F479825

General Info

Members Datasets Scaffolds Average Seq Length
766 348 766 50

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_101720809|Ga0070667_1017208091
Length 60
Sequence MIRKLSTGKYRLYSRKLNPKTGRRRNLGTFATRAAAEKHERAVQYFKRGGAMSRGGARRR

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
111 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
136 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
138 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
208 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
209 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
210 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
211 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
212 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
213 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
214 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
215 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
216 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
217 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
218 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
221 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
222 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
223 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
224 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
225 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
226 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
227 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
228 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
229 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
230 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
231 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
232 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
233 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
234 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
237 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
240 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
245 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
246 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
251 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
252 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
255 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
259 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
264 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
271 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
272 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
273 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
274 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
275 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
276 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
277 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
278 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
279 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
280 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
281 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
295 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
296 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
297 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
300 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
301 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
302 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
303 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
304 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
305 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
306 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
307 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
308 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
309 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
310 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
311 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
312 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
313 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
314 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
315 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
320 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
324 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
334 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
337 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
338 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
339 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
340 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
341 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
342 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
343 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
344 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
345 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
346 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
348 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.05
Nodule 0
Rhizoplane 4.31
Rhizosphere 88.9
Stem 0
Stem Tuber 0
Unclassified 2.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1291068 2162886006 Bacteria 847
2 CNBas_1000908 3300000531 Unclassified 1464
3 JGI25156J39149_1000376 3300002705 Bacteria 28411
4 JGI25154J39366_1000488 3300002738 Bacteria 20416
5 JGI25157J39369_1000199 3300002741 Bacteria 50810
6 rootH1_10037156 3300003316 Bacteria 4740
7 rootH1_10014388 3300003323 Unclassified 2421
8 rootH1_10020809 3300003323 Bacteria 47178
9 rootH1_10039540 3300003323 Bacteria 5790
10 rootH1_10174920 3300003323 Bacteria 8591
11 rootH1_10243980 3300003323 Bacteria 6658
12 Ga0055539_1000312 3300003752 Bacteria 25513
13 Ga0055539_1000659 3300003752 Bacteria 9147
14 Ga0055533_1000033 3300003756 Bacteria 265716
15 Ga0055525_1001535 3300003759 Bacteria 3871
16 Ga0065704_10793649 3300005289 Bacteria 527
17 Ga0065707_10087312 3300005295 Bacteria 5069
18 Ga0070683_100098687 3300005329 Bacteria 2749
19 Ga0070683_100454450 3300005329 Bacteria 1222
20 Ga0070683_100741457 3300005329 Bacteria 941
21 Ga0070690_100012931 3300005330 Bacteria 4922
22 Ga0070690_100016783 3300005330 Bacteria 4394
23 Ga0070690_100037072 3300005330 Bacteria 3070
24 Ga0070690_100758269 3300005330 Bacteria 750
25 Ga0070670_100042702 3300005331 Bacteria 3898
26 Ga0070670_100115598 3300005331 Bacteria 2313
27 Ga0070670_100308670 3300005331 Bacteria 1384
28 Ga0070670_100750172 3300005331 Unclassified 879
29 Ga0070670_101411098 3300005331 Bacteria 638
30 Ga0070677_10122527 3300005333 Bacteria 1176
31 Ga0068869_100534220 3300005334 Bacteria 983
32 Ga0068869_100643224 3300005334 Bacteria 899
33 Ga0068869_100788966 3300005334 Unclassified 816
34 Ga0068869_101242201 3300005334 Bacteria 656
35 Ga0068869_101267466 3300005334 Unclassified 649
36 Ga0068869_101561124 3300005334 Unclassified 587
37 Ga0070666_10010458 3300005335 Bacteria 5806
38 Ga0070666_10156316 3300005335 Bacteria 1592
39 Ga0070680_100127802 3300005336 Unclassified 2124
40 Ga0068868_100108494 3300005338 Bacteria 2253
41 Ga0068868_100969875 3300005338 Unclassified 776
42 Ga0068868_101014780 3300005338 Bacteria 760
43 Ga0070660_100445724 3300005339 Bacteria 1074
44 Ga0070660_100632600 3300005339 Bacteria 896
45 Ga0070689_100052468 3300005340 Bacteria 3154
46 Ga0070689_100079004 3300005340 Bacteria 2580
47 Ga0070689_100617293 3300005340 Bacteria 940
48 Ga0070691_10070822 3300005341 Bacteria 1692
49 Ga0070691_10476470 3300005341 Bacteria 717
50 Ga0070687_100235321 3300005343 Bacteria 1129
51 Ga0070661_100021587 3300005344 Bacteria 4600
52 Ga0070661_100487964 3300005344 Bacteria 985
53 Ga0070669_100255557 3300005353 Bacteria 1396
54 Ga0070669_100533868 3300005353 Bacteria 976
55 Ga0070675_100181617 3300005354 Bacteria 1819
56 Ga0070675_100317263 3300005354 Bacteria 1376
57 Ga0070675_100868855 3300005354 Bacteria 826
58 Ga0070671_100005134 3300005355 Bacteria 10421
59 Ga0070671_101709104 3300005355 Unclassified 558
60 Ga0070674_100303386 3300005356 Bacteria 1274
61 Ga0070674_100678334 3300005356 Bacteria 879
62 Ga0070674_100767368 3300005356 Bacteria 830
63 Ga0070674_101786869 3300005356 Bacteria 557
64 Ga0070673_100154246 3300005364 Bacteria 1948
65 Ga0070673_100350617 3300005364 Bacteria 1310
66 Ga0070688_100084307 3300005365 Bacteria 2064
67 Ga0070688_101020111 3300005365 Unclassified 658
68 Ga0070667_100018405 3300005367 Bacteria 5793
69 Ga0070667_100076221 3300005367 Bacteria 2863
70 Ga0070667_100365916 3300005367 Bacteria 1308
71 Ga0070667_101720809 3300005367 Unclassified 590
72 Ga0070703_10423898 3300005406 Bacteria 584
73 Ga0070709_10098408 3300005434 Bacteria 1944
74 Ga0070709_10254684 3300005434 Bacteria 1266
75 Ga0070709_11458253 3300005434 Bacteria 555
76 Ga0070713_100427433 3300005436 Bacteria 1241
77 Ga0070713_100887561 3300005436 Bacteria 857
78 Ga0070701_10000224 3300005438 Bacteria 17823
79 Ga0070701_10070516 3300005438 Bacteria 1867
80 Ga0070701_10144942 3300005438 Bacteria 1362
81 Ga0070701_10432605 3300005438 Bacteria 841
82 Ga0070711_100886887 3300005439 Bacteria 761
83 Ga0070705_100971525 3300005440 Bacteria 688
84 Ga0070700_100013454 3300005441 Bacteria 4596
85 Ga0070694_100523279 3300005444 Bacteria 946
86 Ga0070663_100343948 3300005455 Bacteria 1206
87 Ga0070663_101024812 3300005455 Bacteria 719
88 Ga0070678_100069355 3300005456 Bacteria 2632
89 Ga0070678_100402741 3300005456 Bacteria 1189
90 Ga0070678_100594055 3300005456 Bacteria 987
91 Ga0070678_100838132 3300005456 Bacteria 837
92 Ga0070678_101282596 3300005456 Bacteria 681
93 Ga0070662_101048876 3300005457 Bacteria 699
94 Ga0070662_101186666 3300005457 Bacteria 656
95 Ga0070681_10100377 3300005458 Unclassified 2840
96 Ga0068867_100176559 3300005459 Bacteria 1695
97 Ga0068867_100511371 3300005459 Bacteria 1034
98 Ga0070685_10042237 3300005466 Bacteria 2601
99 Ga0070685_10667764 3300005466 Bacteria 755
100 Ga0070706_100546096 3300005467 Bacteria 1078
101 Ga0070698_101645983 3300005471 Bacteria 594
102 Ga0070699_101090581 3300005518 Unclassified 732
103 Ga0070679_101437343 3300005530 Bacteria 636
104 Ga0070684_100076468 3300005535 Bacteria 2955
105 Ga0070684_100508384 3300005535 Bacteria 1116
106 Ga0070697_100500657 3300005536 Bacteria 1062
107 Ga0070697_101147305 3300005536 Bacteria 692
108 Ga0068853_100375901 3300005539 Bacteria 1326
109 Ga0070672_100103961 3300005543 Bacteria 2307
110 Ga0070672_100145268 3300005543 Unclassified 1960
111 Ga0070672_100209171 3300005543 Bacteria 1633
112 Ga0070672_100426687 3300005543 Bacteria 1139
113 Ga0070672_100683231 3300005543 Bacteria 898
114 Ga0070686_100054036 3300005544 Bacteria 2568
115 Ga0070686_100333262 3300005544 Bacteria 1135
116 Ga0070695_100000207 3300005545 Bacteria 28678
117 Ga0070695_100227998 3300005545 Unclassified 1345
118 Ga0070695_100847925 3300005545 Unclassified 735
119 Ga0070696_100000958 3300005546 Bacteria 18702
120 Ga0070696_100035272 3300005546 Bacteria 3443
121 Ga0070693_100022202 3300005547 Bacteria 3370
122 Ga0070693_100091139 3300005547 Bacteria 1838
123 Ga0070693_100145648 3300005547 Bacteria 1495
124 Ga0070665_100002191 3300005548 Bacteria 21789
125 Ga0070665_100008155 3300005548 Bacteria 10604
126 Ga0070665_100371530 3300005548 Bacteria 1437
127 Ga0070665_101630736 3300005548 Unclassified 653
128 Ga0070704_100979400 3300005549 Bacteria 764
129 Ga0068855_100074235 3300005563 Bacteria 3950
130 Ga0068855_100331510 3300005563 Bacteria 1680
131 Ga0068855_100724255 3300005563 Bacteria 1063
132 Ga0070664_100008795 3300005564 Bacteria 8180
133 Ga0070664_100120598 3300005564 Bacteria 2296
134 Ga0070664_100297286 3300005564 Unclassified 1458
135 Ga0070664_100527352 3300005564 Bacteria 1091
136 Ga0068857_100001581 3300005577 Bacteria 18238
137 Ga0068857_101212413 3300005577 Unclassified 731
138 Ga0068854_100047175 3300005578 Bacteria 3069
139 Ga0068854_100449821 3300005578 Bacteria 1075
140 Ga0068856_100001069 3300005614 Bacteria 29002
141 Ga0068856_100291434 3300005614 Unclassified 1649
142 Ga0068856_100885385 3300005614 Bacteria 912
143 Ga0070702_100026229 3300005615 Bacteria 3129
144 Ga0070702_100287372 3300005615 Bacteria 1131
145 Ga0070702_100587302 3300005615 Bacteria 833
146 Ga0068852_100159346 3300005616 Bacteria 2106
147 Ga0068852_101272840 3300005616 Bacteria 757
148 Ga0068859_100006635 3300005617 Bacteria 11754
149 Ga0068859_100042745 3300005617 Bacteria 4552
150 Ga0068859_100793842 3300005617 Bacteria 1035
151 Ga0068859_102077725 3300005617 Bacteria 627
152 Ga0068859_102752483 3300005617 Unclassified 540
153 Ga0068864_100003997 3300005618 Bacteria 12141
154 Ga0068864_100054444 3300005618 Unclassified 3453
155 Ga0068864_100076085 3300005618 Bacteria 2932
156 Ga0068864_100128578 3300005618 Bacteria 2273
157 Ga0068864_100337885 3300005618 Bacteria 1418
158 Ga0068864_101265186 3300005618 Bacteria 737
159 Ga0068866_10000950 3300005718 Bacteria 12744
160 Ga0068866_10040043 3300005718 Bacteria 2317
161 Ga0068866_10430335 3300005718 Unclassified 858
162 Ga0068861_100064223 3300005719 Bacteria 2824
163 Ga0068861_100171921 3300005719 Bacteria 1796
164 Ga0068861_100709911 3300005719 Bacteria 935
165 Ga0068861_101641634 3300005719 Bacteria 634
166 Ga0068851_10173382 3300005834 Bacteria 1191
167 Ga0068851_10178843 3300005834 Bacteria 1174
168 Ga0068870_10008184 3300005840 Bacteria 4691
169 Ga0068870_10549094 3300005840 Bacteria 777
170 Ga0068863_100026788 3300005841 Bacteria 5497
171 Ga0068863_100121249 3300005841 Bacteria 2493
172 Ga0068863_100238093 3300005841 Unclassified 1757
173 Ga0068863_100297975 3300005841 Bacteria 1564
174 Ga0068863_100352186 3300005841 Bacteria 1434
175 Ga0068863_100361801 3300005841 Bacteria 1414
176 Ga0068863_100445754 3300005841 Bacteria 1270
177 Ga0068858_100018730 3300005842 Bacteria 6479
178 Ga0068858_100045414 3300005842 Bacteria 4071
179 Ga0068858_100549270 3300005842 Unclassified 1118
180 Ga0068860_100106666 3300005843 Bacteria 2676
181 Ga0068860_100288293 3300005843 Bacteria 1606
182 Ga0068860_100399336 3300005843 Bacteria 1360
183 Ga0068860_100573807 3300005843 Bacteria 1132
184 Ga0068862_100014905 3300005844 Bacteria 6457
185 Ga0081540_1314338 3300005983 Bacteria 537
186 Ga0070717_11631897 3300006028 Bacteria 584
187 Ga0075363_100344347 3300006048 Bacteria 870
188 Ga0075364_10122909 3300006051 Bacteria 1738
189 Ga0070716_100704541 3300006173 Bacteria 772
190 Ga0070716_101840193 3300006173 Unclassified 502
191 Ga0075362_10377651 3300006177 Bacteria 712
192 Ga0097621_100018098 3300006237 Bacteria 5372
193 Ga0097621_100198062 3300006237 Bacteria 1742
194 Ga0097621_102373466 3300006237 Bacteria 507
195 Ga0075370_10034887 3300006353 Bacteria 2821
196 Ga0068871_100039244 3300006358 Bacteria 3787
197 Ga0068871_100074998 3300006358 Bacteria 2792
198 Ga0068871_100304365 3300006358 Bacteria 1400
199 Ga0068871_102147308 3300006358 Bacteria 532
200 Ga0075428_100005195 3300006844 Bacteria 14462
201 Ga0075428_100051828 3300006844 Bacteria 4500
202 Ga0075428_100317286 3300006844 Bacteria 1675
203 Ga0075428_100325599 3300006844 Bacteria 1651
204 Ga0075430_100766684 3300006846 Unclassified 795
205 Ga0075430_101368850 3300006846 Bacteria 582
206 Ga0075431_100359524 3300006847 Bacteria 1462
207 Ga0075431_102036922 3300006847 Bacteria 529
208 Ga0075433_10248315 3300006852 Bacteria 1579
209 Ga0075433_10667477 3300006852 Bacteria 911
210 Ga0075434_100125217 3300006871 Bacteria 2587
211 Ga0075434_100261417 3300006871 Bacteria 1750
212 Ga0075434_100460740 3300006871 Bacteria 1292
213 Ga0075434_101317087 3300006871 Bacteria 733
214 Ga0075434_102050655 3300006871 Bacteria 577
215 Ga0075429_100000103 3300006880 Bacteria 47421
216 Ga0075429_101336131 3300006880 Unclassified 625
217 Ga0075429_101455327 3300006880 Unclassified 596
218 Ga0075429_101783568 3300006880 Bacteria 534
219 Ga0068865_100000447 3300006881 Bacteria 22945
220 Ga0068865_100034173 3300006881 Bacteria 3410
221 Ga0068865_100794248 3300006881 Bacteria 816
222 Ga0068865_102160080 3300006881 Bacteria 506
223 Ga0097620_100006635 3300006931 Bacteria 11754
224 Ga0097620_100042744 3300006931 Bacteria 4552
225 Ga0097620_100793875 3300006931 Bacteria 1035
226 Ga0097620_102077897 3300006931 Bacteria 627
227 Ga0097620_102753001 3300006931 Unclassified 540
228 Ga0075435_100159920 3300007076 Bacteria 1897
229 Ga0075435_100397106 3300007076 Bacteria 1186
230 Ga0075435_101378832 3300007076 Bacteria 618
231 Ga0075435_102013796 3300007076 Bacteria 507
232 Ga0099795_10005750 3300007788 Bacteria 3326
233 Ga0105251_10445248 3300009011 Bacteria 600
234 Ga0105240_10024844 3300009093 Bacteria 7889
235 Ga0105240_10088742 3300009093 Bacteria 3783
236 Ga0105240_10267903 3300009093 Bacteria 1968
237 Ga0105240_11354289 3300009093 Bacteria 749
238 Ga0111539_10049570 3300009094 Bacteria 5006
239 Ga0111539_10156092 3300009094 Bacteria 2670
240 Ga0111539_11805659 3300009094 Bacteria 709
241 Ga0105245_10004425 3300009098 Bacteria 12431
242 Ga0105245_10016905 3300009098 Bacteria 6369
243 Ga0105245_10025899 3300009098 Bacteria 5159
244 Ga0105245_10032189 3300009098 Bacteria 4642
245 Ga0105245_10198636 3300009098 Bacteria 1925
246 Ga0105245_10651099 3300009098 Bacteria 1084
247 Ga0105245_12468450 3300009098 Bacteria 573
248 Ga0105247_10006029 3300009101 Bacteria 7543
249 Ga0114129_10001184 3300009147 Bacteria 34627
250 Ga0114129_10082380 3300009147 Bacteria 4471
251 Ga0105243_10003720 3300009148 Bacteria 12240
252 Ga0105243_10369812 3300009148 Bacteria 1322
253 Ga0105243_10434238 3300009148 Bacteria 1228
254 Ga0105243_10955059 3300009148 Bacteria 857
255 Ga0105241_10013741 3300009174 Bacteria 5931
256 Ga0105241_10672307 3300009174 Bacteria 942
257 Ga0105241_11341688 3300009174 Unclassified 683
258 Ga0105242_10003302 3300009176 Bacteria 12562
259 Ga0105242_10019833 3300009176 Bacteria 5267
260 Ga0105242_10042075 3300009176 Bacteria 3687
261 Ga0105242_10042982 3300009176 Bacteria 3653
262 Ga0105242_10169989 3300009176 Bacteria 1915
263 Ga0105242_10641591 3300009176 Bacteria 1031
264 Ga0105242_13122072 3300009176 Bacteria 514
265 Ga0105248_10001702 3300009177 Bacteria 24467
266 Ga0105248_10031622 3300009177 Bacteria 5912
267 Ga0105248_10270660 3300009177 Bacteria 1913
268 Ga0105248_10758255 3300009177 Unclassified 1095
269 Ga0105248_11038997 3300009177 Bacteria 926
270 Ga0105248_11199894 3300009177 Bacteria 858
271 Ga0105237_11196352 3300009545 Bacteria 767
272 Ga0105238_10009832 3300009551 Bacteria 9580
273 Ga0105238_10272777 3300009551 Bacteria 1672
274 Ga0105238_10317410 3300009551 Bacteria 1544
275 Ga0105249_10000917 3300009553 Bacteria 26070
276 Ga0105249_10087083 3300009553 Bacteria 2914
277 Ga0105249_10317194 3300009553 Bacteria 1569
278 Ga0105249_10636704 3300009553 Bacteria 1123
279 Ga0105249_11455869 3300009553 Bacteria 757
280 Ga0105035_100653 3300009988 Bacteria 2171
281 Ga0099796_10004786 3300010159 Bacteria 3312
282 Ga0105239_10008582 3300010375 Bacteria 11592
283 Ga0105239_10021524 3300010375 Bacteria 7109
284 Ga0105239_10245376 3300010375 Bacteria 2011
285 Ga0105239_12476551 3300010375 Bacteria 605
286 Ga0105246_10000277 3300011119 Bacteria 26747
287 Ga0105246_10007067 3300011119 Bacteria 6871
288 Ga0105246_10576291 3300011119 Bacteria 969
289 Ga0105246_11758534 3300011119 Bacteria 591
290 Ga0157371_10805608 3300013102 Bacteria 708
291 Ga0157371_11633628 3300013102 Bacteria 505
292 Ga0157369_10168044 3300013105 Bacteria 2312
293 Ga0157369_10455716 3300013105 Bacteria 1324
294 Ga0157374_10020454 3300013296 Bacteria 5871
295 Ga0157374_10242013 3300013296 Bacteria 1774
296 Ga0157374_11917478 3300013296 Unclassified 618
297 Ga0157378_10004581 3300013297 Bacteria 12120
298 Ga0157378_10037143 3300013297 Bacteria 4314
299 Ga0157378_10626394 3300013297 Bacteria 1089
300 Ga0157378_10965388 3300013297 Bacteria 885
301 Ga0157378_11327365 3300013297 Unclassified 761
302 Ga0157378_12033908 3300013297 Bacteria 625
303 Ga0163162_10011159 3300013306 Bacteria 8752
304 Ga0163162_10207068 3300013306 Bacteria 2091
305 Ga0163162_10280467 3300013306 Bacteria 1798
306 Ga0163162_10302154 3300013306 Bacteria 1732
307 Ga0163162_10869008 3300013306 Bacteria 1016
308 Ga0163162_11954690 3300013306 Bacteria 672
309 Ga0163162_12115502 3300013306 Unclassified 646
310 Ga0157372_10418032 3300013307 Bacteria 1563
311 Ga0157372_11160790 3300013307 Bacteria 893
312 Ga0157375_10034433 3300013308 Bacteria 4825
313 Ga0157375_10397427 3300013308 Bacteria 1545
314 Ga0157375_10559189 3300013308 Bacteria 1305
315 Ga0157375_10678674 3300013308 Bacteria 1185
316 Ga0157375_11455364 3300013308 Bacteria 808
317 Ga0157515_138793 3300013875 Bacteria 726
318 Ga0163163_10019210 3300014325 Bacteria 6415
319 Ga0163163_10097357 3300014325 Unclassified 2962
320 Ga0163163_10436111 3300014325 Unclassified 1369
321 Ga0163163_11154742 3300014325 Bacteria 837
322 Ga0163163_12352574 3300014325 Bacteria 591
323 Ga0157380_10017894 3300014326 Bacteria 5254
324 Ga0157380_10138310 3300014326 Bacteria 2088
325 Ga0157380_10898826 3300014326 Bacteria 911
326 Ga0157377_10673086 3300014745 Bacteria 748
327 Ga0157379_10089278 3300014968 Bacteria 2765
328 Ga0157379_10104777 3300014968 Bacteria 2538
329 Ga0157379_10126181 3300014968 Bacteria 2302
330 Ga0157379_10162033 3300014968 Bacteria 2019
331 Ga0157379_10436452 3300014968 Bacteria 1207
332 Ga0157379_10881527 3300014968 Bacteria 848
333 Ga0157379_11117554 3300014968 Unclassified 755
334 Ga0157379_11195893 3300014968 Bacteria 731
335 Ga0157376_10004392 3300014969 Bacteria 9818
336 Ga0157376_10012986 3300014969 Bacteria 6203
337 Ga0157376_10023467 3300014969 Bacteria 4827
338 Ga0157376_10562491 3300014969 Bacteria 1130
339 Ga0157376_10644289 3300014969 Bacteria 1059
340 Ga0157376_12556270 3300014969 Bacteria 550
341 Ga0163161_10127479 3300017792 Bacteria 1917
342 Ga0206349_1455567 3300020075 Bacteria 866
343 Ga0206352_10955745 3300020078 Bacteria 751
344 Ga0206350_10501895 3300020080 Bacteria 703
345 Ga0224712_10470241 3300022467 Bacteria 605
346 Ga0224712_10517530 3300022467 Bacteria 578
347 Ga0209674_100064 3300025226 Bacteria 265769
348 Ga0209563_100099 3300025230 Bacteria 153336
349 Ga0209646_1000060 3300025246 Bacteria 256386
350 Ga0209026_1000049 3300025250 Bacteria 255273
351 Ga0209677_100253 3300025253 Bacteria 36497
352 Ga0209677_100469 3300025253 Bacteria 23221
353 Ga0209759_1000272 3300025256 Bacteria 73495
354 Ga0209759_1059340 3300025256 Bacteria 544
355 Ga0207666_1054748 3300025271 Unclassified 635
356 Ga0209051_1004411 3300025303 Bacteria 8688
357 Ga0209051_1006125 3300025303 Bacteria 6838
358 Ga0207697_10006511 3300025315 Bacteria 5278
359 Ga0207656_10153551 3300025321 Bacteria 1092
360 Ga0207653_10004063 3300025885 Bacteria 4604
361 Ga0207653_10347876 3300025885 Bacteria 579
362 Ga0207682_10439108 3300025893 Unclassified 618
363 Ga0207692_11124656 3300025898 Bacteria 520
364 Ga0207642_10001134 3300025899 Bacteria 8234
365 Ga0207642_10332143 3300025899 Unclassified 891
366 Ga0207710_10013245 3300025900 Bacteria 3474
367 Ga0207688_10090865 3300025901 Bacteria 1753
368 Ga0207688_10442548 3300025901 Bacteria 809
369 Ga0207680_10009688 3300025903 Bacteria 4791
370 Ga0207680_10030488 3300025903 Bacteria 3042
371 Ga0207680_10190943 3300025903 Bacteria 1390
372 Ga0207680_10643521 3300025903 Bacteria 759
373 Ga0207699_10467179 3300025906 Bacteria 907
374 Ga0207699_11442702 3300025906 Bacteria 509
375 Ga0207645_10027314 3300025907 Bacteria 3686
376 Ga0207645_10470805 3300025907 Unclassified 849
377 Ga0207643_10034561 3300025908 Bacteria 2832
378 Ga0207643_10108138 3300025908 Bacteria 1636
379 Ga0207654_10013963 3300025911 Bacteria 4140
380 Ga0207707_10314799 3300025912 Bacteria 1352
381 Ga0207695_10011114 3300025913 Bacteria 10930
382 Ga0207695_10077046 3300025913 Bacteria 3388
383 Ga0207695_10311931 3300025913 Bacteria 1463
384 Ga0207693_10467793 3300025915 Bacteria 985
385 Ga0207660_10008341 3300025917 Bacteria 6699
386 Ga0207660_10972769 3300025917 Bacteria 692
387 Ga0207662_10000215 3300025918 Bacteria 26901
388 Ga0207662_10015862 3300025918 Bacteria 4244
389 Ga0207662_10199449 3300025918 Bacteria 1295
390 Ga0207662_10598499 3300025918 Bacteria 767
391 Ga0207657_10339426 3300025919 Bacteria 1186
392 Ga0207649_10933594 3300025920 Bacteria 681
393 Ga0207652_10058107 3300025921 Bacteria 3332
394 Ga0207652_10205627 3300025921 Bacteria 1772
395 Ga0207681_10413495 3300025923 Bacteria 1091
396 Ga0207681_11166189 3300025923 Bacteria 647
397 Ga0207694_10137213 3300025924 Bacteria 1965
398 Ga0207694_10898249 3300025924 Unclassified 749
399 Ga0207650_10009243 3300025925 Bacteria 6735
400 Ga0207650_10009343 3300025925 Bacteria 6702
401 Ga0207650_10082067 3300025925 Bacteria 2446
402 Ga0207650_11076722 3300025925 Unclassified 684
403 Ga0207659_10305219 3300025926 Bacteria 1309
404 Ga0207659_10633490 3300025926 Bacteria 913
405 Ga0207659_10764001 3300025926 Bacteria 829
406 Ga0207659_11648940 3300025926 Unclassified 547
407 Ga0207687_10001049 3300025927 Bacteria 18747
408 Ga0207687_10017744 3300025927 Bacteria 4692
409 Ga0207687_10039884 3300025927 Bacteria 3217
410 Ga0207687_10357875 3300025927 Bacteria 1191
411 Ga0207687_11530252 3300025927 Bacteria 573
412 Ga0207700_10775053 3300025928 Bacteria 857
413 Ga0207700_11058742 3300025928 Bacteria 725
414 Ga0207644_10040540 3300025931 Bacteria 3291
415 Ga0207644_10044810 3300025931 Bacteria 3144
416 Ga0207644_10047149 3300025931 Bacteria 3073
417 Ga0207644_10425140 3300025931 Bacteria 1089
418 Ga0207690_10579789 3300025932 Unclassified 914
419 Ga0207706_10052009 3300025933 Bacteria 3617
420 Ga0207706_10100596 3300025933 Bacteria 2543
421 Ga0207706_10861389 3300025933 Bacteria 767
422 Ga0207706_11654995 3300025933 Bacteria 517
423 Ga0207686_10002720 3300025934 Bacteria 9588
424 Ga0207686_10030105 3300025934 Bacteria 3210
425 Ga0207686_10653580 3300025934 Unclassified 832
426 Ga0207686_10874155 3300025934 Bacteria 724
427 Ga0207709_10003890 3300025935 Bacteria 8729
428 Ga0207709_10057388 3300025935 Bacteria 2414
429 Ga0207709_10094705 3300025935 Bacteria 1961
430 Ga0207709_10311331 3300025935 Bacteria 1175
431 Ga0207709_11104617 3300025935 Unclassified 651
432 Ga0207670_10002408 3300025936 Bacteria 9804
433 Ga0207670_10615099 3300025936 Bacteria 893
434 Ga0207669_10414928 3300025937 Bacteria 1058
435 Ga0207669_10439651 3300025937 Bacteria 1031
436 Ga0207704_10001044 3300025938 Bacteria 12293
437 Ga0207704_10029962 3300025938 Bacteria 3044
438 Ga0207665_11165065 3300025939 Bacteria 615
439 Ga0207691_10143872 3300025940 Bacteria 2100
440 Ga0207691_10144385 3300025940 Bacteria 2096
441 Ga0207691_10223480 3300025940 Unclassified 1632
442 Ga0207691_10465546 3300025940 Bacteria 1075
443 Ga0207691_10756065 3300025940 Bacteria 818
444 Ga0207691_10980261 3300025940 Unclassified 706
445 Ga0207711_10016454 3300025941 Bacteria 6146
446 Ga0207711_10083677 3300025941 Bacteria 2791
447 Ga0207711_10499001 3300025941 Bacteria 1134
448 Ga0207711_11069651 3300025941 Bacteria 747
449 Ga0207689_10000007 3300025942 Bacteria 132362
450 Ga0207689_10008236 3300025942 Bacteria 9082
451 Ga0207689_10339469 3300025942 Bacteria 1248
452 Ga0207689_11265761 3300025942 Bacteria 620
453 Ga0207689_11367469 3300025942 Unclassified 594
454 Ga0207661_10118183 3300025944 Bacteria 2253
455 Ga0207661_10264495 3300025944 Bacteria 1533
456 Ga0207679_10082442 3300025945 Bacteria 2462
457 Ga0207679_10587265 3300025945 Bacteria 1002
458 Ga0207679_10807423 3300025945 Bacteria 855
459 Ga0207667_10012993 3300025949 Bacteria 9558
460 Ga0207667_10060280 3300025949 Bacteria 3972
461 Ga0207667_10823972 3300025949 Bacteria 923
462 Ga0207667_11233703 3300025949 Unclassified 726
463 Ga0207651_10009087 3300025960 Bacteria 5411
464 Ga0207651_10173306 3300025960 Unclassified 1704
465 Ga0207651_10197137 3300025960 Bacteria 1610
466 Ga0207651_10414800 3300025960 Bacteria 1148
467 Ga0207651_10674205 3300025960 Bacteria 909
468 Ga0207712_10032651 3300025961 Bacteria 3514
469 Ga0207712_10233697 3300025961 Bacteria 1477
470 Ga0207712_10741936 3300025961 Bacteria 860
471 Ga0207712_10958383 3300025961 Bacteria 758
472 Ga0207712_11657557 3300025961 Bacteria 573
473 Ga0207712_12020673 3300025961 Unclassified 516
474 Ga0207668_11426800 3300025972 Bacteria 624
475 Ga0207640_10010129 3300025981 Bacteria 5301
476 Ga0207640_10016053 3300025981 Bacteria 4347
477 Ga0207640_10982809 3300025981 Bacteria 742
478 Ga0207658_10157931 3300025986 Bacteria 1855
479 Ga0207677_10002194 3300026023 Bacteria 10259
480 Ga0207677_10027567 3300026023 Bacteria 3580
481 Ga0207677_10646874 3300026023 Unclassified 933
482 Ga0207677_10986842 3300026023 Unclassified 763
483 Ga0207703_10004921 3300026035 Bacteria 10839
484 Ga0207703_10097679 3300026035 Bacteria 2482
485 Ga0207703_10339003 3300026035 Bacteria 1381
486 Ga0207703_11805899 3300026035 Bacteria 587
487 Ga0207639_10029407 3300026041 Bacteria 4022
488 Ga0207678_10301870 3300026067 Bacteria 1376
489 Ga0207678_10432906 3300026067 Bacteria 1142
490 Ga0207708_10001220 3300026075 Bacteria 19421
491 Ga0207708_10002375 3300026075 Bacteria 13829
492 Ga0207708_10006335 3300026075 Bacteria 8771
493 Ga0207702_10000395 3300026078 Bacteria 49788
494 Ga0207702_10503337 3300026078 Bacteria 1181
495 Ga0207702_10770601 3300026078 Bacteria 950
496 Ga0207702_11127755 3300026078 Bacteria 778
497 Ga0207641_10015662 3300026088 Bacteria 6213
498 Ga0207641_10149261 3300026088 Bacteria 2116
499 Ga0207641_10249782 3300026088 Bacteria 1656
500 Ga0207641_10257838 3300026088 Bacteria 1631
501 Ga0207641_10335859 3300026088 Bacteria 1436
502 Ga0207641_10412223 3300026088 Bacteria 1299
503 Ga0207641_11372390 3300026088 Bacteria 708
504 Ga0207641_12560300 3300026088 Bacteria 508
505 Ga0207648_10000135 3300026089 Bacteria 73544
506 Ga0207648_10006030 3300026089 Bacteria 12086
507 Ga0207676_10007204 3300026095 Bacteria 7872
508 Ga0207676_10029815 3300026095 Bacteria 4088
509 Ga0207676_10063599 3300026095 Bacteria 2931
510 Ga0207676_10485683 3300026095 Bacteria 1170
511 Ga0207676_12015997 3300026095 Bacteria 576
512 Ga0207676_12193768 3300026095 Unclassified 550
513 Ga0207674_10011974 3300026116 Bacteria 9722
514 Ga0207674_10169401 3300026116 Bacteria 2137
515 Ga0207674_10992626 3300026116 Unclassified 809
516 Ga0207675_100000825 3300026118 Bacteria 30861
517 Ga0207675_100009738 3300026118 Bacteria 8998
518 Ga0207675_100028360 3300026118 Bacteria 5213
519 Ga0207675_100031263 3300026118 Bacteria 4959
520 Ga0207675_100032021 3300026118 Bacteria 4899
521 Ga0207675_100612113 3300026118 Bacteria 1093
522 Ga0207675_102106483 3300026118 Unclassified 580
523 Ga0207675_102393153 3300026118 Unclassified 540
524 Ga0207683_10015743 3300026121 Bacteria 6436
525 Ga0207683_10400751 3300026121 Bacteria 1262
526 Ga0207683_10750847 3300026121 Bacteria 905
527 Ga0207683_10841291 3300026121 Bacteria 852
528 Ga0207683_10900203 3300026121 Unclassified 822
529 Ga0207698_10128807 3300026142 Bacteria 2159
530 Ga0207698_10311825 3300026142 Bacteria 1469
531 Ga0207698_10610024 3300026142 Unclassified 1077
532 Ga0209179_1001504 3300027512 Bacteria 2878
533 Ga0207428_10000265 3300027907 Bacteria 70984
534 Ga0207428_10531619 3300027907 Bacteria 852
535 Ga0268266_10000808 3300028379 Bacteria 41511
536 Ga0268266_10169068 3300028379 Bacteria 1983
537 Ga0268266_10436893 3300028379 Bacteria 1242
538 Ga0268266_10850716 3300028379 Bacteria 882
539 Ga0268265_10003652 3300028380 Bacteria 10970
540 Ga0268264_10042993 3300028381 Bacteria 3742
541 Ga0268264_10237783 3300028381 Bacteria 1686
542 Ga0268264_10323441 3300028381 Bacteria 1459
543 Ga0268264_10488912 3300028381 Bacteria 1198
544 Ga0268264_10791071 3300028381 Bacteria 947
545 Ga0268264_11663475 3300028381 Bacteria 649
546 Ga0265336_10002580 3300028666 Bacteria 7405
547 Ga0265338_10023488 3300028800 Bacteria 6336
548 Ga0307512_10464740 3300030522 Bacteria 506
549 Ga0265332_10077008 3300031238 Bacteria 1417
550 Ga0265332_10254171 3300031238 Bacteria 727
551 Ga0265328_10000640 3300031239 Bacteria 16218
552 Ga0265320_10001511 3300031240 Bacteria 16937
553 Ga0265320_10026887 3300031240 Bacteria 3006
554 Ga0265325_10083101 3300031241 Bacteria 1589
555 Ga0265329_10055164 3300031242 Bacteria 1261
556 Ga0265339_10028033 3300031249 Bacteria 3206
557 Ga0265339_10148516 3300031249 Bacteria 1187
558 Ga0265339_10409900 3300031249 Bacteria 632
559 Ga0265331_10077555 3300031250 Bacteria 1548
560 Ga0265331_10532620 3300031250 Bacteria 529
561 Ga0265316_11018615 3300031344 Bacteria 576
562 Ga0307509_10209315 3300031507 Bacteria 1777
563 Ga0265314_10004255 3300031711 Bacteria 13407
564 Ga0265314_10041451 3300031711 Bacteria 3295
565 Ga0265342_10000136 3300031712 Bacteria 82368
566 Ga0265342_10028108 3300031712 Bacteria 3507
567 Ga0307510_10077392 3300033180 Bacteria 3263
568 Ga0307510_10205875 3300033180 Bacteria 1496
569 Ga0373930_0064337 3300034816 Bacteria 823
570 Ga0373948_0007910 3300034817 Bacteria 1800
571 Ga0373950_0012776 3300034818 Bacteria 1392
572 Ga0373958_0013783 3300034819 Bacteria 1405
573 Ga0373938_0022610 3300034957 Bacteria 1286
574 Ga0373926_0162274 3300035083 Unclassified 853
575 Ga0373928_0025020 3300035084 Bacteria 1284
576 Ga0373928_0074017 3300035084 Unclassified 848
577 Ga0373928_0272939 3300035084 Bacteria 510
578 Ga0373929_0009977 3300035085 Bacteria 1767
579 Ga0373934_0207549 3300035086 Unclassified 807
580 Ga0373940_0283094 3300035088 Bacteria 567
581 Ga0373944_0164194 3300035089 Unclassified 789
582 Ga0373949_0025002 3300035090 Bacteria 1391
583 Ga0373949_0091353 3300035090 Unclassified 824
584 Ga0373951_0016205 3300035091 Bacteria 1680
585 Ga0373952_0032093 3300035092 Bacteria 1171
586 Ga0373952_0157757 3300035092 Bacteria 641
587 Ga0373923_0353262 3300035111 Unclassified 702
588 Ga0373923_0616945 3300035111 Unclassified 535
589 Ga0373936_0019200 3300035113 Bacteria 2648
590 Ga0373936_0226308 3300035113 Bacteria 831
591 Ga0373939_0009948 3300035114 Bacteria 2367
592 Ga0373939_0210011 3300035114 Bacteria 740
593 Ga0373941_0005618 3300035115 Bacteria 2965
594 Ga0373945_0224593 3300035116 Bacteria 786
595 Ga0373957_0356394 3300035120 Unclassified 625
596 Ga0373960_0024238 3300035121 Bacteria 1639
597 Ga0373943_0133035 3300035170 Unclassified 1332
598 Ga0373943_0460567 3300035170 Bacteria 740
599 Ga0373946_0010654 3300035171 Bacteria 3409
600 Ga0373946_0550713 3300035171 Bacteria 595
601 Ga0373955_0604163 3300035172 Bacteria 672
602 Ga0373942_0015824 3300035207 Bacteria 1843
603 Ga0373942_0056169 3300035207 Bacteria 1117
604 Ga0373961_0106592 3300035241 Bacteria 913
605 Ga0373962_0065055 3300035242 Bacteria 1078
606 Ga0373931_0001607 3300035691 Bacteria 9780
607 Ga0373931_0075361 3300035691 Bacteria 1850
608 Ga0373931_0096028 3300035691 Bacteria 1660
609 Ga0373931_0211548 3300035691 Bacteria 1163
610 Ga0373931_0464982 3300035691 Bacteria 811
611 Ga0373935_0312352 3300035692 Unclassified 1113
612 Ga0373935_0574461 3300035692 Unclassified 823
613 Ga0373927_0097863 3300035695 Bacteria 1907
614 Ga0373927_0426475 3300035695 Unclassified 875
615 Ga0373927_0436447 3300035695 Bacteria 865
616 Ga0373927_0646816 3300035695 Unclassified 699
617 Ga0373927_0906721 3300035695 Bacteria 582
618 Ga0373947_0175536 3300035725 Bacteria 1392
619 Ga0373947_0194527 3300035725 Unclassified 1324
620 Ga0373937_0412469 3300036401 Unclassified 1282
621 Ga0310109_048745 3300036534 Bacteria 546
622 Ga0373925_0019590 3300037068 Bacteria 4923
623 Ga0373925_0154573 3300037068 Bacteria 1803
624 Ga0373925_0229906 3300037068 Bacteria 1483
625 Ga0373925_0825369 3300037068 Bacteria 764
626 Ga0395899_0092302 3300037312 Bacteria 2193
627 Ga0395900_0412387 3300037418 Bacteria 1313
628 Ga0395900_0520188 3300037418 Unclassified 1138
629 Ga0395905_0889784 3300037471 Unclassified 793
630 Ga0395905_1286755 3300037471 Bacteria 635
631 Ga0395901_0002178 3300038443 Bacteria 19994
632 Ga0395901_0702983 3300038443 Bacteria 1008
633 Ga0466963_0705477 3300044694 Bacteria 712
634 Ga0466957_0026643 3300044842 Bacteria 3431
635 Ga0451576_0022710 3300045051 Bacteria 6796
636 Ga0451576_0287673 3300045051 Bacteria 1718
637 Ga0451576_0492236 3300045051 Bacteria 1288
638 Ga0451576_0800716 3300045051 Bacteria 989
639 Ga0451576_1324134 3300045051 Bacteria 751
640 Ga0466967_2595679 3300045976 Bacteria 501
641 Ga0495603_0063676 3300046455 Bacteria 2175
642 Ga0495603_0764523 3300046455 Archaea 552
643 Ga0495590_0152714 3300046457 Bacteria 837
644 Ga0495591_113339 3300046458 Bacteria 665
645 Ga0495629_0479333 3300046459 Bacteria 840
646 Ga0495629_0597844 3300046459 Bacteria 738
647 Ga0495629_0610729 3300046459 Unclassified 729
648 Ga0495653_0629689 3300046463 Bacteria 657
649 Ga0495580_0124396 3300046472 Bacteria 1790
650 Ga0495580_0248400 3300046472 Bacteria 1218
651 Ga0495580_1052106 3300046472 Unclassified 517
652 Ga0495582_0225425 3300046473 Unclassified 1073
653 Ga0495639_0210291 3300046475 Unclassified 954
654 Ga0495639_0368947 3300046475 Unclassified 722
655 Ga0495594_0531963 3300046499 Archaea 667
656 Ga0495610_0207833 3300046512 Bacteria 798
657 Ga0495618_0392284 3300046514 Bacteria 850
658 Ga0495620_0212425 3300046515 Bacteria 742
659 Ga0495632_0010119 3300046519 Bacteria 5615
660 Ga0495663_0153948 3300046525 Bacteria 786
661 Ga0495666_0305368 3300046526 Unclassified 719
662 Ga0495642_0085475 3300046528 Bacteria 1332
663 Ga0495586_0221304 3300046535 Bacteria 1076
664 Ga0495598_0086816 3300046537 Bacteria 1013
665 Ga0495621_0153139 3300046539 Bacteria 908
666 Ga0495621_0311831 3300046539 Bacteria 654
667 Ga0495597_0178152 3300046542 Bacteria 860
668 Ga0495645_0410919 3300046543 Unclassified 861
669 Ga0495634_0035998 3300046642 Bacteria 3387
670 Ga0495611_0350817 3300046648 Bacteria 677
671 Ga0495635_0308925 3300046663 Unclassified 1060
672 Ga0495647_0033520 3300046681 Bacteria 1920
673 Ga0495658_0008063 3300046683 Bacteria 5216
674 Ga0495658_0069779 3300046683 Bacteria 2037
675 Ga0495658_0547064 3300046683 Unclassified 741
676 Ga0495613_0119076 3300046689 Bacteria 1897
677 Ga0495624_0420262 3300046690 Unclassified 802
678 Ga0495671_0475191 3300046692 Bacteria 597
679 Ga0495649_0000767 3300046694 Bacteria 25825
680 Ga0495660_0069900 3300046810 Bacteria 1865
681 Ga0495674_0360140 3300047319 Bacteria 1179
682 Ga0495674_1076683 3300047319 Unclassified 613
683 Ga0495687_014089 3300047443 Bacteria 4134
684 Ga0495626_0050285 3300048091 Bacteria 1926
685 Ga0496100_1417500 3300048903 Bacteria 548
686 Ga0496101_0370511 3300048904 Unclassified 1126
687 Ga0496101_1146933 3300048904 Bacteria 610
688 Ga0496102_0555631 3300048905 Bacteria 1071
689 Ga0496102_1438399 3300048905 Bacteria 608
690 Ga0496103_0662982 3300048906 Unclassified 662
691 Ga0496103_1057418 3300048906 Bacteria 503
692 Ga0496104_0065053 3300048907 Bacteria 3460
693 Ga0496104_0095935 3300048907 Bacteria 2837
694 Ga0496105_0168693 3300048908 Bacteria 1795
695 Ga0496106_0222897 3300048909 Bacteria 1504
696 Ga0496106_0245626 3300048909 Bacteria 1430
697 Ga0496107_0773014 3300048910 Bacteria 704
698 Ga0496107_1109222 3300048910 Bacteria 571
699 Ga0496108_0029402 3300048911 Bacteria 4550
700 Ga0496108_0324828 3300048911 Bacteria 1341
701 Ga0496108_0996473 3300048911 Bacteria 716
702 Ga0496109_0163088 3300048912 Bacteria 2088
703 Ga0496109_1508694 3300048912 Bacteria 607
704 Ga0496109_1840550 3300048912 Unclassified 538
705 Ga0496110_0206878 3300048913 Bacteria 1784
706 Ga0496110_0466209 3300048913 Bacteria 1151
707 Ga0496111_0936021 3300048914 Bacteria 623
708 Ga0496112_0108698 3300048915 Bacteria 2743
709 Ga0496112_0116953 3300048915 Bacteria 2636
710 Ga0496113_0098483 3300048916 Bacteria 2263
711 Ga0496113_0365210 3300048916 Bacteria 1158
712 Ga0496114_0064970 3300048917 Unclassified 3056
713 Ga0496114_0363306 3300048917 Unclassified 1281
714 Ga0496114_1263445 3300048917 Bacteria 625
715 Ga0496115_0056052 3300048918 Unclassified 3167
716 Ga0496115_0081226 3300048918 Unclassified 2640
717 Ga0496115_0246041 3300048918 Bacteria 1473
718 Ga0496119_0284154 3300048922 Bacteria 821
719 Ga0496122_0148921 3300048925 Bacteria 1448
720 Ga0496123_0121635 3300048926 Bacteria 1467
721 Ga0495678_126007 3300049459 Bacteria 854
722 Ga0501034_0094491 3300049571 Bacteria 2986
723 Ga0501048_0272093 3300049582 Bacteria 1204
724 Ga0501070_0229587 3300049586 Bacteria 1521
725 Ga0501072_1263295 3300049588 Bacteria 573
726 Ga0501073_0007406 3300049589 Bacteria 8158
727 Ga0501080_0094703 3300049742 Bacteria 2773
728 Ga0501044_1120184 3300049823 Bacteria 656
729 nmdc:mga03683_84444_c1 3300050489 Bacteria 1376
730 nmdc:mga03n38_716471_c1 3300050490 Bacteria 578
731 nmdc:mga03n38_878602_c1 3300050490 Bacteria 526
732 nmdc:mga00v17_150773_c1 3300050491 Bacteria 1494
733 nmdc:mga05p37_2222976_c1 3300050507 Unclassified 508
734 nmdc:mga05p37_25428_c1 3300050507 Bacteria 7200
735 nmdc:mga05p37_2836_c1 3300050507 Bacteria 20144
736 nmdc:mga09592_1731629_c1 3300050508 Unclassified 503
737 nmdc:mga09592_20267_c1 3300050508 Bacteria 5466
738 nmdc:mga09592_206267_c1 3300050508 Bacteria 1702
739 nmdc:mga0qj67_234818_c1 3300050509 Bacteria 1488
740 nmdc:mga0qj67_977756_c1 3300050509 Bacteria 665
741 nmdc:mga06r32_1287897_c1 3300050510 Unclassified 675
742 nmdc:mga06r32_64989_c1 3300050510 Bacteria 3518
743 nmdc:mga08y16_465879_c1 3300050511 Bacteria 1287
744 nmdc:mga08y16_494575_c1 3300050511 Bacteria 1243
745 nmdc:mga08y16_5446_c1 3300050511 Bacteria 13305
746 nmdc:mga0n895_105890_c1 3300050512 Bacteria 2825
747 nmdc:mga0n895_564976_c1 3300050512 Bacteria 1142
748 nmdc:mga0rr50_1107364_c1 3300050513 Bacteria 674
749 nmdc:mga08x19_433400_c1 3300050514 Bacteria 924
750 nmdc:mga0a205_411098_c1 3300050515 Bacteria 1216
751 Ga0495601_0188492 3300053077 Bacteria 1348
752 Ga0500578_0081618 3300053086 Bacteria 2056
753 Ga0500646_0097200 3300053090 Bacteria 920
754 Ga0500651_0465321 3300053093 Bacteria 701
755 Ga0500650_0155682 3300053098 Bacteria 1055
756 Ga0500650_0461993 3300053098 Bacteria 543
757 Ga0500650_0492547 3300053098 Unclassified 522
758 Ga0500614_059055 3300053123 Unclassified 1027
759 Ga0500621_290116 3300053126 Bacteria 529
760 Ga0500642_0359989 3300053130 Bacteria 644
761 Ga0500603_003095 3300053150 Bacteria 3591
762 Ga0500616_0087441 3300053153 Unclassified 1551
763 Ga0500638_165053 3300053162 Bacteria 971
764 Ga0500637_0068936 3300053178 Bacteria 2032
765 Ga0501084_1156846 3300054114 Bacteria 649
766 Ga0501082_0461270 3300060353 Bacteria 1110

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026142 Ga0207698_10610024 Ga0207698_106100241 42
2 3300002705 JGI25156J39149_1000376 JGI25156J39149_100037621 49
3 3300002738 JGI25154J39366_1000488 JGI25154J39366_10004887 49
4 3300002741 JGI25157J39369_1000199 JGI25157J39369_100019927 49
5 3300003316 rootH1_10037156 rootH1_100371562 49
6 3300003323 rootH1_10014388 rootH1_100143882 49
7 3300003323 rootH1_10020809 rootH1_100208093 49
8 3300003323 rootH1_10039540 rootH1_100395407 49
9 3300003323 rootH1_10174920 rootH1_1017492010 49
10 3300003323 rootH1_10243980 rootH1_102439809 49
11 3300003752 Ga0055539_1000312 Ga0055539_10003129 49
12 3300003752 Ga0055539_1000659 Ga0055539_10006593 49
13 3300003756 Ga0055533_1000033 Ga0055533_1000033221 49
14 3300003759 Ga0055525_1001535 Ga0055525_10015354 49
15 3300005289 Ga0065704_10793649 Ga0065704_107936492 49
16 3300005295 Ga0065707_10087312 Ga0065707_100873123 49
17 3300005329 Ga0070683_100098687 Ga0070683_1000986874 49
18 3300005329 Ga0070683_100454450 Ga0070683_1004544503 49
19 3300005329 Ga0070683_100741457 Ga0070683_1007414571 49
20 3300005330 Ga0070690_100012931 Ga0070690_1000129316 49
21 3300005330 Ga0070690_100037072 Ga0070690_1000370722 49
22 3300005331 Ga0070670_100042702 Ga0070670_1000427024 49
23 3300005331 Ga0070670_100750172 Ga0070670_1007501722 49
24 3300005331 Ga0070670_101411098 Ga0070670_1014110982 49
25 3300005333 Ga0070677_10122527 Ga0070677_101225272 49
26 3300005334 Ga0068869_100534220 Ga0068869_1005342202 49
27 3300005334 Ga0068869_101242201 Ga0068869_1012422011 49
28 3300005334 Ga0068869_101267466 Ga0068869_1012674662 49
29 3300005334 Ga0068869_101561124 Ga0068869_1015611241 49
30 3300005335 Ga0070666_10010458 Ga0070666_100104584 49
31 3300005336 Ga0070680_100127802 Ga0070680_1001278024 49
32 3300005338 Ga0068868_100108494 Ga0068868_1001084942 49
33 3300005338 Ga0068868_100969875 Ga0068868_1009698752 49
34 3300005339 Ga0070660_100445724 Ga0070660_1004457243 49
35 3300005339 Ga0070660_100632600 Ga0070660_1006326001 49
36 3300005340 Ga0070689_100079004 Ga0070689_1000790042 49
37 3300005341 Ga0070691_10476470 Ga0070691_104764702 49
38 3300005344 Ga0070661_100021587 Ga0070661_1000215874 49
39 3300005354 Ga0070675_100868855 Ga0070675_1008688551 49
40 3300005355 Ga0070671_100005134 Ga0070671_1000051346 49
41 3300005355 Ga0070671_101709104 Ga0070671_1017091041 49
42 3300005356 Ga0070674_100678334 Ga0070674_1006783341 49
43 3300005356 Ga0070674_100767368 Ga0070674_1007673682 49
44 3300005356 Ga0070674_101786869 Ga0070674_1017868692 49
45 3300005364 Ga0070673_100154246 Ga0070673_1001542464 49
46 3300005364 Ga0070673_100350617 Ga0070673_1003506172 49
47 3300005365 Ga0070688_101020111 Ga0070688_1010201112 49
48 3300005367 Ga0070667_100018405 Ga0070667_1000184054 49
49 3300005367 Ga0070667_100365916 Ga0070667_1003659162 49
50 3300005434 Ga0070709_10098408 Ga0070709_100984081 49
51 3300005436 Ga0070713_100427433 Ga0070713_1004274332 49
52 3300005436 Ga0070713_100887561 Ga0070713_1008875612 49
53 3300005438 Ga0070701_10144942 Ga0070701_101449423 49
54 3300005444 Ga0070694_100523279 Ga0070694_1005232792 49
55 3300005455 Ga0070663_100343948 Ga0070663_1003439482 49
56 3300005455 Ga0070663_101024812 Ga0070663_1010248121 49
57 3300005456 Ga0070678_100838132 Ga0070678_1008381322 49
58 3300005456 Ga0070678_101282596 Ga0070678_1012825962 49
59 3300005457 Ga0070662_101186666 Ga0070662_1011866662 49
60 3300005458 Ga0070681_10100377 Ga0070681_101003774 49
61 3300005466 Ga0070685_10042237 Ga0070685_100422373 49
62 3300005471 Ga0070698_101645983 Ga0070698_1016459832 49
63 3300005518 Ga0070699_101090581 Ga0070699_1010905812 49
64 3300005535 Ga0070684_100076468 Ga0070684_1000764682 49
65 3300005535 Ga0070684_100508384 Ga0070684_1005083841 49
66 3300005536 Ga0070697_101147305 Ga0070697_1011473051 49
67 3300005539 Ga0068853_100375901 Ga0068853_1003759011 49
68 3300005543 Ga0070672_100145268 Ga0070672_1001452684 49
69 3300005543 Ga0070672_100683231 Ga0070672_1006832312 49
70 3300005544 Ga0070686_100054036 Ga0070686_1000540362 49
71 3300005544 Ga0070686_100333262 Ga0070686_1003332623 49
72 3300005545 Ga0070695_100847925 Ga0070695_1008479252 49
73 3300005546 Ga0070696_100035272 Ga0070696_1000352724 49
74 3300005547 Ga0070693_100022202 Ga0070693_1000222023 49
75 3300005547 Ga0070693_100091139 Ga0070693_1000911392 49
76 3300005547 Ga0070693_100145648 Ga0070693_1001456482 49
77 3300005548 Ga0070665_100002191 Ga0070665_10000219110 49
78 3300005548 Ga0070665_100008155 Ga0070665_1000081558 49
79 3300005548 Ga0070665_100371530 Ga0070665_1003715302 49
80 3300005549 Ga0070704_100979400 Ga0070704_1009794002 49
81 3300005563 Ga0068855_100074235 Ga0068855_1000742358 49
82 3300005563 Ga0068855_100331510 Ga0068855_1003315103 49
83 3300005564 Ga0070664_100008795 Ga0070664_1000087953 49
84 3300005564 Ga0070664_100120598 Ga0070664_1001205983 49
85 3300005564 Ga0070664_100297286 Ga0070664_1002972863 49
86 3300005577 Ga0068857_100001581 Ga0068857_1000015815 49
87 3300005577 Ga0068857_101212413 Ga0068857_1012124132 49
88 3300005578 Ga0068854_100047175 Ga0068854_1000471751 49
89 3300005578 Ga0068854_100449821 Ga0068854_1004498211 49
90 3300005614 Ga0068856_100001069 Ga0068856_10000106922 49
91 3300005614 Ga0068856_100291434 Ga0068856_1002914342 49
92 3300005614 Ga0068856_100885385 Ga0068856_1008853852 49
93 3300005615 Ga0070702_100026229 Ga0070702_1000262294 49
94 3300005616 Ga0068852_100159346 Ga0068852_1001593463 49
95 3300005617 Ga0068859_100006635 Ga0068859_1000066354 49
96 3300005617 Ga0068859_102077725 Ga0068859_1020777252 49
97 3300005617 Ga0068859_102752483 Ga0068859_1027524831 49
98 3300005618 Ga0068864_100003997 Ga0068864_1000039974 49
99 3300005618 Ga0068864_100128578 Ga0068864_1001285781 49
100 3300005618 Ga0068864_101265186 Ga0068864_1012651861 49
101 3300005718 Ga0068866_10430335 Ga0068866_104303352 49
102 3300005719 Ga0068861_100064223 Ga0068861_1000642232 49
103 3300005719 Ga0068861_100709911 Ga0068861_1007099112 49
104 3300005719 Ga0068861_101641634 Ga0068861_1016416342 49
105 3300005834 Ga0068851_10173382 Ga0068851_101733822 49
106 3300005834 Ga0068851_10178843 Ga0068851_101788433 49
107 3300005840 Ga0068870_10008184 Ga0068870_100081843 49
108 3300005841 Ga0068863_100121249 Ga0068863_1001212493 49
109 3300005841 Ga0068863_100238093 Ga0068863_1002380934 49
110 3300005841 Ga0068863_100352186 Ga0068863_1003521861 49
111 3300005841 Ga0068863_100361801 Ga0068863_1003618011 49
112 3300005842 Ga0068858_100018730 Ga0068858_1000187303 49
113 3300005842 Ga0068858_100549270 Ga0068858_1005492702 49
114 3300005843 Ga0068860_100288293 Ga0068860_1002882932 49
115 3300005843 Ga0068860_100399336 Ga0068860_1003993363 49
116 3300005983 Ga0081540_1314338 Ga0081540_13143381 49
117 3300006048 Ga0075363_100344347 Ga0075363_1003443472 49
118 3300006051 Ga0075364_10122909 Ga0075364_101229093 49
119 3300006173 Ga0070716_100704541 Ga0070716_1007045412 49
120 3300006173 Ga0070716_101840193 Ga0070716_1018401932 49
121 3300006177 Ga0075362_10377651 Ga0075362_103776512 49
122 3300006237 Ga0097621_100018098 Ga0097621_1000180987 49
123 3300006353 Ga0075370_10034887 Ga0075370_100348872 49
124 3300006358 Ga0068871_100074998 Ga0068871_1000749984 49
125 3300006358 Ga0068871_100304365 Ga0068871_1003043652 49
126 3300006844 Ga0075428_100051828 Ga0075428_1000518282 49
127 3300006844 Ga0075428_100317286 Ga0075428_1003172862 49
128 3300006846 Ga0075430_100766684 Ga0075430_1007666842 49
129 3300006847 Ga0075431_100359524 Ga0075431_1003595242 49
130 3300006871 Ga0075434_100125217 Ga0075434_1001252173 49
131 3300006871 Ga0075434_100460740 Ga0075434_1004607401 49
132 3300006871 Ga0075434_101317087 Ga0075434_1013170872 49
133 3300006880 Ga0075429_101455327 Ga0075429_1014553272 49
134 3300006880 Ga0075429_101783568 Ga0075429_1017835682 49
135 3300006881 Ga0068865_100794248 Ga0068865_1007942482 49
136 3300006931 Ga0097620_100006635 Ga0097620_1000066354 49
137 3300006931 Ga0097620_102077897 Ga0097620_1020778972 49
138 3300006931 Ga0097620_102753001 Ga0097620_1027530011 49
139 3300007076 Ga0075435_100397106 Ga0075435_1003971062 49
140 3300007076 Ga0075435_102013796 Ga0075435_1020137962 49
141 3300007788 Ga0099795_10005750 Ga0099795_100057503 49
142 3300009093 Ga0105240_10024844 Ga0105240_100248447 49
143 3300009093 Ga0105240_10088742 Ga0105240_100887424 49
144 3300009094 Ga0111539_10156092 Ga0111539_101560923 49
145 3300009098 Ga0105245_10016905 Ga0105245_100169057 49
146 3300009098 Ga0105245_10032189 Ga0105245_100321893 49
147 3300009098 Ga0105245_10198636 Ga0105245_101986362 49
148 3300009098 Ga0105245_12468450 Ga0105245_124684501 49
149 3300009101 Ga0105247_10006029 Ga0105247_100060299 49
150 3300009148 Ga0105243_10434238 Ga0105243_104342383 49
151 3300009148 Ga0105243_10955059 Ga0105243_109550591 49
152 3300009174 Ga0105241_11341688 Ga0105241_113416882 49
153 3300009176 Ga0105242_10019833 Ga0105242_100198332 49
154 3300009176 Ga0105242_10042982 Ga0105242_100429822 49
155 3300009176 Ga0105242_10641591 Ga0105242_106415912 49
156 3300009176 Ga0105242_13122072 Ga0105242_131220722 49
157 3300009177 Ga0105248_10031622 Ga0105248_100316223 49
158 3300009177 Ga0105248_10758255 Ga0105248_107582552 49
159 3300009545 Ga0105237_11196352 Ga0105237_111963522 49
160 3300009551 Ga0105238_10009832 Ga0105238_100098324 49
161 3300009551 Ga0105238_10272777 Ga0105238_102727771 49
162 3300009551 Ga0105238_10317410 Ga0105238_103174103 49
163 3300009553 Ga0105249_10317194 Ga0105249_103171942 49
164 3300009988 Ga0105035_100653 Ga0105035_1006533 49
165 3300010159 Ga0099796_10004786 Ga0099796_100047865 49
166 3300010375 Ga0105239_10021524 Ga0105239_100215246 49
167 3300010375 Ga0105239_10245376 Ga0105239_102453764 49
168 3300011119 Ga0105246_10000277 Ga0105246_100002775 49
169 3300011119 Ga0105246_10007067 Ga0105246_1000706710 49
170 3300013102 Ga0157371_10805608 Ga0157371_108056081 49
171 3300013102 Ga0157371_11633628 Ga0157371_116336282 49
172 3300013105 Ga0157369_10168044 Ga0157369_101680441 49
173 3300013105 Ga0157369_10455716 Ga0157369_104557162 49
174 3300013296 Ga0157374_10020454 Ga0157374_100204543 49
175 3300013296 Ga0157374_11917478 Ga0157374_119174781 49
176 3300013297 Ga0157378_10626394 Ga0157378_106263942 49
177 3300013297 Ga0157378_10965388 Ga0157378_109653882 49
178 3300013297 Ga0157378_11327365 Ga0157378_113273652 49
179 3300013306 Ga0163162_10011159 Ga0163162_100111598 49
180 3300013306 Ga0163162_11954690 Ga0163162_119546902 49
181 3300013306 Ga0163162_12115502 Ga0163162_121155022 49
182 3300013307 Ga0157372_10418032 Ga0157372_104180321 49
183 3300013308 Ga0157375_10034433 Ga0157375_100344333 49
184 3300013308 Ga0157375_10559189 Ga0157375_105591891 49
185 3300013875 Ga0157515_138793 Ga0157515_1387932 49
186 3300014325 Ga0163163_10019210 Ga0163163_100192107 49
187 3300014325 Ga0163163_10436111 Ga0163163_104361113 49
188 3300014325 Ga0163163_11154742 Ga0163163_111547422 49
189 3300014968 Ga0157379_10089278 Ga0157379_100892783 49
190 3300014968 Ga0157379_10104777 Ga0157379_101047772 49
191 3300014968 Ga0157379_10881527 Ga0157379_108815271 49
192 3300014968 Ga0157379_11117554 Ga0157379_111175542 49
193 3300014968 Ga0157379_11195893 Ga0157379_111958931 49
194 3300014969 Ga0157376_10023467 Ga0157376_100234672 49
195 3300014969 Ga0157376_10562491 Ga0157376_105624911 49
196 3300014969 Ga0157376_10644289 Ga0157376_106442891 49
197 3300014969 Ga0157376_12556270 Ga0157376_125562701 49
198 3300020075 Ga0206349_1455567 Ga0206349_14555672 49
199 3300020078 Ga0206352_10955745 Ga0206352_109557451 49
200 3300020080 Ga0206350_10501895 Ga0206350_105018952 49
201 3300022467 Ga0224712_10470241 Ga0224712_104702411 49
202 3300022467 Ga0224712_10517530 Ga0224712_105175301 49
203 3300025226 Ga0209674_100064 Ga0209674_10006427 49
204 3300025230 Ga0209563_100099 Ga0209563_10009927 49
205 3300025246 Ga0209646_1000060 Ga0209646_1000060218 49
206 3300025250 Ga0209026_1000049 Ga0209026_1000049216 49
207 3300025253 Ga0209677_100253 Ga0209677_10025313 49
208 3300025253 Ga0209677_100469 Ga0209677_10046912 49
209 3300025256 Ga0209759_1000272 Ga0209759_100027247 49
210 3300025256 Ga0209759_1059340 Ga0209759_10593401 49
211 3300025303 Ga0209051_1004411 Ga0209051_10044115 49
212 3300025303 Ga0209051_1006125 Ga0209051_10061255 49
213 3300025321 Ga0207656_10153551 Ga0207656_101535512 49
214 3300025885 Ga0207653_10347876 Ga0207653_103478762 49
215 3300025893 Ga0207682_10439108 Ga0207682_104391082 49
216 3300025898 Ga0207692_11124656 Ga0207692_111246561 49
217 3300025899 Ga0207642_10332143 Ga0207642_103321432 49
218 3300025900 Ga0207710_10013245 Ga0207710_100132452 49
219 3300025903 Ga0207680_10009688 Ga0207680_100096881 49
220 3300025907 Ga0207645_10470805 Ga0207645_104708053 49
221 3300025912 Ga0207707_10314799 Ga0207707_103147992 49
222 3300025913 Ga0207695_10011114 Ga0207695_1001111411 49
223 3300025913 Ga0207695_10077046 Ga0207695_100770463 49
224 3300025915 Ga0207693_10467793 Ga0207693_104677931 49
225 3300025917 Ga0207660_10972769 Ga0207660_109727692 49
226 3300025918 Ga0207662_10199449 Ga0207662_101994493 49
227 3300025918 Ga0207662_10598499 Ga0207662_105984992 49
228 3300025919 Ga0207657_10339426 Ga0207657_103394263 49
229 3300025921 Ga0207652_10205627 Ga0207652_102056274 49
230 3300025924 Ga0207694_10137213 Ga0207694_101372135 49
231 3300025924 Ga0207694_10898249 Ga0207694_108982492 49
232 3300025925 Ga0207650_10009243 Ga0207650_100092432 49
233 3300025925 Ga0207650_10082067 Ga0207650_100820672 49
234 3300025925 Ga0207650_11076722 Ga0207650_110767222 49
235 3300025926 Ga0207659_10633490 Ga0207659_106334902 49
236 3300025926 Ga0207659_10764001 Ga0207659_107640013 49
237 3300025927 Ga0207687_10017744 Ga0207687_100177443 49
238 3300025927 Ga0207687_10357875 Ga0207687_103578753 49
239 3300025927 Ga0207687_11530252 Ga0207687_115302521 49
240 3300025928 Ga0207700_10775053 Ga0207700_107750532 49
241 3300025928 Ga0207700_11058742 Ga0207700_110587422 49
242 3300025931 Ga0207644_10040540 Ga0207644_100405401 49
243 3300025932 Ga0207690_10579789 Ga0207690_105797891 49
244 3300025933 Ga0207706_10100596 Ga0207706_101005964 49
245 3300025933 Ga0207706_10861389 Ga0207706_108613892 49
246 3300025933 Ga0207706_11654995 Ga0207706_116549951 49
247 3300025934 Ga0207686_10653580 Ga0207686_106535802 49
248 3300025934 Ga0207686_10874155 Ga0207686_108741552 49
249 3300025935 Ga0207709_10057388 Ga0207709_100573883 49
250 3300025935 Ga0207709_11104617 Ga0207709_111046172 49
251 3300025937 Ga0207669_10414928 Ga0207669_104149282 49
252 3300025937 Ga0207669_10439651 Ga0207669_104396513 49
253 3300025939 Ga0207665_11165065 Ga0207665_111650651 49
254 3300025940 Ga0207691_10223480 Ga0207691_102234803 49
255 3300025940 Ga0207691_10756065 Ga0207691_107560651 49
256 3300025940 Ga0207691_10980261 Ga0207691_109802612 49
257 3300025941 Ga0207711_10016454 Ga0207711_100164544 49
258 3300025942 Ga0207689_10339469 Ga0207689_103394692 49
259 3300025942 Ga0207689_11265761 Ga0207689_112657612 49
260 3300025942 Ga0207689_11367469 Ga0207689_113674692 49
261 3300025944 Ga0207661_10118183 Ga0207661_101181833 49
262 3300025944 Ga0207661_10264495 Ga0207661_102644951 49
263 3300025945 Ga0207679_10082442 Ga0207679_100824424 49
264 3300025945 Ga0207679_10807423 Ga0207679_108074232 49
265 3300025949 Ga0207667_10060280 Ga0207667_100602803 49
266 3300025949 Ga0207667_10823972 Ga0207667_108239722 49
267 3300025960 Ga0207651_10173306 Ga0207651_101733062 49
268 3300025960 Ga0207651_10414800 Ga0207651_104148001 49
269 3300025960 Ga0207651_10674205 Ga0207651_106742052 49
270 3300025961 Ga0207712_10233697 Ga0207712_102336972 49
271 3300025961 Ga0207712_11657557 Ga0207712_116575572 49
272 3300025981 Ga0207640_10016053 Ga0207640_100160533 49
273 3300025981 Ga0207640_10982809 Ga0207640_109828091 49
274 3300025986 Ga0207658_10157931 Ga0207658_101579312 49
275 3300026023 Ga0207677_10027567 Ga0207677_100275674 49
276 3300026023 Ga0207677_10646874 Ga0207677_106468742 49
277 3300026035 Ga0207703_10097679 Ga0207703_100976792 49
278 3300026067 Ga0207678_10301870 Ga0207678_103018702 49
279 3300026067 Ga0207678_10432906 Ga0207678_104329062 49
280 3300026078 Ga0207702_10000395 Ga0207702_1000039513 49
281 3300026078 Ga0207702_10503337 Ga0207702_105033371 49
282 3300026078 Ga0207702_10770601 Ga0207702_107706012 49
283 3300026088 Ga0207641_10015662 Ga0207641_100156622 49
284 3300026088 Ga0207641_10257838 Ga0207641_102578382 49
285 3300026088 Ga0207641_12560300 Ga0207641_125603001 49
286 3300026095 Ga0207676_10007204 Ga0207676_100072043 49
287 3300026095 Ga0207676_12015997 Ga0207676_120159971 49
288 3300026095 Ga0207676_12193768 Ga0207676_121937682 49
289 3300026116 Ga0207674_10011974 Ga0207674_100119741 49
290 3300026116 Ga0207674_10169401 Ga0207674_101694011 49
291 3300026118 Ga0207675_100009738 Ga0207675_1000097383 49
292 3300026118 Ga0207675_100032021 Ga0207675_1000320215 49
293 3300026118 Ga0207675_100612113 Ga0207675_1006121132 49
294 3300026118 Ga0207675_102106483 Ga0207675_1021064832 49
295 3300026118 Ga0207675_102393153 Ga0207675_1023931531 49
296 3300026121 Ga0207683_10750847 Ga0207683_107508473 49
297 3300026142 Ga0207698_10311825 Ga0207698_103118252 49
298 3300027512 Ga0209179_1001504 Ga0209179_10015044 49
299 3300027907 Ga0207428_10531619 Ga0207428_105316191 49
300 3300028379 Ga0268266_10000808 Ga0268266_1000080820 49
301 3300028379 Ga0268266_10169068 Ga0268266_101690682 49
302 3300028379 Ga0268266_10436893 Ga0268266_104368931 49
303 3300028381 Ga0268264_10237783 Ga0268264_102377834 49
304 3300028381 Ga0268264_10488912 Ga0268264_104889121 49
305 3300028666 Ga0265336_10002580 Ga0265336_100025806 49
306 3300028800 Ga0265338_10023488 Ga0265338_100234883 49
307 3300030522 Ga0307512_10464740 Ga0307512_104647402 49
308 3300031238 Ga0265332_10077008 Ga0265332_100770083 49
309 3300031238 Ga0265332_10254171 Ga0265332_102541711 49
310 3300031239 Ga0265328_10000640 Ga0265328_100006408 49
311 3300031240 Ga0265320_10001511 Ga0265320_100015117 49
312 3300031240 Ga0265320_10026887 Ga0265320_100268873 49
313 3300031241 Ga0265325_10083101 Ga0265325_100831012 49
314 3300031242 Ga0265329_10055164 Ga0265329_100551642 49
315 3300031249 Ga0265339_10028033 Ga0265339_100280332 49
316 3300031249 Ga0265339_10148516 Ga0265339_101485163 49
317 3300031249 Ga0265339_10409900 Ga0265339_104099002 49
318 3300031250 Ga0265331_10077555 Ga0265331_100775552 49
319 3300031250 Ga0265331_10532620 Ga0265331_105326202 49
320 3300031507 Ga0307509_10209315 Ga0307509_102093152 49
321 3300031711 Ga0265314_10004255 Ga0265314_100042552 49
322 3300031711 Ga0265314_10041451 Ga0265314_100414512 49
323 3300031712 Ga0265342_10000136 Ga0265342_1000013664 49
324 3300031712 Ga0265342_10028108 Ga0265342_100281084 49
325 3300033180 Ga0307510_10077392 Ga0307510_100773924 49
326 3300033180 Ga0307510_10205875 Ga0307510_102058752 49
327 3300035084 Ga0373928_0074017 Ga0373928_0074017_391_540 49
328 3300035086 Ga0373934_0207549 Ga0373934_0207549_159_308 49
329 3300035088 Ga0373940_0283094 Ga0373940_0283094_242_400 49
330 3300035089 Ga0373944_0164194 Ga0373944_0164194_135_284 49
331 3300035090 Ga0373949_0091353 Ga0373949_0091353_484_633 49
332 3300035092 Ga0373952_0157757 Ga0373952_0157757_259_408 49
333 3300035111 Ga0373923_0616945 Ga0373923_0616945_305_454 49
334 3300035113 Ga0373936_0226308 Ga0373936_0226308_217_366 49
335 3300035114 Ga0373939_0210011 Ga0373939_0210011_176_334 49
336 3300035120 Ga0373957_0356394 Ga0373957_0356394_297_446 49
337 3300035170 Ga0373943_0460567 Ga0373943_0460567_491_640 49
338 3300035172 Ga0373955_0604163 Ga0373955_0604163_423_572 49
339 3300035691 Ga0373931_0075361 Ga0373931_0075361_206_355 49
340 3300035691 Ga0373931_0464982 Ga0373931_0464982_186_344 49
341 3300035692 Ga0373935_0574461 Ga0373935_0574461_158_307 49
342 3300035695 Ga0373927_0436447 Ga0373927_0436447_654_803 49
343 3300035695 Ga0373927_0646816 Ga0373927_0646816_51_200 49
344 3300035695 Ga0373927_0906721 Ga0373927_0906721_103_252 49
345 3300036401 Ga0373937_0412469 Ga0373937_0412469_350_499 49
346 3300036534 Ga0310109_048745 Ga0310109_048745_93_242 49
347 3300037068 Ga0373925_0229906 Ga0373925_0229906_160_309 49
348 3300037312 Ga0395899_0092302 Ga0395899_0092302_1570_1719 49
349 3300037418 Ga0395900_0412387 Ga0395900_0412387_777_926 49
350 3300037471 Ga0395905_1286755 Ga0395905_1286755_472_621 49
351 3300038443 Ga0395901_0002178 Ga0395901_0002178_683_832 49
352 3300044694 Ga0466963_0705477 Ga0466963_0705477_188_337 49
353 3300044842 Ga0466957_0026643 Ga0466957_0026643_900_1049 49
354 3300045051 Ga0451576_0287673 Ga0451576_0287673_1159_1317 49
355 3300045051 Ga0451576_0492236 Ga0451576_0492236_485_634 49
356 3300045976 Ga0466967_2595679 Ga0466967_2595679_193_342 49
357 3300046455 Ga0495603_0063676 Ga0495603_0063676_616_765 49
358 3300046455 Ga0495603_0764523 Ga0495603_0764523_132_281 49
359 3300046457 Ga0495590_0152714 Ga0495590_0152714_549_698 49
360 3300046459 Ga0495629_0479333 Ga0495629_0479333_231_380 49
361 3300046459 Ga0495629_0597844 Ga0495629_0597844_119_268 49
362 3300046459 Ga0495629_0610729 Ga0495629_0610729_431_580 49
363 3300046463 Ga0495653_0629689 Ga0495653_0629689_496_645 49
364 3300046472 Ga0495580_0124396 Ga0495580_0124396_1365_1514 49
365 3300046472 Ga0495580_1052106 Ga0495580_1052106_104_253 49
366 3300046473 Ga0495582_0225425 Ga0495582_0225425_642_791 49
367 3300046475 Ga0495639_0210291 Ga0495639_0210291_568_717 49
368 3300046475 Ga0495639_0368947 Ga0495639_0368947_376_525 49
369 3300046499 Ga0495594_0531963 Ga0495594_0531963_313_462 49
370 3300046512 Ga0495610_0207833 Ga0495610_0207833_323_472 49
371 3300046514 Ga0495618_0392284 Ga0495618_0392284_102_251 49
372 3300046515 Ga0495620_0212425 Ga0495620_0212425_530_679 49
373 3300046519 Ga0495632_0010119 Ga0495632_0010119_2907_3056 49
374 3300046535 Ga0495586_0221304 Ga0495586_0221304_578_727 49
375 3300046542 Ga0495597_0178152 Ga0495597_0178152_179_328 49
376 3300046543 Ga0495645_0410919 Ga0495645_0410919_223_372 49
377 3300046642 Ga0495634_0035998 Ga0495634_0035998_2328_2477 49
378 3300046648 Ga0495611_0350817 Ga0495611_0350817_38_187 49
379 3300046663 Ga0495635_0308925 Ga0495635_0308925_99_248 49
380 3300046681 Ga0495647_0033520 Ga0495647_0033520_58_207 49
381 3300046683 Ga0495658_0069779 Ga0495658_0069779_1168_1317 49
382 3300046683 Ga0495658_0547064 Ga0495658_0547064_549_698 49
383 3300046689 Ga0495613_0119076 Ga0495613_0119076_1631_1780 49
384 3300046690 Ga0495624_0420262 Ga0495624_0420262_241_390 49
385 3300046692 Ga0495671_0475191 Ga0495671_0475191_422_571 49
386 3300046694 Ga0495649_0000767 Ga0495649_0000767_1673_1822 49
387 3300046810 Ga0495660_0069900 Ga0495660_0069900_1531_1680 49
388 3300047319 Ga0495674_0360140 Ga0495674_0360140_10_159 49
389 3300047319 Ga0495674_1076683 Ga0495674_1076683_431_580 49
390 3300047443 Ga0495687_014089 Ga0495687_014089_1279_1428 49
391 3300048091 Ga0495626_0050285 Ga0495626_0050285_1641_1790 49
392 3300048903 Ga0496100_1417500 Ga0496100_1417500_357_506 49
393 3300048904 Ga0496101_0370511 Ga0496101_0370511_497_646 49
394 3300048905 Ga0496102_0555631 Ga0496102_0555631_670_819 49
395 3300048907 Ga0496104_0095935 Ga0496104_0095935_1233_1382 49
396 3300048909 Ga0496106_0222897 Ga0496106_0222897_230_379 49
397 3300048909 Ga0496106_0245626 Ga0496106_0245626_1221_1370 49
398 3300048910 Ga0496107_0773014 Ga0496107_0773014_516_665 49
399 3300048910 Ga0496107_1109222 Ga0496107_1109222_31_180 49
400 3300048911 Ga0496108_0324828 Ga0496108_0324828_730_879 49
401 3300048912 Ga0496109_0163088 Ga0496109_0163088_870_1019 49
402 3300048912 Ga0496109_1840550 Ga0496109_1840550_69_218 49
403 3300048913 Ga0496110_0466209 Ga0496110_0466209_626_775 49
404 3300048915 Ga0496112_0116953 Ga0496112_0116953_2294_2443 49
405 3300048916 Ga0496113_0098483 Ga0496113_0098483_88_237 49
406 3300048917 Ga0496114_0064970 Ga0496114_0064970_254_403 49
407 3300048917 Ga0496114_1263445 Ga0496114_1263445_419_568 49
408 3300048918 Ga0496115_0056052 Ga0496115_0056052_1027_1176 49
409 3300048918 Ga0496115_0081226 Ga0496115_0081226_207_356 49
410 3300048918 Ga0496115_0246041 Ga0496115_0246041_590_739 49
411 3300048922 Ga0496119_0284154 Ga0496119_0284154_457_606 49
412 3300048925 Ga0496122_0148921 Ga0496122_0148921_639_788 49
413 3300048926 Ga0496123_0121635 Ga0496123_0121635_320_469 49
414 3300049459 Ga0495678_126007 Ga0495678_126007_274_423 49
415 3300049588 Ga0501072_1263295 Ga0501072_1263295_191_340 49
416 3300049823 Ga0501044_1120184 Ga0501044_1120184_279_428 49
417 3300050489 nmdc:mga03683_84444_c1 nmdc:mga03683_84444_c1_688_837 49
418 3300050490 nmdc:mga03n38_716471_c1 nmdc:mga03n38_716471_c1_74_223 49
419 3300050490 nmdc:mga03n38_878602_c1 nmdc:mga03n38_878602_c1_278_451 49
420 3300050491 nmdc:mga00v17_150773_c1 nmdc:mga00v17_150773_c1_297_446 49
421 3300050509 nmdc:mga0qj67_234818_c1 nmdc:mga0qj67_234818_c1_579_728 49
422 3300050510 nmdc:mga06r32_1287897_c1 nmdc:mga06r32_1287897_c1_461_610 49
423 3300050511 nmdc:mga08y16_465879_c1 nmdc:mga08y16_465879_c1_493_642 49
424 3300050512 nmdc:mga0n895_105890_c1 nmdc:mga0n895_105890_c1_142_291 49
425 3300053077 Ga0495601_0188492 Ga0495601_0188492_31_180 49
426 3300053086 Ga0500578_0081618 Ga0500578_0081618_253_402 49
427 3300053090 Ga0500646_0097200 Ga0500646_0097200_561_710 49
428 3300053093 Ga0500651_0465321 Ga0500651_0465321_354_503 49
429 3300053098 Ga0500650_0155682 Ga0500650_0155682_232_381 49
430 3300053098 Ga0500650_0461993 Ga0500650_0461993_169_318 49
431 3300053123 Ga0500614_059055 Ga0500614_059055_606_755 49
432 3300053126 Ga0500621_290116 Ga0500621_290116_265_414 49
433 3300053130 Ga0500642_0359989 Ga0500642_0359989_217_366 49
434 3300053150 Ga0500603_003095 Ga0500603_003095_2639_2788 49
435 3300053162 Ga0500638_165053 Ga0500638_165053_42_191 49
436 3300053178 Ga0500637_0068936 Ga0500637_0068936_1250_1399 49
437 3300060353 Ga0501082_0461270 Ga0501082_0461270_813_962 49
438 2162886006 SwRhRL3b_contig_1291068 SwRhRL3b_0647.00001160 50
439 3300000531 CNBas_1000908 CNBas_10009081 50
440 3300005330 Ga0070690_100016783 Ga0070690_1000167836 50
441 3300005330 Ga0070690_100758269 Ga0070690_1007582693 50
442 3300005331 Ga0070670_100115598 Ga0070670_1001155983 50
443 3300005331 Ga0070670_100308670 Ga0070670_1003086702 50
444 3300005334 Ga0068869_100643224 Ga0068869_1006432242 50
445 3300005334 Ga0068869_100788966 Ga0068869_1007889662 50
446 3300005335 Ga0070666_10156316 Ga0070666_101563162 50
447 3300005338 Ga0068868_101014780 Ga0068868_1010147801 50
448 3300005340 Ga0070689_100052468 Ga0070689_1000524681 50
449 3300005340 Ga0070689_100617293 Ga0070689_1006172932 50
450 3300005341 Ga0070691_10070822 Ga0070691_100708222 50
451 3300005343 Ga0070687_100235321 Ga0070687_1002353213 50
452 3300005344 Ga0070661_100487964 Ga0070661_1004879642 50
453 3300005353 Ga0070669_100255557 Ga0070669_1002555572 50
454 3300005353 Ga0070669_100533868 Ga0070669_1005338682 50
455 3300005354 Ga0070675_100181617 Ga0070675_1001816173 50
456 3300005354 Ga0070675_100317263 Ga0070675_1003172632 50
457 3300005356 Ga0070674_100303386 Ga0070674_1003033863 50
458 3300005365 Ga0070688_100084307 Ga0070688_1000843073 50
459 3300005367 Ga0070667_100076221 Ga0070667_1000762213 50
460 3300005367 Ga0070667_101720809 Ga0070667_1017208091 50
461 3300005406 Ga0070703_10423898 Ga0070703_104238982 50
462 3300005434 Ga0070709_10254684 Ga0070709_102546842 50
463 3300005434 Ga0070709_11458253 Ga0070709_114582532 50
464 3300005438 Ga0070701_10000224 Ga0070701_1000022419 50
465 3300005438 Ga0070701_10070516 Ga0070701_100705163 50
466 3300005438 Ga0070701_10432605 Ga0070701_104326052 50
467 3300005439 Ga0070711_100886887 Ga0070711_1008868872 50
468 3300005440 Ga0070705_100971525 Ga0070705_1009715251 50
469 3300005441 Ga0070700_100013454 Ga0070700_1000134542 50
470 3300005456 Ga0070678_100069355 Ga0070678_1000693553 50
471 3300005456 Ga0070678_100402741 Ga0070678_1004027411 50
472 3300005456 Ga0070678_100594055 Ga0070678_1005940552 50
473 3300005457 Ga0070662_101048876 Ga0070662_1010488762 50
474 3300005459 Ga0068867_100176559 Ga0068867_1001765593 50
475 3300005459 Ga0068867_100511371 Ga0068867_1005113712 50
476 3300005466 Ga0070685_10667764 Ga0070685_106677642 50
477 3300005467 Ga0070706_100546096 Ga0070706_1005460961 50
478 3300005530 Ga0070679_101437343 Ga0070679_1014373432 50
479 3300005536 Ga0070697_100500657 Ga0070697_1005006573 50
480 3300005543 Ga0070672_100103961 Ga0070672_1001039615 50
481 3300005543 Ga0070672_100209171 Ga0070672_1002091713 50
482 3300005543 Ga0070672_100426687 Ga0070672_1004266872 50
483 3300005545 Ga0070695_100000207 Ga0070695_10000020712 50
484 3300005545 Ga0070695_100227998 Ga0070695_1002279982 50
485 3300005546 Ga0070696_100000958 Ga0070696_1000009582 50
486 3300005548 Ga0070665_101630736 Ga0070665_1016307362 50
487 3300005563 Ga0068855_100724255 Ga0068855_1007242552 50
488 3300005564 Ga0070664_100527352 Ga0070664_1005273522 50
489 3300005615 Ga0070702_100287372 Ga0070702_1002873722 50
490 3300005615 Ga0070702_100587302 Ga0070702_1005873022 50
491 3300005616 Ga0068852_101272840 Ga0068852_1012728402 50
492 3300005617 Ga0068859_100042745 Ga0068859_1000427457 50
493 3300005617 Ga0068859_100793842 Ga0068859_1007938423 50
494 3300005618 Ga0068864_100054444 Ga0068864_1000544445 50
495 3300005618 Ga0068864_100076085 Ga0068864_1000760852 50
496 3300005618 Ga0068864_100337885 Ga0068864_1003378852 50
497 3300005718 Ga0068866_10000950 Ga0068866_1000095013 50
498 3300005718 Ga0068866_10040043 Ga0068866_100400432 50
499 3300005719 Ga0068861_100171921 Ga0068861_1001719213 50
500 3300005840 Ga0068870_10549094 Ga0068870_105490942 50
501 3300005841 Ga0068863_100026788 Ga0068863_1000267885 50
502 3300005841 Ga0068863_100297975 Ga0068863_1002979752 50
503 3300005841 Ga0068863_100445754 Ga0068863_1004457541 50
504 3300005842 Ga0068858_100045414 Ga0068858_1000454145 50
505 3300005843 Ga0068860_100106666 Ga0068860_1001066662 50
506 3300005843 Ga0068860_100573807 Ga0068860_1005738073 50
507 3300005844 Ga0068862_100014905 Ga0068862_1000149057 50
508 3300006028 Ga0070717_11631897 Ga0070717_116318972 50
509 3300006237 Ga0097621_100198062 Ga0097621_1001980623 50
510 3300006237 Ga0097621_102373466 Ga0097621_1023734661 50
511 3300006358 Ga0068871_100039244 Ga0068871_1000392444 50
512 3300006358 Ga0068871_102147308 Ga0068871_1021473082 50
513 3300006844 Ga0075428_100005195 Ga0075428_1000051954 50
514 3300006844 Ga0075428_100325599 Ga0075428_1003255992 50
515 3300006846 Ga0075430_101368850 Ga0075430_1013688502 50
516 3300006847 Ga0075431_102036922 Ga0075431_1020369222 50
517 3300006852 Ga0075433_10248315 Ga0075433_102483152 50
518 3300006852 Ga0075433_10667477 Ga0075433_106674772 50
519 3300006871 Ga0075434_100261417 Ga0075434_1002614174 50
520 3300006871 Ga0075434_102050655 Ga0075434_1020506551 50
521 3300006880 Ga0075429_100000103 Ga0075429_10000010329 50
522 3300006880 Ga0075429_101336131 Ga0075429_1013361312 50
523 3300006881 Ga0068865_100000447 Ga0068865_10000044715 50
524 3300006881 Ga0068865_100034173 Ga0068865_1000341731 50
525 3300006881 Ga0068865_102160080 Ga0068865_1021600802 50
526 3300006931 Ga0097620_100042744 Ga0097620_1000427442 50
527 3300006931 Ga0097620_100793875 Ga0097620_1007938753 50
528 3300007076 Ga0075435_100159920 Ga0075435_1001599204 50
529 3300007076 Ga0075435_101378832 Ga0075435_1013788322 50
530 3300009011 Ga0105251_10445248 Ga0105251_104452481 50
531 3300009093 Ga0105240_10267903 Ga0105240_102679033 50
532 3300009093 Ga0105240_11354289 Ga0105240_113542892 50
533 3300009094 Ga0111539_10049570 Ga0111539_100495704 50
534 3300009094 Ga0111539_11805659 Ga0111539_118056592 50
535 3300009098 Ga0105245_10004425 Ga0105245_100044255 50
536 3300009098 Ga0105245_10025899 Ga0105245_100258992 50
537 3300009098 Ga0105245_10651099 Ga0105245_106510992 50
538 3300009147 Ga0114129_10001184 Ga0114129_1000118417 50
539 3300009147 Ga0114129_10082380 Ga0114129_100823802 50
540 3300009148 Ga0105243_10003720 Ga0105243_1000372012 50
541 3300009148 Ga0105243_10369812 Ga0105243_103698122 50
542 3300009174 Ga0105241_10013741 Ga0105241_100137417 50
543 3300009174 Ga0105241_10672307 Ga0105241_106723073 50
544 3300009176 Ga0105242_10003302 Ga0105242_1000330212 50
545 3300009176 Ga0105242_10042075 Ga0105242_100420753 50
546 3300009176 Ga0105242_10169989 Ga0105242_101699892 50
547 3300009177 Ga0105248_10001702 Ga0105248_1000170223 50
548 3300009177 Ga0105248_10270660 Ga0105248_102706602 50
549 3300009177 Ga0105248_11038997 Ga0105248_110389972 50
550 3300009177 Ga0105248_11199894 Ga0105248_111998942 50
551 3300009553 Ga0105249_10000917 Ga0105249_1000091731 50
552 3300009553 Ga0105249_10087083 Ga0105249_100870832 50
553 3300009553 Ga0105249_10636704 Ga0105249_106367042 50
554 3300009553 Ga0105249_11455869 Ga0105249_114558693 50
555 3300010375 Ga0105239_10008582 Ga0105239_1000858212 50
556 3300010375 Ga0105239_12476551 Ga0105239_124765512 50
557 3300011119 Ga0105246_10576291 Ga0105246_105762911 50
558 3300011119 Ga0105246_11758534 Ga0105246_117585342 50
559 3300013296 Ga0157374_10242013 Ga0157374_102420133 50
560 3300013297 Ga0157378_10004581 Ga0157378_1000458112 50
561 3300013297 Ga0157378_10037143 Ga0157378_100371432 50
562 3300013297 Ga0157378_12033908 Ga0157378_120339081 50
563 3300013306 Ga0163162_10207068 Ga0163162_102070683 50
564 3300013306 Ga0163162_10280467 Ga0163162_102804673 50
565 3300013306 Ga0163162_10302154 Ga0163162_103021542 50
566 3300013306 Ga0163162_10869008 Ga0163162_108690082 50
567 3300013307 Ga0157372_11160790 Ga0157372_111607902 50
568 3300013308 Ga0157375_10397427 Ga0157375_103974272 50
569 3300013308 Ga0157375_10678674 Ga0157375_106786743 50
570 3300013308 Ga0157375_11455364 Ga0157375_114553642 50
571 3300014325 Ga0163163_10097357 Ga0163163_100973572 50
572 3300014325 Ga0163163_12352574 Ga0163163_123525741 50
573 3300014326 Ga0157380_10017894 Ga0157380_100178943 50
574 3300014326 Ga0157380_10138310 Ga0157380_101383103 50
575 3300014326 Ga0157380_10898826 Ga0157380_108988262 50
576 3300014745 Ga0157377_10673086 Ga0157377_106730862 50
577 3300014968 Ga0157379_10126181 Ga0157379_101261811 50
578 3300014968 Ga0157379_10162033 Ga0157379_101620332 50
579 3300014968 Ga0157379_10436452 Ga0157379_104364522 50
580 3300014969 Ga0157376_10004392 Ga0157376_1000439212 50
581 3300014969 Ga0157376_10012986 Ga0157376_100129861 50
582 3300017792 Ga0163161_10127479 Ga0163161_101274791 50
583 3300025271 Ga0207666_1054748 Ga0207666_10547481 50
584 3300025315 Ga0207697_10006511 Ga0207697_100065116 50
585 3300025885 Ga0207653_10004063 Ga0207653_100040636 50
586 3300025899 Ga0207642_10001134 Ga0207642_100011348 50
587 3300025901 Ga0207688_10090865 Ga0207688_100908652 50
588 3300025901 Ga0207688_10442548 Ga0207688_104425481 50
589 3300025903 Ga0207680_10030488 Ga0207680_100304884 50
590 3300025903 Ga0207680_10190943 Ga0207680_101909432 50
591 3300025903 Ga0207680_10643521 Ga0207680_106435213 50
592 3300025906 Ga0207699_10467179 Ga0207699_104671791 50
593 3300025906 Ga0207699_11442702 Ga0207699_114427022 50
594 3300025907 Ga0207645_10027314 Ga0207645_100273145 50
595 3300025908 Ga0207643_10034561 Ga0207643_100345614 50
596 3300025908 Ga0207643_10108138 Ga0207643_101081382 50
597 3300025911 Ga0207654_10013963 Ga0207654_100139632 50
598 3300025913 Ga0207695_10311931 Ga0207695_103119312 50
599 3300025917 Ga0207660_10008341 Ga0207660_100083412 50
600 3300025918 Ga0207662_10000215 Ga0207662_1000021518 50
601 3300025918 Ga0207662_10015862 Ga0207662_100158621 50
602 3300025920 Ga0207649_10933594 Ga0207649_109335941 50
603 3300025921 Ga0207652_10058107 Ga0207652_100581071 50
604 3300025923 Ga0207681_10413495 Ga0207681_104134952 50
605 3300025923 Ga0207681_11166189 Ga0207681_111661892 50
606 3300025925 Ga0207650_10009343 Ga0207650_100093435 50
607 3300025926 Ga0207659_10305219 Ga0207659_103052192 50
608 3300025926 Ga0207659_11648940 Ga0207659_116489402 50
609 3300025927 Ga0207687_10001049 Ga0207687_1000104918 50
610 3300025927 Ga0207687_10039884 Ga0207687_100398842 50
611 3300025931 Ga0207644_10044810 Ga0207644_100448103 50
612 3300025931 Ga0207644_10047149 Ga0207644_100471493 50
613 3300025931 Ga0207644_10425140 Ga0207644_104251402 50
614 3300025933 Ga0207706_10052009 Ga0207706_100520092 50
615 3300025934 Ga0207686_10002720 Ga0207686_100027208 50
616 3300025934 Ga0207686_10030105 Ga0207686_100301052 50
617 3300025935 Ga0207709_10003890 Ga0207709_100038906 50
618 3300025935 Ga0207709_10094705 Ga0207709_100947053 50
619 3300025935 Ga0207709_10311331 Ga0207709_103113313 50
620 3300025936 Ga0207670_10002408 Ga0207670_100024085 50
621 3300025936 Ga0207670_10615099 Ga0207670_106150992 50
622 3300025938 Ga0207704_10001044 Ga0207704_1000104412 50
623 3300025938 Ga0207704_10029962 Ga0207704_100299624 50
624 3300025940 Ga0207691_10143872 Ga0207691_101438723 50
625 3300025940 Ga0207691_10144385 Ga0207691_101443852 50
626 3300025940 Ga0207691_10465546 Ga0207691_104655462 50
627 3300025941 Ga0207711_10083677 Ga0207711_100836773 50
628 3300025941 Ga0207711_10499001 Ga0207711_104990011 50
629 3300025941 Ga0207711_11069651 Ga0207711_110696512 50
630 3300025942 Ga0207689_10000007 Ga0207689_1000000724 50
631 3300025942 Ga0207689_10008236 Ga0207689_100082366 50
632 3300025945 Ga0207679_10587265 Ga0207679_105872652 50
633 3300025949 Ga0207667_10012993 Ga0207667_100129938 50
634 3300025949 Ga0207667_11233703 Ga0207667_112337032 50
635 3300025960 Ga0207651_10009087 Ga0207651_100090873 50
636 3300025960 Ga0207651_10197137 Ga0207651_101971372 50
637 3300025961 Ga0207712_10032651 Ga0207712_100326516 50
638 3300025961 Ga0207712_10741936 Ga0207712_107419361 50
639 3300025961 Ga0207712_10958383 Ga0207712_109583832 50
640 3300025961 Ga0207712_12020673 Ga0207712_120206731 50
641 3300025972 Ga0207668_11426800 Ga0207668_114268002 50
642 3300025981 Ga0207640_10010129 Ga0207640_100101297 50
643 3300026023 Ga0207677_10002194 Ga0207677_100021949 50
644 3300026023 Ga0207677_10986842 Ga0207677_109868422 50
645 3300026035 Ga0207703_10004921 Ga0207703_100049217 50
646 3300026035 Ga0207703_10339003 Ga0207703_103390032 50
647 3300026035 Ga0207703_11805899 Ga0207703_118058992 50
648 3300026041 Ga0207639_10029407 Ga0207639_100294072 50
649 3300026075 Ga0207708_10001220 Ga0207708_100012206 50
650 3300026075 Ga0207708_10002375 Ga0207708_1000237512 50
651 3300026075 Ga0207708_10006335 Ga0207708_100063353 50
652 3300026078 Ga0207702_11127755 Ga0207702_111277552 50
653 3300026088 Ga0207641_10149261 Ga0207641_101492613 50
654 3300026088 Ga0207641_10249782 Ga0207641_102497823 50
655 3300026088 Ga0207641_10335859 Ga0207641_103358593 50
656 3300026088 Ga0207641_10412223 Ga0207641_104122232 50
657 3300026088 Ga0207641_11372390 Ga0207641_113723902 50
658 3300026089 Ga0207648_10000135 Ga0207648_1000013567 50
659 3300026089 Ga0207648_10006030 Ga0207648_100060305 50
660 3300026095 Ga0207676_10029815 Ga0207676_100298155 50
661 3300026095 Ga0207676_10063599 Ga0207676_100635992 50
662 3300026095 Ga0207676_10485683 Ga0207676_104856832 50
663 3300026116 Ga0207674_10992626 Ga0207674_109926262 50
664 3300026118 Ga0207675_100000825 Ga0207675_1000008257 50
665 3300026118 Ga0207675_100028360 Ga0207675_1000283605 50
666 3300026118 Ga0207675_100031263 Ga0207675_1000312634 50
667 3300026121 Ga0207683_10015743 Ga0207683_100157437 50
668 3300026121 Ga0207683_10400751 Ga0207683_104007512 50
669 3300026121 Ga0207683_10841291 Ga0207683_108412911 50
670 3300026121 Ga0207683_10900203 Ga0207683_109002032 50
671 3300026142 Ga0207698_10128807 Ga0207698_101288074 50
672 3300027907 Ga0207428_10000265 Ga0207428_1000026543 50
673 3300028379 Ga0268266_10850716 Ga0268266_108507162 50
674 3300028380 Ga0268265_10003652 Ga0268265_100036527 50
675 3300028381 Ga0268264_10042993 Ga0268264_100429934 50
676 3300028381 Ga0268264_10323441 Ga0268264_103234413 50
677 3300028381 Ga0268264_10791071 Ga0268264_107910711 50
678 3300028381 Ga0268264_11663475 Ga0268264_116634752 50
679 3300031344 Ga0265316_11018615 Ga0265316_110186151 50
680 3300034816 Ga0373930_0064337 Ga0373930_0064337_160_315 50
681 3300034817 Ga0373948_0007910 Ga0373948_0007910_189_344 50
682 3300034818 Ga0373950_0012776 Ga0373950_0012776_747_902 50
683 3300034819 Ga0373958_0013783 Ga0373958_0013783_148_303 50
684 3300034957 Ga0373938_0022610 Ga0373938_0022610_963_1118 50
685 3300035083 Ga0373926_0162274 Ga0373926_0162274_134_286 50
686 3300035084 Ga0373928_0025020 Ga0373928_0025020_1002_1157 50
687 3300035084 Ga0373928_0272939 Ga0373928_0272939_78_233 50
688 3300035085 Ga0373929_0009977 Ga0373929_0009977_756_911 50
689 3300035090 Ga0373949_0025002 Ga0373949_0025002_240_395 50
690 3300035091 Ga0373951_0016205 Ga0373951_0016205_327_482 50
691 3300035092 Ga0373952_0032093 Ga0373952_0032093_104_259 50
692 3300035111 Ga0373923_0353262 Ga0373923_0353262_64_216 50
693 3300035113 Ga0373936_0019200 Ga0373936_0019200_1672_1824 50
694 3300035114 Ga0373939_0009948 Ga0373939_0009948_1097_1252 50
695 3300035115 Ga0373941_0005618 Ga0373941_0005618_833_988 50
696 3300035116 Ga0373945_0224593 Ga0373945_0224593_411_566 50
697 3300035121 Ga0373960_0024238 Ga0373960_0024238_580_735 50
698 3300035170 Ga0373943_0133035 Ga0373943_0133035_480_632 50
699 3300035171 Ga0373946_0010654 Ga0373946_0010654_553_705 50
700 3300035171 Ga0373946_0550713 Ga0373946_0550713_19_174 50
701 3300035207 Ga0373942_0015824 Ga0373942_0015824_1220_1375 50
702 3300035207 Ga0373942_0056169 Ga0373942_0056169_552_707 50
703 3300035241 Ga0373961_0106592 Ga0373961_0106592_261_416 50
704 3300035242 Ga0373962_0065055 Ga0373962_0065055_246_401 50
705 3300035691 Ga0373931_0001607 Ga0373931_0001607_696_851 50
706 3300035691 Ga0373931_0096028 Ga0373931_0096028_1055_1210 50
707 3300035691 Ga0373931_0211548 Ga0373931_0211548_809_961 50
708 3300035692 Ga0373935_0312352 Ga0373935_0312352_295_447 50
709 3300035695 Ga0373927_0097863 Ga0373927_0097863_1679_1834 50
710 3300035695 Ga0373927_0426475 Ga0373927_0426475_156_308 50
711 3300035725 Ga0373947_0175536 Ga0373947_0175536_1070_1225 50
712 3300035725 Ga0373947_0194527 Ga0373947_0194527_457_609 50
713 3300037068 Ga0373925_0019590 Ga0373925_0019590_4522_4677 50
714 3300037068 Ga0373925_0154573 Ga0373925_0154573_456_608 50
715 3300037068 Ga0373925_0825369 Ga0373925_0825369_17_178 50
716 3300037418 Ga0395900_0520188 Ga0395900_0520188_577_729 50
717 3300037471 Ga0395905_0889784 Ga0395905_0889784_609_761 50
718 3300038443 Ga0395901_0702983 Ga0395901_0702983_258_410 50
719 3300045051 Ga0451576_0022710 Ga0451576_0022710_4543_4698 50
720 3300045051 Ga0451576_0800716 Ga0451576_0800716_325_480 50
721 3300045051 Ga0451576_1324134 Ga0451576_1324134_257_409 50
722 3300046458 Ga0495591_113339 Ga0495591_113339_373_525 50
723 3300046472 Ga0495580_0248400 Ga0495580_0248400_57_212 50
724 3300046525 Ga0495663_0153948 Ga0495663_0153948_426_578 50
725 3300046526 Ga0495666_0305368 Ga0495666_0305368_160_312 50
726 3300046528 Ga0495642_0085475 Ga0495642_0085475_412_564 50
727 3300046537 Ga0495598_0086816 Ga0495598_0086816_517_669 50
728 3300046539 Ga0495621_0153139 Ga0495621_0153139_637_789 50
729 3300046539 Ga0495621_0311831 Ga0495621_0311831_147_299 50
730 3300046683 Ga0495658_0008063 Ga0495658_0008063_4904_5065 50
731 3300048904 Ga0496101_1146933 Ga0496101_1146933_392_544 50
732 3300048905 Ga0496102_1438399 Ga0496102_1438399_69_221 50
733 3300048906 Ga0496103_0662982 Ga0496103_0662982_330_482 50
734 3300048906 Ga0496103_1057418 Ga0496103_1057418_61_213 50
735 3300048907 Ga0496104_0065053 Ga0496104_0065053_247_399 50
736 3300048908 Ga0496105_0168693 Ga0496105_0168693_908_1060 50
737 3300048911 Ga0496108_0029402 Ga0496108_0029402_3621_3773 50
738 3300048911 Ga0496108_0996473 Ga0496108_0996473_188_340 50
739 3300048912 Ga0496109_1508694 Ga0496109_1508694_214_366 50
740 3300048913 Ga0496110_0206878 Ga0496110_0206878_1139_1291 50
741 3300048914 Ga0496111_0936021 Ga0496111_0936021_127_279 50
742 3300048915 Ga0496112_0108698 Ga0496112_0108698_1569_1721 50
743 3300048916 Ga0496113_0365210 Ga0496113_0365210_160_312 50
744 3300048917 Ga0496114_0363306 Ga0496114_0363306_610_762 50
745 3300049571 Ga0501034_0094491 Ga0501034_0094491_2292_2447 50
746 3300049582 Ga0501048_0272093 Ga0501048_0272093_217_369 50
747 3300049586 Ga0501070_0229587 Ga0501070_0229587_571_726 50
748 3300049589 Ga0501073_0007406 Ga0501073_0007406_1655_1810 50
749 3300049742 Ga0501080_0094703 Ga0501080_0094703_1028_1183 50
750 3300050507 nmdc:mga05p37_2222976_c1 nmdc:mga05p37_2222976_c1_153_305 50
751 3300050507 nmdc:mga05p37_25428_c1 nmdc:mga05p37_25428_c1_2949_3101 50
752 3300050507 nmdc:mga05p37_2836_c1 nmdc:mga05p37_2836_c1_4380_4532 50
753 3300050508 nmdc:mga09592_1731629_c1 nmdc:mga09592_1731629_c1_136_288 50
754 3300050508 nmdc:mga09592_20267_c1 nmdc:mga09592_20267_c1_4381_4533 50
755 3300050508 nmdc:mga09592_206267_c1 nmdc:mga09592_206267_c1_169_321 50
756 3300050509 nmdc:mga0qj67_977756_c1 nmdc:mga0qj67_977756_c1_367_519 50
757 3300050510 nmdc:mga06r32_64989_c1 nmdc:mga06r32_64989_c1_1869_2021 50
758 3300050511 nmdc:mga08y16_494575_c1 nmdc:mga08y16_494575_c1_909_1061 50
759 3300050511 nmdc:mga08y16_5446_c1 nmdc:mga08y16_5446_c1_1376_1528 50
760 3300050512 nmdc:mga0n895_564976_c1 nmdc:mga0n895_564976_c1_944_1099 50
761 3300050513 nmdc:mga0rr50_1107364_c1 nmdc:mga0rr50_1107364_c1_411_563 50
762 3300050514 nmdc:mga08x19_433400_c1 nmdc:mga08x19_433400_c1_538_690 50
763 3300050515 nmdc:mga0a205_411098_c1 nmdc:mga0a205_411098_c1_723_875 50
764 3300053098 Ga0500650_0492547 Ga0500650_0492547_87_239 50
765 3300053153 Ga0500616_0087441 Ga0500616_0087441_456_608 50
766 3300054114 Ga0501084_1156846 Ga0501084_1156846_264_416 50

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p4l-assembly1.cif.gz_A crystal structure of the trimeric ectodomain of archaeal fusexin1 (fsx1) 0.7587 1 29
1gcc-assembly1.cif.gz_A solution nmr structure of the complex of gcc-box binding domain of aterf1 and gcc-box dna, minimized average structure 0.7001 2 50
7p4l-assembly1.cif.gz_B crystal structure of the trimeric ectodomain of archaeal fusexin1 (fsx1) 0.6971 1 29
7p4l-assembly1.cif.gz_C crystal structure of the trimeric ectodomain of archaeal fusexin1 (fsx1) 0.683 1 29
1gcc-assembly1.cif.gz_A solution nmr structure of the complex of gcc-box binding domain of aterf1 and gcc-box dna, minimized average structure 0.6661 2 50
ID Description Score Start End Superfamily
af_P76389_435_515_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8838 1 13 3.30.465.10
af_Q9AWS7_65_121_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.8032 2 36 3.30.730.10
af_A0A0R0FVZ4_228_287_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7768 2 36 3.30.730.10
af_A0A1D6KJ58_29_91_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7752 2 36 3.30.730.10
af_K7KP57_178_237_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.754 2 38 3.30.730.10
ID Description Score Start End GO Terms
AF-A0A2V6R6C1-F1-model_v4 AP2-like integrase N-terminal domain-containing protein 1.008 1 48
AF-A0A2V5YM63-F1-model_v4 Uncharacterized protein 1.008 1 39
AF-A0A439UE47-F1-model_v4 AP2-like integrase N-terminal domain-containing protein 1.007 2 47
AF-A0A6I6MUD1-F1-model_v4 AP2-like integrase N-terminal domain-containing protein 1.006 1 49
AF-A0A0Q8QM77-F1-model_v4 AP2/ERF domain-containing protein 1.006 1 48

Feature Viewer

pLDDT pTM Quality
91.28 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map