F479756
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 764 | 333 | 764 | 127 |
Family's Representative Sequence
| Representative Sequence | 3300059655|Ga0587114_079771|Ga0587114_079771_95_475 |
| Length | 126 |
| Sequence | MARIAGINIPLNKRVEIGLTYIYGIGRSTSNQLLADVGIEPDTYVRDLTDDEVVKLRDAVDGLTVEGDLRRERSQNVKRLMEIGCYRGLRHRRGLPVRGQNTKTNARTRKGPKRMQVAGKKKAGKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 82 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 92 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 98 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 101 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 143 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 146 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 147 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 158 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 164 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 165 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 169 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 170 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 173 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 180 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 181 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 182 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 183 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 185 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 186 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 187 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 188 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 189 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 194 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 195 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 196 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 197 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 198 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 199 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 200 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 201 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 239 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 242 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 243 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 248 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 252 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 253 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 255 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 280 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 281 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 282 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 288 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 289 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 298 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 300 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 301 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.98 |
| Metatranscriptomes | 17.02 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.79 |
| Nodule | 0 |
| Rhizoplane | 5.1 |
| Rhizosphere | 83.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1007467 | 3300000546 | Bacteria | 1179 |
| 2 | Ga0006777J48905_1063153 | 3300003308 | Bacteria | 613 |
| 3 | Ga0007417J51691_1016750 | 3300003544 | Bacteria | 757 |
| 4 | Ga0007417J51691_1056724 | 3300003544 | Bacteria | 650 |
| 5 | Ga0007410J51695_1017675 | 3300003574 | Bacteria | 777 |
| 6 | Ga0007409J51694_1011186 | 3300003575 | Bacteria | 734 |
| 7 | Ga0007416J51690_1020405 | 3300003577 | Bacteria | 728 |
| 8 | Ga0007416J51690_1064679 | 3300003577 | Bacteria | 840 |
| 9 | Ga0007429J51699_1027606 | 3300003579 | Bacteria | 648 |
| 10 | Ga0007429J51699_1054942 | 3300003579 | Bacteria | 828 |
| 11 | Ga0032354_1007334 | 3300003693 | Bacteria | 985 |
| 12 | Ga0032354_1055984 | 3300003693 | Bacteria | 708 |
| 13 | Ga0058859_11782233 | 3300004798 | Bacteria | 791 |
| 14 | Ga0058863_11934614 | 3300004799 | Bacteria | 810 |
| 15 | Ga0058863_11964497 | 3300004799 | Bacteria | 576 |
| 16 | Ga0058861_11992365 | 3300004800 | Bacteria | 662 |
| 17 | Ga0058862_12623738 | 3300004803 | Bacteria | 729 |
| 18 | Ga0058862_12792749 | 3300004803 | Bacteria | 660 |
| 19 | Ga0070683_100330436 | 3300005329 | Bacteria | 1451 |
| 20 | Ga0070683_100479723 | 3300005329 | Bacteria | 1187 |
| 21 | Ga0070680_100585102 | 3300005336 | Bacteria | 958 |
| 22 | Ga0070680_100775862 | 3300005336 | Bacteria | 826 |
| 23 | Ga0070682_100404269 | 3300005337 | Bacteria | 1034 |
| 24 | Ga0070682_100930240 | 3300005337 | Bacteria | 716 |
| 25 | Ga0068868_101635393 | 3300005338 | Bacteria | 606 |
| 26 | Ga0070687_100538208 | 3300005343 | Bacteria | 792 |
| 27 | Ga0070661_100370971 | 3300005344 | Bacteria | 1127 |
| 28 | Ga0070692_10005318 | 3300005345 | Bacteria | 5474 |
| 29 | Ga0070692_11053737 | 3300005345 | Bacteria | 572 |
| 30 | Ga0070671_101455884 | 3300005355 | Bacteria | 606 |
| 31 | Ga0070659_100000160 | 3300005366 | Bacteria | 51528 |
| 32 | Ga0070659_100395794 | 3300005366 | Bacteria | 1165 |
| 33 | Ga0070659_100484767 | 3300005366 | Bacteria | 1052 |
| 34 | Ga0070659_101404006 | 3300005366 | Bacteria | 621 |
| 35 | Ga0070709_10511387 | 3300005434 | Bacteria | 914 |
| 36 | Ga0070709_11438456 | 3300005434 | Bacteria | 559 |
| 37 | Ga0070714_100018243 | 3300005435 | Bacteria | 5696 |
| 38 | Ga0070714_100076714 | 3300005435 | Bacteria | 2902 |
| 39 | Ga0070714_100190199 | 3300005435 | Bacteria | 1873 |
| 40 | Ga0070714_100267532 | 3300005435 | Bacteria | 1584 |
| 41 | Ga0070714_100376416 | 3300005435 | Bacteria | 1338 |
| 42 | Ga0070714_100414251 | 3300005435 | Bacteria | 1276 |
| 43 | Ga0070714_100420905 | 3300005435 | Bacteria | 1265 |
| 44 | Ga0070714_100843472 | 3300005435 | Bacteria | 888 |
| 45 | Ga0070714_101543834 | 3300005435 | Bacteria | 649 |
| 46 | Ga0070714_101746451 | 3300005435 | Bacteria | 608 |
| 47 | Ga0070713_100551375 | 3300005436 | Bacteria | 1091 |
| 48 | Ga0070713_100732827 | 3300005436 | Bacteria | 945 |
| 49 | Ga0070713_101875710 | 3300005436 | Bacteria | 581 |
| 50 | Ga0070713_102326394 | 3300005436 | Bacteria | 518 |
| 51 | Ga0070710_10000005 | 3300005437 | Bacteria | 238049 |
| 52 | Ga0070710_10119932 | 3300005437 | Bacteria | 1591 |
| 53 | Ga0070710_10202621 | 3300005437 | Bacteria | 1254 |
| 54 | Ga0070710_10500829 | 3300005437 | Bacteria | 831 |
| 55 | Ga0070711_100002145 | 3300005439 | Bacteria | 11183 |
| 56 | Ga0070711_100055655 | 3300005439 | Bacteria | 2733 |
| 57 | Ga0070711_100342630 | 3300005439 | Bacteria | 1200 |
| 58 | Ga0070711_100425633 | 3300005439 | Bacteria | 1083 |
| 59 | Ga0070711_100733572 | 3300005439 | Bacteria | 834 |
| 60 | Ga0070705_100002004 | 3300005440 | Bacteria | 10415 |
| 61 | Ga0070700_100324369 | 3300005441 | Bacteria | 1132 |
| 62 | Ga0070708_100642959 | 3300005445 | Bacteria | 1000 |
| 63 | Ga0070678_100000830 | 3300005456 | Bacteria | 15675 |
| 64 | Ga0070678_102246658 | 3300005456 | Bacteria | 518 |
| 65 | Ga0070662_100310435 | 3300005457 | Bacteria | 1284 |
| 66 | Ga0070662_100392137 | 3300005457 | Bacteria | 1144 |
| 67 | Ga0070662_101526355 | 3300005457 | Bacteria | 576 |
| 68 | Ga0070681_10985116 | 3300005458 | Bacteria | 763 |
| 69 | Ga0070681_11393309 | 3300005458 | Bacteria | 625 |
| 70 | Ga0070685_10672070 | 3300005466 | Bacteria | 752 |
| 71 | Ga0070707_100513038 | 3300005468 | Bacteria | 1161 |
| 72 | Ga0070699_101025435 | 3300005518 | Bacteria | 757 |
| 73 | Ga0070684_100065608 | 3300005535 | Bacteria | 3186 |
| 74 | Ga0070684_100208430 | 3300005535 | Bacteria | 1781 |
| 75 | Ga0070684_101056819 | 3300005535 | Bacteria | 762 |
| 76 | Ga0070697_100279209 | 3300005536 | Bacteria | 1433 |
| 77 | Ga0068853_100229878 | 3300005539 | Bacteria | 1696 |
| 78 | Ga0070686_100396414 | 3300005544 | Bacteria | 1048 |
| 79 | Ga0070695_100369828 | 3300005545 | Bacteria | 1079 |
| 80 | Ga0070695_100676321 | 3300005545 | Bacteria | 817 |
| 81 | Ga0070696_100042297 | 3300005546 | Bacteria | 3151 |
| 82 | Ga0070704_100273070 | 3300005549 | Bacteria | 1398 |
| 83 | Ga0070664_100123830 | 3300005564 | Bacteria | 2266 |
| 84 | Ga0070664_101105099 | 3300005564 | Bacteria | 747 |
| 85 | Ga0068854_100445301 | 3300005578 | Bacteria | 1081 |
| 86 | Ga0068854_101215749 | 3300005578 | Bacteria | 676 |
| 87 | Ga0070702_100064604 | 3300005615 | Bacteria | 2141 |
| 88 | Ga0070702_100174927 | 3300005615 | Bacteria | 1399 |
| 89 | Ga0068852_100146967 | 3300005616 | Bacteria | 2187 |
| 90 | Ga0068852_100616363 | 3300005616 | Bacteria | 1090 |
| 91 | Ga0068859_102381056 | 3300005617 | Bacteria | 584 |
| 92 | Ga0068866_10226337 | 3300005718 | Bacteria | 1131 |
| 93 | Ga0068866_11264619 | 3300005718 | Bacteria | 535 |
| 94 | Ga0068861_100273934 | 3300005719 | Bacteria | 1450 |
| 95 | Ga0068851_10377744 | 3300005834 | Bacteria | 830 |
| 96 | Ga0068858_100930244 | 3300005842 | Bacteria | 851 |
| 97 | Ga0081540_1149021 | 3300005983 | Bacteria | 926 |
| 98 | Ga0070717_10008688 | 3300006028 | Bacteria | 7600 |
| 99 | Ga0070717_10043519 | 3300006028 | Bacteria | 3665 |
| 100 | Ga0070717_10288172 | 3300006028 | Bacteria | 1457 |
| 101 | Ga0070717_10593391 | 3300006028 | Bacteria | 1005 |
| 102 | Ga0070717_10712900 | 3300006028 | Bacteria | 912 |
| 103 | Ga0070717_10759070 | 3300006028 | Bacteria | 882 |
| 104 | Ga0070717_11128867 | 3300006028 | Bacteria | 714 |
| 105 | Ga0070717_11273728 | 3300006028 | Bacteria | 668 |
| 106 | Ga0075365_10178436 | 3300006038 | Bacteria | 1484 |
| 107 | Ga0075364_10376256 | 3300006051 | Bacteria | 969 |
| 108 | Ga0075432_10123820 | 3300006058 | Bacteria | 973 |
| 109 | Ga0070715_10217202 | 3300006163 | Bacteria | 981 |
| 110 | Ga0070716_100040774 | 3300006173 | Bacteria | 2584 |
| 111 | Ga0070716_100585981 | 3300006173 | Bacteria | 837 |
| 112 | Ga0070712_100015327 | 3300006175 | Bacteria | 4932 |
| 113 | Ga0070712_100015527 | 3300006175 | Bacteria | 4909 |
| 114 | Ga0070712_100385985 | 3300006175 | Bacteria | 1154 |
| 115 | Ga0070712_101346287 | 3300006175 | Bacteria | 622 |
| 116 | Ga0068871_101824694 | 3300006358 | Bacteria | 578 |
| 117 | Ga0075428_100779757 | 3300006844 | Bacteria | 1016 |
| 118 | Ga0075428_100935741 | 3300006844 | Bacteria | 919 |
| 119 | Ga0075430_100406030 | 3300006846 | Bacteria | 1124 |
| 120 | Ga0075430_100647440 | 3300006846 | Bacteria | 871 |
| 121 | Ga0075430_101179430 | 3300006846 | Bacteria | 630 |
| 122 | Ga0075429_100008266 | 3300006880 | Bacteria | 9046 |
| 123 | Ga0068865_100591571 | 3300006881 | Bacteria | 937 |
| 124 | Ga0068865_101370202 | 3300006881 | Bacteria | 631 |
| 125 | Ga0075436_101495819 | 3300006914 | Bacteria | 513 |
| 126 | Ga0097620_102380962 | 3300006931 | Bacteria | 584 |
| 127 | Ga0105251_10368456 | 3300009011 | Bacteria | 657 |
| 128 | Ga0105240_10006736 | 3300009093 | Bacteria | 16822 |
| 129 | Ga0105240_11126444 | 3300009093 | Bacteria | 834 |
| 130 | Ga0111539_10371241 | 3300009094 | Bacteria | 1665 |
| 131 | Ga0111539_12086955 | 3300009094 | Bacteria | 657 |
| 132 | Ga0105245_10235778 | 3300009098 | Bacteria | 1771 |
| 133 | Ga0105245_10419437 | 3300009098 | Bacteria | 1341 |
| 134 | Ga0105245_10435547 | 3300009098 | Bacteria | 1317 |
| 135 | Ga0105245_11641151 | 3300009098 | Bacteria | 695 |
| 136 | Ga0105247_10188613 | 3300009101 | Bacteria | 1379 |
| 137 | Ga0114129_10410816 | 3300009147 | Bacteria | 1782 |
| 138 | Ga0114129_11244710 | 3300009147 | Bacteria | 925 |
| 139 | Ga0114129_11629237 | 3300009147 | Bacteria | 789 |
| 140 | Ga0114129_11732699 | 3300009147 | Bacteria | 762 |
| 141 | Ga0105243_10187204 | 3300009148 | Bacteria | 1805 |
| 142 | Ga0105243_10234625 | 3300009148 | Bacteria | 1629 |
| 143 | Ga0105243_10817676 | 3300009148 | Bacteria | 920 |
| 144 | Ga0105243_10870519 | 3300009148 | Bacteria | 894 |
| 145 | Ga0105241_10309942 | 3300009174 | Bacteria | 1357 |
| 146 | Ga0105241_11850817 | 3300009174 | Bacteria | 590 |
| 147 | Ga0105242_10386951 | 3300009176 | Bacteria | 1301 |
| 148 | Ga0105242_11237829 | 3300009176 | Bacteria | 767 |
| 149 | Ga0105237_10000795 | 3300009545 | Bacteria | 43136 |
| 150 | Ga0105238_10407094 | 3300009551 | Bacteria | 1354 |
| 151 | Ga0105249_10349025 | 3300009553 | Bacteria | 1498 |
| 152 | Ga0105249_10514192 | 3300009553 | Bacteria | 1244 |
| 153 | Ga0105249_11273929 | 3300009553 | Bacteria | 806 |
| 154 | Ga0105239_10052946 | 3300010375 | Bacteria | 4452 |
| 155 | Ga0105239_10565745 | 3300010375 | Bacteria | 1295 |
| 156 | Ga0105239_10728378 | 3300010375 | Bacteria | 1135 |
| 157 | Ga0105246_10047961 | 3300011119 | Bacteria | 2919 |
| 158 | Ga0105246_10204294 | 3300011119 | Bacteria | 1538 |
| 159 | Ga0105246_11246359 | 3300011119 | Bacteria | 687 |
| 160 | Ga0157317_1029149 | 3300012475 | Bacteria | 530 |
| 161 | Ga0154010_123301 | 3300013062 | Bacteria | 650 |
| 162 | Ga0157378_12723615 | 3300013297 | Bacteria | 547 |
| 163 | Ga0163162_10855954 | 3300013306 | Bacteria | 1024 |
| 164 | Ga0163162_11040097 | 3300013306 | Bacteria | 927 |
| 165 | Ga0157372_10260305 | 3300013307 | Bacteria | 2015 |
| 166 | Ga0157372_11027672 | 3300013307 | Bacteria | 954 |
| 167 | Ga0157380_10423884 | 3300014326 | Bacteria | 1270 |
| 168 | Ga0157380_10490923 | 3300014326 | Bacteria | 1190 |
| 169 | Ga0157380_10932425 | 3300014326 | Bacteria | 897 |
| 170 | Ga0157377_10295674 | 3300014745 | Bacteria | 1067 |
| 171 | Ga0157377_10616970 | 3300014745 | Bacteria | 776 |
| 172 | Ga0197907_10147709 | 3300020069 | Bacteria | 611 |
| 173 | Ga0197907_10147937 | 3300020069 | Bacteria | 607 |
| 174 | Ga0197907_10274865 | 3300020069 | Bacteria | 611 |
| 175 | Ga0197907_10395385 | 3300020069 | Bacteria | 958 |
| 176 | Ga0197907_10604094 | 3300020069 | Bacteria | 1168 |
| 177 | Ga0197907_10658254 | 3300020069 | Bacteria | 821 |
| 178 | Ga0197907_10784893 | 3300020069 | Bacteria | 660 |
| 179 | Ga0197907_11199968 | 3300020069 | Bacteria | 1399 |
| 180 | Ga0197907_11212975 | 3300020069 | Bacteria | 1106 |
| 181 | Ga0206356_10404506 | 3300020070 | Bacteria | 1099 |
| 182 | Ga0206356_10449285 | 3300020070 | Bacteria | 3301 |
| 183 | Ga0206356_10702775 | 3300020070 | Bacteria | 976 |
| 184 | Ga0206356_11616220 | 3300020070 | Bacteria | 588 |
| 185 | Ga0206356_11810765 | 3300020070 | Bacteria | 609 |
| 186 | Ga0206349_1284854 | 3300020075 | Bacteria | 820 |
| 187 | Ga0206349_1914227 | 3300020075 | Bacteria | 1169 |
| 188 | Ga0206355_1001847 | 3300020076 | Bacteria | 2018 |
| 189 | Ga0206355_1125333 | 3300020076 | Bacteria | 806 |
| 190 | Ga0206355_1206623 | 3300020076 | Bacteria | 817 |
| 191 | Ga0206355_1478742 | 3300020076 | Bacteria | 678 |
| 192 | Ga0206355_1539572 | 3300020076 | Bacteria | 817 |
| 193 | Ga0206355_1619291 | 3300020076 | Bacteria | 781 |
| 194 | Ga0206351_10366003 | 3300020077 | Bacteria | 803 |
| 195 | Ga0206351_10947414 | 3300020077 | Bacteria | 690 |
| 196 | Ga0206351_10952347 | 3300020077 | Bacteria | 584 |
| 197 | Ga0206352_10069301 | 3300020078 | Bacteria | 677 |
| 198 | Ga0206352_10186458 | 3300020078 | Bacteria | 732 |
| 199 | Ga0206352_10475010 | 3300020078 | Bacteria | 865 |
| 200 | Ga0206352_10598505 | 3300020078 | Bacteria | 768 |
| 201 | Ga0206350_10261611 | 3300020080 | Bacteria | 968 |
| 202 | Ga0206350_10437302 | 3300020080 | Bacteria | 956 |
| 203 | Ga0206350_11032215 | 3300020080 | Bacteria | 1131 |
| 204 | Ga0206350_11141738 | 3300020080 | Bacteria | 1184 |
| 205 | Ga0206350_11597202 | 3300020080 | Bacteria | 610 |
| 206 | Ga0206354_10449146 | 3300020081 | Bacteria | 714 |
| 207 | Ga0206354_10499121 | 3300020081 | Bacteria | 1160 |
| 208 | Ga0206354_11218193 | 3300020081 | Bacteria | 1041 |
| 209 | Ga0206354_11425170 | 3300020081 | Bacteria | 752 |
| 210 | Ga0206354_11640189 | 3300020081 | Bacteria | 676 |
| 211 | Ga0206353_10120481 | 3300020082 | Bacteria | 842 |
| 212 | Ga0206353_10433378 | 3300020082 | Bacteria | 2197 |
| 213 | Ga0206353_10652344 | 3300020082 | Bacteria | 755 |
| 214 | Ga0206353_10994385 | 3300020082 | Bacteria | 645 |
| 215 | Ga0206353_11518563 | 3300020082 | Bacteria | 1048 |
| 216 | Ga0154015_1010392 | 3300020610 | Bacteria | 2054 |
| 217 | Ga0154015_1183149 | 3300020610 | Bacteria | 617 |
| 218 | Ga0154015_1209516 | 3300020610 | Bacteria | 601 |
| 219 | Ga0154015_1431325 | 3300020610 | Bacteria | 610 |
| 220 | Ga0154015_1489538 | 3300020610 | Bacteria | 624 |
| 221 | Ga0213874_10000186 | 3300021377 | Bacteria | 11171 |
| 222 | Ga0213874_10007135 | 3300021377 | Bacteria | 2670 |
| 223 | Ga0213874_10077485 | 3300021377 | Bacteria | 1071 |
| 224 | Ga0213874_10308884 | 3300021377 | Bacteria | 597 |
| 225 | Ga0213876_10009713 | 3300021384 | Bacteria | 5178 |
| 226 | Ga0213876_10016993 | 3300021384 | Bacteria | 3843 |
| 227 | Ga0213876_10169474 | 3300021384 | Bacteria | 1161 |
| 228 | Ga0213876_10259435 | 3300021384 | Bacteria | 923 |
| 229 | Ga0213876_10308974 | 3300021384 | Bacteria | 840 |
| 230 | Ga0213876_10517728 | 3300021384 | Bacteria | 635 |
| 231 | Ga0213876_10521368 | 3300021384 | Bacteria | 632 |
| 232 | Ga0213875_10001225 | 3300021388 | Bacteria | 17356 |
| 233 | Ga0213875_10003279 | 3300021388 | Bacteria | 9270 |
| 234 | Ga0213875_10006988 | 3300021388 | Bacteria | 5875 |
| 235 | Ga0213875_10007028 | 3300021388 | Bacteria | 5857 |
| 236 | Ga0213875_10020207 | 3300021388 | Bacteria | 3195 |
| 237 | Ga0213875_10046096 | 3300021388 | Bacteria | 2046 |
| 238 | Ga0213875_10102614 | 3300021388 | Bacteria | 1335 |
| 239 | Ga0213875_10135676 | 3300021388 | Bacteria | 1151 |
| 240 | Ga0213875_10137097 | 3300021388 | Bacteria | 1144 |
| 241 | Ga0213875_10574069 | 3300021388 | Bacteria | 544 |
| 242 | Ga0224712_10046331 | 3300022467 | Bacteria | 1668 |
| 243 | Ga0224712_10137034 | 3300022467 | Bacteria | 1074 |
| 244 | Ga0224712_10253464 | 3300022467 | Bacteria | 814 |
| 245 | Ga0224712_10273654 | 3300022467 | Bacteria | 785 |
| 246 | Ga0224712_10281192 | 3300022467 | Bacteria | 774 |
| 247 | Ga0224712_10500389 | 3300022467 | Bacteria | 587 |
| 248 | Ga0207656_10430606 | 3300025321 | Bacteria | 665 |
| 249 | Ga0207692_10000003 | 3300025898 | Bacteria | 431531 |
| 250 | Ga0207692_10059514 | 3300025898 | Bacteria | 1973 |
| 251 | Ga0207692_10124873 | 3300025898 | Bacteria | 1446 |
| 252 | Ga0207692_10232695 | 3300025898 | Bacteria | 1097 |
| 253 | Ga0207692_10985649 | 3300025898 | Bacteria | 556 |
| 254 | Ga0207642_10097226 | 3300025899 | Bacteria | 1469 |
| 255 | Ga0207642_10771549 | 3300025899 | Bacteria | 610 |
| 256 | Ga0207685_10194836 | 3300025905 | Bacteria | 948 |
| 257 | Ga0207699_10120006 | 3300025906 | Bacteria | 1699 |
| 258 | Ga0207654_10908541 | 3300025911 | Bacteria | 638 |
| 259 | Ga0207695_10023985 | 3300025913 | Bacteria | 6879 |
| 260 | Ga0207671_10007459 | 3300025914 | Bacteria | 9487 |
| 261 | Ga0207693_10084455 | 3300025915 | Bacteria | 2488 |
| 262 | Ga0207693_10118948 | 3300025915 | Bacteria | 2075 |
| 263 | Ga0207693_10175259 | 3300025915 | Bacteria | 1688 |
| 264 | Ga0207693_10488547 | 3300025915 | Bacteria | 961 |
| 265 | Ga0207693_11002443 | 3300025915 | Bacteria | 638 |
| 266 | Ga0207663_10002651 | 3300025916 | Bacteria | 8611 |
| 267 | Ga0207663_10198247 | 3300025916 | Bacteria | 1446 |
| 268 | Ga0207663_10371479 | 3300025916 | Bacteria | 1087 |
| 269 | Ga0207663_10625858 | 3300025916 | Bacteria | 848 |
| 270 | Ga0207663_10651351 | 3300025916 | Bacteria | 831 |
| 271 | Ga0207663_11135416 | 3300025916 | Bacteria | 628 |
| 272 | Ga0207657_10033580 | 3300025919 | Bacteria | 4624 |
| 273 | Ga0207649_10408462 | 3300025920 | Bacteria | 1017 |
| 274 | Ga0207649_10646531 | 3300025920 | Bacteria | 817 |
| 275 | Ga0207652_11813439 | 3300025921 | Bacteria | 515 |
| 276 | Ga0207646_10141568 | 3300025922 | Bacteria | 2167 |
| 277 | Ga0207646_10448943 | 3300025922 | Bacteria | 1163 |
| 278 | Ga0207694_10674996 | 3300025924 | Bacteria | 871 |
| 279 | Ga0207687_10505568 | 3300025927 | Bacteria | 1009 |
| 280 | Ga0207687_11317512 | 3300025927 | Bacteria | 621 |
| 281 | Ga0207700_10125575 | 3300025928 | Bacteria | 2087 |
| 282 | Ga0207700_10229152 | 3300025928 | Bacteria | 1579 |
| 283 | Ga0207700_10570465 | 3300025928 | Bacteria | 1006 |
| 284 | Ga0207700_11190054 | 3300025928 | Bacteria | 680 |
| 285 | Ga0207664_10000020 | 3300025929 | Bacteria | 218362 |
| 286 | Ga0207664_10016090 | 3300025929 | Bacteria | 5449 |
| 287 | Ga0207664_10119702 | 3300025929 | Bacteria | 2202 |
| 288 | Ga0207664_10274702 | 3300025929 | Bacteria | 1477 |
| 289 | Ga0207664_11004377 | 3300025929 | Bacteria | 748 |
| 290 | Ga0207664_11160746 | 3300025929 | Bacteria | 689 |
| 291 | Ga0207664_11443762 | 3300025929 | Bacteria | 609 |
| 292 | Ga0207664_11847877 | 3300025929 | Bacteria | 527 |
| 293 | Ga0207690_10000165 | 3300025932 | Bacteria | 51537 |
| 294 | Ga0207706_10850026 | 3300025933 | Bacteria | 773 |
| 295 | Ga0207706_11294405 | 3300025933 | Bacteria | 602 |
| 296 | Ga0207686_10759341 | 3300025934 | Bacteria | 775 |
| 297 | Ga0207709_10309612 | 3300025935 | Bacteria | 1178 |
| 298 | Ga0207669_10537689 | 3300025937 | Bacteria | 941 |
| 299 | Ga0207704_10357620 | 3300025938 | Bacteria | 1139 |
| 300 | Ga0207665_10096814 | 3300025939 | Bacteria | 2053 |
| 301 | Ga0207665_10403998 | 3300025939 | Bacteria | 1041 |
| 302 | Ga0207665_10581610 | 3300025939 | Bacteria | 873 |
| 303 | Ga0207665_11341572 | 3300025939 | Bacteria | 570 |
| 304 | Ga0207689_10489602 | 3300025942 | Bacteria | 1030 |
| 305 | Ga0207661_10047980 | 3300025944 | Bacteria | 3392 |
| 306 | Ga0207661_10258788 | 3300025944 | Bacteria | 1549 |
| 307 | Ga0207661_10698591 | 3300025944 | Bacteria | 933 |
| 308 | Ga0207661_11004950 | 3300025944 | Bacteria | 768 |
| 309 | Ga0207661_11769097 | 3300025944 | Bacteria | 563 |
| 310 | Ga0207679_10043796 | 3300025945 | Bacteria | 3225 |
| 311 | Ga0207679_10787836 | 3300025945 | Bacteria | 866 |
| 312 | Ga0207679_10959976 | 3300025945 | Bacteria | 783 |
| 313 | Ga0207712_10717494 | 3300025961 | Bacteria | 874 |
| 314 | Ga0207668_10572013 | 3300025972 | Bacteria | 981 |
| 315 | Ga0207640_10328424 | 3300025981 | Bacteria | 1221 |
| 316 | Ga0207640_11109261 | 3300025981 | Bacteria | 700 |
| 317 | Ga0207703_10651625 | 3300026035 | Bacteria | 999 |
| 318 | Ga0207678_10429999 | 3300026067 | Bacteria | 1146 |
| 319 | Ga0207708_10354544 | 3300026075 | Bacteria | 1204 |
| 320 | Ga0207702_10462383 | 3300026078 | Bacteria | 1233 |
| 321 | Ga0207702_11164039 | 3300026078 | Bacteria | 765 |
| 322 | Ga0207641_10380276 | 3300026088 | Bacteria | 1352 |
| 323 | Ga0207641_12106298 | 3300026088 | Bacteria | 565 |
| 324 | Ga0207648_11122393 | 3300026089 | Bacteria | 738 |
| 325 | Ga0207674_10377936 | 3300026116 | Bacteria | 1370 |
| 326 | Ga0207675_100191546 | 3300026118 | Bacteria | 1961 |
| 327 | Ga0207675_101285499 | 3300026118 | Bacteria | 752 |
| 328 | Ga0207698_10059058 | 3300026142 | Bacteria | 2976 |
| 329 | Ga0207698_11304754 | 3300026142 | Bacteria | 741 |
| 330 | Ga0207428_10240031 | 3300027907 | Bacteria | 1354 |
| 331 | Ga0268265_10261569 | 3300028380 | Bacteria | 1539 |
| 332 | Ga0268264_11930140 | 3300028381 | Bacteria | 600 |
| 333 | Ga0265337_1000328 | 3300028556 | Bacteria | 25426 |
| 334 | Ga0265326_10000874 | 3300028558 | Bacteria | 10947 |
| 335 | Ga0265319_1000863 | 3300028563 | Bacteria | 19261 |
| 336 | Ga0265319_1119056 | 3300028563 | Bacteria | 823 |
| 337 | Ga0265318_10000275 | 3300028577 | Bacteria | 43186 |
| 338 | Ga0265322_10004443 | 3300028654 | Bacteria | 4177 |
| 339 | Ga0265322_10095602 | 3300028654 | Bacteria | 845 |
| 340 | Ga0265336_10000043 | 3300028666 | Bacteria | 132135 |
| 341 | Ga0265338_10000142 | 3300028800 | Bacteria | 132135 |
| 342 | Ga0265338_10075957 | 3300028800 | Bacteria | 2848 |
| 343 | Ga0265338_10314049 | 3300028800 | Bacteria | 1136 |
| 344 | Ga0265324_10002249 | 3300029957 | Bacteria | 10059 |
| 345 | Ga0265766_1005144 | 3300030863 | Bacteria | 822 |
| 346 | Ga0265771_1015233 | 3300031010 | Bacteria | 615 |
| 347 | Ga0265330_10279511 | 3300031235 | Bacteria | 703 |
| 348 | Ga0265320_10011831 | 3300031240 | Bacteria | 5114 |
| 349 | Ga0265320_10335286 | 3300031240 | Bacteria | 668 |
| 350 | Ga0265340_10000006 | 3300031247 | Bacteria | 132135 |
| 351 | Ga0265331_10503127 | 3300031250 | Bacteria | 545 |
| 352 | Ga0265316_10089873 | 3300031344 | Bacteria | 2343 |
| 353 | Ga0265314_10073998 | 3300031711 | Bacteria | 2270 |
| 354 | Ga0265314_10167811 | 3300031711 | Bacteria | 1328 |
| 355 | Ga0265342_10399056 | 3300031712 | Bacteria | 710 |
| 356 | Ga0307405_11625222 | 3300031731 | Bacteria | 571 |
| 357 | Ga0307410_11524385 | 3300031852 | Bacteria | 589 |
| 358 | Ga0307407_10634965 | 3300031903 | Bacteria | 798 |
| 359 | Ga0307407_10910688 | 3300031903 | Bacteria | 675 |
| 360 | Ga0307412_11935075 | 3300031911 | Bacteria | 545 |
| 361 | Ga0307409_101299224 | 3300031995 | Bacteria | 752 |
| 362 | Ga0307416_103646449 | 3300032002 | Bacteria | 515 |
| 363 | Ga0307411_10637143 | 3300032005 | Bacteria | 921 |
| 364 | Ga0307415_102503742 | 3300032126 | Bacteria | 508 |
| 365 | Ga0373943_0972404 | 3300035170 | Bacteria | 509 |
| 366 | Ga0373935_1269532 | 3300035692 | Bacteria | 550 |
| 367 | Ga0373947_0174086 | 3300035725 | Bacteria | 1398 |
| 368 | Ga0265778_025158 | 3300036457 | Bacteria | 750 |
| 369 | Ga0395899_0709025 | 3300037312 | Bacteria | 630 |
| 370 | Ga0395898_0514379 | 3300037466 | Bacteria | 1138 |
| 371 | Ga0436364_0041476 | 3300037853 | Bacteria | 1655 |
| 372 | Ga0436364_0054318 | 3300037853 | Bacteria | 7060 |
| 373 | Ga0436364_0095065 | 3300037853 | Bacteria | 4309 |
| 374 | Ga0436364_0149301 | 3300037853 | Bacteria | 17361 |
| 375 | Ga0436364_0221495 | 3300037853 | Bacteria | 40749 |
| 376 | Ga0436364_0295555 | 3300037853 | Bacteria | 2792 |
| 377 | Ga0436364_0367212 | 3300037853 | Bacteria | 15974 |
| 378 | Ga0436364_0369585 | 3300037853 | Bacteria | 1009 |
| 379 | Ga0436364_0531473 | 3300037853 | Bacteria | 2513 |
| 380 | Ga0436364_0637866 | 3300037853 | Bacteria | 1657 |
| 381 | Ga0436364_0682897 | 3300037853 | Bacteria | 546 |
| 382 | Ga0436364_0740129 | 3300037853 | Bacteria | 3629 |
| 383 | Ga0436364_0746361 | 3300037853 | Bacteria | 1658 |
| 384 | Ga0436364_0764623 | 3300037853 | Bacteria | 3130 |
| 385 | Ga0436364_0771931 | 3300037853 | Bacteria | 1120 |
| 386 | Ga0436364_0839163 | 3300037853 | Bacteria | 8786 |
| 387 | Ga0436364_0999256 | 3300037853 | Bacteria | 646 |
| 388 | Ga0436364_1152751 | 3300037853 | Bacteria | 1903 |
| 389 | Ga0436364_1164844 | 3300037853 | Bacteria | 6131 |
| 390 | Ga0395901_1411746 | 3300038443 | Bacteria | 654 |
| 391 | Ga0436365_0120242 | 3300039437 | Bacteria | 2079 |
| 392 | Ga0436365_0143115 | 3300039437 | Bacteria | 588 |
| 393 | Ga0436365_0172227 | 3300039437 | Bacteria | 548 |
| 394 | Ga0436365_0222942 | 3300039437 | Bacteria | 6189 |
| 395 | Ga0436365_0463391 | 3300039437 | Bacteria | 2113 |
| 396 | Ga0436365_0497321 | 3300039437 | Bacteria | 2166 |
| 397 | Ga0436365_0745551 | 3300039437 | Bacteria | 841 |
| 398 | Ga0436365_0746312 | 3300039437 | Bacteria | 950 |
| 399 | Ga0436365_1112641 | 3300039437 | Bacteria | 3351 |
| 400 | Ga0436365_1192333 | 3300039437 | Bacteria | 1003 |
| 401 | Ga0436365_1296594 | 3300039437 | Bacteria | 887 |
| 402 | Ga0436365_1331551 | 3300039437 | Bacteria | 9291 |
| 403 | Ga0436365_1469372 | 3300039437 | Bacteria | 1111 |
| 404 | Ga0436365_1544784 | 3300039437 | Bacteria | 5536 |
| 405 | Ga0436365_1589280 | 3300039437 | Bacteria | 588 |
| 406 | Ga0436365_1662543 | 3300039437 | Bacteria | 16980 |
| 407 | Ga0436365_1688016 | 3300039437 | Bacteria | 932 |
| 408 | Ga0436365_1709979 | 3300039437 | Bacteria | 1873 |
| 409 | Ga0436360_0344681 | 3300039438 | Bacteria | 1136 |
| 410 | Ga0436360_0503545 | 3300039438 | Bacteria | 933 |
| 411 | Ga0436360_1281492 | 3300039438 | Bacteria | 855 |
| 412 | Ga0436361_0295179 | 3300039447 | Bacteria | 508 |
| 413 | Ga0436361_0585938 | 3300039447 | Bacteria | 805 |
| 414 | Ga0436361_0849285 | 3300039447 | Bacteria | 559 |
| 415 | Ga0436361_1220824 | 3300039447 | Bacteria | 1616 |
| 416 | Ga0436363_0027919 | 3300039450 | Bacteria | 1826 |
| 417 | Ga0436363_0032375 | 3300039450 | Bacteria | 1459 |
| 418 | Ga0436363_0032926 | 3300039450 | Bacteria | 683 |
| 419 | Ga0436363_0136874 | 3300039450 | Bacteria | 50367 |
| 420 | Ga0436363_0145734 | 3300039450 | Bacteria | 3290 |
| 421 | Ga0436363_0180243 | 3300039450 | Bacteria | 1660 |
| 422 | Ga0436363_0330098 | 3300039450 | Bacteria | 856 |
| 423 | Ga0436363_0351951 | 3300039450 | Bacteria | 742 |
| 424 | Ga0436363_0376788 | 3300039450 | Bacteria | 963 |
| 425 | Ga0436363_0532966 | 3300039450 | Bacteria | 1169 |
| 426 | Ga0436363_0678090 | 3300039450 | Bacteria | 2537 |
| 427 | Ga0436363_0889406 | 3300039450 | Bacteria | 833 |
| 428 | Ga0436363_1003415 | 3300039450 | Bacteria | 859 |
| 429 | Ga0436363_1115108 | 3300039450 | Bacteria | 806 |
| 430 | Ga0436363_1187247 | 3300039450 | Bacteria | 897 |
| 431 | Ga0436363_1191833 | 3300039450 | Bacteria | 863 |
| 432 | Ga0436363_1392677 | 3300039450 | Bacteria | 811 |
| 433 | Ga0436363_1401676 | 3300039450 | Bacteria | 1404 |
| 434 | Ga0436363_1566285 | 3300039450 | Bacteria | 826 |
| 435 | Ga0436363_1686345 | 3300039450 | Bacteria | 865 |
| 436 | Ga0436362_0021263 | 3300039453 | Bacteria | 606 |
| 437 | Ga0436362_0187053 | 3300039453 | Bacteria | 1619 |
| 438 | Ga0436362_0299203 | 3300039453 | Bacteria | 1296 |
| 439 | Ga0436362_0351520 | 3300039453 | Bacteria | 866 |
| 440 | Ga0436362_0401791 | 3300039453 | Bacteria | 661 |
| 441 | Ga0436362_0702484 | 3300039453 | Bacteria | 927 |
| 442 | Ga0436362_0774635 | 3300039453 | Bacteria | 929 |
| 443 | Ga0436362_0801538 | 3300039453 | Bacteria | 1052 |
| 444 | Ga0436362_1062177 | 3300039453 | Bacteria | 1953 |
| 445 | Ga0451798_0485314 | 3300041458 | Bacteria | 550 |
| 446 | Ga0451837_1551250 | 3300041494 | Bacteria | 1209 |
| 447 | Ga0451849_1412726 | 3300041505 | Bacteria | 628 |
| 448 | Ga0451851_1253955 | 3300041507 | Bacteria | 575 |
| 449 | Ga0451855_0958897 | 3300041511 | Bacteria | 542 |
| 450 | Ga0466969_0135109 | 3300044656 | Bacteria | 1142 |
| 451 | Ga0466969_0154577 | 3300044656 | Bacteria | 1056 |
| 452 | Ga0466969_0256187 | 3300044656 | Bacteria | 793 |
| 453 | Ga0466965_0209444 | 3300044683 | Bacteria | 1036 |
| 454 | Ga0466965_0241562 | 3300044683 | Bacteria | 967 |
| 455 | Ga0466965_0251688 | 3300044683 | Bacteria | 948 |
| 456 | Ga0466965_0720926 | 3300044683 | Bacteria | 573 |
| 457 | Ga0466965_0880549 | 3300044683 | Bacteria | 521 |
| 458 | Ga0466965_0922039 | 3300044683 | Bacteria | 510 |
| 459 | Ga0466966_0026754 | 3300044684 | Bacteria | 3765 |
| 460 | Ga0466966_0190379 | 3300044684 | Bacteria | 1243 |
| 461 | Ga0466966_0493158 | 3300044684 | Bacteria | 737 |
| 462 | Ga0466966_0679812 | 3300044684 | Bacteria | 620 |
| 463 | Ga0466961_0004906 | 3300044693 | Bacteria | 8412 |
| 464 | Ga0466961_0070568 | 3300044693 | Bacteria | 2218 |
| 465 | Ga0466961_0106847 | 3300044693 | Bacteria | 1762 |
| 466 | Ga0466961_0357524 | 3300044693 | Bacteria | 888 |
| 467 | Ga0466961_0505124 | 3300044693 | Bacteria | 730 |
| 468 | Ga0466963_0009311 | 3300044694 | Bacteria | 5914 |
| 469 | Ga0466963_0011289 | 3300044694 | Bacteria | 5435 |
| 470 | Ga0466963_0021793 | 3300044694 | Bacteria | 4047 |
| 471 | Ga0466963_0092669 | 3300044694 | Bacteria | 2059 |
| 472 | Ga0466963_0235970 | 3300044694 | Bacteria | 1282 |
| 473 | Ga0466963_0263093 | 3300044694 | Bacteria | 1211 |
| 474 | Ga0466963_0316391 | 3300044694 | Bacteria | 1098 |
| 475 | Ga0466964_0062838 | 3300044706 | Bacteria | 1549 |
| 476 | Ga0466964_0249332 | 3300044706 | Bacteria | 875 |
| 477 | Ga0466964_0345125 | 3300044706 | Bacteria | 763 |
| 478 | Ga0466964_0550780 | 3300044706 | Bacteria | 626 |
| 479 | Ga0466971_0135543 | 3300044719 | Bacteria | 1145 |
| 480 | Ga0466971_0232982 | 3300044719 | Bacteria | 875 |
| 481 | Ga0466971_0295997 | 3300044719 | Bacteria | 776 |
| 482 | Ga0466971_0357709 | 3300044719 | Bacteria | 707 |
| 483 | Ga0466971_0631924 | 3300044719 | Bacteria | 535 |
| 484 | Ga0466968_0081768 | 3300044735 | Bacteria | 1420 |
| 485 | Ga0466968_0109639 | 3300044735 | Bacteria | 1240 |
| 486 | Ga0466968_0172288 | 3300044735 | Bacteria | 1003 |
| 487 | Ga0466968_0214955 | 3300044735 | Bacteria | 904 |
| 488 | Ga0466968_0435662 | 3300044735 | Bacteria | 646 |
| 489 | Ga0466968_0503744 | 3300044735 | Bacteria | 604 |
| 490 | Ga0466970_0016616 | 3300044765 | Bacteria | 3797 |
| 491 | Ga0466970_0070219 | 3300044765 | Bacteria | 1883 |
| 492 | Ga0466970_0273002 | 3300044765 | Bacteria | 950 |
| 493 | Ga0466970_0333917 | 3300044765 | Bacteria | 858 |
| 494 | Ga0466957_0026899 | 3300044842 | Bacteria | 3415 |
| 495 | Ga0466957_0054949 | 3300044842 | Bacteria | 2432 |
| 496 | Ga0466957_0151759 | 3300044842 | Bacteria | 1499 |
| 497 | Ga0466957_0297956 | 3300044842 | Bacteria | 1083 |
| 498 | Ga0466957_0459517 | 3300044842 | Bacteria | 878 |
| 499 | Ga0466957_0638840 | 3300044842 | Bacteria | 748 |
| 500 | Ga0466957_0674006 | 3300044842 | Bacteria | 728 |
| 501 | Ga0466957_0750043 | 3300044842 | Bacteria | 691 |
| 502 | Ga0466957_1075263 | 3300044842 | Bacteria | 579 |
| 503 | Ga0466959_0009134 | 3300045049 | Bacteria | 7040 |
| 504 | Ga0466959_0014110 | 3300045049 | Bacteria | 5798 |
| 505 | Ga0466959_0019509 | 3300045049 | Bacteria | 4986 |
| 506 | Ga0466959_0105651 | 3300045049 | Bacteria | 2013 |
| 507 | Ga0466959_0123556 | 3300045049 | Bacteria | 1838 |
| 508 | Ga0466959_0126886 | 3300045049 | Bacteria | 1811 |
| 509 | Ga0466959_0186337 | 3300045049 | Bacteria | 1450 |
| 510 | Ga0466959_0530305 | 3300045049 | Bacteria | 795 |
| 511 | Ga0466959_0567663 | 3300045049 | Bacteria | 764 |
| 512 | Ga0466959_0640945 | 3300045049 | Bacteria | 713 |
| 513 | Ga0466959_1116573 | 3300045049 | Bacteria | 524 |
| 514 | Ga0466958_0008849 | 3300045836 | Bacteria | 5595 |
| 515 | Ga0466958_0014571 | 3300045836 | Bacteria | 4488 |
| 516 | Ga0466958_0018330 | 3300045836 | Bacteria | 4062 |
| 517 | Ga0466958_0076506 | 3300045836 | Bacteria | 2054 |
| 518 | Ga0466958_0085134 | 3300045836 | Bacteria | 1950 |
| 519 | Ga0466958_0129795 | 3300045836 | Bacteria | 1582 |
| 520 | Ga0466958_0253711 | 3300045836 | Bacteria | 1125 |
| 521 | Ga0466958_0271529 | 3300045836 | Bacteria | 1086 |
| 522 | Ga0466958_0330686 | 3300045836 | Bacteria | 980 |
| 523 | Ga0466958_0345460 | 3300045836 | Bacteria | 957 |
| 524 | Ga0466958_0387199 | 3300045836 | Bacteria | 902 |
| 525 | Ga0466958_0544296 | 3300045836 | Bacteria | 754 |
| 526 | Ga0466967_0002408 | 3300045976 | Bacteria | 11613 |
| 527 | Ga0466967_0005406 | 3300045976 | Bacteria | 8846 |
| 528 | Ga0466967_0162915 | 3300045976 | Bacteria | 2094 |
| 529 | Ga0466967_0198763 | 3300045976 | Bacteria | 1898 |
| 530 | Ga0466967_0213157 | 3300045976 | Bacteria | 1832 |
| 531 | Ga0466967_0926030 | 3300045976 | Bacteria | 867 |
| 532 | Ga0466967_1082599 | 3300045976 | Bacteria | 798 |
| 533 | Ga0466967_2296999 | 3300045976 | Bacteria | 535 |
| 534 | Ga0466967_2319748 | 3300045976 | Bacteria | 532 |
| 535 | Ga0495590_0166854 | 3300046457 | Bacteria | 802 |
| 536 | Ga0495653_0002457 | 3300046463 | Bacteria | 14725 |
| 537 | Ga0495653_0524043 | 3300046463 | Bacteria | 736 |
| 538 | Ga0495582_0367491 | 3300046473 | Bacteria | 829 |
| 539 | Ga0495664_0000007 | 3300046477 | Bacteria | 386710 |
| 540 | Ga0495664_0436072 | 3300046477 | Bacteria | 785 |
| 541 | Ga0495664_0485182 | 3300046477 | Bacteria | 739 |
| 542 | Ga0495585_0285941 | 3300046492 | Bacteria | 814 |
| 543 | Ga0495596_0053322 | 3300046500 | Bacteria | 1582 |
| 544 | Ga0495608_0389953 | 3300046511 | Bacteria | 853 |
| 545 | Ga0495618_0000035 | 3300046514 | Bacteria | 102739 |
| 546 | Ga0495620_0209860 | 3300046515 | Bacteria | 747 |
| 547 | Ga0495630_0000610 | 3300046517 | Bacteria | 25880 |
| 548 | Ga0495630_0949901 | 3300046517 | Bacteria | 654 |
| 549 | Ga0495631_0197915 | 3300046518 | Bacteria | 859 |
| 550 | Ga0495643_0088629 | 3300046522 | Bacteria | 1599 |
| 551 | Ga0495644_0080611 | 3300046523 | Bacteria | 1227 |
| 552 | Ga0495644_0132008 | 3300046523 | Bacteria | 952 |
| 553 | Ga0495663_0024643 | 3300046525 | Bacteria | 1750 |
| 554 | Ga0495652_0081348 | 3300046529 | Bacteria | 2672 |
| 555 | Ga0495586_0094048 | 3300046535 | Bacteria | 1658 |
| 556 | Ga0495587_0127170 | 3300046536 | Bacteria | 1458 |
| 557 | Ga0495609_0307552 | 3300046538 | Bacteria | 645 |
| 558 | Ga0495645_0000033 | 3300046543 | Bacteria | 105930 |
| 559 | Ga0495645_0000159 | 3300046543 | Bacteria | 46648 |
| 560 | Ga0495645_0344692 | 3300046543 | Bacteria | 961 |
| 561 | Ga0495633_0264960 | 3300046558 | Bacteria | 783 |
| 562 | Ga0495656_0175950 | 3300046615 | Bacteria | 1049 |
| 563 | Ga0495635_0460670 | 3300046663 | Bacteria | 840 |
| 564 | Ga0495588_0305027 | 3300046674 | Bacteria | 838 |
| 565 | Ga0495657_0000027 | 3300046675 | Bacteria | 131421 |
| 566 | Ga0495657_0306616 | 3300046675 | Bacteria | 946 |
| 567 | Ga0495646_0243138 | 3300046680 | Bacteria | 966 |
| 568 | Ga0495646_0330790 | 3300046680 | Bacteria | 801 |
| 569 | Ga0495669_0220166 | 3300046684 | Bacteria | 910 |
| 570 | Ga0495624_0552101 | 3300046690 | Bacteria | 688 |
| 571 | Ga0495670_0168519 | 3300046691 | Bacteria | 1153 |
| 572 | Ga0495589_0106285 | 3300046794 | Bacteria | 1356 |
| 573 | Ga0495589_0160991 | 3300046794 | Bacteria | 1069 |
| 574 | Ga0495600_0011832 | 3300046809 | Bacteria | 5449 |
| 575 | Ga0495600_0820330 | 3300046809 | Bacteria | 553 |
| 576 | Ga0495676_0495339 | 3300047321 | Bacteria | 802 |
| 577 | Ga0495680_1012982 | 3300047322 | Bacteria | 530 |
| 578 | Ga0495685_166922 | 3300047447 | Bacteria | 712 |
| 579 | Ga0495686_0416296 | 3300047472 | Bacteria | 719 |
| 580 | Ga0495615_0262081 | 3300048090 | Bacteria | 551 |
| 581 | Ga0496100_0001215 | 3300048903 | Bacteria | 12520 |
| 582 | Ga0496101_0394172 | 3300048904 | Bacteria | 1090 |
| 583 | Ga0496101_0502460 | 3300048904 | Bacteria | 958 |
| 584 | Ga0496101_1332697 | 3300048904 | Bacteria | 561 |
| 585 | Ga0496102_0000002 | 3300048905 | Bacteria | 814588 |
| 586 | Ga0496102_0385249 | 3300048905 | Bacteria | 1319 |
| 587 | Ga0496102_0535385 | 3300048905 | Bacteria | 1094 |
| 588 | Ga0496102_0612487 | 3300048905 | Bacteria | 1012 |
| 589 | Ga0496102_0777672 | 3300048905 | Bacteria | 880 |
| 590 | Ga0496103_0000017 | 3300048906 | Bacteria | 244768 |
| 591 | Ga0496103_0401828 | 3300048906 | Bacteria | 880 |
| 592 | Ga0496104_0000001 | 3300048907 | Bacteria | 711867 |
| 593 | Ga0496104_0576220 | 3300048907 | Bacteria | 1036 |
| 594 | Ga0496104_1528916 | 3300048907 | Bacteria | 570 |
| 595 | Ga0496105_0218944 | 3300048908 | Bacteria | 1550 |
| 596 | Ga0496105_0292086 | 3300048908 | Bacteria | 1312 |
| 597 | Ga0496105_0696822 | 3300048908 | Bacteria | 780 |
| 598 | Ga0496105_0831945 | 3300048908 | Bacteria | 700 |
| 599 | Ga0496106_0963957 | 3300048909 | Bacteria | 672 |
| 600 | Ga0496107_0140213 | 3300048910 | Bacteria | 1787 |
| 601 | Ga0496107_0370657 | 3300048910 | Bacteria | 1065 |
| 602 | Ga0496108_0462407 | 3300048911 | Bacteria | 1108 |
| 603 | Ga0496108_0645387 | 3300048911 | Bacteria | 920 |
| 604 | Ga0496109_0238485 | 3300048912 | Bacteria | 1711 |
| 605 | Ga0496110_0000152 | 3300048913 | Bacteria | 41561 |
| 606 | Ga0496110_0047309 | 3300048913 | Bacteria | 3766 |
| 607 | Ga0496110_0619147 | 3300048913 | Bacteria | 981 |
| 608 | Ga0496111_0000123 | 3300048914 | Bacteria | 33765 |
| 609 | Ga0496111_0335987 | 3300048914 | Bacteria | 1118 |
| 610 | Ga0496112_0103136 | 3300048915 | Bacteria | 2822 |
| 611 | Ga0496112_1056837 | 3300048915 | Bacteria | 731 |
| 612 | Ga0496113_0120615 | 3300048916 | Bacteria | 2050 |
| 613 | Ga0496114_0328950 | 3300048917 | Bacteria | 1351 |
| 614 | Ga0496114_0485472 | 3300048917 | Bacteria | 1093 |
| 615 | Ga0496114_1574300 | 3300048917 | Bacteria | 545 |
| 616 | Ga0496115_0000258 | 3300048918 | Bacteria | 47079 |
| 617 | Ga0496115_0013335 | 3300048918 | Bacteria | 6217 |
| 618 | Ga0496115_0948040 | 3300048918 | Bacteria | 661 |
| 619 | Ga0496123_0131159 | 3300048926 | Bacteria | 1388 |
| 620 | Ga0501306_091840 | 3300049127 | Bacteria | 534 |
| 621 | Ga0501300_061016 | 3300049523 | Bacteria | 597 |
| 622 | Ga0501031_0034173 | 3300049568 | Bacteria | 3318 |
| 623 | Ga0501032_0001419 | 3300049569 | Bacteria | 19025 |
| 624 | Ga0501032_0842708 | 3300049569 | Bacteria | 578 |
| 625 | Ga0501033_0026435 | 3300049570 | Bacteria | 4368 |
| 626 | Ga0501034_0019312 | 3300049571 | Bacteria | 6973 |
| 627 | Ga0501036_0023794 | 3300049572 | Bacteria | 5161 |
| 628 | Ga0501037_0021875 | 3300049573 | Bacteria | 4733 |
| 629 | Ga0501038_0014761 | 3300049574 | Bacteria | 7117 |
| 630 | Ga0501039_0132069 | 3300049575 | Bacteria | 1959 |
| 631 | Ga0501041_0239420 | 3300049577 | Bacteria | 1140 |
| 632 | Ga0501042_0001923 | 3300049578 | Bacteria | 12499 |
| 633 | Ga0501043_0104612 | 3300049579 | Bacteria | 2224 |
| 634 | Ga0501043_0435476 | 3300049579 | Bacteria | 987 |
| 635 | Ga0501046_0008154 | 3300049580 | Bacteria | 9150 |
| 636 | Ga0501047_0043981 | 3300049581 | Bacteria | 4313 |
| 637 | Ga0501047_0082923 | 3300049581 | Bacteria | 3081 |
| 638 | Ga0501047_0903150 | 3300049581 | Bacteria | 697 |
| 639 | Ga0501048_0002360 | 3300049582 | Bacteria | 14414 |
| 640 | Ga0501048_0923485 | 3300049582 | Bacteria | 628 |
| 641 | Ga0501067_0015994 | 3300049583 | Bacteria | 4150 |
| 642 | Ga0501067_0689895 | 3300049583 | Bacteria | 574 |
| 643 | Ga0501068_0048751 | 3300049584 | Bacteria | 2557 |
| 644 | Ga0501068_0150346 | 3300049584 | Bacteria | 1463 |
| 645 | Ga0501069_0030830 | 3300049585 | Bacteria | 2946 |
| 646 | Ga0501069_0081305 | 3300049585 | Bacteria | 1825 |
| 647 | Ga0501069_0141407 | 3300049585 | Bacteria | 1381 |
| 648 | Ga0501069_0869857 | 3300049585 | Bacteria | 548 |
| 649 | Ga0501070_0027023 | 3300049586 | Bacteria | 4813 |
| 650 | Ga0501071_0281722 | 3300049587 | Bacteria | 1258 |
| 651 | Ga0501072_0034435 | 3300049588 | Bacteria | 3970 |
| 652 | Ga0501072_0541254 | 3300049588 | Bacteria | 920 |
| 653 | Ga0501073_0005329 | 3300049589 | Bacteria | 9645 |
| 654 | Ga0501073_0132458 | 3300049589 | Bacteria | 1728 |
| 655 | Ga0501073_0716394 | 3300049589 | Bacteria | 690 |
| 656 | Ga0501074_0079553 | 3300049590 | Bacteria | 2352 |
| 657 | Ga0501074_0154061 | 3300049590 | Bacteria | 1642 |
| 658 | Ga0501075_0328392 | 3300049591 | Bacteria | 1166 |
| 659 | Ga0501075_0926867 | 3300049591 | Bacteria | 662 |
| 660 | Ga0501076_0271774 | 3300049592 | Bacteria | 1388 |
| 661 | Ga0501198_049626 | 3300049649 | Bacteria | 745 |
| 662 | Ga0501202_028277 | 3300049652 | Bacteria | 1157 |
| 663 | Ga0501225_0255530 | 3300049705 | Bacteria | 578 |
| 664 | Ga0501079_0082592 | 3300049741 | Bacteria | 2485 |
| 665 | Ga0501079_0120171 | 3300049741 | Bacteria | 2043 |
| 666 | Ga0501080_0038231 | 3300049742 | Bacteria | 4481 |
| 667 | Ga0501080_0060612 | 3300049742 | Bacteria | 3522 |
| 668 | Ga0501083_0021040 | 3300049744 | Bacteria | 4534 |
| 669 | Ga0501083_0718693 | 3300049744 | Bacteria | 650 |
| 670 | Ga0501083_0811563 | 3300049744 | Bacteria | 609 |
| 671 | Ga0501035_0026409 | 3300049822 | Bacteria | 5312 |
| 672 | Ga0501044_0046126 | 3300049823 | Bacteria | 4513 |
| 673 | nmdc:mga00v17_233674_c1 | 3300050491 | Bacteria | 1191 |
| 674 | nmdc:mga0yw44_368517_c1 | 3300050492 | Bacteria | 969 |
| 675 | nmdc:mga05p37_1061659_c1 | 3300050507 | Bacteria | 853 |
| 676 | nmdc:mga05p37_1064446_c1 | 3300050507 | Bacteria | 851 |
| 677 | nmdc:mga05p37_1563070_c1 | 3300050507 | Bacteria | 652 |
| 678 | nmdc:mga05p37_761789_c1 | 3300050507 | Bacteria | 1065 |
| 679 | nmdc:mga09592_108160_c1 | 3300050508 | Bacteria | 2385 |
| 680 | nmdc:mga09592_780712_c1 | 3300050508 | Bacteria | 809 |
| 681 | nmdc:mga0qj67_1179658_c1 | 3300050509 | Bacteria | 596 |
| 682 | nmdc:mga0qj67_12200_c1 | 3300050509 | Bacteria | 6467 |
| 683 | nmdc:mga0qj67_697275_c1 | 3300050509 | Bacteria | 808 |
| 684 | nmdc:mga0qj67_766591_c1 | 3300050509 | Bacteria | 765 |
| 685 | nmdc:mga0qj67_938869_c1 | 3300050509 | Bacteria | 680 |
| 686 | nmdc:mga08y16_275095_c1 | 3300050511 | Bacteria | 1738 |
| 687 | nmdc:mga08y16_427549_c1 | 3300050511 | Bacteria | 1353 |
| 688 | nmdc:mga0a205_1075773_c1 | 3300050515 | Bacteria | 651 |
| 689 | nmdc:mga0a205_797555_c1 | 3300050515 | Bacteria | 792 |
| 690 | Ga0495601_0357794 | 3300053077 | Bacteria | 949 |
| 691 | Ga0495601_0504949 | 3300053077 | Bacteria | 780 |
| 692 | Ga0495655_0008046 | 3300053083 | Bacteria | 1988 |
| 693 | Ga0495655_0120668 | 3300053083 | Bacteria | 797 |
| 694 | Ga0495619_0158223 | 3300053085 | Bacteria | 1564 |
| 695 | Ga0495619_0533917 | 3300053085 | Bacteria | 805 |
| 696 | Ga0495619_0699628 | 3300053085 | Bacteria | 689 |
| 697 | Ga0495619_0868793 | 3300053085 | Bacteria | 608 |
| 698 | Ga0495619_1186930 | 3300053085 | Bacteria | 506 |
| 699 | Ga0500641_0114552 | 3300053096 | Bacteria | 1161 |
| 700 | Ga0500641_0277123 | 3300053096 | Bacteria | 696 |
| 701 | Ga0501084_0088731 | 3300054114 | Bacteria | 2596 |
| 702 | Ga0501084_1383447 | 3300054114 | Bacteria | 589 |
| 703 | Ga0590071_144989 | 3300059421 | Bacteria | 614 |
| 704 | Ga0590075_059045 | 3300059424 | Bacteria | 988 |
| 705 | Ga0587084_053854 | 3300059477 | Bacteria | 719 |
| 706 | Ga0587093_014885 | 3300059478 | Bacteria | 976 |
| 707 | Ga0587066_047517 | 3300059490 | Bacteria | 832 |
| 708 | Ga0587066_105945 | 3300059490 | Bacteria | 646 |
| 709 | Ga0587070_095587 | 3300059491 | Bacteria | 675 |
| 710 | Ga0587073_0132035 | 3300059492 | Bacteria | 687 |
| 711 | Ga0587077_117187 | 3300059493 | Bacteria | 660 |
| 712 | Ga0587077_118160 | 3300059493 | Bacteria | 658 |
| 713 | Ga0587080_019869 | 3300059503 | Bacteria | 1091 |
| 714 | Ga0587082_117078 | 3300059504 | Bacteria | 598 |
| 715 | Ga0587082_153156 | 3300059504 | Bacteria | 547 |
| 716 | Ga0587082_195456 | 3300059504 | Bacteria | 503 |
| 717 | Ga0587083_0038830 | 3300059505 | Bacteria | 986 |
| 718 | Ga0587083_0067777 | 3300059505 | Bacteria | 821 |
| 719 | Ga0587083_0069002 | 3300059505 | Bacteria | 816 |
| 720 | Ga0587083_0262681 | 3300059505 | Bacteria | 519 |
| 721 | Ga0587085_085026 | 3300059506 | Bacteria | 644 |
| 722 | Ga0587085_103493 | 3300059506 | Bacteria | 604 |
| 723 | Ga0587085_127256 | 3300059506 | Bacteria | 566 |
| 724 | Ga0587086_048068 | 3300059507 | Bacteria | 680 |
| 725 | Ga0587088_100566 | 3300059508 | Bacteria | 645 |
| 726 | Ga0587089_047168 | 3300059509 | Bacteria | 682 |
| 727 | Ga0587090_068847 | 3300059510 | Bacteria | 687 |
| 728 | Ga0587090_089920 | 3300059510 | Bacteria | 628 |
| 729 | Ga0587091_087291 | 3300059511 | Bacteria | 710 |
| 730 | Ga0587091_148730 | 3300059511 | Bacteria | 593 |
| 731 | Ga0587098_083523 | 3300059604 | Bacteria | 535 |
| 732 | Ga0587106_046646 | 3300059605 | Bacteria | 755 |
| 733 | Ga0587115_042577 | 3300059626 | Bacteria | 714 |
| 734 | Ga0587117_045152 | 3300059627 | Bacteria | 715 |
| 735 | Ga0587128_077506 | 3300059630 | Bacteria | 659 |
| 736 | Ga0587128_085959 | 3300059630 | Bacteria | 637 |
| 737 | Ga0587128_111147 | 3300059630 | Bacteria | 586 |
| 738 | Ga0587128_120517 | 3300059630 | Bacteria | 571 |
| 739 | Ga0587128_142329 | 3300059630 | Bacteria | 540 |
| 740 | Ga0587130_029628 | 3300059631 | Bacteria | 626 |
| 741 | Ga0587067_075553 | 3300059640 | Bacteria | 736 |
| 742 | Ga0587068_045948 | 3300059641 | Bacteria | 804 |
| 743 | Ga0587068_047189 | 3300059641 | Bacteria | 796 |
| 744 | Ga0587075_048811 | 3300059644 | Bacteria | 732 |
| 745 | Ga0587076_091514 | 3300059645 | Bacteria | 666 |
| 746 | Ga0587076_121773 | 3300059645 | Bacteria | 605 |
| 747 | Ga0587079_089135 | 3300059647 | Bacteria | 719 |
| 748 | Ga0587079_098913 | 3300059647 | Bacteria | 694 |
| 749 | Ga0587100_019026 | 3300059648 | Bacteria | 656 |
| 750 | Ga0587114_079771 | 3300059655 | Bacteria | 607 |
| 751 | Ga0587119_046021 | 3300059658 | Bacteria | 640 |
| 752 | Ga0587071_039236 | 3300060344 | Bacteria | 943 |
| 753 | Ga0587071_042087 | 3300060344 | Bacteria | 919 |
| 754 | Ga0587071_094709 | 3300060344 | Bacteria | 683 |
| 755 | Ga0587071_167645 | 3300060344 | Bacteria | 556 |
| 756 | Ga0587111_0073488 | 3300060346 | Bacteria | 803 |
| 757 | Ga0587111_0239058 | 3300060346 | Bacteria | 532 |
| 758 | Ga0501082_0039856 | 3300060353 | Bacteria | 4052 |
| 759 | Ga0466962_0014349 | 3300061719 | Bacteria | 3819 |
| 760 | Ga0466962_0015342 | 3300061719 | Bacteria | 3694 |
| 761 | Ga0466962_0046924 | 3300061719 | Bacteria | 2064 |
| 762 | Ga0466962_0107606 | 3300061719 | Bacteria | 1341 |
| 763 | Ga0466962_0275007 | 3300061719 | Bacteria | 831 |
| 764 | Ga0466962_0350587 | 3300061719 | Bacteria | 735 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300059511 | Ga0587091_148730 | Ga0587091_148730_40_423 | 118 |
| 2 | 3300031911 | Ga0307412_11935075 | Ga0307412_119350752 | 122 |
| 3 | 3300049569 | Ga0501032_0842708 | Ga0501032_0842708_112_480 | 122 |
| 4 | 3300049581 | Ga0501047_0043981 | Ga0501047_0043981_1081_1449 | 122 |
| 5 | 3300049585 | Ga0501069_0141407 | Ga0501069_0141407_673_1041 | 122 |
| 6 | 3300049589 | Ga0501073_0132458 | Ga0501073_0132458_688_1056 | 122 |
| 7 | 3300049744 | Ga0501083_0718693 | Ga0501083_0718693_262_630 | 122 |
| 8 | 3300003308 | Ga0006777J48905_1063153 | Ga0006777J48905_10631531 | 123 |
| 9 | 3300003544 | Ga0007417J51691_1056724 | Ga0007417J51691_10567241 | 123 |
| 10 | 3300003577 | Ga0007416J51690_1064679 | Ga0007416J51690_10646791 | 123 |
| 11 | 3300003579 | Ga0007429J51699_1054942 | Ga0007429J51699_10549422 | 123 |
| 12 | 3300003693 | Ga0032354_1055984 | Ga0032354_10559841 | 123 |
| 13 | 3300004798 | Ga0058859_11782233 | Ga0058859_117822331 | 123 |
| 14 | 3300005456 | Ga0070678_100000830 | Ga0070678_1000008302 | 123 |
| 15 | 3300005545 | Ga0070695_100369828 | Ga0070695_1003698282 | 123 |
| 16 | 3300005546 | Ga0070696_100042297 | Ga0070696_1000422971 | 123 |
| 17 | 3300005617 | Ga0068859_102381056 | Ga0068859_1023810561 | 123 |
| 18 | 3300005983 | Ga0081540_1149021 | Ga0081540_11490212 | 123 |
| 19 | 3300006931 | Ga0097620_102380962 | Ga0097620_1023809621 | 123 |
| 20 | 3300009148 | Ga0105243_10234625 | Ga0105243_102346251 | 123 |
| 21 | 3300009148 | Ga0105243_10817676 | Ga0105243_108176763 | 123 |
| 22 | 3300009176 | Ga0105242_11237829 | Ga0105242_112378292 | 123 |
| 23 | 3300009553 | Ga0105249_10514192 | Ga0105249_105141921 | 123 |
| 24 | 3300011119 | Ga0105246_11246359 | Ga0105246_112463591 | 123 |
| 25 | 3300025934 | Ga0207686_10759341 | Ga0207686_107593413 | 123 |
| 26 | 3300025942 | Ga0207689_10489602 | Ga0207689_104896021 | 123 |
| 27 | 3300025961 | Ga0207712_10717494 | Ga0207712_107174942 | 123 |
| 28 | 3300026088 | Ga0207641_12106298 | Ga0207641_121062981 | 123 |
| 29 | 3300026118 | Ga0207675_101285499 | Ga0207675_1012854992 | 123 |
| 30 | 3300026142 | Ga0207698_11304754 | Ga0207698_113047542 | 123 |
| 31 | 3300028380 | Ga0268265_10261569 | Ga0268265_102615693 | 123 |
| 32 | 3300028563 | Ga0265319_1119056 | Ga0265319_11190562 | 123 |
| 33 | 3300028654 | Ga0265322_10095602 | Ga0265322_100956022 | 123 |
| 34 | 3300031240 | Ga0265320_10011831 | Ga0265320_100118318 | 123 |
| 35 | 3300031240 | Ga0265320_10335286 | Ga0265320_103352861 | 123 |
| 36 | 3300031250 | Ga0265331_10503127 | Ga0265331_105031272 | 123 |
| 37 | 3300031711 | Ga0265314_10167811 | Ga0265314_101678112 | 123 |
| 38 | 3300031712 | Ga0265342_10399056 | Ga0265342_103990561 | 123 |
| 39 | 3300046473 | Ga0495582_0367491 | Ga0495582_0367491_55_426 | 123 |
| 40 | 3300046511 | Ga0495608_0389953 | Ga0495608_0389953_389_760 | 123 |
| 41 | 3300046523 | Ga0495644_0132008 | Ga0495644_0132008_294_665 | 123 |
| 42 | 3300046663 | Ga0495635_0460670 | Ga0495635_0460670_243_614 | 123 |
| 43 | 3300046794 | Ga0495589_0160991 | Ga0495589_0160991_436_807 | 123 |
| 44 | 3300048904 | Ga0496101_1332697 | Ga0496101_1332697_120_491 | 123 |
| 45 | 3300048905 | Ga0496102_0612487 | Ga0496102_0612487_343_714 | 123 |
| 46 | 3300048909 | Ga0496106_0963957 | Ga0496106_0963957_40_411 | 123 |
| 47 | 3300048910 | Ga0496107_0140213 | Ga0496107_0140213_576_947 | 123 |
| 48 | 3300048911 | Ga0496108_0645387 | Ga0496108_0645387_291_662 | 123 |
| 49 | 3300048913 | Ga0496110_0619147 | Ga0496110_0619147_411_782 | 123 |
| 50 | 3300049577 | Ga0501041_0239420 | Ga0501041_0239420_565_936 | 123 |
| 51 | 3300049579 | Ga0501043_0435476 | Ga0501043_0435476_158_529 | 123 |
| 52 | 3300049581 | Ga0501047_0903150 | Ga0501047_0903150_238_609 | 123 |
| 53 | 3300049588 | Ga0501072_0541254 | Ga0501072_0541254_165_536 | 123 |
| 54 | 3300049590 | Ga0501074_0079553 | Ga0501074_0079553_1329_1700 | 123 |
| 55 | 3300049592 | Ga0501076_0271774 | Ga0501076_0271774_150_521 | 123 |
| 56 | 3300049741 | Ga0501079_0082592 | Ga0501079_0082592_632_1003 | 123 |
| 57 | 3300049744 | Ga0501083_0811563 | Ga0501083_0811563_210_581 | 123 |
| 58 | 3300053096 | Ga0500641_0277123 | Ga0500641_0277123_235_606 | 123 |
| 59 | 3300054114 | Ga0501084_1383447 | Ga0501084_1383447_63_434 | 123 |
| 60 | 3300059493 | Ga0587077_118160 | Ga0587077_118160_175_546 | 123 |
| 61 | 3300059504 | Ga0587082_153156 | Ga0587082_153156_149_520 | 123 |
| 62 | 3300059506 | Ga0587085_127256 | Ga0587085_127256_114_485 | 123 |
| 63 | 3300059510 | Ga0587090_089920 | Ga0587090_089920_232_603 | 123 |
| 64 | 3300059658 | Ga0587119_046021 | Ga0587119_046021_219_590 | 123 |
| 65 | 3300006844 | Ga0075428_100935741 | Ga0075428_1009357411 | 124 |
| 66 | 3300041458 | Ga0451798_0485314 | Ga0451798_0485314_98_472 | 124 |
| 67 | 3300049127 | Ga0501306_091840 | Ga0501306_091840_48_422 | 124 |
| 68 | 3300005564 | Ga0070664_100123830 | Ga0070664_1001238303 | 125 |
| 69 | 3300006914 | Ga0075436_101495819 | Ga0075436_1014958191 | 125 |
| 70 | 3300025920 | Ga0207649_10646531 | Ga0207649_106465313 | 125 |
| 71 | 3300025945 | Ga0207679_10043796 | Ga0207679_100437965 | 125 |
| 72 | 3300028800 | Ga0265338_10075957 | Ga0265338_100759574 | 125 |
| 73 | 3300039437 | Ga0436365_1469372 | Ga0436365_1469372_656_1033 | 125 |
| 74 | 3300039450 | Ga0436363_0376788 | Ga0436363_0376788_429_806 | 125 |
| 75 | 3300048905 | Ga0496102_0535385 | Ga0496102_0535385_447_824 | 125 |
| 76 | 3300048908 | Ga0496105_0696822 | Ga0496105_0696822_360_737 | 125 |
| 77 | 3300048918 | Ga0496115_0000258 | Ga0496115_0000258_2251_2628 | 125 |
| 78 | 3300048918 | Ga0496115_0013335 | Ga0496115_0013335_3592_3969 | 125 |
| 79 | 3300048926 | Ga0496123_0131159 | Ga0496123_0131159_815_1192 | 125 |
| 80 | 3300049591 | Ga0501075_0328392 | Ga0501075_0328392_195_572 | 125 |
| 81 | 3300005457 | Ga0070662_101526355 | Ga0070662_1015263551 | 126 |
| 82 | 3300005545 | Ga0070695_100676321 | Ga0070695_1006763212 | 126 |
| 83 | 3300005718 | Ga0068866_11264619 | Ga0068866_112646192 | 126 |
| 84 | 3300006846 | Ga0075430_100647440 | Ga0075430_1006474401 | 126 |
| 85 | 3300006846 | Ga0075430_101179430 | Ga0075430_1011794301 | 126 |
| 86 | 3300009093 | Ga0105240_10006736 | Ga0105240_100067363 | 126 |
| 87 | 3300009098 | Ga0105245_10235778 | Ga0105245_102357782 | 126 |
| 88 | 3300009174 | Ga0105241_10309942 | Ga0105241_103099423 | 126 |
| 89 | 3300009174 | Ga0105241_11850817 | Ga0105241_118508171 | 126 |
| 90 | 3300009553 | Ga0105249_10349025 | Ga0105249_103490252 | 126 |
| 91 | 3300014326 | Ga0157380_10932425 | Ga0157380_109324251 | 126 |
| 92 | 3300020070 | Ga0206356_10449285 | Ga0206356_104492854 | 126 |
| 93 | 3300020075 | Ga0206349_1914227 | Ga0206349_19142272 | 126 |
| 94 | 3300025899 | Ga0207642_10771549 | Ga0207642_107715491 | 126 |
| 95 | 3300025911 | Ga0207654_10908541 | Ga0207654_109085412 | 126 |
| 96 | 3300025913 | Ga0207695_10023985 | Ga0207695_100239858 | 126 |
| 97 | 3300025933 | Ga0207706_10850026 | Ga0207706_108500261 | 126 |
| 98 | 3300025933 | Ga0207706_11294405 | Ga0207706_112944051 | 126 |
| 99 | 3300032126 | Ga0307415_102503742 | Ga0307415_1025037421 | 126 |
| 100 | 3300035725 | Ga0373947_0174086 | Ga0373947_0174086_565_945 | 126 |
| 101 | 3300039437 | Ga0436365_0143115 | Ga0436365_0143115_75_455 | 126 |
| 102 | 3300046477 | Ga0495664_0000007 | Ga0495664_0000007_136191_136571 | 126 |
| 103 | 3300046529 | Ga0495652_0081348 | Ga0495652_0081348_171_551 | 126 |
| 104 | 3300046535 | Ga0495586_0094048 | Ga0495586_0094048_1002_1382 | 126 |
| 105 | 3300046809 | Ga0495600_0011832 | Ga0495600_0011832_4644_5024 | 126 |
| 106 | 3300048905 | Ga0496102_0000002 | Ga0496102_0000002_635117_635497 | 126 |
| 107 | 3300048906 | Ga0496103_0000017 | Ga0496103_0000017_228334_228714 | 126 |
| 108 | 3300048907 | Ga0496104_0000001 | Ga0496104_0000001_332904_333284 | 126 |
| 109 | 3300048908 | Ga0496105_0292086 | Ga0496105_0292086_363_743 | 126 |
| 110 | 3300048913 | Ga0496110_0000152 | Ga0496110_0000152_32743_33123 | 126 |
| 111 | 3300048914 | Ga0496111_0000123 | Ga0496111_0000123_5552_5932 | 126 |
| 112 | 3300050509 | nmdc:mga0qj67_12200_c1 | nmdc:mga0qj67_12200_c1_6053_6433 | 126 |
| 113 | 3300050509 | nmdc:mga0qj67_766591_c1 | nmdc:mga0qj67_766591_c1_35_415 | 126 |
| 114 | 3300053077 | Ga0495601_0504949 | Ga0495601_0504949_147_527 | 126 |
| 115 | 3300053085 | Ga0495619_0158223 | Ga0495619_0158223_111_491 | 126 |
| 116 | 3300059492 | Ga0587073_0132035 | Ga0587073_0132035_83_463 | 126 |
| 117 | 3300059504 | Ga0587082_117078 | Ga0587082_117078_51_431 | 126 |
| 118 | 3300059507 | Ga0587086_048068 | Ga0587086_048068_219_599 | 126 |
| 119 | 3300059655 | Ga0587114_079771 | Ga0587114_079771_95_475 | 126 |
| 120 | 3300000546 | LJNas_1007467 | LJNas_10074672 | 127 |
| 121 | 3300003544 | Ga0007417J51691_1016750 | Ga0007417J51691_10167502 | 127 |
| 122 | 3300003574 | Ga0007410J51695_1017675 | Ga0007410J51695_10176752 | 127 |
| 123 | 3300003575 | Ga0007409J51694_1011186 | Ga0007409J51694_10111862 | 127 |
| 124 | 3300003577 | Ga0007416J51690_1020405 | Ga0007416J51690_10204052 | 127 |
| 125 | 3300003579 | Ga0007429J51699_1027606 | Ga0007429J51699_10276061 | 127 |
| 126 | 3300003693 | Ga0032354_1007334 | Ga0032354_10073341 | 127 |
| 127 | 3300004799 | Ga0058863_11934614 | Ga0058863_119346142 | 127 |
| 128 | 3300004799 | Ga0058863_11964497 | Ga0058863_119644971 | 127 |
| 129 | 3300004800 | Ga0058861_11992365 | Ga0058861_119923652 | 127 |
| 130 | 3300004803 | Ga0058862_12623738 | Ga0058862_126237381 | 127 |
| 131 | 3300004803 | Ga0058862_12792749 | Ga0058862_127927492 | 127 |
| 132 | 3300005329 | Ga0070683_100330436 | Ga0070683_1003304362 | 127 |
| 133 | 3300005329 | Ga0070683_100479723 | Ga0070683_1004797232 | 127 |
| 134 | 3300005336 | Ga0070680_100585102 | Ga0070680_1005851022 | 127 |
| 135 | 3300005336 | Ga0070680_100775862 | Ga0070680_1007758621 | 127 |
| 136 | 3300005337 | Ga0070682_100404269 | Ga0070682_1004042692 | 127 |
| 137 | 3300005337 | Ga0070682_100930240 | Ga0070682_1009302402 | 127 |
| 138 | 3300005338 | Ga0068868_101635393 | Ga0068868_1016353931 | 127 |
| 139 | 3300005343 | Ga0070687_100538208 | Ga0070687_1005382082 | 127 |
| 140 | 3300005344 | Ga0070661_100370971 | Ga0070661_1003709711 | 127 |
| 141 | 3300005345 | Ga0070692_10005318 | Ga0070692_100053184 | 127 |
| 142 | 3300005345 | Ga0070692_11053737 | Ga0070692_110537372 | 127 |
| 143 | 3300005355 | Ga0070671_101455884 | Ga0070671_1014558841 | 127 |
| 144 | 3300005366 | Ga0070659_100000160 | Ga0070659_10000016026 | 127 |
| 145 | 3300005366 | Ga0070659_100395794 | Ga0070659_1003957942 | 127 |
| 146 | 3300005366 | Ga0070659_100484767 | Ga0070659_1004847671 | 127 |
| 147 | 3300005366 | Ga0070659_101404006 | Ga0070659_1014040062 | 127 |
| 148 | 3300005434 | Ga0070709_10511387 | Ga0070709_105113871 | 127 |
| 149 | 3300005434 | Ga0070709_11438456 | Ga0070709_114384561 | 127 |
| 150 | 3300005435 | Ga0070714_100018243 | Ga0070714_1000182434 | 127 |
| 151 | 3300005435 | Ga0070714_100076714 | Ga0070714_1000767144 | 127 |
| 152 | 3300005435 | Ga0070714_100190199 | Ga0070714_1001901992 | 127 |
| 153 | 3300005435 | Ga0070714_100267532 | Ga0070714_1002675323 | 127 |
| 154 | 3300005435 | Ga0070714_100376416 | Ga0070714_1003764162 | 127 |
| 155 | 3300005435 | Ga0070714_100414251 | Ga0070714_1004142512 | 127 |
| 156 | 3300005435 | Ga0070714_100420905 | Ga0070714_1004209052 | 127 |
| 157 | 3300005435 | Ga0070714_100843472 | Ga0070714_1008434722 | 127 |
| 158 | 3300005435 | Ga0070714_101543834 | Ga0070714_1015438341 | 127 |
| 159 | 3300005435 | Ga0070714_101746451 | Ga0070714_1017464511 | 127 |
| 160 | 3300005436 | Ga0070713_100551375 | Ga0070713_1005513751 | 127 |
| 161 | 3300005436 | Ga0070713_100732827 | Ga0070713_1007328273 | 127 |
| 162 | 3300005436 | Ga0070713_101875710 | Ga0070713_1018757101 | 127 |
| 163 | 3300005436 | Ga0070713_102326394 | Ga0070713_1023263941 | 127 |
| 164 | 3300005437 | Ga0070710_10000005 | Ga0070710_10000005111 | 127 |
| 165 | 3300005437 | Ga0070710_10119932 | Ga0070710_101199322 | 127 |
| 166 | 3300005437 | Ga0070710_10202621 | Ga0070710_102026211 | 127 |
| 167 | 3300005437 | Ga0070710_10500829 | Ga0070710_105008291 | 127 |
| 168 | 3300005439 | Ga0070711_100002145 | Ga0070711_10000214513 | 127 |
| 169 | 3300005439 | Ga0070711_100055655 | Ga0070711_1000556553 | 127 |
| 170 | 3300005439 | Ga0070711_100342630 | Ga0070711_1003426302 | 127 |
| 171 | 3300005439 | Ga0070711_100425633 | Ga0070711_1004256332 | 127 |
| 172 | 3300005439 | Ga0070711_100733572 | Ga0070711_1007335722 | 127 |
| 173 | 3300005440 | Ga0070705_100002004 | Ga0070705_1000020046 | 127 |
| 174 | 3300005441 | Ga0070700_100324369 | Ga0070700_1003243693 | 127 |
| 175 | 3300005445 | Ga0070708_100642959 | Ga0070708_1006429592 | 127 |
| 176 | 3300005456 | Ga0070678_102246658 | Ga0070678_1022466581 | 127 |
| 177 | 3300005457 | Ga0070662_100310435 | Ga0070662_1003104353 | 127 |
| 178 | 3300005457 | Ga0070662_100392137 | Ga0070662_1003921372 | 127 |
| 179 | 3300005458 | Ga0070681_10985116 | Ga0070681_109851162 | 127 |
| 180 | 3300005458 | Ga0070681_11393309 | Ga0070681_113933091 | 127 |
| 181 | 3300005466 | Ga0070685_10672070 | Ga0070685_106720702 | 127 |
| 182 | 3300005468 | Ga0070707_100513038 | Ga0070707_1005130383 | 127 |
| 183 | 3300005518 | Ga0070699_101025435 | Ga0070699_1010254352 | 127 |
| 184 | 3300005535 | Ga0070684_100065608 | Ga0070684_1000656084 | 127 |
| 185 | 3300005535 | Ga0070684_100208430 | Ga0070684_1002084304 | 127 |
| 186 | 3300005535 | Ga0070684_101056819 | Ga0070684_1010568192 | 127 |
| 187 | 3300005536 | Ga0070697_100279209 | Ga0070697_1002792093 | 127 |
| 188 | 3300005539 | Ga0068853_100229878 | Ga0068853_1002298783 | 127 |
| 189 | 3300005544 | Ga0070686_100396414 | Ga0070686_1003964143 | 127 |
| 190 | 3300005549 | Ga0070704_100273070 | Ga0070704_1002730702 | 127 |
| 191 | 3300005564 | Ga0070664_101105099 | Ga0070664_1011050992 | 127 |
| 192 | 3300005578 | Ga0068854_100445301 | Ga0068854_1004453012 | 127 |
| 193 | 3300005578 | Ga0068854_101215749 | Ga0068854_1012157491 | 127 |
| 194 | 3300005615 | Ga0070702_100064604 | Ga0070702_1000646042 | 127 |
| 195 | 3300005615 | Ga0070702_100174927 | Ga0070702_1001749272 | 127 |
| 196 | 3300005616 | Ga0068852_100146967 | Ga0068852_1001469672 | 127 |
| 197 | 3300005616 | Ga0068852_100616363 | Ga0068852_1006163632 | 127 |
| 198 | 3300005718 | Ga0068866_10226337 | Ga0068866_102263373 | 127 |
| 199 | 3300005719 | Ga0068861_100273934 | Ga0068861_1002739342 | 127 |
| 200 | 3300005834 | Ga0068851_10377744 | Ga0068851_103777441 | 127 |
| 201 | 3300005842 | Ga0068858_100930244 | Ga0068858_1009302443 | 127 |
| 202 | 3300006028 | Ga0070717_10008688 | Ga0070717_100086887 | 127 |
| 203 | 3300006028 | Ga0070717_10043519 | Ga0070717_100435193 | 127 |
| 204 | 3300006028 | Ga0070717_10288172 | Ga0070717_102881723 | 127 |
| 205 | 3300006028 | Ga0070717_10593391 | Ga0070717_105933912 | 127 |
| 206 | 3300006028 | Ga0070717_10712900 | Ga0070717_107129002 | 127 |
| 207 | 3300006028 | Ga0070717_10759070 | Ga0070717_107590702 | 127 |
| 208 | 3300006028 | Ga0070717_11128867 | Ga0070717_111288672 | 127 |
| 209 | 3300006028 | Ga0070717_11273728 | Ga0070717_112737282 | 127 |
| 210 | 3300006038 | Ga0075365_10178436 | Ga0075365_101784362 | 127 |
| 211 | 3300006051 | Ga0075364_10376256 | Ga0075364_103762562 | 127 |
| 212 | 3300006058 | Ga0075432_10123820 | Ga0075432_101238203 | 127 |
| 213 | 3300006163 | Ga0070715_10217202 | Ga0070715_102172023 | 127 |
| 214 | 3300006173 | Ga0070716_100040774 | Ga0070716_1000407743 | 127 |
| 215 | 3300006173 | Ga0070716_100585981 | Ga0070716_1005859812 | 127 |
| 216 | 3300006175 | Ga0070712_100015327 | Ga0070712_1000153276 | 127 |
| 217 | 3300006175 | Ga0070712_100015527 | Ga0070712_1000155277 | 127 |
| 218 | 3300006175 | Ga0070712_100385985 | Ga0070712_1003859853 | 127 |
| 219 | 3300006175 | Ga0070712_101346287 | Ga0070712_1013462872 | 127 |
| 220 | 3300006358 | Ga0068871_101824694 | Ga0068871_1018246942 | 127 |
| 221 | 3300006844 | Ga0075428_100779757 | Ga0075428_1007797572 | 127 |
| 222 | 3300006846 | Ga0075430_100406030 | Ga0075430_1004060302 | 127 |
| 223 | 3300006880 | Ga0075429_100008266 | Ga0075429_10000826615 | 127 |
| 224 | 3300006881 | Ga0068865_100591571 | Ga0068865_1005915712 | 127 |
| 225 | 3300006881 | Ga0068865_101370202 | Ga0068865_1013702022 | 127 |
| 226 | 3300009011 | Ga0105251_10368456 | Ga0105251_103684561 | 127 |
| 227 | 3300009093 | Ga0105240_11126444 | Ga0105240_111264441 | 127 |
| 228 | 3300009094 | Ga0111539_10371241 | Ga0111539_103712413 | 127 |
| 229 | 3300009094 | Ga0111539_12086955 | Ga0111539_120869551 | 127 |
| 230 | 3300009098 | Ga0105245_10419437 | Ga0105245_104194373 | 127 |
| 231 | 3300009098 | Ga0105245_10435547 | Ga0105245_104355472 | 127 |
| 232 | 3300009098 | Ga0105245_11641151 | Ga0105245_116411512 | 127 |
| 233 | 3300009101 | Ga0105247_10188613 | Ga0105247_101886132 | 127 |
| 234 | 3300009147 | Ga0114129_10410816 | Ga0114129_104108163 | 127 |
| 235 | 3300009147 | Ga0114129_11244710 | Ga0114129_112447101 | 127 |
| 236 | 3300009147 | Ga0114129_11629237 | Ga0114129_116292371 | 127 |
| 237 | 3300009147 | Ga0114129_11732699 | Ga0114129_117326992 | 127 |
| 238 | 3300009148 | Ga0105243_10187204 | Ga0105243_101872044 | 127 |
| 239 | 3300009148 | Ga0105243_10870519 | Ga0105243_108705192 | 127 |
| 240 | 3300009176 | Ga0105242_10386951 | Ga0105242_103869513 | 127 |
| 241 | 3300009545 | Ga0105237_10000795 | Ga0105237_1000079536 | 127 |
| 242 | 3300009551 | Ga0105238_10407094 | Ga0105238_104070942 | 127 |
| 243 | 3300009553 | Ga0105249_11273929 | Ga0105249_112739292 | 127 |
| 244 | 3300010375 | Ga0105239_10052946 | Ga0105239_100529462 | 127 |
| 245 | 3300010375 | Ga0105239_10565745 | Ga0105239_105657452 | 127 |
| 246 | 3300010375 | Ga0105239_10728378 | Ga0105239_107283783 | 127 |
| 247 | 3300011119 | Ga0105246_10047961 | Ga0105246_100479613 | 127 |
| 248 | 3300011119 | Ga0105246_10204294 | Ga0105246_102042942 | 127 |
| 249 | 3300012475 | Ga0157317_1029149 | Ga0157317_10291491 | 127 |
| 250 | 3300013062 | Ga0154010_123301 | Ga0154010_1233012 | 127 |
| 251 | 3300013297 | Ga0157378_12723615 | Ga0157378_127236152 | 127 |
| 252 | 3300013306 | Ga0163162_10855954 | Ga0163162_108559542 | 127 |
| 253 | 3300013306 | Ga0163162_11040097 | Ga0163162_110400972 | 127 |
| 254 | 3300013307 | Ga0157372_10260305 | Ga0157372_102603053 | 127 |
| 255 | 3300013307 | Ga0157372_11027672 | Ga0157372_110276722 | 127 |
| 256 | 3300014326 | Ga0157380_10423884 | Ga0157380_104238842 | 127 |
| 257 | 3300014326 | Ga0157380_10490923 | Ga0157380_104909232 | 127 |
| 258 | 3300014745 | Ga0157377_10295674 | Ga0157377_102956742 | 127 |
| 259 | 3300014745 | Ga0157377_10616970 | Ga0157377_106169702 | 127 |
| 260 | 3300020069 | Ga0197907_10147709 | Ga0197907_101477092 | 127 |
| 261 | 3300020069 | Ga0197907_10147937 | Ga0197907_101479372 | 127 |
| 262 | 3300020069 | Ga0197907_10274865 | Ga0197907_102748652 | 127 |
| 263 | 3300020069 | Ga0197907_10395385 | Ga0197907_103953852 | 127 |
| 264 | 3300020069 | Ga0197907_10604094 | Ga0197907_106040942 | 127 |
| 265 | 3300020069 | Ga0197907_10658254 | Ga0197907_106582542 | 127 |
| 266 | 3300020069 | Ga0197907_10784893 | Ga0197907_107848932 | 127 |
| 267 | 3300020069 | Ga0197907_11199968 | Ga0197907_111999682 | 127 |
| 268 | 3300020069 | Ga0197907_11212975 | Ga0197907_112129753 | 127 |
| 269 | 3300020070 | Ga0206356_10404506 | Ga0206356_104045063 | 127 |
| 270 | 3300020070 | Ga0206356_10702775 | Ga0206356_107027752 | 127 |
| 271 | 3300020070 | Ga0206356_11616220 | Ga0206356_116162202 | 127 |
| 272 | 3300020070 | Ga0206356_11810765 | Ga0206356_118107651 | 127 |
| 273 | 3300020075 | Ga0206349_1284854 | Ga0206349_12848542 | 127 |
| 274 | 3300020076 | Ga0206355_1001847 | Ga0206355_10018473 | 127 |
| 275 | 3300020076 | Ga0206355_1125333 | Ga0206355_11253332 | 127 |
| 276 | 3300020076 | Ga0206355_1206623 | Ga0206355_12066232 | 127 |
| 277 | 3300020076 | Ga0206355_1478742 | Ga0206355_14787421 | 127 |
| 278 | 3300020076 | Ga0206355_1539572 | Ga0206355_15395722 | 127 |
| 279 | 3300020076 | Ga0206355_1619291 | Ga0206355_16192912 | 127 |
| 280 | 3300020077 | Ga0206351_10366003 | Ga0206351_103660031 | 127 |
| 281 | 3300020077 | Ga0206351_10947414 | Ga0206351_109474142 | 127 |
| 282 | 3300020077 | Ga0206351_10952347 | Ga0206351_109523471 | 127 |
| 283 | 3300020078 | Ga0206352_10069301 | Ga0206352_100693012 | 127 |
| 284 | 3300020078 | Ga0206352_10186458 | Ga0206352_101864582 | 127 |
| 285 | 3300020078 | Ga0206352_10475010 | Ga0206352_104750101 | 127 |
| 286 | 3300020078 | Ga0206352_10598505 | Ga0206352_105985052 | 127 |
| 287 | 3300020080 | Ga0206350_10261611 | Ga0206350_102616111 | 127 |
| 288 | 3300020080 | Ga0206350_10437302 | Ga0206350_104373022 | 127 |
| 289 | 3300020080 | Ga0206350_11032215 | Ga0206350_110322152 | 127 |
| 290 | 3300020080 | Ga0206350_11141738 | Ga0206350_111417382 | 127 |
| 291 | 3300020080 | Ga0206350_11597202 | Ga0206350_115972022 | 127 |
| 292 | 3300020081 | Ga0206354_10449146 | Ga0206354_104491462 | 127 |
| 293 | 3300020081 | Ga0206354_10499121 | Ga0206354_104991212 | 127 |
| 294 | 3300020081 | Ga0206354_11218193 | Ga0206354_112181932 | 127 |
| 295 | 3300020081 | Ga0206354_11425170 | Ga0206354_114251702 | 127 |
| 296 | 3300020081 | Ga0206354_11640189 | Ga0206354_116401891 | 127 |
| 297 | 3300020082 | Ga0206353_10120481 | Ga0206353_101204812 | 127 |
| 298 | 3300020082 | Ga0206353_10433378 | Ga0206353_104333784 | 127 |
| 299 | 3300020082 | Ga0206353_10652344 | Ga0206353_106523441 | 127 |
| 300 | 3300020082 | Ga0206353_10994385 | Ga0206353_109943851 | 127 |
| 301 | 3300020082 | Ga0206353_11518563 | Ga0206353_115185633 | 127 |
| 302 | 3300020610 | Ga0154015_1010392 | Ga0154015_10103922 | 127 |
| 303 | 3300020610 | Ga0154015_1183149 | Ga0154015_11831491 | 127 |
| 304 | 3300020610 | Ga0154015_1209516 | Ga0154015_12095161 | 127 |
| 305 | 3300020610 | Ga0154015_1431325 | Ga0154015_14313251 | 127 |
| 306 | 3300020610 | Ga0154015_1489538 | Ga0154015_14895382 | 127 |
| 307 | 3300021377 | Ga0213874_10000186 | Ga0213874_1000018619 | 127 |
| 308 | 3300021377 | Ga0213874_10007135 | Ga0213874_100071354 | 127 |
| 309 | 3300021377 | Ga0213874_10077485 | Ga0213874_100774851 | 127 |
| 310 | 3300021377 | Ga0213874_10308884 | Ga0213874_103088842 | 127 |
| 311 | 3300021384 | Ga0213876_10009713 | Ga0213876_100097135 | 127 |
| 312 | 3300021384 | Ga0213876_10016993 | Ga0213876_100169932 | 127 |
| 313 | 3300021384 | Ga0213876_10169474 | Ga0213876_101694743 | 127 |
| 314 | 3300021384 | Ga0213876_10259435 | Ga0213876_102594351 | 127 |
| 315 | 3300021384 | Ga0213876_10308974 | Ga0213876_103089741 | 127 |
| 316 | 3300021384 | Ga0213876_10517728 | Ga0213876_105177282 | 127 |
| 317 | 3300021384 | Ga0213876_10521368 | Ga0213876_105213681 | 127 |
| 318 | 3300021388 | Ga0213875_10001225 | Ga0213875_1000122517 | 127 |
| 319 | 3300021388 | Ga0213875_10003279 | Ga0213875_100032798 | 127 |
| 320 | 3300021388 | Ga0213875_10006988 | Ga0213875_100069884 | 127 |
| 321 | 3300021388 | Ga0213875_10007028 | Ga0213875_100070283 | 127 |
| 322 | 3300021388 | Ga0213875_10020207 | Ga0213875_100202073 | 127 |
| 323 | 3300021388 | Ga0213875_10046096 | Ga0213875_100460962 | 127 |
| 324 | 3300021388 | Ga0213875_10102614 | Ga0213875_101026143 | 127 |
| 325 | 3300021388 | Ga0213875_10135676 | Ga0213875_101356763 | 127 |
| 326 | 3300021388 | Ga0213875_10137097 | Ga0213875_101370972 | 127 |
| 327 | 3300021388 | Ga0213875_10574069 | Ga0213875_105740691 | 127 |
| 328 | 3300022467 | Ga0224712_10046331 | Ga0224712_100463313 | 127 |
| 329 | 3300022467 | Ga0224712_10137034 | Ga0224712_101370341 | 127 |
| 330 | 3300022467 | Ga0224712_10253464 | Ga0224712_102534642 | 127 |
| 331 | 3300022467 | Ga0224712_10273654 | Ga0224712_102736541 | 127 |
| 332 | 3300022467 | Ga0224712_10281192 | Ga0224712_102811921 | 127 |
| 333 | 3300022467 | Ga0224712_10500389 | Ga0224712_105003892 | 127 |
| 334 | 3300025321 | Ga0207656_10430606 | Ga0207656_104306062 | 127 |
| 335 | 3300025898 | Ga0207692_10000003 | Ga0207692_10000003383 | 127 |
| 336 | 3300025898 | Ga0207692_10059514 | Ga0207692_100595143 | 127 |
| 337 | 3300025898 | Ga0207692_10124873 | Ga0207692_101248732 | 127 |
| 338 | 3300025898 | Ga0207692_10232695 | Ga0207692_102326952 | 127 |
| 339 | 3300025898 | Ga0207692_10985649 | Ga0207692_109856491 | 127 |
| 340 | 3300025899 | Ga0207642_10097226 | Ga0207642_100972263 | 127 |
| 341 | 3300025905 | Ga0207685_10194836 | Ga0207685_101948362 | 127 |
| 342 | 3300025906 | Ga0207699_10120006 | Ga0207699_101200063 | 127 |
| 343 | 3300025914 | Ga0207671_10007459 | Ga0207671_100074593 | 127 |
| 344 | 3300025915 | Ga0207693_10084455 | Ga0207693_100844553 | 127 |
| 345 | 3300025915 | Ga0207693_10118948 | Ga0207693_101189482 | 127 |
| 346 | 3300025915 | Ga0207693_10175259 | Ga0207693_101752592 | 127 |
| 347 | 3300025915 | Ga0207693_10488547 | Ga0207693_104885472 | 127 |
| 348 | 3300025915 | Ga0207693_11002443 | Ga0207693_110024431 | 127 |
| 349 | 3300025916 | Ga0207663_10002651 | Ga0207663_100026516 | 127 |
| 350 | 3300025916 | Ga0207663_10198247 | Ga0207663_101982472 | 127 |
| 351 | 3300025916 | Ga0207663_10371479 | Ga0207663_103714793 | 127 |
| 352 | 3300025916 | Ga0207663_10625858 | Ga0207663_106258582 | 127 |
| 353 | 3300025916 | Ga0207663_10651351 | Ga0207663_106513512 | 127 |
| 354 | 3300025916 | Ga0207663_11135416 | Ga0207663_111354162 | 127 |
| 355 | 3300025919 | Ga0207657_10033580 | Ga0207657_100335806 | 127 |
| 356 | 3300025920 | Ga0207649_10408462 | Ga0207649_104084622 | 127 |
| 357 | 3300025921 | Ga0207652_11813439 | Ga0207652_118134391 | 127 |
| 358 | 3300025922 | Ga0207646_10141568 | Ga0207646_101415682 | 127 |
| 359 | 3300025922 | Ga0207646_10448943 | Ga0207646_104489432 | 127 |
| 360 | 3300025924 | Ga0207694_10674996 | Ga0207694_106749962 | 127 |
| 361 | 3300025927 | Ga0207687_10505568 | Ga0207687_105055682 | 127 |
| 362 | 3300025927 | Ga0207687_11317512 | Ga0207687_113175122 | 127 |
| 363 | 3300025928 | Ga0207700_10125575 | Ga0207700_101255751 | 127 |
| 364 | 3300025928 | Ga0207700_10229152 | Ga0207700_102291523 | 127 |
| 365 | 3300025928 | Ga0207700_10570465 | Ga0207700_105704653 | 127 |
| 366 | 3300025928 | Ga0207700_11190054 | Ga0207700_111900542 | 127 |
| 367 | 3300025929 | Ga0207664_10000020 | Ga0207664_10000020230 | 127 |
| 368 | 3300025929 | Ga0207664_10016090 | Ga0207664_100160904 | 127 |
| 369 | 3300025929 | Ga0207664_10119702 | Ga0207664_101197023 | 127 |
| 370 | 3300025929 | Ga0207664_10274702 | Ga0207664_102747022 | 127 |
| 371 | 3300025929 | Ga0207664_11004377 | Ga0207664_110043772 | 127 |
| 372 | 3300025929 | Ga0207664_11160746 | Ga0207664_111607462 | 127 |
| 373 | 3300025929 | Ga0207664_11443762 | Ga0207664_114437621 | 127 |
| 374 | 3300025929 | Ga0207664_11847877 | Ga0207664_118478771 | 127 |
| 375 | 3300025932 | Ga0207690_10000165 | Ga0207690_1000016538 | 127 |
| 376 | 3300025935 | Ga0207709_10309612 | Ga0207709_103096123 | 127 |
| 377 | 3300025937 | Ga0207669_10537689 | Ga0207669_105376892 | 127 |
| 378 | 3300025938 | Ga0207704_10357620 | Ga0207704_103576203 | 127 |
| 379 | 3300025939 | Ga0207665_10096814 | Ga0207665_100968143 | 127 |
| 380 | 3300025939 | Ga0207665_10403998 | Ga0207665_104039981 | 127 |
| 381 | 3300025939 | Ga0207665_10581610 | Ga0207665_105816102 | 127 |
| 382 | 3300025939 | Ga0207665_11341572 | Ga0207665_113415721 | 127 |
| 383 | 3300025944 | Ga0207661_10047980 | Ga0207661_100479803 | 127 |
| 384 | 3300025944 | Ga0207661_10258788 | Ga0207661_102587883 | 127 |
| 385 | 3300025944 | Ga0207661_10698591 | Ga0207661_106985913 | 127 |
| 386 | 3300025944 | Ga0207661_11004950 | Ga0207661_110049501 | 127 |
| 387 | 3300025944 | Ga0207661_11769097 | Ga0207661_117690971 | 127 |
| 388 | 3300025945 | Ga0207679_10787836 | Ga0207679_107878362 | 127 |
| 389 | 3300025945 | Ga0207679_10959976 | Ga0207679_109599762 | 127 |
| 390 | 3300025972 | Ga0207668_10572013 | Ga0207668_105720132 | 127 |
| 391 | 3300025981 | Ga0207640_10328424 | Ga0207640_103284243 | 127 |
| 392 | 3300025981 | Ga0207640_11109261 | Ga0207640_111092611 | 127 |
| 393 | 3300026035 | Ga0207703_10651625 | Ga0207703_106516252 | 127 |
| 394 | 3300026067 | Ga0207678_10429999 | Ga0207678_104299992 | 127 |
| 395 | 3300026075 | Ga0207708_10354544 | Ga0207708_103545442 | 127 |
| 396 | 3300026078 | Ga0207702_10462383 | Ga0207702_104623831 | 127 |
| 397 | 3300026078 | Ga0207702_11164039 | Ga0207702_111640392 | 127 |
| 398 | 3300026088 | Ga0207641_10380276 | Ga0207641_103802763 | 127 |
| 399 | 3300026089 | Ga0207648_11122393 | Ga0207648_111223932 | 127 |
| 400 | 3300026116 | Ga0207674_10377936 | Ga0207674_103779361 | 127 |
| 401 | 3300026118 | Ga0207675_100191546 | Ga0207675_1001915464 | 127 |
| 402 | 3300026142 | Ga0207698_10059058 | Ga0207698_100590584 | 127 |
| 403 | 3300027907 | Ga0207428_10240031 | Ga0207428_102400312 | 127 |
| 404 | 3300028381 | Ga0268264_11930140 | Ga0268264_119301402 | 127 |
| 405 | 3300028556 | Ga0265337_1000328 | Ga0265337_100032813 | 127 |
| 406 | 3300028558 | Ga0265326_10000874 | Ga0265326_1000087410 | 127 |
| 407 | 3300028563 | Ga0265319_1000863 | Ga0265319_100086328 | 127 |
| 408 | 3300028577 | Ga0265318_10000275 | Ga0265318_1000027534 | 127 |
| 409 | 3300028654 | Ga0265322_10004443 | Ga0265322_100044436 | 127 |
| 410 | 3300028666 | Ga0265336_10000043 | Ga0265336_10000043125 | 127 |
| 411 | 3300028800 | Ga0265338_10000142 | Ga0265338_1000014224 | 127 |
| 412 | 3300028800 | Ga0265338_10314049 | Ga0265338_103140491 | 127 |
| 413 | 3300029957 | Ga0265324_10002249 | Ga0265324_100022496 | 127 |
| 414 | 3300030863 | Ga0265766_1005144 | Ga0265766_10051441 | 127 |
| 415 | 3300031010 | Ga0265771_1015233 | Ga0265771_10152332 | 127 |
| 416 | 3300031235 | Ga0265330_10279511 | Ga0265330_102795112 | 127 |
| 417 | 3300031247 | Ga0265340_10000006 | Ga0265340_10000006125 | 127 |
| 418 | 3300031344 | Ga0265316_10089873 | Ga0265316_100898734 | 127 |
| 419 | 3300031711 | Ga0265314_10073998 | Ga0265314_100739983 | 127 |
| 420 | 3300031731 | Ga0307405_11625222 | Ga0307405_116252222 | 127 |
| 421 | 3300031852 | Ga0307410_11524385 | Ga0307410_115243851 | 127 |
| 422 | 3300031903 | Ga0307407_10634965 | Ga0307407_106349652 | 127 |
| 423 | 3300031903 | Ga0307407_10910688 | Ga0307407_109106881 | 127 |
| 424 | 3300031995 | Ga0307409_101299224 | Ga0307409_1012992241 | 127 |
| 425 | 3300032002 | Ga0307416_103646449 | Ga0307416_1036464491 | 127 |
| 426 | 3300032005 | Ga0307411_10637143 | Ga0307411_106371431 | 127 |
| 427 | 3300035170 | Ga0373943_0972404 | Ga0373943_0972404_71_454 | 127 |
| 428 | 3300035692 | Ga0373935_1269532 | Ga0373935_1269532_129_512 | 127 |
| 429 | 3300036457 | Ga0265778_025158 | Ga0265778_025158_31_414 | 127 |
| 430 | 3300037312 | Ga0395899_0709025 | Ga0395899_0709025_43_426 | 127 |
| 431 | 3300037466 | Ga0395898_0514379 | Ga0395898_0514379_203_586 | 127 |
| 432 | 3300037853 | Ga0436364_0041476 | Ga0436364_0041476_458_841 | 127 |
| 433 | 3300037853 | Ga0436364_0054318 | Ga0436364_0054318_2037_2420 | 127 |
| 434 | 3300037853 | Ga0436364_0095065 | Ga0436364_0095065_1670_2053 | 127 |
| 435 | 3300037853 | Ga0436364_0149301 | Ga0436364_0149301_8651_9034 | 127 |
| 436 | 3300037853 | Ga0436364_0221495 | Ga0436364_0221495_7057_7440 | 127 |
| 437 | 3300037853 | Ga0436364_0295555 | Ga0436364_0295555_726_1109 | 127 |
| 438 | 3300037853 | Ga0436364_0367212 | Ga0436364_0367212_14968_15351 | 127 |
| 439 | 3300037853 | Ga0436364_0369585 | Ga0436364_0369585_298_681 | 127 |
| 440 | 3300037853 | Ga0436364_0531473 | Ga0436364_0531473_592_975 | 127 |
| 441 | 3300037853 | Ga0436364_0637866 | Ga0436364_0637866_1023_1406 | 127 |
| 442 | 3300037853 | Ga0436364_0682897 | Ga0436364_0682897_96_479 | 127 |
| 443 | 3300037853 | Ga0436364_0740129 | Ga0436364_0740129_1826_2209 | 127 |
| 444 | 3300037853 | Ga0436364_0746361 | Ga0436364_0746361_1132_1515 | 127 |
| 445 | 3300037853 | Ga0436364_0764623 | Ga0436364_0764623_1973_2356 | 127 |
| 446 | 3300037853 | Ga0436364_0771931 | Ga0436364_0771931_689_1072 | 127 |
| 447 | 3300037853 | Ga0436364_0839163 | Ga0436364_0839163_7878_8261 | 127 |
| 448 | 3300037853 | Ga0436364_0999256 | Ga0436364_0999256_190_573 | 127 |
| 449 | 3300037853 | Ga0436364_1152751 | Ga0436364_1152751_1369_1752 | 127 |
| 450 | 3300037853 | Ga0436364_1164844 | Ga0436364_1164844_3693_4076 | 127 |
| 451 | 3300038443 | Ga0395901_1411746 | Ga0395901_1411746_111_494 | 127 |
| 452 | 3300039437 | Ga0436365_0120242 | Ga0436365_0120242_120_503 | 127 |
| 453 | 3300039437 | Ga0436365_0172227 | Ga0436365_0172227_97_480 | 127 |
| 454 | 3300039437 | Ga0436365_0222942 | Ga0436365_0222942_4205_4588 | 127 |
| 455 | 3300039437 | Ga0436365_0463391 | Ga0436365_0463391_281_664 | 127 |
| 456 | 3300039437 | Ga0436365_0497321 | Ga0436365_0497321_1541_1924 | 127 |
| 457 | 3300039437 | Ga0436365_0745551 | Ga0436365_0745551_393_776 | 127 |
| 458 | 3300039437 | Ga0436365_0746312 | Ga0436365_0746312_149_532 | 127 |
| 459 | 3300039437 | Ga0436365_1112641 | Ga0436365_1112641_396_779 | 127 |
| 460 | 3300039437 | Ga0436365_1192333 | Ga0436365_1192333_547_930 | 127 |
| 461 | 3300039437 | Ga0436365_1296594 | Ga0436365_1296594_398_781 | 127 |
| 462 | 3300039437 | Ga0436365_1331551 | Ga0436365_1331551_5850_6233 | 127 |
| 463 | 3300039437 | Ga0436365_1544784 | Ga0436365_1544784_2607_2990 | 127 |
| 464 | 3300039437 | Ga0436365_1589280 | Ga0436365_1589280_61_444 | 127 |
| 465 | 3300039437 | Ga0436365_1662543 | Ga0436365_1662543_12613_12996 | 127 |
| 466 | 3300039437 | Ga0436365_1688016 | Ga0436365_1688016_282_665 | 127 |
| 467 | 3300039437 | Ga0436365_1709979 | Ga0436365_1709979_240_623 | 127 |
| 468 | 3300039438 | Ga0436360_0344681 | Ga0436360_0344681_414_797 | 127 |
| 469 | 3300039438 | Ga0436360_0503545 | Ga0436360_0503545_450_833 | 127 |
| 470 | 3300039438 | Ga0436360_1281492 | Ga0436360_1281492_91_474 | 127 |
| 471 | 3300039447 | Ga0436361_0295179 | Ga0436361_0295179_68_451 | 127 |
| 472 | 3300039447 | Ga0436361_0585938 | Ga0436361_0585938_293_676 | 127 |
| 473 | 3300039447 | Ga0436361_0849285 | Ga0436361_0849285_23_406 | 127 |
| 474 | 3300039447 | Ga0436361_1220824 | Ga0436361_1220824_99_482 | 127 |
| 475 | 3300039450 | Ga0436363_0027919 | Ga0436363_0027919_271_654 | 127 |
| 476 | 3300039450 | Ga0436363_0032375 | Ga0436363_0032375_721_1104 | 127 |
| 477 | 3300039450 | Ga0436363_0032926 | Ga0436363_0032926_290_673 | 127 |
| 478 | 3300039450 | Ga0436363_0136874 | Ga0436363_0136874_8987_9370 | 127 |
| 479 | 3300039450 | Ga0436363_0145734 | Ga0436363_0145734_1191_1574 | 127 |
| 480 | 3300039450 | Ga0436363_0180243 | Ga0436363_0180243_731_1114 | 127 |
| 481 | 3300039450 | Ga0436363_0330098 | Ga0436363_0330098_245_628 | 127 |
| 482 | 3300039450 | Ga0436363_0351951 | Ga0436363_0351951_55_438 | 127 |
| 483 | 3300039450 | Ga0436363_0532966 | Ga0436363_0532966_250_633 | 127 |
| 484 | 3300039450 | Ga0436363_0678090 | Ga0436363_0678090_2131_2514 | 127 |
| 485 | 3300039450 | Ga0436363_0889406 | Ga0436363_0889406_382_765 | 127 |
| 486 | 3300039450 | Ga0436363_1003415 | Ga0436363_1003415_151_534 | 127 |
| 487 | 3300039450 | Ga0436363_1115108 | Ga0436363_1115108_16_399 | 127 |
| 488 | 3300039450 | Ga0436363_1187247 | Ga0436363_1187247_31_414 | 127 |
| 489 | 3300039450 | Ga0436363_1191833 | Ga0436363_1191833_410_793 | 127 |
| 490 | 3300039450 | Ga0436363_1392677 | Ga0436363_1392677_294_686 | 127 |
| 491 | 3300039450 | Ga0436363_1401676 | Ga0436363_1401676_979_1362 | 127 |
| 492 | 3300039450 | Ga0436363_1566285 | Ga0436363_1566285_274_657 | 127 |
| 493 | 3300039450 | Ga0436363_1686345 | Ga0436363_1686345_349_732 | 127 |
| 494 | 3300039453 | Ga0436362_0021263 | Ga0436362_0021263_181_564 | 127 |
| 495 | 3300039453 | Ga0436362_0187053 | Ga0436362_0187053_583_966 | 127 |
| 496 | 3300039453 | Ga0436362_0299203 | Ga0436362_0299203_120_503 | 127 |
| 497 | 3300039453 | Ga0436362_0351520 | Ga0436362_0351520_301_684 | 127 |
| 498 | 3300039453 | Ga0436362_0401791 | Ga0436362_0401791_14_397 | 127 |
| 499 | 3300039453 | Ga0436362_0702484 | Ga0436362_0702484_186_569 | 127 |
| 500 | 3300039453 | Ga0436362_0774635 | Ga0436362_0774635_166_549 | 127 |
| 501 | 3300039453 | Ga0436362_0801538 | Ga0436362_0801538_155_538 | 127 |
| 502 | 3300039453 | Ga0436362_1062177 | Ga0436362_1062177_1281_1664 | 127 |
| 503 | 3300041494 | Ga0451837_1551250 | Ga0451837_1551250_109_492 | 127 |
| 504 | 3300041505 | Ga0451849_1412726 | Ga0451849_1412726_124_507 | 127 |
| 505 | 3300041507 | Ga0451851_1253955 | Ga0451851_1253955_137_520 | 127 |
| 506 | 3300041511 | Ga0451855_0958897 | Ga0451855_0958897_39_422 | 127 |
| 507 | 3300044656 | Ga0466969_0135109 | Ga0466969_0135109_65_448 | 127 |
| 508 | 3300044656 | Ga0466969_0154577 | Ga0466969_0154577_89_472 | 127 |
| 509 | 3300044656 | Ga0466969_0256187 | Ga0466969_0256187_319_702 | 127 |
| 510 | 3300044683 | Ga0466965_0209444 | Ga0466965_0209444_157_540 | 127 |
| 511 | 3300044683 | Ga0466965_0241562 | Ga0466965_0241562_444_827 | 127 |
| 512 | 3300044683 | Ga0466965_0251688 | Ga0466965_0251688_554_937 | 127 |
| 513 | 3300044683 | Ga0466965_0720926 | Ga0466965_0720926_18_401 | 127 |
| 514 | 3300044683 | Ga0466965_0880549 | Ga0466965_0880549_32_415 | 127 |
| 515 | 3300044683 | Ga0466965_0922039 | Ga0466965_0922039_16_399 | 127 |
| 516 | 3300044684 | Ga0466966_0026754 | Ga0466966_0026754_2050_2433 | 127 |
| 517 | 3300044684 | Ga0466966_0190379 | Ga0466966_0190379_476_859 | 127 |
| 518 | 3300044684 | Ga0466966_0493158 | Ga0466966_0493158_344_727 | 127 |
| 519 | 3300044684 | Ga0466966_0679812 | Ga0466966_0679812_39_422 | 127 |
| 520 | 3300044693 | Ga0466961_0004906 | Ga0466961_0004906_7526_7909 | 127 |
| 521 | 3300044693 | Ga0466961_0070568 | Ga0466961_0070568_949_1332 | 127 |
| 522 | 3300044693 | Ga0466961_0106847 | Ga0466961_0106847_1059_1442 | 127 |
| 523 | 3300044693 | Ga0466961_0357524 | Ga0466961_0357524_410_793 | 127 |
| 524 | 3300044693 | Ga0466961_0505124 | Ga0466961_0505124_169_552 | 127 |
| 525 | 3300044694 | Ga0466963_0009311 | Ga0466963_0009311_460_843 | 127 |
| 526 | 3300044694 | Ga0466963_0011289 | Ga0466963_0011289_898_1281 | 127 |
| 527 | 3300044694 | Ga0466963_0021793 | Ga0466963_0021793_2305_2688 | 127 |
| 528 | 3300044694 | Ga0466963_0092669 | Ga0466963_0092669_1666_2049 | 127 |
| 529 | 3300044694 | Ga0466963_0235970 | Ga0466963_0235970_834_1217 | 127 |
| 530 | 3300044694 | Ga0466963_0263093 | Ga0466963_0263093_230_613 | 127 |
| 531 | 3300044694 | Ga0466963_0316391 | Ga0466963_0316391_119_502 | 127 |
| 532 | 3300044706 | Ga0466964_0062838 | Ga0466964_0062838_539_922 | 127 |
| 533 | 3300044706 | Ga0466964_0249332 | Ga0466964_0249332_462_845 | 127 |
| 534 | 3300044706 | Ga0466964_0345125 | Ga0466964_0345125_366_749 | 127 |
| 535 | 3300044706 | Ga0466964_0550780 | Ga0466964_0550780_171_554 | 127 |
| 536 | 3300044719 | Ga0466971_0135543 | Ga0466971_0135543_192_575 | 127 |
| 537 | 3300044719 | Ga0466971_0232982 | Ga0466971_0232982_181_564 | 127 |
| 538 | 3300044719 | Ga0466971_0295997 | Ga0466971_0295997_274_657 | 127 |
| 539 | 3300044719 | Ga0466971_0357709 | Ga0466971_0357709_273_656 | 127 |
| 540 | 3300044719 | Ga0466971_0631924 | Ga0466971_0631924_124_507 | 127 |
| 541 | 3300044735 | Ga0466968_0081768 | Ga0466968_0081768_120_503 | 127 |
| 542 | 3300044735 | Ga0466968_0109639 | Ga0466968_0109639_494_877 | 127 |
| 543 | 3300044735 | Ga0466968_0172288 | Ga0466968_0172288_229_612 | 127 |
| 544 | 3300044735 | Ga0466968_0214955 | Ga0466968_0214955_145_528 | 127 |
| 545 | 3300044735 | Ga0466968_0435662 | Ga0466968_0435662_76_459 | 127 |
| 546 | 3300044735 | Ga0466968_0503744 | Ga0466968_0503744_207_590 | 127 |
| 547 | 3300044765 | Ga0466970_0016616 | Ga0466970_0016616_2818_3201 | 127 |
| 548 | 3300044765 | Ga0466970_0070219 | Ga0466970_0070219_1228_1611 | 127 |
| 549 | 3300044765 | Ga0466970_0273002 | Ga0466970_0273002_12_395 | 127 |
| 550 | 3300044765 | Ga0466970_0333917 | Ga0466970_0333917_344_727 | 127 |
| 551 | 3300044842 | Ga0466957_0026899 | Ga0466957_0026899_2869_3252 | 127 |
| 552 | 3300044842 | Ga0466957_0054949 | Ga0466957_0054949_574_957 | 127 |
| 553 | 3300044842 | Ga0466957_0151759 | Ga0466957_0151759_599_982 | 127 |
| 554 | 3300044842 | Ga0466957_0297956 | Ga0466957_0297956_349_732 | 127 |
| 555 | 3300044842 | Ga0466957_0459517 | Ga0466957_0459517_100_483 | 127 |
| 556 | 3300044842 | Ga0466957_0638840 | Ga0466957_0638840_100_483 | 127 |
| 557 | 3300044842 | Ga0466957_0674006 | Ga0466957_0674006_251_634 | 127 |
| 558 | 3300044842 | Ga0466957_0750043 | Ga0466957_0750043_31_414 | 127 |
| 559 | 3300044842 | Ga0466957_1075263 | Ga0466957_1075263_92_475 | 127 |
| 560 | 3300045049 | Ga0466959_0009134 | Ga0466959_0009134_5111_5494 | 127 |
| 561 | 3300045049 | Ga0466959_0014110 | Ga0466959_0014110_2100_2483 | 127 |
| 562 | 3300045049 | Ga0466959_0019509 | Ga0466959_0019509_3920_4303 | 127 |
| 563 | 3300045049 | Ga0466959_0105651 | Ga0466959_0105651_969_1352 | 127 |
| 564 | 3300045049 | Ga0466959_0123556 | Ga0466959_0123556_674_1057 | 127 |
| 565 | 3300045049 | Ga0466959_0126886 | Ga0466959_0126886_1418_1801 | 127 |
| 566 | 3300045049 | Ga0466959_0186337 | Ga0466959_0186337_439_822 | 127 |
| 567 | 3300045049 | Ga0466959_0530305 | Ga0466959_0530305_225_608 | 127 |
| 568 | 3300045049 | Ga0466959_0567663 | Ga0466959_0567663_25_408 | 127 |
| 569 | 3300045049 | Ga0466959_0640945 | Ga0466959_0640945_56_439 | 127 |
| 570 | 3300045049 | Ga0466959_1116573 | Ga0466959_1116573_92_475 | 127 |
| 571 | 3300045836 | Ga0466958_0008849 | Ga0466958_0008849_2616_2999 | 127 |
| 572 | 3300045836 | Ga0466958_0014571 | Ga0466958_0014571_3542_3925 | 127 |
| 573 | 3300045836 | Ga0466958_0018330 | Ga0466958_0018330_2350_2733 | 127 |
| 574 | 3300045836 | Ga0466958_0076506 | Ga0466958_0076506_1159_1542 | 127 |
| 575 | 3300045836 | Ga0466958_0085134 | Ga0466958_0085134_1501_1884 | 127 |
| 576 | 3300045836 | Ga0466958_0129795 | Ga0466958_0129795_133_516 | 127 |
| 577 | 3300045836 | Ga0466958_0253711 | Ga0466958_0253711_507_890 | 127 |
| 578 | 3300045836 | Ga0466958_0271529 | Ga0466958_0271529_688_1071 | 127 |
| 579 | 3300045836 | Ga0466958_0330686 | Ga0466958_0330686_136_519 | 127 |
| 580 | 3300045836 | Ga0466958_0345460 | Ga0466958_0345460_254_637 | 127 |
| 581 | 3300045836 | Ga0466958_0387199 | Ga0466958_0387199_101_484 | 127 |
| 582 | 3300045836 | Ga0466958_0544296 | Ga0466958_0544296_224_607 | 127 |
| 583 | 3300045976 | Ga0466967_0002408 | Ga0466967_0002408_8055_8438 | 127 |
| 584 | 3300045976 | Ga0466967_0005406 | Ga0466967_0005406_5451_5834 | 127 |
| 585 | 3300045976 | Ga0466967_0162915 | Ga0466967_0162915_1098_1481 | 127 |
| 586 | 3300045976 | Ga0466967_0198763 | Ga0466967_0198763_1326_1709 | 127 |
| 587 | 3300045976 | Ga0466967_0213157 | Ga0466967_0213157_320_703 | 127 |
| 588 | 3300045976 | Ga0466967_0926030 | Ga0466967_0926030_209_592 | 127 |
| 589 | 3300045976 | Ga0466967_1082599 | Ga0466967_1082599_199_582 | 127 |
| 590 | 3300045976 | Ga0466967_2296999 | Ga0466967_2296999_112_495 | 127 |
| 591 | 3300045976 | Ga0466967_2319748 | Ga0466967_2319748_135_518 | 127 |
| 592 | 3300046457 | Ga0495590_0166854 | Ga0495590_0166854_119_502 | 127 |
| 593 | 3300046463 | Ga0495653_0002457 | Ga0495653_0002457_10114_10497 | 127 |
| 594 | 3300046463 | Ga0495653_0524043 | Ga0495653_0524043_242_625 | 127 |
| 595 | 3300046477 | Ga0495664_0436072 | Ga0495664_0436072_86_469 | 127 |
| 596 | 3300046477 | Ga0495664_0485182 | Ga0495664_0485182_196_579 | 127 |
| 597 | 3300046492 | Ga0495585_0285941 | Ga0495585_0285941_272_655 | 127 |
| 598 | 3300046500 | Ga0495596_0053322 | Ga0495596_0053322_1171_1554 | 127 |
| 599 | 3300046514 | Ga0495618_0000035 | Ga0495618_0000035_68103_68486 | 127 |
| 600 | 3300046515 | Ga0495620_0209860 | Ga0495620_0209860_309_692 | 127 |
| 601 | 3300046517 | Ga0495630_0000610 | Ga0495630_0000610_9750_10133 | 127 |
| 602 | 3300046517 | Ga0495630_0949901 | Ga0495630_0949901_197_580 | 127 |
| 603 | 3300046518 | Ga0495631_0197915 | Ga0495631_0197915_280_663 | 127 |
| 604 | 3300046522 | Ga0495643_0088629 | Ga0495643_0088629_761_1144 | 127 |
| 605 | 3300046523 | Ga0495644_0080611 | Ga0495644_0080611_253_636 | 127 |
| 606 | 3300046525 | Ga0495663_0024643 | Ga0495663_0024643_120_503 | 127 |
| 607 | 3300046536 | Ga0495587_0127170 | Ga0495587_0127170_418_801 | 127 |
| 608 | 3300046538 | Ga0495609_0307552 | Ga0495609_0307552_13_396 | 127 |
| 609 | 3300046543 | Ga0495645_0000033 | Ga0495645_0000033_34955_35338 | 127 |
| 610 | 3300046543 | Ga0495645_0000159 | Ga0495645_0000159_27753_28136 | 127 |
| 611 | 3300046543 | Ga0495645_0344692 | Ga0495645_0344692_396_779 | 127 |
| 612 | 3300046558 | Ga0495633_0264960 | Ga0495633_0264960_140_523 | 127 |
| 613 | 3300046615 | Ga0495656_0175950 | Ga0495656_0175950_304_687 | 127 |
| 614 | 3300046674 | Ga0495588_0305027 | Ga0495588_0305027_119_502 | 127 |
| 615 | 3300046675 | Ga0495657_0000027 | Ga0495657_0000027_94872_95255 | 127 |
| 616 | 3300046675 | Ga0495657_0306616 | Ga0495657_0306616_40_423 | 127 |
| 617 | 3300046680 | Ga0495646_0243138 | Ga0495646_0243138_220_603 | 127 |
| 618 | 3300046680 | Ga0495646_0330790 | Ga0495646_0330790_178_621 | 127 |
| 619 | 3300046684 | Ga0495669_0220166 | Ga0495669_0220166_99_482 | 127 |
| 620 | 3300046690 | Ga0495624_0552101 | Ga0495624_0552101_167_550 | 127 |
| 621 | 3300046691 | Ga0495670_0168519 | Ga0495670_0168519_403_786 | 127 |
| 622 | 3300046794 | Ga0495589_0106285 | Ga0495589_0106285_862_1245 | 127 |
| 623 | 3300046809 | Ga0495600_0820330 | Ga0495600_0820330_10_393 | 127 |
| 624 | 3300047321 | Ga0495676_0495339 | Ga0495676_0495339_195_578 | 127 |
| 625 | 3300047322 | Ga0495680_1012982 | Ga0495680_1012982_109_492 | 127 |
| 626 | 3300047447 | Ga0495685_166922 | Ga0495685_166922_220_603 | 127 |
| 627 | 3300047472 | Ga0495686_0416296 | Ga0495686_0416296_211_594 | 127 |
| 628 | 3300048090 | Ga0495615_0262081 | Ga0495615_0262081_153_536 | 127 |
| 629 | 3300048903 | Ga0496100_0001215 | Ga0496100_0001215_10117_10500 | 127 |
| 630 | 3300048904 | Ga0496101_0394172 | Ga0496101_0394172_566_949 | 127 |
| 631 | 3300048904 | Ga0496101_0502460 | Ga0496101_0502460_49_432 | 127 |
| 632 | 3300048905 | Ga0496102_0385249 | Ga0496102_0385249_697_1080 | 127 |
| 633 | 3300048905 | Ga0496102_0777672 | Ga0496102_0777672_86_469 | 127 |
| 634 | 3300048906 | Ga0496103_0401828 | Ga0496103_0401828_124_507 | 127 |
| 635 | 3300048907 | Ga0496104_0576220 | Ga0496104_0576220_329_712 | 127 |
| 636 | 3300048907 | Ga0496104_1528916 | Ga0496104_1528916_43_426 | 127 |
| 637 | 3300048908 | Ga0496105_0218944 | Ga0496105_0218944_900_1283 | 127 |
| 638 | 3300048908 | Ga0496105_0831945 | Ga0496105_0831945_235_618 | 127 |
| 639 | 3300048910 | Ga0496107_0370657 | Ga0496107_0370657_380_763 | 127 |
| 640 | 3300048911 | Ga0496108_0462407 | Ga0496108_0462407_419_802 | 127 |
| 641 | 3300048912 | Ga0496109_0238485 | Ga0496109_0238485_734_1117 | 127 |
| 642 | 3300048913 | Ga0496110_0047309 | Ga0496110_0047309_2174_2557 | 127 |
| 643 | 3300048914 | Ga0496111_0335987 | Ga0496111_0335987_405_788 | 127 |
| 644 | 3300048915 | Ga0496112_0103136 | Ga0496112_0103136_526_909 | 127 |
| 645 | 3300048915 | Ga0496112_1056837 | Ga0496112_1056837_124_507 | 127 |
| 646 | 3300048916 | Ga0496113_0120615 | Ga0496113_0120615_888_1271 | 127 |
| 647 | 3300048917 | Ga0496114_0328950 | Ga0496114_0328950_849_1232 | 127 |
| 648 | 3300048917 | Ga0496114_0485472 | Ga0496114_0485472_406_789 | 127 |
| 649 | 3300048917 | Ga0496114_1574300 | Ga0496114_1574300_135_518 | 127 |
| 650 | 3300048918 | Ga0496115_0948040 | Ga0496115_0948040_48_431 | 127 |
| 651 | 3300049523 | Ga0501300_061016 | Ga0501300_061016_113_496 | 127 |
| 652 | 3300049568 | Ga0501031_0034173 | Ga0501031_0034173_405_788 | 127 |
| 653 | 3300049569 | Ga0501032_0001419 | Ga0501032_0001419_16150_16533 | 127 |
| 654 | 3300049570 | Ga0501033_0026435 | Ga0501033_0026435_557_940 | 127 |
| 655 | 3300049571 | Ga0501034_0019312 | Ga0501034_0019312_1657_2040 | 127 |
| 656 | 3300049572 | Ga0501036_0023794 | Ga0501036_0023794_2802_3185 | 127 |
| 657 | 3300049573 | Ga0501037_0021875 | Ga0501037_0021875_1809_2192 | 127 |
| 658 | 3300049574 | Ga0501038_0014761 | Ga0501038_0014761_5691_6074 | 127 |
| 659 | 3300049575 | Ga0501039_0132069 | Ga0501039_0132069_503_886 | 127 |
| 660 | 3300049578 | Ga0501042_0001923 | Ga0501042_0001923_780_1163 | 127 |
| 661 | 3300049579 | Ga0501043_0104612 | Ga0501043_0104612_1190_1573 | 127 |
| 662 | 3300049580 | Ga0501046_0008154 | Ga0501046_0008154_5508_5891 | 127 |
| 663 | 3300049581 | Ga0501047_0082923 | Ga0501047_0082923_465_848 | 127 |
| 664 | 3300049582 | Ga0501048_0002360 | Ga0501048_0002360_2753_3136 | 127 |
| 665 | 3300049582 | Ga0501048_0923485 | Ga0501048_0923485_146_529 | 127 |
| 666 | 3300049583 | Ga0501067_0015994 | Ga0501067_0015994_1337_1720 | 127 |
| 667 | 3300049583 | Ga0501067_0689895 | Ga0501067_0689895_107_490 | 127 |
| 668 | 3300049584 | Ga0501068_0048751 | Ga0501068_0048751_1202_1585 | 127 |
| 669 | 3300049584 | Ga0501068_0150346 | Ga0501068_0150346_879_1262 | 127 |
| 670 | 3300049585 | Ga0501069_0030830 | Ga0501069_0030830_2361_2744 | 127 |
| 671 | 3300049585 | Ga0501069_0081305 | Ga0501069_0081305_952_1335 | 127 |
| 672 | 3300049585 | Ga0501069_0869857 | Ga0501069_0869857_121_504 | 127 |
| 673 | 3300049586 | Ga0501070_0027023 | Ga0501070_0027023_2468_2851 | 127 |
| 674 | 3300049587 | Ga0501071_0281722 | Ga0501071_0281722_847_1230 | 127 |
| 675 | 3300049588 | Ga0501072_0034435 | Ga0501072_0034435_1534_1917 | 127 |
| 676 | 3300049589 | Ga0501073_0005329 | Ga0501073_0005329_5772_6155 | 127 |
| 677 | 3300049589 | Ga0501073_0716394 | Ga0501073_0716394_178_561 | 127 |
| 678 | 3300049590 | Ga0501074_0154061 | Ga0501074_0154061_1235_1618 | 127 |
| 679 | 3300049591 | Ga0501075_0926867 | Ga0501075_0926867_269_652 | 127 |
| 680 | 3300049649 | Ga0501198_049626 | Ga0501198_049626_134_517 | 127 |
| 681 | 3300049652 | Ga0501202_028277 | Ga0501202_028277_373_756 | 127 |
| 682 | 3300049705 | Ga0501225_0255530 | Ga0501225_0255530_109_492 | 127 |
| 683 | 3300049741 | Ga0501079_0120171 | Ga0501079_0120171_592_975 | 127 |
| 684 | 3300049742 | Ga0501080_0038231 | Ga0501080_0038231_2068_2451 | 127 |
| 685 | 3300049742 | Ga0501080_0060612 | Ga0501080_0060612_2512_2895 | 127 |
| 686 | 3300049744 | Ga0501083_0021040 | Ga0501083_0021040_2501_2884 | 127 |
| 687 | 3300049822 | Ga0501035_0026409 | Ga0501035_0026409_2513_2896 | 127 |
| 688 | 3300049823 | Ga0501044_0046126 | Ga0501044_0046126_2608_2991 | 127 |
| 689 | 3300050491 | nmdc:mga00v17_233674_c1 | nmdc:mga00v17_233674_c1_114_497 | 127 |
| 690 | 3300050492 | nmdc:mga0yw44_368517_c1 | nmdc:mga0yw44_368517_c1_370_753 | 127 |
| 691 | 3300050507 | nmdc:mga05p37_1061659_c1 | nmdc:mga05p37_1061659_c1_425_808 | 127 |
| 692 | 3300050507 | nmdc:mga05p37_1064446_c1 | nmdc:mga05p37_1064446_c1_231_614 | 127 |
| 693 | 3300050507 | nmdc:mga05p37_1563070_c1 | nmdc:mga05p37_1563070_c1_146_529 | 127 |
| 694 | 3300050507 | nmdc:mga05p37_761789_c1 | nmdc:mga05p37_761789_c1_373_756 | 127 |
| 695 | 3300050508 | nmdc:mga09592_108160_c1 | nmdc:mga09592_108160_c1_1059_1442 | 127 |
| 696 | 3300050508 | nmdc:mga09592_780712_c1 | nmdc:mga09592_780712_c1_218_601 | 127 |
| 697 | 3300050509 | nmdc:mga0qj67_1179658_c1 | nmdc:mga0qj67_1179658_c1_189_572 | 127 |
| 698 | 3300050509 | nmdc:mga0qj67_697275_c1 | nmdc:mga0qj67_697275_c1_210_593 | 127 |
| 699 | 3300050509 | nmdc:mga0qj67_938869_c1 | nmdc:mga0qj67_938869_c1_232_615 | 127 |
| 700 | 3300050511 | nmdc:mga08y16_275095_c1 | nmdc:mga08y16_275095_c1_102_485 | 127 |
| 701 | 3300050511 | nmdc:mga08y16_427549_c1 | nmdc:mga08y16_427549_c1_422_805 | 127 |
| 702 | 3300050515 | nmdc:mga0a205_1075773_c1 | nmdc:mga0a205_1075773_c1_257_640 | 127 |
| 703 | 3300050515 | nmdc:mga0a205_797555_c1 | nmdc:mga0a205_797555_c1_388_771 | 127 |
| 704 | 3300053077 | Ga0495601_0357794 | Ga0495601_0357794_420_803 | 127 |
| 705 | 3300053083 | Ga0495655_0008046 | Ga0495655_0008046_1415_1798 | 127 |
| 706 | 3300053083 | Ga0495655_0120668 | Ga0495655_0120668_162_545 | 127 |
| 707 | 3300053085 | Ga0495619_0533917 | Ga0495619_0533917_380_763 | 127 |
| 708 | 3300053085 | Ga0495619_0699628 | Ga0495619_0699628_164_547 | 127 |
| 709 | 3300053085 | Ga0495619_0868793 | Ga0495619_0868793_46_429 | 127 |
| 710 | 3300053085 | Ga0495619_1186930 | Ga0495619_1186930_28_411 | 127 |
| 711 | 3300053096 | Ga0500641_0114552 | Ga0500641_0114552_86_469 | 127 |
| 712 | 3300054114 | Ga0501084_0088731 | Ga0501084_0088731_579_962 | 127 |
| 713 | 3300059421 | Ga0590071_144989 | Ga0590071_144989_185_568 | 127 |
| 714 | 3300059424 | Ga0590075_059045 | Ga0590075_059045_419_802 | 127 |
| 715 | 3300059477 | Ga0587084_053854 | Ga0587084_053854_109_492 | 127 |
| 716 | 3300059478 | Ga0587093_014885 | Ga0587093_014885_169_552 | 127 |
| 717 | 3300059490 | Ga0587066_047517 | Ga0587066_047517_144_527 | 127 |
| 718 | 3300059490 | Ga0587066_105945 | Ga0587066_105945_154_537 | 127 |
| 719 | 3300059491 | Ga0587070_095587 | Ga0587070_095587_186_569 | 127 |
| 720 | 3300059493 | Ga0587077_117187 | Ga0587077_117187_51_434 | 127 |
| 721 | 3300059503 | Ga0587080_019869 | Ga0587080_019869_217_600 | 127 |
| 722 | 3300059504 | Ga0587082_195456 | Ga0587082_195456_56_439 | 127 |
| 723 | 3300059505 | Ga0587083_0038830 | Ga0587083_0038830_524_907 | 127 |
| 724 | 3300059505 | Ga0587083_0067777 | Ga0587083_0067777_202_585 | 127 |
| 725 | 3300059505 | Ga0587083_0069002 | Ga0587083_0069002_330_713 | 127 |
| 726 | 3300059505 | Ga0587083_0262681 | Ga0587083_0262681_86_469 | 127 |
| 727 | 3300059506 | Ga0587085_085026 | Ga0587085_085026_83_466 | 127 |
| 728 | 3300059506 | Ga0587085_103493 | Ga0587085_103493_121_504 | 127 |
| 729 | 3300059508 | Ga0587088_100566 | Ga0587088_100566_223_606 | 127 |
| 730 | 3300059509 | Ga0587089_047168 | Ga0587089_047168_221_604 | 127 |
| 731 | 3300059510 | Ga0587090_068847 | Ga0587090_068847_62_445 | 127 |
| 732 | 3300059511 | Ga0587091_087291 | Ga0587091_087291_221_604 | 127 |
| 733 | 3300059604 | Ga0587098_083523 | Ga0587098_083523_107_490 | 127 |
| 734 | 3300059605 | Ga0587106_046646 | Ga0587106_046646_200_583 | 127 |
| 735 | 3300059626 | Ga0587115_042577 | Ga0587115_042577_229_612 | 127 |
| 736 | 3300059627 | Ga0587117_045152 | Ga0587117_045152_223_606 | 127 |
| 737 | 3300059630 | Ga0587128_077506 | Ga0587128_077506_231_614 | 127 |
| 738 | 3300059630 | Ga0587128_085959 | Ga0587128_085959_173_556 | 127 |
| 739 | 3300059630 | Ga0587128_111147 | Ga0587128_111147_163_546 | 127 |
| 740 | 3300059630 | Ga0587128_120517 | Ga0587128_120517_110_493 | 127 |
| 741 | 3300059630 | Ga0587128_142329 | Ga0587128_142329_51_434 | 127 |
| 742 | 3300059631 | Ga0587130_029628 | Ga0587130_029628_223_606 | 127 |
| 743 | 3300059640 | Ga0587067_075553 | Ga0587067_075553_104_490 | 127 |
| 744 | 3300059641 | Ga0587068_045948 | Ga0587068_045948_206_589 | 127 |
| 745 | 3300059641 | Ga0587068_047189 | Ga0587068_047189_218_601 | 127 |
| 746 | 3300059644 | Ga0587075_048811 | Ga0587075_048811_328_711 | 127 |
| 747 | 3300059645 | Ga0587076_091514 | Ga0587076_091514_175_558 | 127 |
| 748 | 3300059645 | Ga0587076_121773 | Ga0587076_121773_154_537 | 127 |
| 749 | 3300059647 | Ga0587079_089135 | Ga0587079_089135_112_495 | 127 |
| 750 | 3300059647 | Ga0587079_098913 | Ga0587079_098913_138_521 | 127 |
| 751 | 3300059648 | Ga0587100_019026 | Ga0587100_019026_194_577 | 127 |
| 752 | 3300060344 | Ga0587071_039236 | Ga0587071_039236_425_808 | 127 |
| 753 | 3300060344 | Ga0587071_042087 | Ga0587071_042087_60_443 | 127 |
| 754 | 3300060344 | Ga0587071_094709 | Ga0587071_094709_221_604 | 127 |
| 755 | 3300060344 | Ga0587071_167645 | Ga0587071_167645_123_506 | 127 |
| 756 | 3300060346 | Ga0587111_0073488 | Ga0587111_0073488_193_576 | 127 |
| 757 | 3300060346 | Ga0587111_0239058 | Ga0587111_0239058_52_435 | 127 |
| 758 | 3300060353 | Ga0501082_0039856 | Ga0501082_0039856_2547_2930 | 127 |
| 759 | 3300061719 | Ga0466962_0014349 | Ga0466962_0014349_3325_3708 | 127 |
| 760 | 3300061719 | Ga0466962_0015342 | Ga0466962_0015342_490_873 | 127 |
| 761 | 3300061719 | Ga0466962_0046924 | Ga0466962_0046924_1064_1447 | 127 |
| 762 | 3300061719 | Ga0466962_0107606 | Ga0466962_0107606_369_752 | 127 |
| 763 | 3300061719 | Ga0466962_0275007 | Ga0466962_0275007_217_600 | 127 |
| 764 | 3300061719 | Ga0466962_0350587 | Ga0466962_0350587_177_560 | 127 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar