162_102804673 | 50 |
| 565 | 3300013306 | Ga0163162_10302154 | Ga0163162_103021542 | 50 |
| 566 | 3300013306 | Ga0163162_10869008 | Ga0163162_108690082 | 50 |
| 567 | 3300013307 | Ga0157372_11160790 | Ga0157372_111607902 | 50 |
| 568 | 3300013308 | Ga0157375_10397427 | Ga0157375_103974272 | 50 |
| 569 | 3300013308 | Ga0157375_10678674 | Ga0157375_106786743 | 50 |
| 570 | 3300013308 | Ga0157375_11455364 | Ga0157375_114553642 | 50 |
| 571 | 3300014325 | Ga0163163_10097357 | Ga0163163_100973572 | 50 |
| 572 | 3300014325 | Ga0163163_12352574 | Ga0163163_123525741 | 50 |
| 573 | 3300014326 | Ga0157380_10017894 | Ga0157380_100178943 | 50 |
| 574 | 3300014326 | Ga0157380_10138310 | Ga0157380_101383103 | 50 |
| 575 | 3300014326 | Ga0157380_10898826 | Ga0157380_108988262 | 50 |
| 576 | 3300014745 | Ga0157377_10673086 | Ga0157377_106730862 | 50 |
| 577 | 3300014968 | Ga0157379_10126181 | Ga0157379_101261811 | 50 |
| 578 | 3300014968 | Ga0157379_10162033 | Ga0157379_101620332 | 50 |
| 579 | 3300014968 | Ga0157379_10436452 | Ga0157379_104364522 | 50 |
| 580 | 3300014969 | Ga0157376_10004392 | Ga0157376_1000439212 | 50 |
| 581 | 3300014969 | Ga0157376_10012986 | Ga0157376_100129861 | 50 |
| 582 | 3300017792 | Ga0163161_10127479 | Ga0163161_101274791 | 50 |
| 583 | 3300025271 | Ga0207666_1054748 | Ga0207666_10547481 | 50 |
| 584 | 3300025315 | Ga0207697_10006511 | Ga0207697_100065116 | 50 |
| 585 | 3300025885 | Ga0207653_10004063 | Ga0207653_100040636 | 50 |
| 586 | 3300025899 | Ga0207642_10001134 | Ga0207642_100011348 | 50 |
| 587 | 3300025901 | Ga0207688_10090865 | Ga0207688_100908652 | 50 |
| 588 | 3300025901 | Ga0207688_10442548 | Ga0207688_104425481 | 50 |
| 589 | 3300025903 | Ga0207680_10030488 | Ga0207680_100304884 | 50 |
| 590 | 3300025903 | Ga0207680_10190943 | Ga0207680_101909432 | 50 |
| 591 | 3300025903 | Ga0207680_10643521 | Ga0207680_106435213 | 50 |
| 592 | 3300025906 | Ga0207699_10467179 | Ga0207699_104671791 | 50 |
| 593 | 3300025906 | Ga0207699_11442702 | Ga0207699_114427022 | 50 |
| 594 | 3300025907 | Ga0207645_10027314 | Ga0207645_100273145 | 50 |
| 595 | 3300025908 | Ga0207643_10034561 | Ga0207643_100345614 | 50 |
| 596 | 3300025908 | Ga0207643_10108138 | Ga0207643_101081382 | 50 |
| 597 | 3300025911 | Ga0207654_10013963 | Ga0207654_100139632 | 50 |
| 598 | 3300025913 | Ga0207695_10311931 | Ga0207695_103119312 | 50 |
| 599 | 3300025917 | Ga0207660_10008341 | Ga0207660_100083412 | 50 |
| 600 | 3300025918 | Ga0207662_10000215 | Ga0207662_1000021518 | 50 |
| 601 | 3300025918 | Ga0207662_10015862 | Ga0207662_100158621 | 50 |
| 602 | 3300025920 | Ga0207649_10933594 | Ga0207649_109335941 | 50 |
| 603 | 3300025921 | Ga0207652_10058107 | Ga0207652_100581071 | 50 |
| 604 | 3300025923 | Ga0207681_10413495 | Ga0207681_104134952 | 50 |
| 605 | 3300025923 | Ga0207681_11166189 | Ga0207681_111661892 | 50 |
| 606 | 3300025925 | Ga0207650_10009343 | Ga0207650_100093435 | 50 |
| 607 | 3300025926 | Ga0207659_10305219 | Ga0207659_103052192 | 50 |
| 608 | 3300025926 | Ga0207659_11648940 | Ga0207659_116489402 | 50 |
| 609 | 3300025927 | Ga0207687_10001049 | Ga0207687_1000104918 | 50 |
| 610 | 3300025927 | Ga0207687_10039884 | Ga0207687_100398842 | 50 |
| 611 | 3300025931 | Ga0207644_10044810 | Ga0207644_100448103 | 50 |
| 612 | 3300025931 | Ga0207644_10047149 | Ga0207644_100471493 | 50 |
| 613 | 3300025931 | Ga0207644_10425140 | Ga0207644_104251402 | 50 |
| 614 | 3300025933 | Ga0207706_10052009 | Ga0207706_100520092 | 50 |
| 615 | 3300025934 | Ga0207686_10002720 | Ga0207686_100027208 | 50 |
| 616 | 3300025934 | Ga0207686_10030105 | Ga0207686_100301052 | 50 |
| 617 | 3300025935 | Ga0207709_10003890 | Ga0207709_100038906 | 50 |
| 618 | 3300025935 | Ga0207709_10094705 | Ga0207709_100947053 | 50 |
| 619 | 3300025935 | Ga0207709_10311331 | Ga0207709_103113313 | 50 |
| 620 | 3300025936 | Ga0207670_10002408 | Ga0207670_100024085 | 50 |
| 621 | 3300025936 | Ga0207670_10615099 | Ga0207670_106150992 | 50 |
| 622 | 3300025938 | Ga0207704_10001044 | Ga0207704_1000104412 | 50 |
| 623 | 3300025938 | Ga0207704_10029962 | Ga0207704_100299624 | 50 |
| 624 | 3300025940 | Ga0207691_10143872 | Ga0207691_101438723 | 50 |
| 625 | 3300025940 | Ga0207691_10144385 | Ga0207691_101443852 | 50 |
| 626 | 3300025940 | Ga0207691_10465546 | Ga0207691_104655462 | 50 |
| 627 | 3300025941 | Ga0207711_10083677 | Ga0207711_100836773 | 50 |
| 628 | 3300025941 | Ga0207711_10499001 | Ga0207711_104990011 | 50 |
| 629 | 3300025941 | Ga0207711_11069651 | Ga0207711_110696512 | 50 |
| 630 | 3300025942 | Ga0207689_10000007 | Ga0207689_1000000724 | 50 |
| 631 | 3300025942 | Ga0207689_10008236 | Ga0207689_100082366 | 50 |
| 632 | 3300025945 | Ga0207679_10587265 | Ga0207679_105872652 | 50 |
| 633 | 3300025949 | Ga0207667_10012993 | Ga0207667_100129938 | 50 |
| 634 | 3300025949 | Ga0207667_11233703 | Ga0207667_112337032 | 50 |
| 635 | 3300025960 | Ga0207651_10009087 | Ga0207651_100090873 | 50 |
| 636 | 3300025960 | Ga0207651_10197137 | Ga0207651_101971372 | 50 |
| 637 | 3300025961 | Ga0207712_10032651 | Ga0207712_100326516 | 50 |
| 638 | 3300025961 | Ga0207712_10741936 | Ga0207712_107419361 | 50 |
| 639 | 3300025961 | Ga0207712_10958383 | Ga0207712_109583832 | 50 |
| 640 | 3300025961 | Ga0207712_12020673 | Ga0207712_120206731 | 50 |
| 641 | 3300025972 | Ga0207668_11426800 | Ga0207668_114268002 | 50 |
| 642 | 3300025981 | Ga0207640_10010129 | Ga0207640_100101297 | 50 |
| 643 | 3300026023 | Ga0207677_10002194 | Ga0207677_100021949 | 50 |
| 644 | 3300026023 | Ga0207677_10986842 | Ga0207677_109868422 | 50 |
| 645 | 3300026035 | Ga0207703_10004921 | Ga0207703_100049217 | 50 |
| 646 | 3300026035 | Ga0207703_10339003 | Ga0207703_103390032 | 50 |
| 647 | 3300026035 | Ga0207703_11805899 | Ga0207703_118058992 | 50 |
| 648 | 3300026041 | Ga0207639_10029407 | Ga0207639_100294072 | 50 |
| 649 | 3300026075 | Ga0207708_10001220 | Ga0207708_100012206 | 50 |
| 650 | 3300026075 | Ga0207708_10002375 | Ga0207708_1000237512 | 50 |
| 651 | 3300026075 | Ga0207708_10006335 | Ga0207708_100063353 | 50 |
| 652 | 3300026078 | Ga0207702_11127755 | Ga0207702_111277552 | 50 |
| 653 | 3300026088 | Ga0207641_10149261 | Ga0207641_101492613 | 50 |
| 654 | 3300026088 | Ga0207641_10249782 | Ga0207641_102497823 | 50 |
| 655 | 3300026088 | Ga0207641_10335859 | Ga0207641_103358593 | 50 |
| 656 | 3300026088 | Ga0207641_10412223 | Ga0207641_104122232 | 50 |
| 657 | 3300026088 | Ga0207641_11372390 | Ga0207641_113723902 | 50 |
| 658 | 3300026089 | Ga0207648_10000135 | Ga0207648_1000013567 | 50 |
| 659 | 3300026089 | Ga0207648_10006030 | Ga0207648_100060305 | 50 |
| 660 | 3300026095 | Ga0207676_10029815 | Ga0207676_100298155 | 50 |
| 661 | 3300026095 | Ga0207676_10063599 | Ga0207676_100635992 | 50 |
| 662 | 3300026095 | Ga0207676_10485683 | Ga0207676_104856832 | 50 |
| 663 | 3300026116 | Ga0207674_10992626 | Ga0207674_109926262 | 50 |
| 664 | 3300026118 | Ga0207675_100000825 | Ga0207675_1000008257 | 50 |
| 665 | 3300026118 | Ga0207675_100028360 | Ga0207675_1000283605 | 50 |
| 666 | 3300026118 | Ga0207675_100031263 | Ga0207675_1000312634 | 50 |
| 667 | 3300026121 | Ga0207683_10015743 | Ga0207683_100157437 | 50 |
| 668 | 3300026121 | Ga0207683_10400751 | Ga0207683_104007512 | 50 |
| 669 | 3300026121 | Ga0207683_10841291 | Ga0207683_108412911 | 50 |
| 670 | 3300026121 | Ga0207683_10900203 | Ga0207683_109002032 | 50 |
| 671 | 3300026142 | Ga0207698_10128807 | Ga0207698_101288074 | 50 |
| 672 | 3300027907 | Ga0207428_10000265 | Ga0207428_1000026543 | 50 |
| 673 | 3300028379 | Ga0268266_10850716 | Ga0268266_108507162 | 50 |
| 674 | 3300028380 | Ga0268265_10003652 | Ga0268265_100036527 | 50 |
| 675 | 3300028381 | Ga0268264_10042993 | Ga0268264_100429934 | 50 |
| 676 | 3300028381 | Ga0268264_10323441 | Ga0268264_103234413 | 50 |
| 677 | 3300028381 | Ga0268264_10791071 | Ga0268264_107910711 | 50 |
| 678 | 3300028381 | Ga0268264_11663475 | Ga0268264_116634752 | 50 |
| 679 | 3300031344 | Ga0265316_11018615 | Ga0265316_110186151 | 50 |
| 680 | 3300034816 | Ga0373930_0064337 | Ga0373930_0064337_160_315 | 50 |
| 681 | 3300034817 | Ga0373948_0007910 | Ga0373948_0007910_189_344 | 50 |
| 682 | 3300034818 | Ga0373950_0012776 | Ga0373950_0012776_747_902 | 50 |
| 683 | 3300034819 | Ga0373958_0013783 | Ga0373958_0013783_148_303 | 50 |
| 684 | 3300034957 | Ga0373938_0022610 | Ga0373938_0022610_963_1118 | 50 |
| 685 | 3300035083 | Ga0373926_0162274 | Ga0373926_0162274_134_286 | 50 |
| 686 | 3300035084 | Ga0373928_0025020 | Ga0373928_0025020_1002_1157 | 50 |
| 687 | 3300035084 | Ga0373928_0272939 | Ga0373928_0272939_78_233 | 50 |
| 688 | 3300035085 | Ga0373929_0009977 | Ga0373929_0009977_756_911 | 50 |
| 689 | 3300035090 | Ga0373949_0025002 | Ga0373949_0025002_240_395 | 50 |
| 690 | 3300035091 | Ga0373951_0016205 | Ga0373951_0016205_327_482 | 50 |
| 691 | 3300035092 | Ga0373952_0032093 | Ga0373952_0032093_104_259 | 50 |
| 692 | 3300035111 | Ga0373923_0353262 | Ga0373923_0353262_64_216 | 50 |
| 693 | 3300035113 | Ga0373936_0019200 | Ga0373936_0019200_1672_1824 | 50 |
| 694 | 3300035114 | Ga0373939_0009948 | Ga0373939_0009948_1097_1252 | 50 |
| 695 | 3300035115 | Ga0373941_0005618 | Ga0373941_0005618_833_988 | 50 |
| 696 | 3300035116 | Ga0373945_0224593 | Ga0373945_0224593_411_566 | 50 |
| 697 | 3300035121 | Ga0373960_0024238 | Ga0373960_0024238_580_735 | 50 |
| 698 | 3300035170 | Ga0373943_0133035 | Ga0373943_0133035_480_632 | 50 |
| 699 | 3300035171 | Ga0373946_0010654 | Ga0373946_0010654_553_705 | 50 |
| 700 | 3300035171 | Ga0373946_0550713 | Ga0373946_0550713_19_174 | 50 |
| 701 | 3300035207 | Ga0373942_0015824 | Ga0373942_0015824_1220_1375 | 50 |
| 702 | 3300035207 | Ga0373942_0056169 | Ga0373942_0056169_552_707 | 50 |
| 703 | 3300035241 | Ga0373961_0106592 | Ga0373961_0106592_261_416 | 50 |
| 704 | 3300035242 | Ga0373962_0065055 | Ga0373962_0065055_246_401 | 50 |
| 705 | 3300035691 | Ga0373931_0001607 | Ga0373931_0001607_696_851 | 50 |
| 706 | 3300035691 | Ga0373931_0096028 | Ga0373931_0096028_1055_1210 | 50 |
| 707 | 3300035691 | Ga0373931_0211548 | Ga0373931_0211548_809_961 | 50 |
| 708 | 3300035692 | Ga0373935_0312352 | Ga0373935_0312352_295_447 | 50 |
| 709 | 3300035695 | Ga0373927_0097863 | Ga0373927_0097863_1679_1834 | 50 |
| 710 | 3300035695 | Ga0373927_0426475 | Ga0373927_0426475_156_308 | 50 |
| 711 | 3300035725 | Ga0373947_0175536 | Ga0373947_0175536_1070_1225 | 50 |
| 712 | 3300035725 | Ga0373947_0194527 | Ga0373947_0194527_457_609 | 50 |
| 713 | 3300037068 | Ga0373925_0019590 | Ga0373925_0019590_4522_4677 | 50 |
| 714 | 3300037068 | Ga0373925_0154573 | Ga0373925_0154573_456_608 | 50 |
| 715 | 3300037068 | Ga0373925_0825369 | Ga0373925_0825369_17_178 | 50 |
| 716 | 3300037418 | Ga0395900_0520188 | Ga0395900_0520188_577_729 | 50 |
| 717 | 3300037471 | Ga0395905_0889784 | Ga0395905_0889784_609_761 | 50 |
| 718 | 3300038443 | Ga0395901_0702983 | Ga0395901_0702983_258_410 | 50 |
| 719 | 3300045051 | Ga0451576_0022710 | Ga0451576_0022710_4543_4698 | 50 |
| 720 | 3300045051 | Ga0451576_0800716 | Ga0451576_0800716_325_480 | 50 |
| 721 | 3300045051 | Ga0451576_1324134 | Ga0451576_1324134_257_409 | 50 |
| 722 | 3300046458 | Ga0495591_113339 | Ga0495591_113339_373_525 | 50 |
| 723 | 3300046472 | Ga0495580_0248400 | Ga0495580_0248400_57_212 | 50 |
| 724 | 3300046525 | Ga0495663_0153948 | Ga0495663_0153948_426_578 | 50 |
| 725 | 3300046526 | Ga0495666_0305368 | Ga0495666_0305368_160_312 | 50 |
| 726 | 3300046528 | Ga0495642_0085475 | Ga0495642_0085475_412_564 | 50 |
| 727 | 3300046537 | Ga0495598_0086816 | Ga0495598_0086816_517_669 | 50 |
| 728 | 3300046539 | Ga0495621_0153139 | Ga0495621_0153139_637_789 | 50 |
| 729 | 3300046539 | Ga0495621_0311831 | Ga0495621_0311831_147_299 | 50 |
| 730 | 3300046683 | Ga0495658_0008063 | Ga0495658_0008063_4904_5065 | 50 |
| 731 | 3300048904 | Ga0496101_1146933 | Ga0496101_1146933_392_544 | 50 |
| 732 | 3300048905 | Ga0496102_1438399 | Ga0496102_1438399_69_221 | 50 |
| 733 | 3300048906 | Ga0496103_0662982 | Ga0496103_0662982_330_482 | 50 |
| 734 | 3300048906 | Ga0496103_1057418 | Ga0496103_1057418_61_213 | 50 |
| 735 | 3300048907 | Ga0496104_0065053 | Ga0496104_0065053_247_399 | 50 |
| 736 | 3300048908 | Ga0496105_0168693 | Ga0496105_0168693_908_1060 | 50 |
| 737 | 3300048911 | Ga0496108_0029402 | Ga0496108_0029402_3621_3773 | 50 |
| 738 | 3300048911 | Ga0496108_0996473 | Ga0496108_0996473_188_340 | 50 |
| 739 | 3300048912 | Ga0496109_1508694 | Ga0496109_1508694_214_366 | 50 |
| 740 | 3300048913 | Ga0496110_0206878 | Ga0496110_0206878_1139_1291 | 50 |
| 741 | 3300048914 | Ga0496111_0936021 | Ga0496111_0936021_127_279 | 50 |
| 742 | 3300048915 | Ga0496112_0108698 | Ga0496112_0108698_1569_1721 | 50 |
| 743 | 3300048916 | Ga0496113_0365210 | Ga0496113_0365210_160_312 | 50 |
| 744 | 3300048917 | Ga0496114_0363306 | Ga0496114_0363306_610_762 | 50 |
| 745 | 3300049571 | Ga0501034_0094491 | Ga0501034_0094491_2292_2447 | 50 |
| 746 | 3300049582 | Ga0501048_0272093 | Ga0501048_0272093_217_369 | 50 |
| 747 | 3300049586 | Ga0501070_0229587 | Ga0501070_0229587_571_726 | 50 |
| 748 | 3300049589 | Ga0501073_0007406 | Ga0501073_0007406_1655_1810 | 50 |
| 749 | 3300049742 | Ga0501080_0094703 | Ga0501080_0094703_1028_1183 | 50 |
| 750 | 3300050507 | nmdc:mga05p37_2222976_c1 | nmdc:mga05p37_2222976_c1_153_305 | 50 |
| 751 | 3300050507 | nmdc:mga05p37_25428_c1 | nmdc:mga05p37_25428_c1_2949_3101 | 50 |
| 752 | 3300050507 | nmdc:mga05p37_2836_c1 | nmdc:mga05p37_2836_c1_4380_4532 | 50 |
| 753 | 3300050508 | nmdc:mga09592_1731629_c1 | nmdc:mga09592_1731629_c1_136_288 | 50 |
| 754 | 3300050508 | nmdc:mga09592_20267_c1 | nmdc:mga09592_20267_c1_4381_4533 | 50 |
| 755 | 3300050508 | nmdc:mga09592_206267_c1 | nmdc:mga09592_206267_c1_169_321 | 50 |
| 756 | 3300050509 | nmdc:mga0qj67_977756_c1 | nmdc:mga0qj67_977756_c1_367_519 | 50 |
| 757 | 3300050510 | nmdc:mga06r32_64989_c1 | nmdc:mga06r32_64989_c1_1869_2021 | 50 |
| 758 | 3300050511 | nmdc:mga08y16_494575_c1 | nmdc:mga08y16_494575_c1_909_1061 | 50 |
| 759 | 3300050511 | nmdc:mga08y16_5446_c1 | nmdc:mga08y16_5446_c1_1376_1528 | 50 |
| 760 | 3300050512 | nmdc:mga0n895_564976_c1 | nmdc:mga0n895_564976_c1_944_1099 | 50 |
| 761 | 3300050513 | nmdc:mga0rr50_1107364_c1 | nmdc:mga0rr50_1107364_c1_411_563 | 50 |
| 762 | 3300050514 | nmdc:mga08x19_433400_c1 | nmdc:mga08x19_433400_c1_538_690 | 50 |
| 763 | 3300050515 | nmdc:mga0a205_411098_c1 | nmdc:mga0a205_411098_c1_723_875 | 50 |
| 764 | 3300053098 | Ga0500650_0492547 | Ga0500650_0492547_87_239 | 50 |
| 765 | 3300053153 | Ga0500616_0087441 | Ga0500616_0087441_456_608 | 50 |
| 766 | 3300054114 | Ga0501084_1156846 | Ga0501084_1156846_264_416 | 50 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p4l-assembly1.cif.gz_A | crystal structure of the trimeric ectodomain of archaeal fusexin1 (fsx1) | 0.7587 | 1 | 29 |
| 1gcc-assembly1.cif.gz_A | solution nmr structure of the complex of gcc-box binding domain of aterf1 and gcc-box dna, minimized average structure | 0.7001 | 2 | 50 |
| 7p4l-assembly1.cif.gz_B | crystal structure of the trimeric ectodomain of archaeal fusexin1 (fsx1) | 0.6971 | 1 | 29 |
| 7p4l-assembly1.cif.gz_C | crystal structure of the trimeric ectodomain of archaeal fusexin1 (fsx1) | 0.683 | 1 | 29 |
| 1gcc-assembly1.cif.gz_A | solution nmr structure of the complex of gcc-box binding domain of aterf1 and gcc-box dna, minimized average structure | 0.6661 | 2 | 50 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76389_435_515_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.8838 | 1 | 13 | 3.30.465.10 |
| af_Q9AWS7_65_121_3.30.730.10 | Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain | 0.8032 | 2 | 36 | 3.30.730.10 |
| af_A0A0R0FVZ4_228_287_3.30.730.10 | Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain | 0.7768 | 2 | 36 | 3.30.730.10 |
| af_A0A1D6KJ58_29_91_3.30.730.10 | Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain | 0.7752 | 2 | 36 | 3.30.730.10 |
| af_K7KP57_178_237_3.30.730.10 | Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain | 0.754 | 2 | 38 | 3.30.730.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6R6C1-F1-model_v4 | AP2-like integrase N-terminal domain-containing protein | 1.008 | 1 | 48 |
|
| AF-A0A2V5YM63-F1-model_v4 | Uncharacterized protein | 1.008 | 1 | 39 |
|
| AF-A0A439UE47-F1-model_v4 | AP2-like integrase N-terminal domain-containing protein | 1.007 | 2 | 47 |
|
| AF-A0A6I6MUD1-F1-model_v4 | AP2-like integrase N-terminal domain-containing protein | 1.006 | 1 | 49 |
|
| AF-A0A0Q8QM77-F1-model_v4 | AP2/ERF domain-containing protein | 1.006 | 1 | 48 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar