F479756

General Info

Members Datasets Scaffolds Average Seq Length
764 333 764 127

Family's Representative Sequence

Representative Sequence 3300059655|Ga0587114_079771|Ga0587114_079771_95_475
Length 126
Sequence MARIAGINIPLNKRVEIGLTYIYGIGRSTSNQLLADVGIEPDTYVRDLTDDEVVKLRDAVDGLTVEGDLRRERSQNVKRLMEIGCYRGLRHRRGLPVRGQNTKTNARTRKGPKRMQVAGKKKAGKK

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
82 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
92 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
146 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
147 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
148 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
149 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
150 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
153 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
180 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
184 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
185 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
186 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
187 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
196 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
214 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
276 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
277 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
278 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
279 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
280 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
281 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
300 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
301 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.98
Metatranscriptomes 17.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 5.1
Rhizosphere 83.12
Stem 0
Stem Tuber 0
Unclassified 10.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1007467 3300000546 Bacteria 1179
2 Ga0006777J48905_1063153 3300003308 Bacteria 613
3 Ga0007417J51691_1016750 3300003544 Bacteria 757
4 Ga0007417J51691_1056724 3300003544 Bacteria 650
5 Ga0007410J51695_1017675 3300003574 Bacteria 777
6 Ga0007409J51694_1011186 3300003575 Bacteria 734
7 Ga0007416J51690_1020405 3300003577 Bacteria 728
8 Ga0007416J51690_1064679 3300003577 Bacteria 840
9 Ga0007429J51699_1027606 3300003579 Bacteria 648
10 Ga0007429J51699_1054942 3300003579 Bacteria 828
11 Ga0032354_1007334 3300003693 Bacteria 985
12 Ga0032354_1055984 3300003693 Bacteria 708
13 Ga0058859_11782233 3300004798 Bacteria 791
14 Ga0058863_11934614 3300004799 Bacteria 810
15 Ga0058863_11964497 3300004799 Bacteria 576
16 Ga0058861_11992365 3300004800 Bacteria 662
17 Ga0058862_12623738 3300004803 Bacteria 729
18 Ga0058862_12792749 3300004803 Bacteria 660
19 Ga0070683_100330436 3300005329 Bacteria 1451
20 Ga0070683_100479723 3300005329 Bacteria 1187
21 Ga0070680_100585102 3300005336 Bacteria 958
22 Ga0070680_100775862 3300005336 Bacteria 826
23 Ga0070682_100404269 3300005337 Bacteria 1034
24 Ga0070682_100930240 3300005337 Bacteria 716
25 Ga0068868_101635393 3300005338 Bacteria 606
26 Ga0070687_100538208 3300005343 Bacteria 792
27 Ga0070661_100370971 3300005344 Bacteria 1127
28 Ga0070692_10005318 3300005345 Bacteria 5474
29 Ga0070692_11053737 3300005345 Bacteria 572
30 Ga0070671_101455884 3300005355 Bacteria 606
31 Ga0070659_100000160 3300005366 Bacteria 51528
32 Ga0070659_100395794 3300005366 Bacteria 1165
33 Ga0070659_100484767 3300005366 Bacteria 1052
34 Ga0070659_101404006 3300005366 Bacteria 621
35 Ga0070709_10511387 3300005434 Bacteria 914
36 Ga0070709_11438456 3300005434 Bacteria 559
37 Ga0070714_100018243 3300005435 Bacteria 5696
38 Ga0070714_100076714 3300005435 Bacteria 2902
39 Ga0070714_100190199 3300005435 Bacteria 1873
40 Ga0070714_100267532 3300005435 Bacteria 1584
41 Ga0070714_100376416 3300005435 Bacteria 1338
42 Ga0070714_100414251 3300005435 Bacteria 1276
43 Ga0070714_100420905 3300005435 Bacteria 1265
44 Ga0070714_100843472 3300005435 Bacteria 888
45 Ga0070714_101543834 3300005435 Bacteria 649
46 Ga0070714_101746451 3300005435 Bacteria 608
47 Ga0070713_100551375 3300005436 Bacteria 1091
48 Ga0070713_100732827 3300005436 Bacteria 945
49 Ga0070713_101875710 3300005436 Bacteria 581
50 Ga0070713_102326394 3300005436 Bacteria 518
51 Ga0070710_10000005 3300005437 Bacteria 238049
52 Ga0070710_10119932 3300005437 Bacteria 1591
53 Ga0070710_10202621 3300005437 Bacteria 1254
54 Ga0070710_10500829 3300005437 Bacteria 831
55 Ga0070711_100002145 3300005439 Bacteria 11183
56 Ga0070711_100055655 3300005439 Bacteria 2733
57 Ga0070711_100342630 3300005439 Bacteria 1200
58 Ga0070711_100425633 3300005439 Bacteria 1083
59 Ga0070711_100733572 3300005439 Bacteria 834
60 Ga0070705_100002004 3300005440 Bacteria 10415
61 Ga0070700_100324369 3300005441 Bacteria 1132
62 Ga0070708_100642959 3300005445 Bacteria 1000
63 Ga0070678_100000830 3300005456 Bacteria 15675
64 Ga0070678_102246658 3300005456 Bacteria 518
65 Ga0070662_100310435 3300005457 Bacteria 1284
66 Ga0070662_100392137 3300005457 Bacteria 1144
67 Ga0070662_101526355 3300005457 Bacteria 576
68 Ga0070681_10985116 3300005458 Bacteria 763
69 Ga0070681_11393309 3300005458 Bacteria 625
70 Ga0070685_10672070 3300005466 Bacteria 752
71 Ga0070707_100513038 3300005468 Bacteria 1161
72 Ga0070699_101025435 3300005518 Bacteria 757
73 Ga0070684_100065608 3300005535 Bacteria 3186
74 Ga0070684_100208430 3300005535 Bacteria 1781
75 Ga0070684_101056819 3300005535 Bacteria 762
76 Ga0070697_100279209 3300005536 Bacteria 1433
77 Ga0068853_100229878 3300005539 Bacteria 1696
78 Ga0070686_100396414 3300005544 Bacteria 1048
79 Ga0070695_100369828 3300005545 Bacteria 1079
80 Ga0070695_100676321 3300005545 Bacteria 817
81 Ga0070696_100042297 3300005546 Bacteria 3151
82 Ga0070704_100273070 3300005549 Bacteria 1398
83 Ga0070664_100123830 3300005564 Bacteria 2266
84 Ga0070664_101105099 3300005564 Bacteria 747
85 Ga0068854_100445301 3300005578 Bacteria 1081
86 Ga0068854_101215749 3300005578 Bacteria 676
87 Ga0070702_100064604 3300005615 Bacteria 2141
88 Ga0070702_100174927 3300005615 Bacteria 1399
89 Ga0068852_100146967 3300005616 Bacteria 2187
90 Ga0068852_100616363 3300005616 Bacteria 1090
91 Ga0068859_102381056 3300005617 Bacteria 584
92 Ga0068866_10226337 3300005718 Bacteria 1131
93 Ga0068866_11264619 3300005718 Bacteria 535
94 Ga0068861_100273934 3300005719 Bacteria 1450
95 Ga0068851_10377744 3300005834 Bacteria 830
96 Ga0068858_100930244 3300005842 Bacteria 851
97 Ga0081540_1149021 3300005983 Bacteria 926
98 Ga0070717_10008688 3300006028 Bacteria 7600
99 Ga0070717_10043519 3300006028 Bacteria 3665
100 Ga0070717_10288172 3300006028 Bacteria 1457
101 Ga0070717_10593391 3300006028 Bacteria 1005
102 Ga0070717_10712900 3300006028 Bacteria 912
103 Ga0070717_10759070 3300006028 Bacteria 882
104 Ga0070717_11128867 3300006028 Bacteria 714
105 Ga0070717_11273728 3300006028 Bacteria 668
106 Ga0075365_10178436 3300006038 Bacteria 1484
107 Ga0075364_10376256 3300006051 Bacteria 969
108 Ga0075432_10123820 3300006058 Bacteria 973
109 Ga0070715_10217202 3300006163 Bacteria 981
110 Ga0070716_100040774 3300006173 Bacteria 2584
111 Ga0070716_100585981 3300006173 Bacteria 837
112 Ga0070712_100015327 3300006175 Bacteria 4932
113 Ga0070712_100015527 3300006175 Bacteria 4909
114 Ga0070712_100385985 3300006175 Bacteria 1154
115 Ga0070712_101346287 3300006175 Bacteria 622
116 Ga0068871_101824694 3300006358 Bacteria 578
117 Ga0075428_100779757 3300006844 Bacteria 1016
118 Ga0075428_100935741 3300006844 Bacteria 919
119 Ga0075430_100406030 3300006846 Bacteria 1124
120 Ga0075430_100647440 3300006846 Bacteria 871
121 Ga0075430_101179430 3300006846 Bacteria 630
122 Ga0075429_100008266 3300006880 Bacteria 9046
123 Ga0068865_100591571 3300006881 Bacteria 937
124 Ga0068865_101370202 3300006881 Bacteria 631
125 Ga0075436_101495819 3300006914 Bacteria 513
126 Ga0097620_102380962 3300006931 Bacteria 584
127 Ga0105251_10368456 3300009011 Bacteria 657
128 Ga0105240_10006736 3300009093 Bacteria 16822
129 Ga0105240_11126444 3300009093 Bacteria 834
130 Ga0111539_10371241 3300009094 Bacteria 1665
131 Ga0111539_12086955 3300009094 Bacteria 657
132 Ga0105245_10235778 3300009098 Bacteria 1771
133 Ga0105245_10419437 3300009098 Bacteria 1341
134 Ga0105245_10435547 3300009098 Bacteria 1317
135 Ga0105245_11641151 3300009098 Bacteria 695
136 Ga0105247_10188613 3300009101 Bacteria 1379
137 Ga0114129_10410816 3300009147 Bacteria 1782
138 Ga0114129_11244710 3300009147 Bacteria 925
139 Ga0114129_11629237 3300009147 Bacteria 789
140 Ga0114129_11732699 3300009147 Bacteria 762
141 Ga0105243_10187204 3300009148 Bacteria 1805
142 Ga0105243_10234625 3300009148 Bacteria 1629
143 Ga0105243_10817676 3300009148 Bacteria 920
144 Ga0105243_10870519 3300009148 Bacteria 894
145 Ga0105241_10309942 3300009174 Bacteria 1357
146 Ga0105241_11850817 3300009174 Bacteria 590
147 Ga0105242_10386951 3300009176 Bacteria 1301
148 Ga0105242_11237829 3300009176 Bacteria 767
149 Ga0105237_10000795 3300009545 Bacteria 43136
150 Ga0105238_10407094 3300009551 Bacteria 1354
151 Ga0105249_10349025 3300009553 Bacteria 1498
152 Ga0105249_10514192 3300009553 Bacteria 1244
153 Ga0105249_11273929 3300009553 Bacteria 806
154 Ga0105239_10052946 3300010375 Bacteria 4452
155 Ga0105239_10565745 3300010375 Bacteria 1295
156 Ga0105239_10728378 3300010375 Bacteria 1135
157 Ga0105246_10047961 3300011119 Bacteria 2919
158 Ga0105246_10204294 3300011119 Bacteria 1538
159 Ga0105246_11246359 3300011119 Bacteria 687
160 Ga0157317_1029149 3300012475 Bacteria 530
161 Ga0154010_123301 3300013062 Bacteria 650
162 Ga0157378_12723615 3300013297 Bacteria 547
163 Ga0163162_10855954 3300013306 Bacteria 1024
164 Ga0163162_11040097 3300013306 Bacteria 927
165 Ga0157372_10260305 3300013307 Bacteria 2015
166 Ga0157372_11027672 3300013307 Bacteria 954
167 Ga0157380_10423884 3300014326 Bacteria 1270
168 Ga0157380_10490923 3300014326 Bacteria 1190
169 Ga0157380_10932425 3300014326 Bacteria 897
170 Ga0157377_10295674 3300014745 Bacteria 1067
171 Ga0157377_10616970 3300014745 Bacteria 776
172 Ga0197907_10147709 3300020069 Bacteria 611
173 Ga0197907_10147937 3300020069 Bacteria 607
174 Ga0197907_10274865 3300020069 Bacteria 611
175 Ga0197907_10395385 3300020069 Bacteria 958
176 Ga0197907_10604094 3300020069 Bacteria 1168
177 Ga0197907_10658254 3300020069 Bacteria 821
178 Ga0197907_10784893 3300020069 Bacteria 660
179 Ga0197907_11199968 3300020069 Bacteria 1399
180 Ga0197907_11212975 3300020069 Bacteria 1106
181 Ga0206356_10404506 3300020070 Bacteria 1099
182 Ga0206356_10449285 3300020070 Bacteria 3301
183 Ga0206356_10702775 3300020070 Bacteria 976
184 Ga0206356_11616220 3300020070 Bacteria 588
185 Ga0206356_11810765 3300020070 Bacteria 609
186 Ga0206349_1284854 3300020075 Bacteria 820
187 Ga0206349_1914227 3300020075 Bacteria 1169
188 Ga0206355_1001847 3300020076 Bacteria 2018
189 Ga0206355_1125333 3300020076 Bacteria 806
190 Ga0206355_1206623 3300020076 Bacteria 817
191 Ga0206355_1478742 3300020076 Bacteria 678
192 Ga0206355_1539572 3300020076 Bacteria 817
193 Ga0206355_1619291 3300020076 Bacteria 781
194 Ga0206351_10366003 3300020077 Bacteria 803
195 Ga0206351_10947414 3300020077 Bacteria 690
196 Ga0206351_10952347 3300020077 Bacteria 584
197 Ga0206352_10069301 3300020078 Bacteria 677
198 Ga0206352_10186458 3300020078 Bacteria 732
199 Ga0206352_10475010 3300020078 Bacteria 865
200 Ga0206352_10598505 3300020078 Bacteria 768
201 Ga0206350_10261611 3300020080 Bacteria 968
202 Ga0206350_10437302 3300020080 Bacteria 956
203 Ga0206350_11032215 3300020080 Bacteria 1131
204 Ga0206350_11141738 3300020080 Bacteria 1184
205 Ga0206350_11597202 3300020080 Bacteria 610
206 Ga0206354_10449146 3300020081 Bacteria 714
207 Ga0206354_10499121 3300020081 Bacteria 1160
208 Ga0206354_11218193 3300020081 Bacteria 1041
209 Ga0206354_11425170 3300020081 Bacteria 752
210 Ga0206354_11640189 3300020081 Bacteria 676
211 Ga0206353_10120481 3300020082 Bacteria 842
212 Ga0206353_10433378 3300020082 Bacteria 2197
213 Ga0206353_10652344 3300020082 Bacteria 755
214 Ga0206353_10994385 3300020082 Bacteria 645
215 Ga0206353_11518563 3300020082 Bacteria 1048
216 Ga0154015_1010392 3300020610 Bacteria 2054
217 Ga0154015_1183149 3300020610 Bacteria 617
218 Ga0154015_1209516 3300020610 Bacteria 601
219 Ga0154015_1431325 3300020610 Bacteria 610
220 Ga0154015_1489538 3300020610 Bacteria 624
221 Ga0213874_10000186 3300021377 Bacteria 11171
222 Ga0213874_10007135 3300021377 Bacteria 2670
223 Ga0213874_10077485 3300021377 Bacteria 1071
224 Ga0213874_10308884 3300021377 Bacteria 597
225 Ga0213876_10009713 3300021384 Bacteria 5178
226 Ga0213876_10016993 3300021384 Bacteria 3843
227 Ga0213876_10169474 3300021384 Bacteria 1161
228 Ga0213876_10259435 3300021384 Bacteria 923
229 Ga0213876_10308974 3300021384 Bacteria 840
230 Ga0213876_10517728 3300021384 Bacteria 635
231 Ga0213876_10521368 3300021384 Bacteria 632
232 Ga0213875_10001225 3300021388 Bacteria 17356
233 Ga0213875_10003279 3300021388 Bacteria 9270
234 Ga0213875_10006988 3300021388 Bacteria 5875
235 Ga0213875_10007028 3300021388 Bacteria 5857
236 Ga0213875_10020207 3300021388 Bacteria 3195
237 Ga0213875_10046096 3300021388 Bacteria 2046
238 Ga0213875_10102614 3300021388 Bacteria 1335
239 Ga0213875_10135676 3300021388 Bacteria 1151
240 Ga0213875_10137097 3300021388 Bacteria 1144
241 Ga0213875_10574069 3300021388 Bacteria 544
242 Ga0224712_10046331 3300022467 Bacteria 1668
243 Ga0224712_10137034 3300022467 Bacteria 1074
244 Ga0224712_10253464 3300022467 Bacteria 814
245 Ga0224712_10273654 3300022467 Bacteria 785
246 Ga0224712_10281192 3300022467 Bacteria 774
247 Ga0224712_10500389 3300022467 Bacteria 587
248 Ga0207656_10430606 3300025321 Bacteria 665
249 Ga0207692_10000003 3300025898 Bacteria 431531
250 Ga0207692_10059514 3300025898 Bacteria 1973
251 Ga0207692_10124873 3300025898 Bacteria 1446
252 Ga0207692_10232695 3300025898 Bacteria 1097
253 Ga0207692_10985649 3300025898 Bacteria 556
254 Ga0207642_10097226 3300025899 Bacteria 1469
255 Ga0207642_10771549 3300025899 Bacteria 610
256 Ga0207685_10194836 3300025905 Bacteria 948
257 Ga0207699_10120006 3300025906 Bacteria 1699
258 Ga0207654_10908541 3300025911 Bacteria 638
259 Ga0207695_10023985 3300025913 Bacteria 6879
260 Ga0207671_10007459 3300025914 Bacteria 9487
261 Ga0207693_10084455 3300025915 Bacteria 2488
262 Ga0207693_10118948 3300025915 Bacteria 2075
263 Ga0207693_10175259 3300025915 Bacteria 1688
264 Ga0207693_10488547 3300025915 Bacteria 961
265 Ga0207693_11002443 3300025915 Bacteria 638
266 Ga0207663_10002651 3300025916 Bacteria 8611
267 Ga0207663_10198247 3300025916 Bacteria 1446
268 Ga0207663_10371479 3300025916 Bacteria 1087
269 Ga0207663_10625858 3300025916 Bacteria 848
270 Ga0207663_10651351 3300025916 Bacteria 831
271 Ga0207663_11135416 3300025916 Bacteria 628
272 Ga0207657_10033580 3300025919 Bacteria 4624
273 Ga0207649_10408462 3300025920 Bacteria 1017
274 Ga0207649_10646531 3300025920 Bacteria 817
275 Ga0207652_11813439 3300025921 Bacteria 515
276 Ga0207646_10141568 3300025922 Bacteria 2167
277 Ga0207646_10448943 3300025922 Bacteria 1163
278 Ga0207694_10674996 3300025924 Bacteria 871
279 Ga0207687_10505568 3300025927 Bacteria 1009
280 Ga0207687_11317512 3300025927 Bacteria 621
281 Ga0207700_10125575 3300025928 Bacteria 2087
282 Ga0207700_10229152 3300025928 Bacteria 1579
283 Ga0207700_10570465 3300025928 Bacteria 1006
284 Ga0207700_11190054 3300025928 Bacteria 680
285 Ga0207664_10000020 3300025929 Bacteria 218362
286 Ga0207664_10016090 3300025929 Bacteria 5449
287 Ga0207664_10119702 3300025929 Bacteria 2202
288 Ga0207664_10274702 3300025929 Bacteria 1477
289 Ga0207664_11004377 3300025929 Bacteria 748
290 Ga0207664_11160746 3300025929 Bacteria 689
291 Ga0207664_11443762 3300025929 Bacteria 609
292 Ga0207664_11847877 3300025929 Bacteria 527
293 Ga0207690_10000165 3300025932 Bacteria 51537
294 Ga0207706_10850026 3300025933 Bacteria 773
295 Ga0207706_11294405 3300025933 Bacteria 602
296 Ga0207686_10759341 3300025934 Bacteria 775
297 Ga0207709_10309612 3300025935 Bacteria 1178
298 Ga0207669_10537689 3300025937 Bacteria 941
299 Ga0207704_10357620 3300025938 Bacteria 1139
300 Ga0207665_10096814 3300025939 Bacteria 2053
301 Ga0207665_10403998 3300025939 Bacteria 1041
302 Ga0207665_10581610 3300025939 Bacteria 873
303 Ga0207665_11341572 3300025939 Bacteria 570
304 Ga0207689_10489602 3300025942 Bacteria 1030
305 Ga0207661_10047980 3300025944 Bacteria 3392
306 Ga0207661_10258788 3300025944 Bacteria 1549
307 Ga0207661_10698591 3300025944 Bacteria 933
308 Ga0207661_11004950 3300025944 Bacteria 768
309 Ga0207661_11769097 3300025944 Bacteria 563
310 Ga0207679_10043796 3300025945 Bacteria 3225
311 Ga0207679_10787836 3300025945 Bacteria 866
312 Ga0207679_10959976 3300025945 Bacteria 783
313 Ga0207712_10717494 3300025961 Bacteria 874
314 Ga0207668_10572013 3300025972 Bacteria 981
315 Ga0207640_10328424 3300025981 Bacteria 1221
316 Ga0207640_11109261 3300025981 Bacteria 700
317 Ga0207703_10651625 3300026035 Bacteria 999
318 Ga0207678_10429999 3300026067 Bacteria 1146
319 Ga0207708_10354544 3300026075 Bacteria 1204
320 Ga0207702_10462383 3300026078 Bacteria 1233
321 Ga0207702_11164039 3300026078 Bacteria 765
322 Ga0207641_10380276 3300026088 Bacteria 1352
323 Ga0207641_12106298 3300026088 Bacteria 565
324 Ga0207648_11122393 3300026089 Bacteria 738
325 Ga0207674_10377936 3300026116 Bacteria 1370
326 Ga0207675_100191546 3300026118 Bacteria 1961
327 Ga0207675_101285499 3300026118 Bacteria 752
328 Ga0207698_10059058 3300026142 Bacteria 2976
329 Ga0207698_11304754 3300026142 Bacteria 741
330 Ga0207428_10240031 3300027907 Bacteria 1354
331 Ga0268265_10261569 3300028380 Bacteria 1539
332 Ga0268264_11930140 3300028381 Bacteria 600
333 Ga0265337_1000328 3300028556 Bacteria 25426
334 Ga0265326_10000874 3300028558 Bacteria 10947
335 Ga0265319_1000863 3300028563 Bacteria 19261
336 Ga0265319_1119056 3300028563 Bacteria 823
337 Ga0265318_10000275 3300028577 Bacteria 43186
338 Ga0265322_10004443 3300028654 Bacteria 4177
339 Ga0265322_10095602 3300028654 Bacteria 845
340 Ga0265336_10000043 3300028666 Bacteria 132135
341 Ga0265338_10000142 3300028800 Bacteria 132135
342 Ga0265338_10075957 3300028800 Bacteria 2848
343 Ga0265338_10314049 3300028800 Bacteria 1136
344 Ga0265324_10002249 3300029957 Bacteria 10059
345 Ga0265766_1005144 3300030863 Bacteria 822
346 Ga0265771_1015233 3300031010 Bacteria 615
347 Ga0265330_10279511 3300031235 Bacteria 703
348 Ga0265320_10011831 3300031240 Bacteria 5114
349 Ga0265320_10335286 3300031240 Bacteria 668
350 Ga0265340_10000006 3300031247 Bacteria 132135
351 Ga0265331_10503127 3300031250 Bacteria 545
352 Ga0265316_10089873 3300031344 Bacteria 2343
353 Ga0265314_10073998 3300031711 Bacteria 2270
354 Ga0265314_10167811 3300031711 Bacteria 1328
355 Ga0265342_10399056 3300031712 Bacteria 710
356 Ga0307405_11625222 3300031731 Bacteria 571
357 Ga0307410_11524385 3300031852 Bacteria 589
358 Ga0307407_10634965 3300031903 Bacteria 798
359 Ga0307407_10910688 3300031903 Bacteria 675
360 Ga0307412_11935075 3300031911 Bacteria 545
361 Ga0307409_101299224 3300031995 Bacteria 752
362 Ga0307416_103646449 3300032002 Bacteria 515
363 Ga0307411_10637143 3300032005 Bacteria 921
364 Ga0307415_102503742 3300032126 Bacteria 508
365 Ga0373943_0972404 3300035170 Bacteria 509
366 Ga0373935_1269532 3300035692 Bacteria 550
367 Ga0373947_0174086 3300035725 Bacteria 1398
368 Ga0265778_025158 3300036457 Bacteria 750
369 Ga0395899_0709025 3300037312 Bacteria 630
370 Ga0395898_0514379 3300037466 Bacteria 1138
371 Ga0436364_0041476 3300037853 Bacteria 1655
372 Ga0436364_0054318 3300037853 Bacteria 7060
373 Ga0436364_0095065 3300037853 Bacteria 4309
374 Ga0436364_0149301 3300037853 Bacteria 17361
375 Ga0436364_0221495 3300037853 Bacteria 40749
376 Ga0436364_0295555 3300037853 Bacteria 2792
377 Ga0436364_0367212 3300037853 Bacteria 15974
378 Ga0436364_0369585 3300037853 Bacteria 1009
379 Ga0436364_0531473 3300037853 Bacteria 2513
380 Ga0436364_0637866 3300037853 Bacteria 1657
381 Ga0436364_0682897 3300037853 Bacteria 546
382 Ga0436364_0740129 3300037853 Bacteria 3629
383 Ga0436364_0746361 3300037853 Bacteria 1658
384 Ga0436364_0764623 3300037853 Bacteria 3130
385 Ga0436364_0771931 3300037853 Bacteria 1120
386 Ga0436364_0839163 3300037853 Bacteria 8786
387 Ga0436364_0999256 3300037853 Bacteria 646
388 Ga0436364_1152751 3300037853 Bacteria 1903
389 Ga0436364_1164844 3300037853 Bacteria 6131
390 Ga0395901_1411746 3300038443 Bacteria 654
391 Ga0436365_0120242 3300039437 Bacteria 2079
392 Ga0436365_0143115 3300039437 Bacteria 588
393 Ga0436365_0172227 3300039437 Bacteria 548
394 Ga0436365_0222942 3300039437 Bacteria 6189
395 Ga0436365_0463391 3300039437 Bacteria 2113
396 Ga0436365_0497321 3300039437 Bacteria 2166
397 Ga0436365_0745551 3300039437 Bacteria 841
398 Ga0436365_0746312 3300039437 Bacteria 950
399 Ga0436365_1112641 3300039437 Bacteria 3351
400 Ga0436365_1192333 3300039437 Bacteria 1003
401 Ga0436365_1296594 3300039437 Bacteria 887
402 Ga0436365_1331551 3300039437 Bacteria 9291
403 Ga0436365_1469372 3300039437 Bacteria 1111
404 Ga0436365_1544784 3300039437 Bacteria 5536
405 Ga0436365_1589280 3300039437 Bacteria 588
406 Ga0436365_1662543 3300039437 Bacteria 16980
407 Ga0436365_1688016 3300039437 Bacteria 932
408 Ga0436365_1709979 3300039437 Bacteria 1873
409 Ga0436360_0344681 3300039438 Bacteria 1136
410 Ga0436360_0503545 3300039438 Bacteria 933
411 Ga0436360_1281492 3300039438 Bacteria 855
412 Ga0436361_0295179 3300039447 Bacteria 508
413 Ga0436361_0585938 3300039447 Bacteria 805
414 Ga0436361_0849285 3300039447 Bacteria 559
415 Ga0436361_1220824 3300039447 Bacteria 1616
416 Ga0436363_0027919 3300039450 Bacteria 1826
417 Ga0436363_0032375 3300039450 Bacteria 1459
418 Ga0436363_0032926 3300039450 Bacteria 683
419 Ga0436363_0136874 3300039450 Bacteria 50367
420 Ga0436363_0145734 3300039450 Bacteria 3290
421 Ga0436363_0180243 3300039450 Bacteria 1660
422 Ga0436363_0330098 3300039450 Bacteria 856
423 Ga0436363_0351951 3300039450 Bacteria 742
424 Ga0436363_0376788 3300039450 Bacteria 963
425 Ga0436363_0532966 3300039450 Bacteria 1169
426 Ga0436363_0678090 3300039450 Bacteria 2537
427 Ga0436363_0889406 3300039450 Bacteria 833
428 Ga0436363_1003415 3300039450 Bacteria 859
429 Ga0436363_1115108 3300039450 Bacteria 806
430 Ga0436363_1187247 3300039450 Bacteria 897
431 Ga0436363_1191833 3300039450 Bacteria 863
432 Ga0436363_1392677 3300039450 Bacteria 811
433 Ga0436363_1401676 3300039450 Bacteria 1404
434 Ga0436363_1566285 3300039450 Bacteria 826
435 Ga0436363_1686345 3300039450 Bacteria 865
436 Ga0436362_0021263 3300039453 Bacteria 606
437 Ga0436362_0187053 3300039453 Bacteria 1619
438 Ga0436362_0299203 3300039453 Bacteria 1296
439 Ga0436362_0351520 3300039453 Bacteria 866
440 Ga0436362_0401791 3300039453 Bacteria 661
441 Ga0436362_0702484 3300039453 Bacteria 927
442 Ga0436362_0774635 3300039453 Bacteria 929
443 Ga0436362_0801538 3300039453 Bacteria 1052
444 Ga0436362_1062177 3300039453 Bacteria 1953
445 Ga0451798_0485314 3300041458 Bacteria 550
446 Ga0451837_1551250 3300041494 Bacteria 1209
447 Ga0451849_1412726 3300041505 Bacteria 628
448 Ga0451851_1253955 3300041507 Bacteria 575
449 Ga0451855_0958897 3300041511 Bacteria 542
450 Ga0466969_0135109 3300044656 Bacteria 1142
451 Ga0466969_0154577 3300044656 Bacteria 1056
452 Ga0466969_0256187 3300044656 Bacteria 793
453 Ga0466965_0209444 3300044683 Bacteria 1036
454 Ga0466965_0241562 3300044683 Bacteria 967
455 Ga0466965_0251688 3300044683 Bacteria 948
456 Ga0466965_0720926 3300044683 Bacteria 573
457 Ga0466965_0880549 3300044683 Bacteria 521
458 Ga0466965_0922039 3300044683 Bacteria 510
459 Ga0466966_0026754 3300044684 Bacteria 3765
460 Ga0466966_0190379 3300044684 Bacteria 1243
461 Ga0466966_0493158 3300044684 Bacteria 737
462 Ga0466966_0679812 3300044684 Bacteria 620
463 Ga0466961_0004906 3300044693 Bacteria 8412
464 Ga0466961_0070568 3300044693 Bacteria 2218
465 Ga0466961_0106847 3300044693 Bacteria 1762
466 Ga0466961_0357524 3300044693 Bacteria 888
467 Ga0466961_0505124 3300044693 Bacteria 730
468 Ga0466963_0009311 3300044694 Bacteria 5914
469 Ga0466963_0011289 3300044694 Bacteria 5435
470 Ga0466963_0021793 3300044694 Bacteria 4047
471 Ga0466963_0092669 3300044694 Bacteria 2059
472 Ga0466963_0235970 3300044694 Bacteria 1282
473 Ga0466963_0263093 3300044694 Bacteria 1211
474 Ga0466963_0316391 3300044694 Bacteria 1098
475 Ga0466964_0062838 3300044706 Bacteria 1549
476 Ga0466964_0249332 3300044706 Bacteria 875
477 Ga0466964_0345125 3300044706 Bacteria 763
478 Ga0466964_0550780 3300044706 Bacteria 626
479 Ga0466971_0135543 3300044719 Bacteria 1145
480 Ga0466971_0232982 3300044719 Bacteria 875
481 Ga0466971_0295997 3300044719 Bacteria 776
482 Ga0466971_0357709 3300044719 Bacteria 707
483 Ga0466971_0631924 3300044719 Bacteria 535
484 Ga0466968_0081768 3300044735 Bacteria 1420
485 Ga0466968_0109639 3300044735 Bacteria 1240
486 Ga0466968_0172288 3300044735 Bacteria 1003
487 Ga0466968_0214955 3300044735 Bacteria 904
488 Ga0466968_0435662 3300044735 Bacteria 646
489 Ga0466968_0503744 3300044735 Bacteria 604
490 Ga0466970_0016616 3300044765 Bacteria 3797
491 Ga0466970_0070219 3300044765 Bacteria 1883
492 Ga0466970_0273002 3300044765 Bacteria 950
493 Ga0466970_0333917 3300044765 Bacteria 858
494 Ga0466957_0026899 3300044842 Bacteria 3415
495 Ga0466957_0054949 3300044842 Bacteria 2432
496 Ga0466957_0151759 3300044842 Bacteria 1499
497 Ga0466957_0297956 3300044842 Bacteria 1083
498 Ga0466957_0459517 3300044842 Bacteria 878
499 Ga0466957_0638840 3300044842 Bacteria 748
500 Ga0466957_0674006 3300044842 Bacteria 728
501 Ga0466957_0750043 3300044842 Bacteria 691
502 Ga0466957_1075263 3300044842 Bacteria 579
503 Ga0466959_0009134 3300045049 Bacteria 7040
504 Ga0466959_0014110 3300045049 Bacteria 5798
505 Ga0466959_0019509 3300045049 Bacteria 4986
506 Ga0466959_0105651 3300045049 Bacteria 2013
507 Ga0466959_0123556 3300045049 Bacteria 1838
508 Ga0466959_0126886 3300045049 Bacteria 1811
509 Ga0466959_0186337 3300045049 Bacteria 1450
510 Ga0466959_0530305 3300045049 Bacteria 795
511 Ga0466959_0567663 3300045049 Bacteria 764
512 Ga0466959_0640945 3300045049 Bacteria 713
513 Ga0466959_1116573 3300045049 Bacteria 524
514 Ga0466958_0008849 3300045836 Bacteria 5595
515 Ga0466958_0014571 3300045836 Bacteria 4488
516 Ga0466958_0018330 3300045836 Bacteria 4062
517 Ga0466958_0076506 3300045836 Bacteria 2054
518 Ga0466958_0085134 3300045836 Bacteria 1950
519 Ga0466958_0129795 3300045836 Bacteria 1582
520 Ga0466958_0253711 3300045836 Bacteria 1125
521 Ga0466958_0271529 3300045836 Bacteria 1086
522 Ga0466958_0330686 3300045836 Bacteria 980
523 Ga0466958_0345460 3300045836 Bacteria 957
524 Ga0466958_0387199 3300045836 Bacteria 902
525 Ga0466958_0544296 3300045836 Bacteria 754
526 Ga0466967_0002408 3300045976 Bacteria 11613
527 Ga0466967_0005406 3300045976 Bacteria 8846
528 Ga0466967_0162915 3300045976 Bacteria 2094
529 Ga0466967_0198763 3300045976 Bacteria 1898
530 Ga0466967_0213157 3300045976 Bacteria 1832
531 Ga0466967_0926030 3300045976 Bacteria 867
532 Ga0466967_1082599 3300045976 Bacteria 798
533 Ga0466967_2296999 3300045976 Bacteria 535
534 Ga0466967_2319748 3300045976 Bacteria 532
535 Ga0495590_0166854 3300046457 Bacteria 802
536 Ga0495653_0002457 3300046463 Bacteria 14725
537 Ga0495653_0524043 3300046463 Bacteria 736
538 Ga0495582_0367491 3300046473 Bacteria 829
539 Ga0495664_0000007 3300046477 Bacteria 386710
540 Ga0495664_0436072 3300046477 Bacteria 785
541 Ga0495664_0485182 3300046477 Bacteria 739
542 Ga0495585_0285941 3300046492 Bacteria 814
543 Ga0495596_0053322 3300046500 Bacteria 1582
544 Ga0495608_0389953 3300046511 Bacteria 853
545 Ga0495618_0000035 3300046514 Bacteria 102739
546 Ga0495620_0209860 3300046515 Bacteria 747
547 Ga0495630_0000610 3300046517 Bacteria 25880
548 Ga0495630_0949901 3300046517 Bacteria 654
549 Ga0495631_0197915 3300046518 Bacteria 859
550 Ga0495643_0088629 3300046522 Bacteria 1599
551 Ga0495644_0080611 3300046523 Bacteria 1227
552 Ga0495644_0132008 3300046523 Bacteria 952
553 Ga0495663_0024643 3300046525 Bacteria 1750
554 Ga0495652_0081348 3300046529 Bacteria 2672
555 Ga0495586_0094048 3300046535 Bacteria 1658
556 Ga0495587_0127170 3300046536 Bacteria 1458
557 Ga0495609_0307552 3300046538 Bacteria 645
558 Ga0495645_0000033 3300046543 Bacteria 105930
559 Ga0495645_0000159 3300046543 Bacteria 46648
560 Ga0495645_0344692 3300046543 Bacteria 961
561 Ga0495633_0264960 3300046558 Bacteria 783
562 Ga0495656_0175950 3300046615 Bacteria 1049
563 Ga0495635_0460670 3300046663 Bacteria 840
564 Ga0495588_0305027 3300046674 Bacteria 838
565 Ga0495657_0000027 3300046675 Bacteria 131421
566 Ga0495657_0306616 3300046675 Bacteria 946
567 Ga0495646_0243138 3300046680 Bacteria 966
568 Ga0495646_0330790 3300046680 Bacteria 801
569 Ga0495669_0220166 3300046684 Bacteria 910
570 Ga0495624_0552101 3300046690 Bacteria 688
571 Ga0495670_0168519 3300046691 Bacteria 1153
572 Ga0495589_0106285 3300046794 Bacteria 1356
573 Ga0495589_0160991 3300046794 Bacteria 1069
574 Ga0495600_0011832 3300046809 Bacteria 5449
575 Ga0495600_0820330 3300046809 Bacteria 553
576 Ga0495676_0495339 3300047321 Bacteria 802
577 Ga0495680_1012982 3300047322 Bacteria 530
578 Ga0495685_166922 3300047447 Bacteria 712
579 Ga0495686_0416296 3300047472 Bacteria 719
580 Ga0495615_0262081 3300048090 Bacteria 551
581 Ga0496100_0001215 3300048903 Bacteria 12520
582 Ga0496101_0394172 3300048904 Bacteria 1090
583 Ga0496101_0502460 3300048904 Bacteria 958
584 Ga0496101_1332697 3300048904 Bacteria 561
585 Ga0496102_0000002 3300048905 Bacteria 814588
586 Ga0496102_0385249 3300048905 Bacteria 1319
587 Ga0496102_0535385 3300048905 Bacteria 1094
588 Ga0496102_0612487 3300048905 Bacteria 1012
589 Ga0496102_0777672 3300048905 Bacteria 880
590 Ga0496103_0000017 3300048906 Bacteria 244768
591 Ga0496103_0401828 3300048906 Bacteria 880
592 Ga0496104_0000001 3300048907 Bacteria 711867
593 Ga0496104_0576220 3300048907 Bacteria 1036
594 Ga0496104_1528916 3300048907 Bacteria 570
595 Ga0496105_0218944 3300048908 Bacteria 1550
596 Ga0496105_0292086 3300048908 Bacteria 1312
597 Ga0496105_0696822 3300048908 Bacteria 780
598 Ga0496105_0831945 3300048908 Bacteria 700
599 Ga0496106_0963957 3300048909 Bacteria 672
600 Ga0496107_0140213 3300048910 Bacteria 1787
601 Ga0496107_0370657 3300048910 Bacteria 1065
602 Ga0496108_0462407 3300048911 Bacteria 1108
603 Ga0496108_0645387 3300048911 Bacteria 920
604 Ga0496109_0238485 3300048912 Bacteria 1711
605 Ga0496110_0000152 3300048913 Bacteria 41561
606 Ga0496110_0047309 3300048913 Bacteria 3766
607 Ga0496110_0619147 3300048913 Bacteria 981
608 Ga0496111_0000123 3300048914 Bacteria 33765
609 Ga0496111_0335987 3300048914 Bacteria 1118
610 Ga0496112_0103136 3300048915 Bacteria 2822
611 Ga0496112_1056837 3300048915 Bacteria 731
612 Ga0496113_0120615 3300048916 Bacteria 2050
613 Ga0496114_0328950 3300048917 Bacteria 1351
614 Ga0496114_0485472 3300048917 Bacteria 1093
615 Ga0496114_1574300 3300048917 Bacteria 545
616 Ga0496115_0000258 3300048918 Bacteria 47079
617 Ga0496115_0013335 3300048918 Bacteria 6217
618 Ga0496115_0948040 3300048918 Bacteria 661
619 Ga0496123_0131159 3300048926 Bacteria 1388
620 Ga0501306_091840 3300049127 Bacteria 534
621 Ga0501300_061016 3300049523 Bacteria 597
622 Ga0501031_0034173 3300049568 Bacteria 3318
623 Ga0501032_0001419 3300049569 Bacteria 19025
624 Ga0501032_0842708 3300049569 Bacteria 578
625 Ga0501033_0026435 3300049570 Bacteria 4368
626 Ga0501034_0019312 3300049571 Bacteria 6973
627 Ga0501036_0023794 3300049572 Bacteria 5161
628 Ga0501037_0021875 3300049573 Bacteria 4733
629 Ga0501038_0014761 3300049574 Bacteria 7117
630 Ga0501039_0132069 3300049575 Bacteria 1959
631 Ga0501041_0239420 3300049577 Bacteria 1140
632 Ga0501042_0001923 3300049578 Bacteria 12499
633 Ga0501043_0104612 3300049579 Bacteria 2224
634 Ga0501043_0435476 3300049579 Bacteria 987
635 Ga0501046_0008154 3300049580 Bacteria 9150
636 Ga0501047_0043981 3300049581 Bacteria 4313
637 Ga0501047_0082923 3300049581 Bacteria 3081
638 Ga0501047_0903150 3300049581 Bacteria 697
639 Ga0501048_0002360 3300049582 Bacteria 14414
640 Ga0501048_0923485 3300049582 Bacteria 628
641 Ga0501067_0015994 3300049583 Bacteria 4150
642 Ga0501067_0689895 3300049583 Bacteria 574
643 Ga0501068_0048751 3300049584 Bacteria 2557
644 Ga0501068_0150346 3300049584 Bacteria 1463
645 Ga0501069_0030830 3300049585 Bacteria 2946
646 Ga0501069_0081305 3300049585 Bacteria 1825
647 Ga0501069_0141407 3300049585 Bacteria 1381
648 Ga0501069_0869857 3300049585 Bacteria 548
649 Ga0501070_0027023 3300049586 Bacteria 4813
650 Ga0501071_0281722 3300049587 Bacteria 1258
651 Ga0501072_0034435 3300049588 Bacteria 3970
652 Ga0501072_0541254 3300049588 Bacteria 920
653 Ga0501073_0005329 3300049589 Bacteria 9645
654 Ga0501073_0132458 3300049589 Bacteria 1728
655 Ga0501073_0716394 3300049589 Bacteria 690
656 Ga0501074_0079553 3300049590 Bacteria 2352
657 Ga0501074_0154061 3300049590 Bacteria 1642
658 Ga0501075_0328392 3300049591 Bacteria 1166
659 Ga0501075_0926867 3300049591 Bacteria 662
660 Ga0501076_0271774 3300049592 Bacteria 1388
661 Ga0501198_049626 3300049649 Bacteria 745
662 Ga0501202_028277 3300049652 Bacteria 1157
663 Ga0501225_0255530 3300049705 Bacteria 578
664 Ga0501079_0082592 3300049741 Bacteria 2485
665 Ga0501079_0120171 3300049741 Bacteria 2043
666 Ga0501080_0038231 3300049742 Bacteria 4481
667 Ga0501080_0060612 3300049742 Bacteria 3522
668 Ga0501083_0021040 3300049744 Bacteria 4534
669 Ga0501083_0718693 3300049744 Bacteria 650
670 Ga0501083_0811563 3300049744 Bacteria 609
671 Ga0501035_0026409 3300049822 Bacteria 5312
672 Ga0501044_0046126 3300049823 Bacteria 4513
673 nmdc:mga00v17_233674_c1 3300050491 Bacteria 1191
674 nmdc:mga0yw44_368517_c1 3300050492 Bacteria 969
675 nmdc:mga05p37_1061659_c1 3300050507 Bacteria 853
676 nmdc:mga05p37_1064446_c1 3300050507 Bacteria 851
677 nmdc:mga05p37_1563070_c1 3300050507 Bacteria 652
678 nmdc:mga05p37_761789_c1 3300050507 Bacteria 1065
679 nmdc:mga09592_108160_c1 3300050508 Bacteria 2385
680 nmdc:mga09592_780712_c1 3300050508 Bacteria 809
681 nmdc:mga0qj67_1179658_c1 3300050509 Bacteria 596
682 nmdc:mga0qj67_12200_c1 3300050509 Bacteria 6467
683 nmdc:mga0qj67_697275_c1 3300050509 Bacteria 808
684 nmdc:mga0qj67_766591_c1 3300050509 Bacteria 765
685 nmdc:mga0qj67_938869_c1 3300050509 Bacteria 680
686 nmdc:mga08y16_275095_c1 3300050511 Bacteria 1738
687 nmdc:mga08y16_427549_c1 3300050511 Bacteria 1353
688 nmdc:mga0a205_1075773_c1 3300050515 Bacteria 651
689 nmdc:mga0a205_797555_c1 3300050515 Bacteria 792
690 Ga0495601_0357794 3300053077 Bacteria 949
691 Ga0495601_0504949 3300053077 Bacteria 780
692 Ga0495655_0008046 3300053083 Bacteria 1988
693 Ga0495655_0120668 3300053083 Bacteria 797
694 Ga0495619_0158223 3300053085 Bacteria 1564
695 Ga0495619_0533917 3300053085 Bacteria 805
696 Ga0495619_0699628 3300053085 Bacteria 689
697 Ga0495619_0868793 3300053085 Bacteria 608
698 Ga0495619_1186930 3300053085 Bacteria 506
699 Ga0500641_0114552 3300053096 Bacteria 1161
700 Ga0500641_0277123 3300053096 Bacteria 696
701 Ga0501084_0088731 3300054114 Bacteria 2596
702 Ga0501084_1383447 3300054114 Bacteria 589
703 Ga0590071_144989 3300059421 Bacteria 614
704 Ga0590075_059045 3300059424 Bacteria 988
705 Ga0587084_053854 3300059477 Bacteria 719
706 Ga0587093_014885 3300059478 Bacteria 976
707 Ga0587066_047517 3300059490 Bacteria 832
708 Ga0587066_105945 3300059490 Bacteria 646
709 Ga0587070_095587 3300059491 Bacteria 675
710 Ga0587073_0132035 3300059492 Bacteria 687
711 Ga0587077_117187 3300059493 Bacteria 660
712 Ga0587077_118160 3300059493 Bacteria 658
713 Ga0587080_019869 3300059503 Bacteria 1091
714 Ga0587082_117078 3300059504 Bacteria 598
715 Ga0587082_153156 3300059504 Bacteria 547
716 Ga0587082_195456 3300059504 Bacteria 503
717 Ga0587083_0038830 3300059505 Bacteria 986
718 Ga0587083_0067777 3300059505 Bacteria 821
719 Ga0587083_0069002 3300059505 Bacteria 816
720 Ga0587083_0262681 3300059505 Bacteria 519
721 Ga0587085_085026 3300059506 Bacteria 644
722 Ga0587085_103493 3300059506 Bacteria 604
723 Ga0587085_127256 3300059506 Bacteria 566
724 Ga0587086_048068 3300059507 Bacteria 680
725 Ga0587088_100566 3300059508 Bacteria 645
726 Ga0587089_047168 3300059509 Bacteria 682
727 Ga0587090_068847 3300059510 Bacteria 687
728 Ga0587090_089920 3300059510 Bacteria 628
729 Ga0587091_087291 3300059511 Bacteria 710
730 Ga0587091_148730 3300059511 Bacteria 593
731 Ga0587098_083523 3300059604 Bacteria 535
732 Ga0587106_046646 3300059605 Bacteria 755
733 Ga0587115_042577 3300059626 Bacteria 714
734 Ga0587117_045152 3300059627 Bacteria 715
735 Ga0587128_077506 3300059630 Bacteria 659
736 Ga0587128_085959 3300059630 Bacteria 637
737 Ga0587128_111147 3300059630 Bacteria 586
738 Ga0587128_120517 3300059630 Bacteria 571
739 Ga0587128_142329 3300059630 Bacteria 540
740 Ga0587130_029628 3300059631 Bacteria 626
741 Ga0587067_075553 3300059640 Bacteria 736
742 Ga0587068_045948 3300059641 Bacteria 804
743 Ga0587068_047189 3300059641 Bacteria 796
744 Ga0587075_048811 3300059644 Bacteria 732
745 Ga0587076_091514 3300059645 Bacteria 666
746 Ga0587076_121773 3300059645 Bacteria 605
747 Ga0587079_089135 3300059647 Bacteria 719
748 Ga0587079_098913 3300059647 Bacteria 694
749 Ga0587100_019026 3300059648 Bacteria 656
750 Ga0587114_079771 3300059655 Bacteria 607
751 Ga0587119_046021 3300059658 Bacteria 640
752 Ga0587071_039236 3300060344 Bacteria 943
753 Ga0587071_042087 3300060344 Bacteria 919
754 Ga0587071_094709 3300060344 Bacteria 683
755 Ga0587071_167645 3300060344 Bacteria 556
756 Ga0587111_0073488 3300060346 Bacteria 803
757 Ga0587111_0239058 3300060346 Bacteria 532
758 Ga0501082_0039856 3300060353 Bacteria 4052
759 Ga0466962_0014349 3300061719 Bacteria 3819
760 Ga0466962_0015342 3300061719 Bacteria 3694
761 Ga0466962_0046924 3300061719 Bacteria 2064
762 Ga0466962_0107606 3300061719 Bacteria 1341
763 Ga0466962_0275007 3300061719 Bacteria 831
764 Ga0466962_0350587 3300061719 Bacteria 735

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300059511 Ga0587091_148730 Ga0587091_148730_40_423 118
2 3300031911 Ga0307412_11935075 Ga0307412_119350752 122
3 3300049569 Ga0501032_0842708 Ga0501032_0842708_112_480 122
4 3300049581 Ga0501047_0043981 Ga0501047_0043981_1081_1449 122
5 3300049585 Ga0501069_0141407 Ga0501069_0141407_673_1041 122
6 3300049589 Ga0501073_0132458 Ga0501073_0132458_688_1056 122
7 3300049744 Ga0501083_0718693 Ga0501083_0718693_262_630 122
8 3300003308 Ga0006777J48905_1063153 Ga0006777J48905_10631531 123
9 3300003544 Ga0007417J51691_1056724 Ga0007417J51691_10567241 123
10 3300003577 Ga0007416J51690_1064679 Ga0007416J51690_10646791 123
11 3300003579 Ga0007429J51699_1054942 Ga0007429J51699_10549422 123
12 3300003693 Ga0032354_1055984 Ga0032354_10559841 123
13 3300004798 Ga0058859_11782233 Ga0058859_117822331 123
14 3300005456 Ga0070678_100000830 Ga0070678_1000008302 123
15 3300005545 Ga0070695_100369828 Ga0070695_1003698282 123
16 3300005546 Ga0070696_100042297 Ga0070696_1000422971 123
17 3300005617 Ga0068859_102381056 Ga0068859_1023810561 123
18 3300005983 Ga0081540_1149021 Ga0081540_11490212 123
19 3300006931 Ga0097620_102380962 Ga0097620_1023809621 123
20 3300009148 Ga0105243_10234625 Ga0105243_102346251 123
21 3300009148 Ga0105243_10817676 Ga0105243_108176763 123
22 3300009176 Ga0105242_11237829 Ga0105242_112378292 123
23 3300009553 Ga0105249_10514192 Ga0105249_105141921 123
24 3300011119 Ga0105246_11246359 Ga0105246_112463591 123
25 3300025934 Ga0207686_10759341 Ga0207686_107593413 123
26 3300025942 Ga0207689_10489602 Ga0207689_104896021 123
27 3300025961 Ga0207712_10717494 Ga0207712_107174942 123
28 3300026088 Ga0207641_12106298 Ga0207641_121062981 123
29 3300026118 Ga0207675_101285499 Ga0207675_1012854992 123
30 3300026142 Ga0207698_11304754 Ga0207698_113047542 123
31 3300028380 Ga0268265_10261569 Ga0268265_102615693 123
32 3300028563 Ga0265319_1119056 Ga0265319_11190562 123
33 3300028654 Ga0265322_10095602 Ga0265322_100956022 123
34 3300031240 Ga0265320_10011831 Ga0265320_100118318 123
35 3300031240 Ga0265320_10335286 Ga0265320_103352861 123
36 3300031250 Ga0265331_10503127 Ga0265331_105031272 123
37 3300031711 Ga0265314_10167811 Ga0265314_101678112 123
38 3300031712 Ga0265342_10399056 Ga0265342_103990561 123
39 3300046473 Ga0495582_0367491 Ga0495582_0367491_55_426 123
40 3300046511 Ga0495608_0389953 Ga0495608_0389953_389_760 123
41 3300046523 Ga0495644_0132008 Ga0495644_0132008_294_665 123
42 3300046663 Ga0495635_0460670 Ga0495635_0460670_243_614 123
43 3300046794 Ga0495589_0160991 Ga0495589_0160991_436_807 123
44 3300048904 Ga0496101_1332697 Ga0496101_1332697_120_491 123
45 3300048905 Ga0496102_0612487 Ga0496102_0612487_343_714 123
46 3300048909 Ga0496106_0963957 Ga0496106_0963957_40_411 123
47 3300048910 Ga0496107_0140213 Ga0496107_0140213_576_947 123
48 3300048911 Ga0496108_0645387 Ga0496108_0645387_291_662 123
49 3300048913 Ga0496110_0619147 Ga0496110_0619147_411_782 123
50 3300049577 Ga0501041_0239420 Ga0501041_0239420_565_936 123
51 3300049579 Ga0501043_0435476 Ga0501043_0435476_158_529 123
52 3300049581 Ga0501047_0903150 Ga0501047_0903150_238_609 123
53 3300049588 Ga0501072_0541254 Ga0501072_0541254_165_536 123
54 3300049590 Ga0501074_0079553 Ga0501074_0079553_1329_1700 123
55 3300049592 Ga0501076_0271774 Ga0501076_0271774_150_521 123
56 3300049741 Ga0501079_0082592 Ga0501079_0082592_632_1003 123
57 3300049744 Ga0501083_0811563 Ga0501083_0811563_210_581 123
58 3300053096 Ga0500641_0277123 Ga0500641_0277123_235_606 123
59 3300054114 Ga0501084_1383447 Ga0501084_1383447_63_434 123
60 3300059493 Ga0587077_118160 Ga0587077_118160_175_546 123
61 3300059504 Ga0587082_153156 Ga0587082_153156_149_520 123
62 3300059506 Ga0587085_127256 Ga0587085_127256_114_485 123
63 3300059510 Ga0587090_089920 Ga0587090_089920_232_603 123
64 3300059658 Ga0587119_046021 Ga0587119_046021_219_590 123
65 3300006844 Ga0075428_100935741 Ga0075428_1009357411 124
66 3300041458 Ga0451798_0485314 Ga0451798_0485314_98_472 124
67 3300049127 Ga0501306_091840 Ga0501306_091840_48_422 124
68 3300005564 Ga0070664_100123830 Ga0070664_1001238303 125
69 3300006914 Ga0075436_101495819 Ga0075436_1014958191 125
70 3300025920 Ga0207649_10646531 Ga0207649_106465313 125
71 3300025945 Ga0207679_10043796 Ga0207679_100437965 125
72 3300028800 Ga0265338_10075957 Ga0265338_100759574 125
73 3300039437 Ga0436365_1469372 Ga0436365_1469372_656_1033 125
74 3300039450 Ga0436363_0376788 Ga0436363_0376788_429_806 125
75 3300048905 Ga0496102_0535385 Ga0496102_0535385_447_824 125
76 3300048908 Ga0496105_0696822 Ga0496105_0696822_360_737 125
77 3300048918 Ga0496115_0000258 Ga0496115_0000258_2251_2628 125
78 3300048918 Ga0496115_0013335 Ga0496115_0013335_3592_3969 125
79 3300048926 Ga0496123_0131159 Ga0496123_0131159_815_1192 125
80 3300049591 Ga0501075_0328392 Ga0501075_0328392_195_572 125
81 3300005457 Ga0070662_101526355 Ga0070662_1015263551 126
82 3300005545 Ga0070695_100676321 Ga0070695_1006763212 126
83 3300005718 Ga0068866_11264619 Ga0068866_112646192 126
84 3300006846 Ga0075430_100647440 Ga0075430_1006474401 126
85 3300006846 Ga0075430_101179430 Ga0075430_1011794301 126
86 3300009093 Ga0105240_10006736 Ga0105240_100067363 126
87 3300009098 Ga0105245_10235778 Ga0105245_102357782 126
88 3300009174 Ga0105241_10309942 Ga0105241_103099423 126
89 3300009174 Ga0105241_11850817 Ga0105241_118508171 126
90 3300009553 Ga0105249_10349025 Ga0105249_103490252 126
91 3300014326 Ga0157380_10932425 Ga0157380_109324251 126
92 3300020070 Ga0206356_10449285 Ga0206356_104492854 126
93 3300020075 Ga0206349_1914227 Ga0206349_19142272 126
94 3300025899 Ga0207642_10771549 Ga0207642_107715491 126
95 3300025911 Ga0207654_10908541 Ga0207654_109085412 126
96 3300025913 Ga0207695_10023985 Ga0207695_100239858 126
97 3300025933 Ga0207706_10850026 Ga0207706_108500261 126
98 3300025933 Ga0207706_11294405 Ga0207706_112944051 126
99 3300032126 Ga0307415_102503742 Ga0307415_1025037421 126
100 3300035725 Ga0373947_0174086 Ga0373947_0174086_565_945 126
101 3300039437 Ga0436365_0143115 Ga0436365_0143115_75_455 126
102 3300046477 Ga0495664_0000007 Ga0495664_0000007_136191_136571 126
103 3300046529 Ga0495652_0081348 Ga0495652_0081348_171_551 126
104 3300046535 Ga0495586_0094048 Ga0495586_0094048_1002_1382 126
105 3300046809 Ga0495600_0011832 Ga0495600_0011832_4644_5024 126
106 3300048905 Ga0496102_0000002 Ga0496102_0000002_635117_635497 126
107 3300048906 Ga0496103_0000017 Ga0496103_0000017_228334_228714 126
108 3300048907 Ga0496104_0000001 Ga0496104_0000001_332904_333284 126
109 3300048908 Ga0496105_0292086 Ga0496105_0292086_363_743 126
110 3300048913 Ga0496110_0000152 Ga0496110_0000152_32743_33123 126
111 3300048914 Ga0496111_0000123 Ga0496111_0000123_5552_5932 126
112 3300050509 nmdc:mga0qj67_12200_c1 nmdc:mga0qj67_12200_c1_6053_6433 126
113 3300050509 nmdc:mga0qj67_766591_c1 nmdc:mga0qj67_766591_c1_35_415 126
114 3300053077 Ga0495601_0504949 Ga0495601_0504949_147_527 126
115 3300053085 Ga0495619_0158223 Ga0495619_0158223_111_491 126
116 3300059492 Ga0587073_0132035 Ga0587073_0132035_83_463 126
117 3300059504 Ga0587082_117078 Ga0587082_117078_51_431 126
118 3300059507 Ga0587086_048068 Ga0587086_048068_219_599 126
119 3300059655 Ga0587114_079771 Ga0587114_079771_95_475 126
120 3300000546 LJNas_1007467 LJNas_10074672 127
121 3300003544 Ga0007417J51691_1016750 Ga0007417J51691_10167502 127
122 3300003574 Ga0007410J51695_1017675 Ga0007410J51695_10176752 127
123 3300003575 Ga0007409J51694_1011186 Ga0007409J51694_10111862 127
124 3300003577 Ga0007416J51690_1020405 Ga0007416J51690_10204052 127
125 3300003579 Ga0007429J51699_1027606 Ga0007429J51699_10276061 127
126 3300003693 Ga0032354_1007334 Ga0032354_10073341 127
127 3300004799 Ga0058863_11934614 Ga0058863_119346142 127
128 3300004799 Ga0058863_11964497 Ga0058863_119644971 127
129 3300004800 Ga0058861_11992365 Ga0058861_119923652 127
130 3300004803 Ga0058862_12623738 Ga0058862_126237381 127
131 3300004803 Ga0058862_12792749 Ga0058862_127927492 127
132 3300005329 Ga0070683_100330436 Ga0070683_1003304362 127
133 3300005329 Ga0070683_100479723 Ga0070683_1004797232 127
134 3300005336 Ga0070680_100585102 Ga0070680_1005851022 127
135 3300005336 Ga0070680_100775862 Ga0070680_1007758621 127
136 3300005337 Ga0070682_100404269 Ga0070682_1004042692 127
137 3300005337 Ga0070682_100930240 Ga0070682_1009302402 127
138 3300005338 Ga0068868_101635393 Ga0068868_1016353931 127
139 3300005343 Ga0070687_100538208 Ga0070687_1005382082 127
140 3300005344 Ga0070661_100370971 Ga0070661_1003709711 127
141 3300005345 Ga0070692_10005318 Ga0070692_100053184 127
142 3300005345 Ga0070692_11053737 Ga0070692_110537372 127
143 3300005355 Ga0070671_101455884 Ga0070671_1014558841 127
144 3300005366 Ga0070659_100000160 Ga0070659_10000016026 127
145 3300005366 Ga0070659_100395794 Ga0070659_1003957942 127
146 3300005366 Ga0070659_100484767 Ga0070659_1004847671 127
147 3300005366 Ga0070659_101404006 Ga0070659_1014040062 127
148 3300005434 Ga0070709_10511387 Ga0070709_105113871 127
149 3300005434 Ga0070709_11438456 Ga0070709_114384561 127
150 3300005435 Ga0070714_100018243 Ga0070714_1000182434 127
151 3300005435 Ga0070714_100076714 Ga0070714_1000767144 127
152 3300005435 Ga0070714_100190199 Ga0070714_1001901992 127
153 3300005435 Ga0070714_100267532 Ga0070714_1002675323 127
154 3300005435 Ga0070714_100376416 Ga0070714_1003764162 127
155 3300005435 Ga0070714_100414251 Ga0070714_1004142512 127
156 3300005435 Ga0070714_100420905 Ga0070714_1004209052 127
157 3300005435 Ga0070714_100843472 Ga0070714_1008434722 127
158 3300005435 Ga0070714_101543834 Ga0070714_1015438341 127
159 3300005435 Ga0070714_101746451 Ga0070714_1017464511 127
160 3300005436 Ga0070713_100551375 Ga0070713_1005513751 127
161 3300005436 Ga0070713_100732827 Ga0070713_1007328273 127
162 3300005436 Ga0070713_101875710 Ga0070713_1018757101 127
163 3300005436 Ga0070713_102326394 Ga0070713_1023263941 127
164 3300005437 Ga0070710_10000005 Ga0070710_10000005111 127
165 3300005437 Ga0070710_10119932 Ga0070710_101199322 127
166 3300005437 Ga0070710_10202621 Ga0070710_102026211 127
167 3300005437 Ga0070710_10500829 Ga0070710_105008291 127
168 3300005439 Ga0070711_100002145 Ga0070711_10000214513 127
169 3300005439 Ga0070711_100055655 Ga0070711_1000556553 127
170 3300005439 Ga0070711_100342630 Ga0070711_1003426302 127
171 3300005439 Ga0070711_100425633 Ga0070711_1004256332 127
172 3300005439 Ga0070711_100733572 Ga0070711_1007335722 127
173 3300005440 Ga0070705_100002004 Ga0070705_1000020046 127
174 3300005441 Ga0070700_100324369 Ga0070700_1003243693 127
175 3300005445 Ga0070708_100642959 Ga0070708_1006429592 127
176 3300005456 Ga0070678_102246658 Ga0070678_1022466581 127
177 3300005457 Ga0070662_100310435 Ga0070662_1003104353 127
178 3300005457 Ga0070662_100392137 Ga0070662_1003921372 127
179 3300005458 Ga0070681_10985116 Ga0070681_109851162 127
180 3300005458 Ga0070681_11393309 Ga0070681_113933091 127
181 3300005466 Ga0070685_10672070 Ga0070685_106720702 127
182 3300005468 Ga0070707_100513038 Ga0070707_1005130383 127
183 3300005518 Ga0070699_101025435 Ga0070699_1010254352 127
184 3300005535 Ga0070684_100065608 Ga0070684_1000656084 127
185 3300005535 Ga0070684_100208430 Ga0070684_1002084304 127
186 3300005535 Ga0070684_101056819 Ga0070684_1010568192 127
187 3300005536 Ga0070697_100279209 Ga0070697_1002792093 127
188 3300005539 Ga0068853_100229878 Ga0068853_1002298783 127
189 3300005544 Ga0070686_100396414 Ga0070686_1003964143 127
190 3300005549 Ga0070704_100273070 Ga0070704_1002730702 127
191 3300005564 Ga0070664_101105099 Ga0070664_1011050992 127
192 3300005578 Ga0068854_100445301 Ga0068854_1004453012 127
193 3300005578 Ga0068854_101215749 Ga0068854_1012157491 127
194 3300005615 Ga0070702_100064604 Ga0070702_1000646042 127
195 3300005615 Ga0070702_100174927 Ga0070702_1001749272 127
196 3300005616 Ga0068852_100146967 Ga0068852_1001469672 127
197 3300005616 Ga0068852_100616363 Ga0068852_1006163632 127
198 3300005718 Ga0068866_10226337 Ga0068866_102263373 127
199 3300005719 Ga0068861_100273934 Ga0068861_1002739342 127
200 3300005834 Ga0068851_10377744 Ga0068851_103777441 127
201 3300005842 Ga0068858_100930244 Ga0068858_1009302443 127
202 3300006028 Ga0070717_10008688 Ga0070717_100086887 127
203 3300006028 Ga0070717_10043519 Ga0070717_100435193 127
204 3300006028 Ga0070717_10288172 Ga0070717_102881723 127
205 3300006028 Ga0070717_10593391 Ga0070717_105933912 127
206 3300006028 Ga0070717_10712900 Ga0070717_107129002 127
207 3300006028 Ga0070717_10759070 Ga0070717_107590702 127
208 3300006028 Ga0070717_11128867 Ga0070717_111288672 127
209 3300006028 Ga0070717_11273728 Ga0070717_112737282 127
210 3300006038 Ga0075365_10178436 Ga0075365_101784362 127
211 3300006051 Ga0075364_10376256 Ga0075364_103762562 127
212 3300006058 Ga0075432_10123820 Ga0075432_101238203 127
213 3300006163 Ga0070715_10217202 Ga0070715_102172023 127
214 3300006173 Ga0070716_100040774 Ga0070716_1000407743 127
215 3300006173 Ga0070716_100585981 Ga0070716_1005859812 127
216 3300006175 Ga0070712_100015327 Ga0070712_1000153276 127
217 3300006175 Ga0070712_100015527 Ga0070712_1000155277 127
218 3300006175 Ga0070712_100385985 Ga0070712_1003859853 127
219 3300006175 Ga0070712_101346287 Ga0070712_1013462872 127
220 3300006358 Ga0068871_101824694 Ga0068871_1018246942 127
221 3300006844 Ga0075428_100779757 Ga0075428_1007797572 127
222 3300006846 Ga0075430_100406030 Ga0075430_1004060302 127
223 3300006880 Ga0075429_100008266 Ga0075429_10000826615 127
224 3300006881 Ga0068865_100591571 Ga0068865_1005915712 127
225 3300006881 Ga0068865_101370202 Ga0068865_1013702022 127
226 3300009011 Ga0105251_10368456 Ga0105251_103684561 127
227 3300009093 Ga0105240_11126444 Ga0105240_111264441 127
228 3300009094 Ga0111539_10371241 Ga0111539_103712413 127
229 3300009094 Ga0111539_12086955 Ga0111539_120869551 127
230 3300009098 Ga0105245_10419437 Ga0105245_104194373 127
231 3300009098 Ga0105245_10435547 Ga0105245_104355472 127
232 3300009098 Ga0105245_11641151 Ga0105245_116411512 127
233 3300009101 Ga0105247_10188613 Ga0105247_101886132 127
234 3300009147 Ga0114129_10410816 Ga0114129_104108163 127
235 3300009147 Ga0114129_11244710 Ga0114129_112447101 127
236 3300009147 Ga0114129_11629237 Ga0114129_116292371 127
237 3300009147 Ga0114129_11732699 Ga0114129_117326992 127
238 3300009148 Ga0105243_10187204 Ga0105243_101872044 127
239 3300009148 Ga0105243_10870519 Ga0105243_108705192 127
240 3300009176 Ga0105242_10386951 Ga0105242_103869513 127
241 3300009545 Ga0105237_10000795 Ga0105237_1000079536 127
242 3300009551 Ga0105238_10407094 Ga0105238_104070942 127
243 3300009553 Ga0105249_11273929 Ga0105249_112739292 127
244 3300010375 Ga0105239_10052946 Ga0105239_100529462 127
245 3300010375 Ga0105239_10565745 Ga0105239_105657452 127
246 3300010375 Ga0105239_10728378 Ga0105239_107283783 127
247 3300011119 Ga0105246_10047961 Ga0105246_100479613 127
248 3300011119 Ga0105246_10204294 Ga0105246_102042942 127
249 3300012475 Ga0157317_1029149 Ga0157317_10291491 127
250 3300013062 Ga0154010_123301 Ga0154010_1233012 127
251 3300013297 Ga0157378_12723615 Ga0157378_127236152 127
252 3300013306 Ga0163162_10855954 Ga0163162_108559542 127
253 3300013306 Ga0163162_11040097 Ga0163162_110400972 127
254 3300013307 Ga0157372_10260305 Ga0157372_102603053 127
255 3300013307 Ga0157372_11027672 Ga0157372_110276722 127
256 3300014326 Ga0157380_10423884 Ga0157380_104238842 127
257 3300014326 Ga0157380_10490923 Ga0157380_104909232 127
258 3300014745 Ga0157377_10295674 Ga0157377_102956742 127
259 3300014745 Ga0157377_10616970 Ga0157377_106169702 127
260 3300020069 Ga0197907_10147709 Ga0197907_101477092 127
261 3300020069 Ga0197907_10147937 Ga0197907_101479372 127
262 3300020069 Ga0197907_10274865 Ga0197907_102748652 127
263 3300020069 Ga0197907_10395385 Ga0197907_103953852 127
264 3300020069 Ga0197907_10604094 Ga0197907_106040942 127
265 3300020069 Ga0197907_10658254 Ga0197907_106582542 127
266 3300020069 Ga0197907_10784893 Ga0197907_107848932 127
267 3300020069 Ga0197907_11199968 Ga0197907_111999682 127
268 3300020069 Ga0197907_11212975 Ga0197907_112129753 127
269 3300020070 Ga0206356_10404506 Ga0206356_104045063 127
270 3300020070 Ga0206356_10702775 Ga0206356_107027752 127
271 3300020070 Ga0206356_11616220 Ga0206356_116162202 127
272 3300020070 Ga0206356_11810765 Ga0206356_118107651 127
273 3300020075 Ga0206349_1284854 Ga0206349_12848542 127
274 3300020076 Ga0206355_1001847 Ga0206355_10018473 127
275 3300020076 Ga0206355_1125333 Ga0206355_11253332 127
276 3300020076 Ga0206355_1206623 Ga0206355_12066232 127
277 3300020076 Ga0206355_1478742 Ga0206355_14787421 127
278 3300020076 Ga0206355_1539572 Ga0206355_15395722 127
279 3300020076 Ga0206355_1619291 Ga0206355_16192912 127
280 3300020077 Ga0206351_10366003 Ga0206351_103660031 127
281 3300020077 Ga0206351_10947414 Ga0206351_109474142 127
282 3300020077 Ga0206351_10952347 Ga0206351_109523471 127
283 3300020078 Ga0206352_10069301 Ga0206352_100693012 127
284 3300020078 Ga0206352_10186458 Ga0206352_101864582 127
285 3300020078 Ga0206352_10475010 Ga0206352_104750101 127
286 3300020078 Ga0206352_10598505 Ga0206352_105985052 127
287 3300020080 Ga0206350_10261611 Ga0206350_102616111 127
288 3300020080 Ga0206350_10437302 Ga0206350_104373022 127
289 3300020080 Ga0206350_11032215 Ga0206350_110322152 127
290 3300020080 Ga0206350_11141738 Ga0206350_111417382 127
291 3300020080 Ga0206350_11597202 Ga0206350_115972022 127
292 3300020081 Ga0206354_10449146 Ga0206354_104491462 127
293 3300020081 Ga0206354_10499121 Ga0206354_104991212 127
294 3300020081 Ga0206354_11218193 Ga0206354_112181932 127
295 3300020081 Ga0206354_11425170 Ga0206354_114251702 127
296 3300020081 Ga0206354_11640189 Ga0206354_116401891 127
297 3300020082 Ga0206353_10120481 Ga0206353_101204812 127
298 3300020082 Ga0206353_10433378 Ga0206353_104333784 127
299 3300020082 Ga0206353_10652344 Ga0206353_106523441 127
300 3300020082 Ga0206353_10994385 Ga0206353_109943851 127
301 3300020082 Ga0206353_11518563 Ga0206353_115185633 127
302 3300020610 Ga0154015_1010392 Ga0154015_10103922 127
303 3300020610 Ga0154015_1183149 Ga0154015_11831491 127
304 3300020610 Ga0154015_1209516 Ga0154015_12095161 127
305 3300020610 Ga0154015_1431325 Ga0154015_14313251 127
306 3300020610 Ga0154015_1489538 Ga0154015_14895382 127
307 3300021377 Ga0213874_10000186 Ga0213874_1000018619 127
308 3300021377 Ga0213874_10007135 Ga0213874_100071354 127
309 3300021377 Ga0213874_10077485 Ga0213874_100774851 127
310 3300021377 Ga0213874_10308884 Ga0213874_103088842 127
311 3300021384 Ga0213876_10009713 Ga0213876_100097135 127
312 3300021384 Ga0213876_10016993 Ga0213876_100169932 127
313 3300021384 Ga0213876_10169474 Ga0213876_101694743 127
314 3300021384 Ga0213876_10259435 Ga0213876_102594351 127
315 3300021384 Ga0213876_10308974 Ga0213876_103089741 127
316 3300021384 Ga0213876_10517728 Ga0213876_105177282 127
317 3300021384 Ga0213876_10521368 Ga0213876_105213681 127
318 3300021388 Ga0213875_10001225 Ga0213875_1000122517 127
319 3300021388 Ga0213875_10003279 Ga0213875_100032798 127
320 3300021388 Ga0213875_10006988 Ga0213875_100069884 127
321 3300021388 Ga0213875_10007028 Ga0213875_100070283 127
322 3300021388 Ga0213875_10020207 Ga0213875_100202073 127
323 3300021388 Ga0213875_10046096 Ga0213875_100460962 127
324 3300021388 Ga0213875_10102614 Ga0213875_101026143 127
325 3300021388 Ga0213875_10135676 Ga0213875_101356763 127
326 3300021388 Ga0213875_10137097 Ga0213875_101370972 127
327 3300021388 Ga0213875_10574069 Ga0213875_105740691 127
328 3300022467 Ga0224712_10046331 Ga0224712_100463313 127
329 3300022467 Ga0224712_10137034 Ga0224712_101370341 127
330 3300022467 Ga0224712_10253464 Ga0224712_102534642 127
331 3300022467 Ga0224712_10273654 Ga0224712_102736541 127
332 3300022467 Ga0224712_10281192 Ga0224712_102811921 127
333 3300022467 Ga0224712_10500389 Ga0224712_105003892 127
334 3300025321 Ga0207656_10430606 Ga0207656_104306062 127
335 3300025898 Ga0207692_10000003 Ga0207692_10000003383 127
336 3300025898 Ga0207692_10059514 Ga0207692_100595143 127
337 3300025898 Ga0207692_10124873 Ga0207692_101248732 127
338 3300025898 Ga0207692_10232695 Ga0207692_102326952 127
339 3300025898 Ga0207692_10985649 Ga0207692_109856491 127
340 3300025899 Ga0207642_10097226 Ga0207642_100972263 127
341 3300025905 Ga0207685_10194836 Ga0207685_101948362 127
342 3300025906 Ga0207699_10120006 Ga0207699_101200063 127
343 3300025914 Ga0207671_10007459 Ga0207671_100074593 127
344 3300025915 Ga0207693_10084455 Ga0207693_100844553 127
345 3300025915 Ga0207693_10118948 Ga0207693_101189482 127
346 3300025915 Ga0207693_10175259 Ga0207693_101752592 127
347 3300025915 Ga0207693_10488547 Ga0207693_104885472 127
348 3300025915 Ga0207693_11002443 Ga0207693_110024431 127
349 3300025916 Ga0207663_10002651 Ga0207663_100026516 127
350 3300025916 Ga0207663_10198247 Ga0207663_101982472 127
351 3300025916 Ga0207663_10371479 Ga0207663_103714793 127
352 3300025916 Ga0207663_10625858 Ga0207663_106258582 127
353 3300025916 Ga0207663_10651351 Ga0207663_106513512 127
354 3300025916 Ga0207663_11135416 Ga0207663_111354162 127
355 3300025919 Ga0207657_10033580 Ga0207657_100335806 127
356 3300025920 Ga0207649_10408462 Ga0207649_104084622 127
357 3300025921 Ga0207652_11813439 Ga0207652_118134391 127
358 3300025922 Ga0207646_10141568 Ga0207646_101415682 127
359 3300025922 Ga0207646_10448943 Ga0207646_104489432 127
360 3300025924 Ga0207694_10674996 Ga0207694_106749962 127
361 3300025927 Ga0207687_10505568 Ga0207687_105055682 127
362 3300025927 Ga0207687_11317512 Ga0207687_113175122 127
363 3300025928 Ga0207700_10125575 Ga0207700_101255751 127
364 3300025928 Ga0207700_10229152 Ga0207700_102291523 127
365 3300025928 Ga0207700_10570465 Ga0207700_105704653 127
366 3300025928 Ga0207700_11190054 Ga0207700_111900542 127
367 3300025929 Ga0207664_10000020 Ga0207664_10000020230 127
368 3300025929 Ga0207664_10016090 Ga0207664_100160904 127
369 3300025929 Ga0207664_10119702 Ga0207664_101197023 127
370 3300025929 Ga0207664_10274702 Ga0207664_102747022 127
371 3300025929 Ga0207664_11004377 Ga0207664_110043772 127
372 3300025929 Ga0207664_11160746 Ga0207664_111607462 127
373 3300025929 Ga0207664_11443762 Ga0207664_114437621 127
374 3300025929 Ga0207664_11847877 Ga0207664_118478771 127
375 3300025932 Ga0207690_10000165 Ga0207690_1000016538 127
376 3300025935 Ga0207709_10309612 Ga0207709_103096123 127
377 3300025937 Ga0207669_10537689 Ga0207669_105376892 127
378 3300025938 Ga0207704_10357620 Ga0207704_103576203 127
379 3300025939 Ga0207665_10096814 Ga0207665_100968143 127
380 3300025939 Ga0207665_10403998 Ga0207665_104039981 127
381 3300025939 Ga0207665_10581610 Ga0207665_105816102 127
382 3300025939 Ga0207665_11341572 Ga0207665_113415721 127
383 3300025944 Ga0207661_10047980 Ga0207661_100479803 127
384 3300025944 Ga0207661_10258788 Ga0207661_102587883 127
385 3300025944 Ga0207661_10698591 Ga0207661_106985913 127
386 3300025944 Ga0207661_11004950 Ga0207661_110049501 127
387 3300025944 Ga0207661_11769097 Ga0207661_117690971 127
388 3300025945 Ga0207679_10787836 Ga0207679_107878362 127
389 3300025945 Ga0207679_10959976 Ga0207679_109599762 127
390 3300025972 Ga0207668_10572013 Ga0207668_105720132 127
391 3300025981 Ga0207640_10328424 Ga0207640_103284243 127
392 3300025981 Ga0207640_11109261 Ga0207640_111092611 127
393 3300026035 Ga0207703_10651625 Ga0207703_106516252 127
394 3300026067 Ga0207678_10429999 Ga0207678_104299992 127
395 3300026075 Ga0207708_10354544 Ga0207708_103545442 127
396 3300026078 Ga0207702_10462383 Ga0207702_104623831 127
397 3300026078 Ga0207702_11164039 Ga0207702_111640392 127
398 3300026088 Ga0207641_10380276 Ga0207641_103802763 127
399 3300026089 Ga0207648_11122393 Ga0207648_111223932 127
400 3300026116 Ga0207674_10377936 Ga0207674_103779361 127
401 3300026118 Ga0207675_100191546 Ga0207675_1001915464 127
402 3300026142 Ga0207698_10059058 Ga0207698_100590584 127
403 3300027907 Ga0207428_10240031 Ga0207428_102400312 127
404 3300028381 Ga0268264_11930140 Ga0268264_119301402 127
405 3300028556 Ga0265337_1000328 Ga0265337_100032813 127
406 3300028558 Ga0265326_10000874 Ga0265326_1000087410 127
407 3300028563 Ga0265319_1000863 Ga0265319_100086328 127
408 3300028577 Ga0265318_10000275 Ga0265318_1000027534 127
409 3300028654 Ga0265322_10004443 Ga0265322_100044436 127
410 3300028666 Ga0265336_10000043 Ga0265336_10000043125 127
411 3300028800 Ga0265338_10000142 Ga0265338_1000014224 127
412 3300028800 Ga0265338_10314049 Ga0265338_103140491 127
413 3300029957 Ga0265324_10002249 Ga0265324_100022496 127
414 3300030863 Ga0265766_1005144 Ga0265766_10051441 127
415 3300031010 Ga0265771_1015233 Ga0265771_10152332 127
416 3300031235 Ga0265330_10279511 Ga0265330_102795112 127
417 3300031247 Ga0265340_10000006 Ga0265340_10000006125 127
418 3300031344 Ga0265316_10089873 Ga0265316_100898734 127
419 3300031711 Ga0265314_10073998 Ga0265314_100739983 127
420 3300031731 Ga0307405_11625222 Ga0307405_116252222 127
421 3300031852 Ga0307410_11524385 Ga0307410_115243851 127
422 3300031903 Ga0307407_10634965 Ga0307407_106349652 127
423 3300031903 Ga0307407_10910688 Ga0307407_109106881 127
424 3300031995 Ga0307409_101299224 Ga0307409_1012992241 127
425 3300032002 Ga0307416_103646449 Ga0307416_1036464491 127
426 3300032005 Ga0307411_10637143 Ga0307411_106371431 127
427 3300035170 Ga0373943_0972404 Ga0373943_0972404_71_454 127
428 3300035692 Ga0373935_1269532 Ga0373935_1269532_129_512 127
429 3300036457 Ga0265778_025158 Ga0265778_025158_31_414 127
430 3300037312 Ga0395899_0709025 Ga0395899_0709025_43_426 127
431 3300037466 Ga0395898_0514379 Ga0395898_0514379_203_586 127
432 3300037853 Ga0436364_0041476 Ga0436364_0041476_458_841 127
433 3300037853 Ga0436364_0054318 Ga0436364_0054318_2037_2420 127
434 3300037853 Ga0436364_0095065 Ga0436364_0095065_1670_2053 127
435 3300037853 Ga0436364_0149301 Ga0436364_0149301_8651_9034 127
436 3300037853 Ga0436364_0221495 Ga0436364_0221495_7057_7440 127
437 3300037853 Ga0436364_0295555 Ga0436364_0295555_726_1109 127
438 3300037853 Ga0436364_0367212 Ga0436364_0367212_14968_15351 127
439 3300037853 Ga0436364_0369585 Ga0436364_0369585_298_681 127
440 3300037853 Ga0436364_0531473 Ga0436364_0531473_592_975 127
441 3300037853 Ga0436364_0637866 Ga0436364_0637866_1023_1406 127
442 3300037853 Ga0436364_0682897 Ga0436364_0682897_96_479 127
443 3300037853 Ga0436364_0740129 Ga0436364_0740129_1826_2209 127
444 3300037853 Ga0436364_0746361 Ga0436364_0746361_1132_1515 127
445 3300037853 Ga0436364_0764623 Ga0436364_0764623_1973_2356 127
446 3300037853 Ga0436364_0771931 Ga0436364_0771931_689_1072 127
447 3300037853 Ga0436364_0839163 Ga0436364_0839163_7878_8261 127
448 3300037853 Ga0436364_0999256 Ga0436364_0999256_190_573 127
449 3300037853 Ga0436364_1152751 Ga0436364_1152751_1369_1752 127
450 3300037853 Ga0436364_1164844 Ga0436364_1164844_3693_4076 127
451 3300038443 Ga0395901_1411746 Ga0395901_1411746_111_494 127
452 3300039437 Ga0436365_0120242 Ga0436365_0120242_120_503 127
453 3300039437 Ga0436365_0172227 Ga0436365_0172227_97_480 127
454 3300039437 Ga0436365_0222942 Ga0436365_0222942_4205_4588 127
455 3300039437 Ga0436365_0463391 Ga0436365_0463391_281_664 127
456 3300039437 Ga0436365_0497321 Ga0436365_0497321_1541_1924 127
457 3300039437 Ga0436365_0745551 Ga0436365_0745551_393_776 127
458 3300039437 Ga0436365_0746312 Ga0436365_0746312_149_532 127
459 3300039437 Ga0436365_1112641 Ga0436365_1112641_396_779 127
460 3300039437 Ga0436365_1192333 Ga0436365_1192333_547_930 127
461 3300039437 Ga0436365_1296594 Ga0436365_1296594_398_781 127
462 3300039437 Ga0436365_1331551 Ga0436365_1331551_5850_6233 127
463 3300039437 Ga0436365_1544784 Ga0436365_1544784_2607_2990 127
464 3300039437 Ga0436365_1589280 Ga0436365_1589280_61_444 127
465 3300039437 Ga0436365_1662543 Ga0436365_1662543_12613_12996 127
466 3300039437 Ga0436365_1688016 Ga0436365_1688016_282_665 127
467 3300039437 Ga0436365_1709979 Ga0436365_1709979_240_623 127
468 3300039438 Ga0436360_0344681 Ga0436360_0344681_414_797 127
469 3300039438 Ga0436360_0503545 Ga0436360_0503545_450_833 127
470 3300039438 Ga0436360_1281492 Ga0436360_1281492_91_474 127
471 3300039447 Ga0436361_0295179 Ga0436361_0295179_68_451 127
472 3300039447 Ga0436361_0585938 Ga0436361_0585938_293_676 127
473 3300039447 Ga0436361_0849285 Ga0436361_0849285_23_406 127
474 3300039447 Ga0436361_1220824 Ga0436361_1220824_99_482 127
475 3300039450 Ga0436363_0027919 Ga0436363_0027919_271_654 127
476 3300039450 Ga0436363_0032375 Ga0436363_0032375_721_1104 127
477 3300039450 Ga0436363_0032926 Ga0436363_0032926_290_673 127
478 3300039450 Ga0436363_0136874 Ga0436363_0136874_8987_9370 127
479 3300039450 Ga0436363_0145734 Ga0436363_0145734_1191_1574 127
480 3300039450 Ga0436363_0180243 Ga0436363_0180243_731_1114 127
481 3300039450 Ga0436363_0330098 Ga0436363_0330098_245_628 127
482 3300039450 Ga0436363_0351951 Ga0436363_0351951_55_438 127
483 3300039450 Ga0436363_0532966 Ga0436363_0532966_250_633 127
484 3300039450 Ga0436363_0678090 Ga0436363_0678090_2131_2514 127
485 3300039450 Ga0436363_0889406 Ga0436363_0889406_382_765 127
486 3300039450 Ga0436363_1003415 Ga0436363_1003415_151_534 127
487 3300039450 Ga0436363_1115108 Ga0436363_1115108_16_399 127
488 3300039450 Ga0436363_1187247 Ga0436363_1187247_31_414 127
489 3300039450 Ga0436363_1191833 Ga0436363_1191833_410_793 127
490 3300039450 Ga0436363_1392677 Ga0436363_1392677_294_686 127
491 3300039450 Ga0436363_1401676 Ga0436363_1401676_979_1362 127
492 3300039450 Ga0436363_1566285 Ga0436363_1566285_274_657 127
493 3300039450 Ga0436363_1686345 Ga0436363_1686345_349_732 127
494 3300039453 Ga0436362_0021263 Ga0436362_0021263_181_564 127
495 3300039453 Ga0436362_0187053 Ga0436362_0187053_583_966 127
496 3300039453 Ga0436362_0299203 Ga0436362_0299203_120_503 127
497 3300039453 Ga0436362_0351520 Ga0436362_0351520_301_684 127
498 3300039453 Ga0436362_0401791 Ga0436362_0401791_14_397 127
499 3300039453 Ga0436362_0702484 Ga0436362_0702484_186_569 127
500 3300039453 Ga0436362_0774635 Ga0436362_0774635_166_549 127
501 3300039453 Ga0436362_0801538 Ga0436362_0801538_155_538 127
502 3300039453 Ga0436362_1062177 Ga0436362_1062177_1281_1664 127
503 3300041494 Ga0451837_1551250 Ga0451837_1551250_109_492 127
504 3300041505 Ga0451849_1412726 Ga0451849_1412726_124_507 127
505 3300041507 Ga0451851_1253955 Ga0451851_1253955_137_520 127
506 3300041511 Ga0451855_0958897 Ga0451855_0958897_39_422 127
507 3300044656 Ga0466969_0135109 Ga0466969_0135109_65_448 127
508 3300044656 Ga0466969_0154577 Ga0466969_0154577_89_472 127
509 3300044656 Ga0466969_0256187 Ga0466969_0256187_319_702 127
510 3300044683 Ga0466965_0209444 Ga0466965_0209444_157_540 127
511 3300044683 Ga0466965_0241562 Ga0466965_0241562_444_827 127
512 3300044683 Ga0466965_0251688 Ga0466965_0251688_554_937 127
513 3300044683 Ga0466965_0720926 Ga0466965_0720926_18_401 127
514 3300044683 Ga0466965_0880549 Ga0466965_0880549_32_415 127
515 3300044683 Ga0466965_0922039 Ga0466965_0922039_16_399 127
516 3300044684 Ga0466966_0026754 Ga0466966_0026754_2050_2433 127
517 3300044684 Ga0466966_0190379 Ga0466966_0190379_476_859 127
518 3300044684 Ga0466966_0493158 Ga0466966_0493158_344_727 127
519 3300044684 Ga0466966_0679812 Ga0466966_0679812_39_422 127
520 3300044693 Ga0466961_0004906 Ga0466961_0004906_7526_7909 127
521 3300044693 Ga0466961_0070568 Ga0466961_0070568_949_1332 127
522 3300044693 Ga0466961_0106847 Ga0466961_0106847_1059_1442 127
523 3300044693 Ga0466961_0357524 Ga0466961_0357524_410_793 127
524 3300044693 Ga0466961_0505124 Ga0466961_0505124_169_552 127
525 3300044694 Ga0466963_0009311 Ga0466963_0009311_460_843 127
526 3300044694 Ga0466963_0011289 Ga0466963_0011289_898_1281 127
527 3300044694 Ga0466963_0021793 Ga0466963_0021793_2305_2688 127
528 3300044694 Ga0466963_0092669 Ga0466963_0092669_1666_2049 127
529 3300044694 Ga0466963_0235970 Ga0466963_0235970_834_1217 127
530 3300044694 Ga0466963_0263093 Ga0466963_0263093_230_613 127
531 3300044694 Ga0466963_0316391 Ga0466963_0316391_119_502 127
532 3300044706 Ga0466964_0062838 Ga0466964_0062838_539_922 127
533 3300044706 Ga0466964_0249332 Ga0466964_0249332_462_845 127
534 3300044706 Ga0466964_0345125 Ga0466964_0345125_366_749 127
535 3300044706 Ga0466964_0550780 Ga0466964_0550780_171_554 127
536 3300044719 Ga0466971_0135543 Ga0466971_0135543_192_575 127
537 3300044719 Ga0466971_0232982 Ga0466971_0232982_181_564 127
538 3300044719 Ga0466971_0295997 Ga0466971_0295997_274_657 127
539 3300044719 Ga0466971_0357709 Ga0466971_0357709_273_656 127
540 3300044719 Ga0466971_0631924 Ga0466971_0631924_124_507 127
541 3300044735 Ga0466968_0081768 Ga0466968_0081768_120_503 127
542 3300044735 Ga0466968_0109639 Ga0466968_0109639_494_877 127
543 3300044735 Ga0466968_0172288 Ga0466968_0172288_229_612 127
544 3300044735 Ga0466968_0214955 Ga0466968_0214955_145_528 127
545 3300044735 Ga0466968_0435662 Ga0466968_0435662_76_459 127
546 3300044735 Ga0466968_0503744 Ga0466968_0503744_207_590 127
547 3300044765 Ga0466970_0016616 Ga0466970_0016616_2818_3201 127
548 3300044765 Ga0466970_0070219 Ga0466970_0070219_1228_1611 127
549 3300044765 Ga0466970_0273002 Ga0466970_0273002_12_395 127
550 3300044765 Ga0466970_0333917 Ga0466970_0333917_344_727 127
551 3300044842 Ga0466957_0026899 Ga0466957_0026899_2869_3252 127
552 3300044842 Ga0466957_0054949 Ga0466957_0054949_574_957 127
553 3300044842 Ga0466957_0151759 Ga0466957_0151759_599_982 127
554 3300044842 Ga0466957_0297956 Ga0466957_0297956_349_732 127
555 3300044842 Ga0466957_0459517 Ga0466957_0459517_100_483 127
556 3300044842 Ga0466957_0638840 Ga0466957_0638840_100_483 127
557 3300044842 Ga0466957_0674006 Ga0466957_0674006_251_634 127
558 3300044842 Ga0466957_0750043 Ga0466957_0750043_31_414 127
559 3300044842 Ga0466957_1075263 Ga0466957_1075263_92_475 127
560 3300045049 Ga0466959_0009134 Ga0466959_0009134_5111_5494 127
561 3300045049 Ga0466959_0014110 Ga0466959_0014110_2100_2483 127
562 3300045049 Ga0466959_0019509 Ga0466959_0019509_3920_4303 127
563 3300045049 Ga0466959_0105651 Ga0466959_0105651_969_1352 127
564 3300045049 Ga0466959_0123556 Ga0466959_0123556_674_1057 127
565 3300045049 Ga0466959_0126886 Ga0466959_0126886_1418_1801 127
566 3300045049 Ga0466959_0186337 Ga0466959_0186337_439_822 127
567 3300045049 Ga0466959_0530305 Ga0466959_0530305_225_608 127
568 3300045049 Ga0466959_0567663 Ga0466959_0567663_25_408 127
569 3300045049 Ga0466959_0640945 Ga0466959_0640945_56_439 127
570 3300045049 Ga0466959_1116573 Ga0466959_1116573_92_475 127
571 3300045836 Ga0466958_0008849 Ga0466958_0008849_2616_2999 127
572 3300045836 Ga0466958_0014571 Ga0466958_0014571_3542_3925 127
573 3300045836 Ga0466958_0018330 Ga0466958_0018330_2350_2733 127
574 3300045836 Ga0466958_0076506 Ga0466958_0076506_1159_1542 127
575 3300045836 Ga0466958_0085134 Ga0466958_0085134_1501_1884 127
576 3300045836 Ga0466958_0129795 Ga0466958_0129795_133_516 127
577 3300045836 Ga0466958_0253711 Ga0466958_0253711_507_890 127
578 3300045836 Ga0466958_0271529 Ga0466958_0271529_688_1071 127
579 3300045836 Ga0466958_0330686 Ga0466958_0330686_136_519 127
580 3300045836 Ga0466958_0345460 Ga0466958_0345460_254_637 127
581 3300045836 Ga0466958_0387199 Ga0466958_0387199_101_484 127
582 3300045836 Ga0466958_0544296 Ga0466958_0544296_224_607 127
583 3300045976 Ga0466967_0002408 Ga0466967_0002408_8055_8438 127
584 3300045976 Ga0466967_0005406 Ga0466967_0005406_5451_5834 127
585 3300045976 Ga0466967_0162915 Ga0466967_0162915_1098_1481 127
586 3300045976 Ga0466967_0198763 Ga0466967_0198763_1326_1709 127
587 3300045976 Ga0466967_0213157 Ga0466967_0213157_320_703 127
588 3300045976 Ga0466967_0926030 Ga0466967_0926030_209_592 127
589 3300045976 Ga0466967_1082599 Ga0466967_1082599_199_582 127
590 3300045976 Ga0466967_2296999 Ga0466967_2296999_112_495 127
591 3300045976 Ga0466967_2319748 Ga0466967_2319748_135_518 127
592 3300046457 Ga0495590_0166854 Ga0495590_0166854_119_502 127
593 3300046463 Ga0495653_0002457 Ga0495653_0002457_10114_10497 127
594 3300046463 Ga0495653_0524043 Ga0495653_0524043_242_625 127
595 3300046477 Ga0495664_0436072 Ga0495664_0436072_86_469 127
596 3300046477 Ga0495664_0485182 Ga0495664_0485182_196_579 127
597 3300046492 Ga0495585_0285941 Ga0495585_0285941_272_655 127
598 3300046500 Ga0495596_0053322 Ga0495596_0053322_1171_1554 127
599 3300046514 Ga0495618_0000035 Ga0495618_0000035_68103_68486 127
600 3300046515 Ga0495620_0209860 Ga0495620_0209860_309_692 127
601 3300046517 Ga0495630_0000610 Ga0495630_0000610_9750_10133 127
602 3300046517 Ga0495630_0949901 Ga0495630_0949901_197_580 127
603 3300046518 Ga0495631_0197915 Ga0495631_0197915_280_663 127
604 3300046522 Ga0495643_0088629 Ga0495643_0088629_761_1144 127
605 3300046523 Ga0495644_0080611 Ga0495644_0080611_253_636 127
606 3300046525 Ga0495663_0024643 Ga0495663_0024643_120_503 127
607 3300046536 Ga0495587_0127170 Ga0495587_0127170_418_801 127
608 3300046538 Ga0495609_0307552 Ga0495609_0307552_13_396 127
609 3300046543 Ga0495645_0000033 Ga0495645_0000033_34955_35338 127
610 3300046543 Ga0495645_0000159 Ga0495645_0000159_27753_28136 127
611 3300046543 Ga0495645_0344692 Ga0495645_0344692_396_779 127
612 3300046558 Ga0495633_0264960 Ga0495633_0264960_140_523 127
613 3300046615 Ga0495656_0175950 Ga0495656_0175950_304_687 127
614 3300046674 Ga0495588_0305027 Ga0495588_0305027_119_502 127
615 3300046675 Ga0495657_0000027 Ga0495657_0000027_94872_95255 127
616 3300046675 Ga0495657_0306616 Ga0495657_0306616_40_423 127
617 3300046680 Ga0495646_0243138 Ga0495646_0243138_220_603 127
618 3300046680 Ga0495646_0330790 Ga0495646_0330790_178_621 127
619 3300046684 Ga0495669_0220166 Ga0495669_0220166_99_482 127
620 3300046690 Ga0495624_0552101 Ga0495624_0552101_167_550 127
621 3300046691 Ga0495670_0168519 Ga0495670_0168519_403_786 127
622 3300046794 Ga0495589_0106285 Ga0495589_0106285_862_1245 127
623 3300046809 Ga0495600_0820330 Ga0495600_0820330_10_393 127
624 3300047321 Ga0495676_0495339 Ga0495676_0495339_195_578 127
625 3300047322 Ga0495680_1012982 Ga0495680_1012982_109_492 127
626 3300047447 Ga0495685_166922 Ga0495685_166922_220_603 127
627 3300047472 Ga0495686_0416296 Ga0495686_0416296_211_594 127
628 3300048090 Ga0495615_0262081 Ga0495615_0262081_153_536 127
629 3300048903 Ga0496100_0001215 Ga0496100_0001215_10117_10500 127
630 3300048904 Ga0496101_0394172 Ga0496101_0394172_566_949 127
631 3300048904 Ga0496101_0502460 Ga0496101_0502460_49_432 127
632 3300048905 Ga0496102_0385249 Ga0496102_0385249_697_1080 127
633 3300048905 Ga0496102_0777672 Ga0496102_0777672_86_469 127
634 3300048906 Ga0496103_0401828 Ga0496103_0401828_124_507 127
635 3300048907 Ga0496104_0576220 Ga0496104_0576220_329_712 127
636 3300048907 Ga0496104_1528916 Ga0496104_1528916_43_426 127
637 3300048908 Ga0496105_0218944 Ga0496105_0218944_900_1283 127
638 3300048908 Ga0496105_0831945 Ga0496105_0831945_235_618 127
639 3300048910 Ga0496107_0370657 Ga0496107_0370657_380_763 127
640 3300048911 Ga0496108_0462407 Ga0496108_0462407_419_802 127
641 3300048912 Ga0496109_0238485 Ga0496109_0238485_734_1117 127
642 3300048913 Ga0496110_0047309 Ga0496110_0047309_2174_2557 127
643 3300048914 Ga0496111_0335987 Ga0496111_0335987_405_788 127
644 3300048915 Ga0496112_0103136 Ga0496112_0103136_526_909 127
645 3300048915 Ga0496112_1056837 Ga0496112_1056837_124_507 127
646 3300048916 Ga0496113_0120615 Ga0496113_0120615_888_1271 127
647 3300048917 Ga0496114_0328950 Ga0496114_0328950_849_1232 127
648 3300048917 Ga0496114_0485472 Ga0496114_0485472_406_789 127
649 3300048917 Ga0496114_1574300 Ga0496114_1574300_135_518 127
650 3300048918 Ga0496115_0948040 Ga0496115_0948040_48_431 127
651 3300049523 Ga0501300_061016 Ga0501300_061016_113_496 127
652 3300049568 Ga0501031_0034173 Ga0501031_0034173_405_788 127
653 3300049569 Ga0501032_0001419 Ga0501032_0001419_16150_16533 127
654 3300049570 Ga0501033_0026435 Ga0501033_0026435_557_940 127
655 3300049571 Ga0501034_0019312 Ga0501034_0019312_1657_2040 127
656 3300049572 Ga0501036_0023794 Ga0501036_0023794_2802_3185 127
657 3300049573 Ga0501037_0021875 Ga0501037_0021875_1809_2192 127
658 3300049574 Ga0501038_0014761 Ga0501038_0014761_5691_6074 127
659 3300049575 Ga0501039_0132069 Ga0501039_0132069_503_886 127
660 3300049578 Ga0501042_0001923 Ga0501042_0001923_780_1163 127
661 3300049579 Ga0501043_0104612 Ga0501043_0104612_1190_1573 127
662 3300049580 Ga0501046_0008154 Ga0501046_0008154_5508_5891 127
663 3300049581 Ga0501047_0082923 Ga0501047_0082923_465_848 127
664 3300049582 Ga0501048_0002360 Ga0501048_0002360_2753_3136 127
665 3300049582 Ga0501048_0923485 Ga0501048_0923485_146_529 127
666 3300049583 Ga0501067_0015994 Ga0501067_0015994_1337_1720 127
667 3300049583 Ga0501067_0689895 Ga0501067_0689895_107_490 127
668 3300049584 Ga0501068_0048751 Ga0501068_0048751_1202_1585 127
669 3300049584 Ga0501068_0150346 Ga0501068_0150346_879_1262 127
670 3300049585 Ga0501069_0030830 Ga0501069_0030830_2361_2744 127
671 3300049585 Ga0501069_0081305 Ga0501069_0081305_952_1335 127
672 3300049585 Ga0501069_0869857 Ga0501069_0869857_121_504 127
673 3300049586 Ga0501070_0027023 Ga0501070_0027023_2468_2851 127
674 3300049587 Ga0501071_0281722 Ga0501071_0281722_847_1230 127
675 3300049588 Ga0501072_0034435 Ga0501072_0034435_1534_1917 127
676 3300049589 Ga0501073_0005329 Ga0501073_0005329_5772_6155 127
677 3300049589 Ga0501073_0716394 Ga0501073_0716394_178_561 127
678 3300049590 Ga0501074_0154061 Ga0501074_0154061_1235_1618 127
679 3300049591 Ga0501075_0926867 Ga0501075_0926867_269_652 127
680 3300049649 Ga0501198_049626 Ga0501198_049626_134_517 127
681 3300049652 Ga0501202_028277 Ga0501202_028277_373_756 127
682 3300049705 Ga0501225_0255530 Ga0501225_0255530_109_492 127
683 3300049741 Ga0501079_0120171 Ga0501079_0120171_592_975 127
684 3300049742 Ga0501080_0038231 Ga0501080_0038231_2068_2451 127
685 3300049742 Ga0501080_0060612 Ga0501080_0060612_2512_2895 127
686 3300049744 Ga0501083_0021040 Ga0501083_0021040_2501_2884 127
687 3300049822 Ga0501035_0026409 Ga0501035_0026409_2513_2896 127
688 3300049823 Ga0501044_0046126 Ga0501044_0046126_2608_2991 127
689 3300050491 nmdc:mga00v17_233674_c1 nmdc:mga00v17_233674_c1_114_497 127
690 3300050492 nmdc:mga0yw44_368517_c1 nmdc:mga0yw44_368517_c1_370_753 127
691 3300050507 nmdc:mga05p37_1061659_c1 nmdc:mga05p37_1061659_c1_425_808 127
692 3300050507 nmdc:mga05p37_1064446_c1 nmdc:mga05p37_1064446_c1_231_614 127
693 3300050507 nmdc:mga05p37_1563070_c1 nmdc:mga05p37_1563070_c1_146_529 127
694 3300050507 nmdc:mga05p37_761789_c1 nmdc:mga05p37_761789_c1_373_756 127
695 3300050508 nmdc:mga09592_108160_c1 nmdc:mga09592_108160_c1_1059_1442 127
696 3300050508 nmdc:mga09592_780712_c1 nmdc:mga09592_780712_c1_218_601 127
697 3300050509 nmdc:mga0qj67_1179658_c1 nmdc:mga0qj67_1179658_c1_189_572 127
698 3300050509 nmdc:mga0qj67_697275_c1 nmdc:mga0qj67_697275_c1_210_593 127
699 3300050509 nmdc:mga0qj67_938869_c1 nmdc:mga0qj67_938869_c1_232_615 127
700 3300050511 nmdc:mga08y16_275095_c1 nmdc:mga08y16_275095_c1_102_485 127
701 3300050511 nmdc:mga08y16_427549_c1 nmdc:mga08y16_427549_c1_422_805 127
702 3300050515 nmdc:mga0a205_1075773_c1 nmdc:mga0a205_1075773_c1_257_640 127
703 3300050515 nmdc:mga0a205_797555_c1 nmdc:mga0a205_797555_c1_388_771 127
704 3300053077 Ga0495601_0357794 Ga0495601_0357794_420_803 127
705 3300053083 Ga0495655_0008046 Ga0495655_0008046_1415_1798 127
706 3300053083 Ga0495655_0120668 Ga0495655_0120668_162_545 127
707 3300053085 Ga0495619_0533917 Ga0495619_0533917_380_763 127
708 3300053085 Ga0495619_0699628 Ga0495619_0699628_164_547 127
709 3300053085 Ga0495619_0868793 Ga0495619_0868793_46_429 127
710 3300053085 Ga0495619_1186930 Ga0495619_1186930_28_411 127
711 3300053096 Ga0500641_0114552 Ga0500641_0114552_86_469 127
712 3300054114 Ga0501084_0088731 Ga0501084_0088731_579_962 127
713 3300059421 Ga0590071_144989 Ga0590071_144989_185_568 127
714 3300059424 Ga0590075_059045 Ga0590075_059045_419_802 127
715 3300059477 Ga0587084_053854 Ga0587084_053854_109_492 127
716 3300059478 Ga0587093_014885 Ga0587093_014885_169_552 127
717 3300059490 Ga0587066_047517 Ga0587066_047517_144_527 127
718 3300059490 Ga0587066_105945 Ga0587066_105945_154_537 127
719 3300059491 Ga0587070_095587 Ga0587070_095587_186_569 127
720 3300059493 Ga0587077_117187 Ga0587077_117187_51_434 127
721 3300059503 Ga0587080_019869 Ga0587080_019869_217_600 127
722 3300059504 Ga0587082_195456 Ga0587082_195456_56_439 127
723 3300059505 Ga0587083_0038830 Ga0587083_0038830_524_907 127
724 3300059505 Ga0587083_0067777 Ga0587083_0067777_202_585 127
725 3300059505 Ga0587083_0069002 Ga0587083_0069002_330_713 127
726 3300059505 Ga0587083_0262681 Ga0587083_0262681_86_469 127
727 3300059506 Ga0587085_085026 Ga0587085_085026_83_466 127
728 3300059506 Ga0587085_103493 Ga0587085_103493_121_504 127
729 3300059508 Ga0587088_100566 Ga0587088_100566_223_606 127
730 3300059509 Ga0587089_047168 Ga0587089_047168_221_604 127
731 3300059510 Ga0587090_068847 Ga0587090_068847_62_445 127
732 3300059511 Ga0587091_087291 Ga0587091_087291_221_604 127
733 3300059604 Ga0587098_083523 Ga0587098_083523_107_490 127
734 3300059605 Ga0587106_046646 Ga0587106_046646_200_583 127
735 3300059626 Ga0587115_042577 Ga0587115_042577_229_612 127
736 3300059627 Ga0587117_045152 Ga0587117_045152_223_606 127
737 3300059630 Ga0587128_077506 Ga0587128_077506_231_614 127
738 3300059630 Ga0587128_085959 Ga0587128_085959_173_556 127
739 3300059630 Ga0587128_111147 Ga0587128_111147_163_546 127
740 3300059630 Ga0587128_120517 Ga0587128_120517_110_493 127
741 3300059630 Ga0587128_142329 Ga0587128_142329_51_434 127
742 3300059631 Ga0587130_029628 Ga0587130_029628_223_606 127
743 3300059640 Ga0587067_075553 Ga0587067_075553_104_490 127
744 3300059641 Ga0587068_045948 Ga0587068_045948_206_589 127
745 3300059641 Ga0587068_047189 Ga0587068_047189_218_601 127
746 3300059644 Ga0587075_048811 Ga0587075_048811_328_711 127
747 3300059645 Ga0587076_091514 Ga0587076_091514_175_558 127
748 3300059645 Ga0587076_121773 Ga0587076_121773_154_537 127
749 3300059647 Ga0587079_089135 Ga0587079_089135_112_495 127
750 3300059647 Ga0587079_098913 Ga0587079_098913_138_521 127
751 3300059648 Ga0587100_019026 Ga0587100_019026_194_577 127
752 3300060344 Ga0587071_039236 Ga0587071_039236_425_808 127
753 3300060344 Ga0587071_042087 Ga0587071_042087_60_443 127
754 3300060344 Ga0587071_094709 Ga0587071_094709_221_604 127
755 3300060344 Ga0587071_167645 Ga0587071_167645_123_506 127
756 3300060346 Ga0587111_0073488 Ga0587111_0073488_193_576 127
757 3300060346 Ga0587111_0239058 Ga0587111_0239058_52_435 127
758 3300060353 Ga0501082_0039856 Ga0501082_0039856_2547_2930 127
759 3300061719 Ga0466962_0014349 Ga0466962_0014349_3325_3708 127
760 3300061719 Ga0466962_0015342 Ga0466962_0015342_490_873 127
761 3300061719 Ga0466962_0046924 Ga0466962_0046924_1064_1447 127
762 3300061719 Ga0466962_0107606 Ga0466962_0107606_369_752 127
763 3300061719 Ga0466962_0275007 Ga0466962_0275007_217_600 127
764 3300061719 Ga0466962_0350587 Ga0466962_0350587_177_560 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

3

108

0.99

Feature Viewer

pLDDT pTM Quality
54.92 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map