F479719

General Info

Members Datasets Scaffolds Average Seq Length
764 428 1528 137

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10103410|Ga0081455_101034103
Length 140
Sequence MTGMDLTIHASFLPHADPEASLGFWRDTLGFQVRADVGYGGLRWITVGPVGQPGTAIVLQPPAPPACGITDEERRMIAEMMAKGTYAGVNLATTDLDGVFARLQAADAEVVQAPTDQPYGVRDCAVRDPAGNLIRIQQLP

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
114 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
130 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
131 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
132 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
135 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
136 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
139 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
140 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
141 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
212 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
215 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
216 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
217 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
218 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
219 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
220 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
226 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
227 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
228 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
229 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
230 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
246 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
247 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
250 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
251 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
252 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
253 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
254 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
255 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
256 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
257 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
258 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
259 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
260 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
261 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
262 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
263 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
264 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
265 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
266 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
267 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
268 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
269 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
270 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
271 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
272 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
273 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
274 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
275 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
276 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
277 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
278 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
279 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
280 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
281 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
282 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
283 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
284 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
285 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
286 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
287 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
288 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
289 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
290 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
291 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
292 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
293 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
294 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
295 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
296 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
297 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
298 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
299 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
300 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
301 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
302 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
303 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
304 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
305 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
306 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
307 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
308 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
311 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
312 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
313 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
314 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
315 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
316 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
317 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
318 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
319 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
320 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
321 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
322 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
323 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
324 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
325 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
326 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
327 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
328 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
329 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
330 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
331 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
334 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
335 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
336 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
337 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
338 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
339 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
340 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
341 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
342 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
354 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
357 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
358 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
359 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
360 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
361 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
362 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
363 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
379 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
380 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
381 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
382 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
383 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
384 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
385 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
386 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
387 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
388 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
389 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
390 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
391 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
392 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
393 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
396 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
397 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
398 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
399 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
400 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
401 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
402 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
403 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
404 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
405 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
406 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
407 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
408 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
409 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
410 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
412 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
413 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
414 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
415 2547132424 Nocardia nova SH22a Isolate Unclassified
416 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
417 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
418 2643221679 Angustibacter sp. Root456 Isolate Unclassified
419 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
420 2884411467 Dyella sp. AD56 Isolate Rhizosphere
421 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
422 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
423 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
424 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
425 2941471342 Luteibacter sp. 621 Isolate Unclassified
426 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
427 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
428 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 0.39
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.93
Nodule 0
Rhizoplane 4.58
Rhizosphere 83.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10103410 3300005937 Bacteria 2281
2 JGI24740J21852_10010228 3300001979 Bacteria 3626
3 JGI24739J22299_10005574 3300001989 Bacteria 4774
4 JGI24737J22298_10011930 3300001990 Bacteria 2838
5 JGI25152J39213_1036750 3300002773 Bacteria 715
6 JGI25153J46596_10015908 3300003215 Bacteria 3040
7 rootH1_10025010 3300003316 Bacteria 4579
8 JGI25407J50210_10025965 3300003373 Bacteria 1519
9 JGI25407J50210_10050452 3300003373 Bacteria 1055
10 JGI25407J50210_10109230 3300003373 Bacteria 683
11 Ga0006562J51391_1130019 3300003578 Bacteria 5610
12 Ga0006562J51391_1130020 3300003578 Bacteria 1160
13 Ga0055526_1000003 3300003771 Bacteria 413092
14 Ga0055537_1000002 3300003773 Bacteria 250042
15 Ga0055537_1026784 3300003773 Bacteria 781
16 Ga0055524_1000002 3300003775 Bacteria 459550
17 Ga0055536_1002557 3300003781 Bacteria 10154
18 Ga0055534_1000005 3300003784 Bacteria 238704
19 Ga0055528_1000001 3300003790 Bacteria 402384
20 Ga0055540_1000445 3300003792 Bacteria 32473
21 JGI25405J52794_10031455 3300003911 Bacteria 1103
22 Ga0065165_1005730 3300005262 Bacteria 6833
23 Ga0070658_10615587 3300005327 Bacteria 941
24 Ga0070658_11391430 3300005327 Bacteria 609
25 Ga0070676_10322747 3300005328 Bacteria 1053
26 Ga0068869_100021305 3300005334 Bacteria 4457
27 Ga0070680_100000195 3300005336 Bacteria 39365
28 Ga0070682_100578887 3300005337 Bacteria 883
29 Ga0070682_101041327 3300005337 Bacteria 682
30 Ga0070660_100096232 3300005339 Bacteria 2341
31 Ga0070660_101066335 3300005339 Bacteria 683
32 Ga0070691_10189658 3300005341 Bacteria 1074
33 Ga0070687_100122606 3300005343 Bacteria 1489
34 Ga0070661_100214200 3300005344 Bacteria 1475
35 Ga0070692_10455765 3300005345 Bacteria 819
36 Ga0070668_100685706 3300005347 Bacteria 902
37 Ga0070668_100687121 3300005347 Bacteria 902
38 Ga0070668_101273669 3300005347 Bacteria 668
39 Ga0070669_101323170 3300005353 Bacteria 624
40 Ga0070675_100227960 3300005354 Bacteria 1624
41 Ga0070671_100087941 3300005355 Bacteria 2600
42 Ga0070673_100643418 3300005364 Bacteria 970
43 Ga0070688_100347438 3300005365 Bacteria 1085
44 Ga0070659_100088040 3300005366 Bacteria 2486
45 Ga0070659_101156044 3300005366 Bacteria 683
46 Ga0070667_100020116 3300005367 Bacteria 5542
47 Ga0070667_100622041 3300005367 Bacteria 996
48 Ga0070703_10000026 3300005406 Bacteria 71473
49 Ga0070714_100000325 3300005435 Bacteria 35978
50 Ga0070714_100105441 3300005435 Bacteria 2489
51 Ga0070713_100474750 3300005436 Bacteria 1177
52 Ga0070710_10015201 3300005437 Bacteria 3891
53 Ga0070710_10126314 3300005437 Bacteria 1554
54 Ga0070701_10094761 3300005438 Bacteria 1643
55 Ga0070711_100051735 3300005439 Bacteria 2823
56 Ga0070705_100247617 3300005440 Bacteria 1249
57 Ga0070700_100484057 3300005441 Bacteria 948
58 Ga0070708_100002199 3300005445 Bacteria 15067
59 Ga0070663_101323930 3300005455 Bacteria 636
60 Ga0070678_100268974 3300005456 Bacteria 1437
61 Ga0070678_101021732 3300005456 Bacteria 761
62 Ga0070678_101994484 3300005456 Bacteria 549
63 Ga0070662_100971086 3300005457 Bacteria 727
64 Ga0070681_10000051 3300005458 Bacteria 82091
65 Ga0070681_10034117 3300005458 Bacteria 5111
66 Ga0068867_100147798 3300005459 Bacteria 1843
67 Ga0070685_10241642 3300005466 Bacteria 1192
68 Ga0070706_100002391 3300005467 Bacteria 18918
69 Ga0070707_100033851 3300005468 Bacteria 4872
70 Ga0070707_101624194 3300005468 Bacteria 613
71 Ga0070698_100013351 3300005471 Bacteria 8695
72 Ga0070679_100000058 3300005530 Bacteria 82178
73 Ga0070679_100701348 3300005530 Bacteria 955
74 Ga0070684_100700769 3300005535 Bacteria 944
75 Ga0070697_101350356 3300005536 Bacteria 636
76 Ga0068853_100207849 3300005539 Bacteria 1783
77 Ga0070672_100783683 3300005543 Bacteria 838
78 Ga0070686_100123904 3300005544 Bacteria 1778
79 Ga0070696_101060301 3300005546 Bacteria 680
80 Ga0070693_100177888 3300005547 Bacteria 1367
81 Ga0070665_100344725 3300005548 Bacteria 1495
82 Ga0070665_101833977 3300005548 Bacteria 613
83 Ga0070704_100177346 3300005549 Bacteria 1701
84 Ga0068855_100004616 3300005563 Bacteria 16812
85 Ga0068855_100229139 3300005563 Bacteria 2081
86 Ga0070664_101468968 3300005564 Bacteria 645
87 Ga0068857_100000857 3300005577 Bacteria 22816
88 Ga0068857_100161242 3300005577 Bacteria 2035
89 Ga0068854_100000244 3300005578 Bacteria 36865
90 Ga0068854_100061048 3300005578 Bacteria 2729
91 Ga0068854_100878106 3300005578 Bacteria 787
92 Ga0068856_100237646 3300005614 Bacteria 1837
93 Ga0068856_100614502 3300005614 Bacteria 1108
94 Ga0068856_100811987 3300005614 Bacteria 955
95 Ga0068852_100265455 3300005616 Bacteria 1650
96 Ga0068859_100099975 3300005617 Bacteria 2956
97 Ga0068859_100100739 3300005617 Bacteria 2945
98 Ga0068859_103051291 3300005617 Bacteria 511
99 Ga0068864_100063310 3300005618 Bacteria 3205
100 Ga0068866_10221356 3300005718 Bacteria 1142
101 Ga0068861_100470453 3300005719 Bacteria 1130
102 Ga0068851_10165361 3300005834 Bacteria 1218
103 Ga0068870_10023259 3300005840 Bacteria 3055
104 Ga0068863_100761374 3300005841 Bacteria 965
105 Ga0068858_101120917 3300005842 Bacteria 773
106 Ga0068858_101902260 3300005842 Bacteria 588
107 Ga0081455_10000169 3300005937 Bacteria 80959
108 Ga0081455_10106108 3300005937 Bacteria 2243
109 Ga0081455_10197474 3300005937 Bacteria 1509
110 Ga0081538_10000867 3300005981 Bacteria 32638
111 Ga0081538_10001657 3300005981 Bacteria 22761
112 Ga0081538_10005786 3300005981 Bacteria 11029
113 Ga0081538_10010471 3300005981 Bacteria 7604
114 Ga0081538_10012280 3300005981 Bacteria 6877
115 Ga0081538_10018385 3300005981 Bacteria 5251
116 Ga0081538_10034087 3300005981 Bacteria 3374
117 Ga0081538_10036738 3300005981 Bacteria 3190
118 Ga0081538_10046198 3300005981 Bacteria 2689
119 Ga0081538_10050630 3300005981 Bacteria 2505
120 Ga0081538_10064895 3300005981 Bacteria 2061
121 Ga0081538_10077274 3300005981 Bacteria 1794
122 Ga0081540_1001154 3300005983 Bacteria 23271
123 Ga0081540_1056878 3300005983 Bacteria 1895
124 Ga0081540_1063768 3300005983 Bacteria 1743
125 Ga0081539_10008650 3300005985 Bacteria 8775
126 Ga0081539_10083253 3300005985 Bacteria 1675
127 Ga0081539_10327185 3300005985 Bacteria 650
128 Ga0070717_10916734 3300006028 Bacteria 798
129 Ga0075432_10073059 3300006058 Bacteria 1234
130 Ga0070715_10065459 3300006163 Bacteria 1609
131 Ga0070712_100014894 3300006175 Bacteria 4998
132 Ga0075427_10003986 3300006194 Bacteria 2059
133 Ga0075366_10266555 3300006195 Bacteria 1046
134 Ga0097621_100182911 3300006237 Bacteria 1812
135 Ga0097621_100874722 3300006237 Bacteria 836
136 Ga0068871_100356934 3300006358 Bacteria 1294
137 Ga0075428_100432784 3300006844 Bacteria 1409
138 Ga0075430_100068566 3300006846 Bacteria 2975
139 Ga0075431_100002504 3300006847 Bacteria 17710
140 Ga0075433_10060163 3300006852 Bacteria 3325
141 Ga0075433_10529174 3300006852 Bacteria 1037
142 Ga0075434_100033910 3300006871 Bacteria 5040
143 Ga0075434_100966950 3300006871 Bacteria 866
144 Ga0075429_100003246 3300006880 Bacteria 13840
145 Ga0075429_100038133 3300006880 Bacteria 4183
146 Ga0068865_100129928 3300006881 Bacteria 1886
147 Ga0097620_100099977 3300006931 Bacteria 2956
148 Ga0097620_100100736 3300006931 Bacteria 2945
149 Ga0099794_10001261 3300007265 Bacteria 8755
150 Ga0105240_10003880 3300009093 Bacteria 23090
151 Ga0105240_10016099 3300009093 Bacteria 10132
152 Ga0105240_10078879 3300009093 Bacteria 4053
153 Ga0105240_10194211 3300009093 Bacteria 2385
154 Ga0105240_11743307 3300009093 Bacteria 650
155 Ga0111539_10002959 3300009094 Bacteria 22536
156 Ga0111539_10159513 3300009094 Bacteria 2638
157 Ga0111539_10421275 3300009094 Bacteria 1555
158 Ga0105245_10293464 3300009098 Bacteria 1593
159 Ga0105245_11277384 3300009098 Bacteria 783
160 Ga0105247_10005585 3300009101 Bacteria 7897
161 Ga0105247_10392646 3300009101 Bacteria 986
162 Ga0114129_10084161 3300009147 Bacteria 4417
163 Ga0114129_10135699 3300009147 Bacteria 3376
164 Ga0114129_10247837 3300009147 Bacteria 2392
165 Ga0114129_11540561 3300009147 Bacteria 816
166 Ga0114129_12058217 3300009147 Bacteria 689
167 Ga0105243_10004771 3300009148 Bacteria 10657
168 Ga0105243_10053524 3300009148 Bacteria 3202
169 Ga0105241_10576798 3300009174 Bacteria 1013
170 Ga0105241_11060646 3300009174 Bacteria 761
171 Ga0105242_10113096 3300009176 Bacteria 2318
172 Ga0105248_10074659 3300009177 Bacteria 3811
173 Ga0105237_10003982 3300009545 Bacteria 17262
174 Ga0105237_10015583 3300009545 Bacteria 7906
175 Ga0105237_10379369 3300009545 Bacteria 1418
176 Ga0105238_10032549 3300009551 Bacteria 5306
177 Ga0105238_10076786 3300009551 Bacteria 3332
178 Ga0105238_10923184 3300009551 Bacteria 892
179 Ga0105249_10614636 3300009553 Bacteria 1142
180 Ga0105249_11789522 3300009553 Bacteria 687
181 Ga0105249_13168338 3300009553 Bacteria 529
182 Ga0105239_10002709 3300010375 Bacteria 22282
183 Ga0105239_10048665 3300010375 Bacteria 4648
184 Ga0105239_10338949 3300010375 Bacteria 1696
185 Ga0105246_10012315 3300011119 Bacteria 5334
186 Ga0157343_1010801 3300012488 Bacteria 698
187 Ga0157314_1001860 3300012500 Bacteria 1475
188 Ga0157370_10004200 3300013104 Bacteria 16658
189 Ga0157370_10031743 3300013104 Bacteria 5164
190 Ga0157369_10001250 3300013105 Bacteria 31665
191 Ga0157374_10046610 3300013296 Bacteria 4015
192 Ga0157374_10951334 3300013296 Bacteria 877
193 Ga0157378_10051287 3300013297 Bacteria 3671
194 Ga0157378_10949554 3300013297 Bacteria 892
195 Ga0163162_10605133 3300013306 Bacteria 1222
196 Ga0157372_10084383 3300013307 Bacteria 3600
197 Ga0157372_10312463 3300013307 Bacteria 1829
198 Ga0157375_10028488 3300013308 Bacteria 5235
199 Ga0163163_10062435 3300014325 Bacteria 3692
200 Ga0163163_10487274 3300014325 Bacteria 1294
201 Ga0163163_10603659 3300014325 Bacteria 1161
202 Ga0163163_11043053 3300014325 Bacteria 881
203 Ga0157380_11520260 3300014326 Bacteria 723
204 Ga0157380_11989518 3300014326 Bacteria 643
205 Ga0182008_10657223 3300014497 Bacteria 594
206 Ga0157377_10583137 3300014745 Bacteria 795
207 Ga0157379_10054919 3300014968 Bacteria 3559
208 Ga0157376_10204948 3300014969 Bacteria 1817
209 Ga0182006_1063300 3300015261 Bacteria 1390
210 Ga0183369_1006 3300015685 Bacteria 449058
211 Ga0183360_10003 3300015689 Bacteria 713221
212 Ga0213873_10021443 3300021358 Bacteria 1520
213 Ga0213873_10142014 3300021358 Bacteria 718
214 Ga0213874_10391130 3300021377 Bacteria 539
215 Ga0213876_10095731 3300021384 Bacteria 1573
216 Ga0213876_10300294 3300021384 Bacteria 853
217 Ga0213875_10013397 3300021388 Bacteria 4028
218 Ga0213875_10014726 3300021388 Bacteria 3814
219 Ga0213875_10046058 3300021388 Bacteria 2047
220 Ga0209435_107554 3300025206 Bacteria 1202
221 Ga0209566_105596 3300025225 Bacteria 1558
222 Ga0209147_103044 3300025229 Bacteria 3544
223 Ga0209646_1019215 3300025246 Bacteria 994
224 Ga0209759_1002192 3300025256 Bacteria 8942
225 Ga0209129_1005275 3300025258 Bacteria 4654
226 Ga0209565_1000002 3300025263 Bacteria 1423083
227 Ga0209565_1010764 3300025263 Bacteria 2257
228 Ga0209673_1000002 3300025273 Bacteria 1423083
229 Ga0209675_1000002 3300025291 Bacteria 1423083
230 Ga0209676_1000173 3300025292 Bacteria 153411
231 Ga0209564_1000004 3300025295 Bacteria 1424639
232 Ga0209758_1007050 3300025297 Bacteria 7799
233 Ga0209758_1044448 3300025297 Bacteria 1624
234 Ga0209256_1000004 3300025299 Bacteria 1424643
235 Ga0207426_1033392 3300025302 Bacteria 1659
236 Ga0209051_1001620 3300025303 Bacteria 18357
237 Ga0209257_1011491 3300025304 Bacteria 4255
238 Ga0207656_10076646 3300025321 Bacteria 1496
239 Ga0207653_10000009 3300025885 Bacteria 197279
240 Ga0207692_10023089 3300025898 Bacteria 2873
241 Ga0207710_10002878 3300025900 Bacteria 7820
242 Ga0207688_10060585 3300025901 Bacteria 2132
243 Ga0207688_11075748 3300025901 Bacteria 508
244 Ga0207647_10000002 3300025904 Bacteria 400771
245 Ga0207647_10010791 3300025904 Bacteria 6431
246 Ga0207647_10024562 3300025904 Bacteria 3973
247 Ga0207685_10035440 3300025905 Bacteria 1821
248 Ga0207645_10008114 3300025907 Bacteria 7358
249 Ga0207643_10001214 3300025908 Bacteria 15220
250 Ga0207705_10050898 3300025909 Bacteria 2982
251 Ga0207684_10004245 3300025910 Bacteria 13595
252 Ga0207707_10000113 3300025912 Bacteria 82066
253 Ga0207707_10045836 3300025912 Bacteria 3809
254 Ga0207695_10002657 3300025913 Bacteria 26135
255 Ga0207695_10003783 3300025913 Bacteria 20996
256 Ga0207695_10026238 3300025913 Bacteria 6504
257 Ga0207671_10000050 3300025914 Bacteria 190479
258 Ga0207671_10008231 3300025914 Bacteria 8878
259 Ga0207671_11062560 3300025914 Bacteria 637
260 Ga0207693_10002095 3300025915 Bacteria 17409
261 Ga0207663_10009152 3300025916 Bacteria 5223
262 Ga0207663_10425788 3300025916 Bacteria 1020
263 Ga0207660_10002393 3300025917 Bacteria 12330
264 Ga0207662_10123605 3300025918 Bacteria 1625
265 Ga0207662_10225848 3300025918 Bacteria 1221
266 Ga0207649_10704012 3300025920 Bacteria 783
267 Ga0207652_10000123 3300025921 Bacteria 82875
268 Ga0207646_10022796 3300025922 Bacteria 5759
269 Ga0207681_10393071 3300025923 Bacteria 1119
270 Ga0207694_10011703 3300025924 Bacteria 6618
271 Ga0207694_10055477 3300025924 Bacteria 3076
272 Ga0207650_10003176 3300025925 Bacteria 11317
273 Ga0207659_10469567 3300025926 Bacteria 1062
274 Ga0207687_10066124 3300025927 Bacteria 2569
275 Ga0207687_10679499 3300025927 Bacteria 872
276 Ga0207700_10101565 3300025928 Bacteria 2295
277 Ga0207664_10000235 3300025929 Bacteria 41962
278 Ga0207664_10001291 3300025929 Bacteria 16528
279 Ga0207690_10001981 3300025932 Bacteria 12541
280 Ga0207690_10078950 3300025932 Bacteria 2292
281 Ga0207690_10248423 3300025932 Bacteria 1373
282 Ga0207706_10141065 3300025933 Bacteria 2120
283 Ga0207686_10016934 3300025934 Bacteria 4096
284 Ga0207709_10001019 3300025935 Bacteria 20709
285 Ga0207709_10145296 3300025935 Bacteria 1636
286 Ga0207709_10250589 3300025935 Bacteria 1293
287 Ga0207709_10640606 3300025935 Bacteria 845
288 Ga0207704_10121534 3300025938 Bacteria 1788
289 Ga0207665_10064077 3300025939 Bacteria 2497
290 Ga0207691_11613235 3300025940 Bacteria 527
291 Ga0207711_10491706 3300025941 Bacteria 1143
292 Ga0207711_11755979 3300025941 Bacteria 564
293 Ga0207689_10040594 3300025942 Bacteria 3852
294 Ga0207661_10864051 3300025944 Bacteria 833
295 Ga0207679_11155782 3300025945 Bacteria 710
296 Ga0207667_10000031 3300025949 Bacteria 323587
297 Ga0207667_10000125 3300025949 Bacteria 118155
298 Ga0207667_10098936 3300025949 Bacteria 3009
299 Ga0207712_10543768 3300025961 Bacteria 998
300 Ga0207640_10000090 3300025981 Bacteria 71916
301 Ga0207640_10048571 3300025981 Bacteria 2744
302 Ga0207640_10218566 3300025981 Bacteria 1457
303 Ga0207658_10013712 3300025986 Bacteria 5543
304 Ga0207677_10155682 3300026023 Bacteria 1769
305 Ga0207703_10682955 3300026035 Bacteria 976
306 Ga0207703_11705433 3300026035 Bacteria 606
307 Ga0207639_10125511 3300026041 Bacteria 2116
308 Ga0207639_10467810 3300026041 Bacteria 1147
309 Ga0207678_10053881 3300026067 Bacteria 3465
310 Ga0207708_10012363 3300026075 Bacteria 6361
311 Ga0207702_10130587 3300026078 Bacteria 2260
312 Ga0207702_10579327 3300026078 Bacteria 1100
313 Ga0207702_10717375 3300026078 Bacteria 986
314 Ga0207641_10450527 3300026088 Bacteria 1244
315 Ga0207648_10069943 3300026089 Bacteria 3059
316 Ga0207648_10425965 3300026089 Bacteria 1205
317 Ga0207676_10127854 3300026095 Bacteria 2155
318 Ga0207674_10000178 3300026116 Bacteria 78008
319 Ga0207674_10051172 3300026116 Bacteria 4216
320 Ga0207674_10249841 3300026116 Bacteria 1721
321 Ga0207675_100197663 3300026118 Bacteria 1930
322 Ga0207675_102467295 3300026118 Bacteria 531
323 Ga0207683_10051893 3300026121 Bacteria 3593
324 Ga0207683_10762801 3300026121 Bacteria 898
325 Ga0207683_11004339 3300026121 Bacteria 774
326 Ga0207698_10322822 3300026142 Bacteria 1447
327 Ga0207698_10487293 3300026142 Bacteria 1197
328 Ga0209588_1000338 3300027671 Bacteria 12325
329 Ga0207428_10040198 3300027907 Bacteria 3796
330 Ga0207428_10049313 3300027907 Bacteria 3375
331 Ga0268266_10529908 3300028379 Bacteria 1127
332 Ga0268266_11046323 3300028379 Bacteria 790
333 Ga0268264_10745607 3300028381 Bacteria 975
334 Ga0268264_12247260 3300028381 Bacteria 553
335 Ga0307515_10000176 3300028794 Bacteria 157429
336 Ga0307513_10138607 3300031456 Bacteria 2363
337 Ga0307513_10405419 3300031456 Bacteria 1097
338 Ga0307408_100003816 3300031548 Bacteria 10260
339 Ga0307516_10067572 3300031730 Bacteria 3444
340 Ga0307405_10069525 3300031731 Bacteria 2258
341 Ga0307405_10087617 3300031731 Bacteria 2052
342 Ga0307413_10005546 3300031824 Bacteria 5647
343 Ga0307413_10017521 3300031824 Bacteria 3733
344 Ga0307410_10034811 3300031852 Bacteria 3266
345 Ga0307410_10723957 3300031852 Bacteria 840
346 Ga0307406_10000628 3300031901 Bacteria 20155
347 Ga0307406_10001833 3300031901 Bacteria 11587
348 Ga0307406_10053857 3300031901 Bacteria 2565
349 Ga0307407_10040654 3300031903 Bacteria 2595
350 Ga0307412_10764893 3300031911 Bacteria 835
351 Ga0307409_100000139 3300031995 Bacteria 27253
352 Ga0307409_101586855 3300031995 Bacteria 682
353 Ga0307416_100000106 3300032002 Bacteria 51399
354 Ga0307416_100009780 3300032002 Bacteria 6301
355 Ga0307416_101476469 3300032002 Bacteria 786
356 Ga0307414_10041073 3300032004 Bacteria 3129
357 Ga0307411_10010748 3300032005 Bacteria 4898
358 Ga0307411_11593051 3300032005 Bacteria 602
359 Ga0307415_100007060 3300032126 Bacteria 6111
360 Ga0307415_100186216 3300032126 Bacteria 1634
361 Ga0307415_100495301 3300032126 Bacteria 1067
362 Ga0307415_100935204 3300032126 Bacteria 801
363 Ga0373959_0201496 3300034820 Bacteria 526
364 Ga0373926_0000130 3300035083 Bacteria 15658
365 Ga0373934_0066295 3300035086 Bacteria 1442
366 Ga0373944_0003171 3300035089 Bacteria 4230
367 Ga0373923_0003598 3300035111 Bacteria 4996
368 Ga0373936_0003072 3300035113 Bacteria 6246
369 Ga0373945_0012751 3300035116 Bacteria 2796
370 Ga0373943_0045236 3300035170 Bacteria 2144
371 Ga0373946_0001387 3300035171 Bacteria 8384
372 Ga0373961_0300192 3300035241 Bacteria 594
373 Ga0373924_0005362 3300035410 Bacteria 4535
374 Ga0373935_0007995 3300035692 Bacteria 6340
375 Ga0373935_1249218 3300035692 Bacteria 554
376 Ga0373927_0027055 3300035695 Bacteria 3747
377 Ga0373933_0543057 3300035724 Bacteria 762
378 Ga0373947_0193931 3300035725 Bacteria 1326
379 Ga0373937_0101907 3300036401 Bacteria 2665
380 Ga0373925_0135108 3300037068 Bacteria 1926
381 Ga0395899_0036147 3300037312 Bacteria 3706
382 Ga0395899_0054235 3300037312 Bacteria 2967
383 Ga0395900_0036126 3300037418 Bacteria 5092
384 Ga0395900_0049774 3300037418 Bacteria 4318
385 Ga0395900_0062883 3300037418 Bacteria 3815
386 Ga0395900_0150991 3300037418 Bacteria 2373
387 Ga0395900_0295786 3300037418 Bacteria 1606
388 Ga0395900_0597069 3300037418 Bacteria 1045
389 Ga0395898_0037022 3300037466 Bacteria 4842
390 Ga0395898_1007626 3300037466 Bacteria 768
391 Ga0395905_0094954 3300037471 Bacteria 2798
392 Ga0395905_0118232 3300037471 Bacteria 2491
393 Ga0395905_0470697 3300037471 Bacteria 1155
394 Ga0436364_0133441 3300037853 Bacteria 3782
395 Ga0436364_0348025 3300037853 Bacteria 4963
396 Ga0436364_0461116 3300037853 Bacteria 28046
397 Ga0436364_0539572 3300037853 Bacteria 3593
398 Ga0436364_0598521 3300037853 Bacteria 1103
399 Ga0395901_0053172 3300038443 Bacteria 4208
400 Ga0395901_0053562 3300038443 Bacteria 4192
401 Ga0395901_0099410 3300038443 Bacteria 3050
402 Ga0395901_0112000 3300038443 Bacteria 2866
403 Ga0395901_0982399 3300038443 Bacteria 821
404 Ga0436365_0337423 3300039437 Bacteria 38026
405 Ga0436365_0585665 3300039437 Bacteria 7174
406 Ga0436365_0772299 3300039437 Bacteria 1324
407 Ga0436365_0997281 3300039437 Bacteria 633
408 Ga0436365_1597380 3300039437 Bacteria 1786
409 Ga0436361_0762095 3300039447 Bacteria 566
410 Ga0436363_0695125 3300039450 Bacteria 4869
411 Ga0436363_1433098 3300039450 Bacteria 645
412 Ga0436362_0166660 3300039453 Bacteria 3395
413 Ga0436362_0255063 3300039453 Bacteria 3646
414 Ga0436362_0605423 3300039453 Bacteria 1072
415 Ga0436362_0959228 3300039453 Bacteria 1619
416 Ga0439436_0000734 3300041404 Bacteria 8836
417 Ga0439436_0064939 3300041404 Bacteria 1019
418 Ga0439447_046881 3300041407 Bacteria 1039
419 Ga0439447_073027 3300041407 Bacteria 796
420 Ga0439461_0014644 3300041410 Bacteria 1494
421 Ga0439465_0012246 3300041413 Bacteria 2683
422 Ga0451791_0401375 3300041451 Bacteria 3206
423 Ga0451791_1178751 3300041451 Bacteria 829
424 Ga0451807_0464853 3300041486 Bacteria 2547
425 Ga0451837_0157811 3300041494 Bacteria 2237
426 Ga0451843_0217512 3300041509 Bacteria 619
427 Ga0451853_2970361 3300041512 Bacteria 545
428 Ga0451853_3477429 3300041512 Bacteria 513
429 Ga0439431_0055532 3300041997 Bacteria 1034
430 Ga0439442_017146 3300042002 Bacteria 1494
431 Ga0439445_0000831 3300042004 Bacteria 6522
432 Ga0439448_0034309 3300042005 Bacteria 1621
433 Ga0439432_004175 3300042006 Bacteria 5281
434 Ga0439449_0025925 3300042007 Bacteria 2189
435 Ga0439449_0263564 3300042007 Bacteria 648
436 Ga0439450_042026 3300042008 Bacteria 1064
437 Ga0439452_004789 3300042010 Bacteria 4466
438 Ga0439456_171786 3300042013 Bacteria 509
439 Ga0439457_001103 3300042014 Bacteria 8140
440 Ga0439457_003502 3300042014 Bacteria 4265
441 Ga0439462_0007887 3300042015 Bacteria 2673
442 Ga0439463_003069 3300042016 Bacteria 4243
443 Ga0450917_011888 3300042120 Bacteria 704
444 Ga0450890_048161 3300042127 Bacteria 645
445 Ga0450906_043485 3300042145 Bacteria 793
446 Ga0439446_0031240 3300042156 Bacteria 1541
447 Ga0450908_000020 3300042184 Bacteria 37390
448 Ga0439435_0133086 3300042436 Bacteria 787
449 Ga0439464_0106294 3300042439 Bacteria 856
450 Ga0439440_0020009 3300042993 Bacteria 1498
451 Ga0439440_0032233 3300042993 Bacteria 1243
452 Ga0466972_0181646 3300044658 Bacteria 986
453 Ga0466965_0108493 3300044683 Bacteria 1425
454 Ga0466965_0223713 3300044683 Bacteria 1004
455 Ga0466965_0394619 3300044683 Bacteria 764
456 Ga0466966_0378242 3300044684 Bacteria 851
457 Ga0466961_0074239 3300044693 Bacteria 2156
458 Ga0466961_0103317 3300044693 Bacteria 1794
459 Ga0466963_0022890 3300044694 Bacteria 3961
460 Ga0466963_0028923 3300044694 Bacteria 3563
461 Ga0466963_0056806 3300044694 Bacteria 2605
462 Ga0466963_0425427 3300044694 Bacteria 936
463 Ga0466964_0184496 3300044706 Bacteria 991
464 Ga0466964_0239714 3300044706 Bacteria 889
465 Ga0466964_0243307 3300044706 Bacteria 883
466 Ga0466964_0700707 3300044706 Bacteria 564
467 Ga0453684_1303092 3300044712 Bacteria 758
468 Ga0466971_0022451 3300044719 Bacteria 2812
469 Ga0466971_0040624 3300044719 Bacteria 2089
470 Ga0466971_0044303 3300044719 Bacteria 1998
471 Ga0466971_0292744 3300044719 Bacteria 781
472 Ga0466968_0293544 3300044735 Bacteria 780
473 Ga0466970_0083552 3300044765 Bacteria 1728
474 Ga0466957_0005404 3300044842 Bacteria 7170
475 Ga0466957_0012216 3300044842 Bacteria 4970
476 Ga0466957_0099053 3300044842 Bacteria 1835
477 Ga0466957_0240062 3300044842 Bacteria 1202
478 Ga0466957_0701621 3300044842 Bacteria 714
479 Ga0466960_0001216 3300044901 Bacteria 9284
480 Ga0466960_0019357 3300044901 Bacteria 2999
481 Ga0466959_0064286 3300045049 Bacteria 2664
482 Ga0466959_0094002 3300045049 Bacteria 2151
483 Ga0466959_0365713 3300045049 Bacteria 982
484 Ga0466958_0004953 3300045836 Bacteria 7107
485 Ga0466958_0027842 3300045836 Bacteria 3346
486 Ga0466958_0119334 3300045836 Bacteria 1650
487 Ga0466958_0348857 3300045836 Bacteria 953
488 Ga0466967_0013711 3300045976 Bacteria 6279
489 Ga0466967_0071221 3300045976 Bacteria 3112
490 Ga0466967_0115919 3300045976 Bacteria 2468
491 Ga0466967_0379165 3300045976 Bacteria 1373
492 Ga0466967_0472410 3300045976 Bacteria 1228
493 Ga0466967_0521101 3300045976 Bacteria 1168
494 Ga0466967_0665899 3300045976 Bacteria 1030
495 Ga0495603_0075715 3300046455 Bacteria 1975
496 Ga0495629_0013150 3300046459 Bacteria 5976
497 Ga0495641_0010328 3300046461 Bacteria 5420
498 Ga0495653_0095745 3300046463 Bacteria 2160
499 Ga0495580_0009482 3300046472 Bacteria 7654
500 Ga0495580_0055600 3300046472 Bacteria 2788
501 Ga0495582_0000984 3300046473 Bacteria 15956
502 Ga0495582_0088801 3300046473 Bacteria 1722
503 Ga0495639_0004291 3300046475 Bacteria 6112
504 Ga0495639_0004767 3300046475 Bacteria 5830
505 Ga0495662_0030890 3300046476 Bacteria 2586
506 Ga0495664_0836713 3300046477 Bacteria 540
507 Ga0495585_0326201 3300046492 Bacteria 750
508 Ga0495585_0410653 3300046492 Bacteria 651
509 Ga0495594_0373838 3300046499 Bacteria 811
510 Ga0495607_0253461 3300046501 Bacteria 846
511 Ga0495630_0005925 3300046517 Bacteria 8642
512 Ga0495644_0292482 3300046523 Bacteria 637
513 Ga0495663_0230421 3300046525 Bacteria 653
514 Ga0495666_0011148 3300046526 Bacteria 4485
515 Ga0495665_0003710 3300046531 Bacteria 8277
516 Ga0495665_0006058 3300046531 Bacteria 6523
517 Ga0495640_0003627 3300046533 Bacteria 12391
518 Ga0495586_0004717 3300046535 Bacteria 7286
519 Ga0495586_0062738 3300046535 Bacteria 2023
520 Ga0495667_0065299 3300046559 Bacteria 2381
521 Ga0495656_0146891 3300046615 Bacteria 1136
522 Ga0495656_0348413 3300046615 Bacteria 767
523 Ga0495634_0012336 3300046642 Bacteria 6192
524 Ga0495634_0527007 3300046642 Bacteria 691
525 Ga0495635_0006509 3300046663 Bacteria 8146
526 Ga0495659_0009155 3300046664 Bacteria 3157
527 Ga0495661_0633268 3300046665 Bacteria 501
528 Ga0495588_0000578 3300046674 Bacteria 17475
529 Ga0495588_0002176 3300046674 Bacteria 8387
530 Ga0495647_0004266 3300046681 Bacteria 4630
531 Ga0495658_0034870 3300046683 Bacteria 2763
532 Ga0495613_0004995 3300046689 Bacteria 9962
533 Ga0495624_0052955 3300046690 Bacteria 2563
534 Ga0495670_0237700 3300046691 Bacteria 970
535 Ga0495670_0248766 3300046691 Bacteria 947
536 Ga0495671_0614268 3300046692 Bacteria 517
537 Ga0495589_0184755 3300046794 Bacteria 988
538 Ga0495589_0415258 3300046794 Bacteria 617
539 Ga0495600_0008169 3300046809 Bacteria 6425
540 Ga0495581_0002947 3300047315 Bacteria 9740
541 Ga0495674_0005372 3300047319 Bacteria 12299
542 Ga0495676_0011903 3300047321 Bacteria 7850
543 Ga0495680_0001169 3300047322 Bacteria 28908
544 Ga0495680_0444344 3300047322 Bacteria 888
545 Ga0495686_0000426 3300047472 Bacteria 66285
546 Ga0495593_0014328 3300047673 Bacteria 4508
547 Ga0495593_0062553 3300047673 Bacteria 1945
548 Ga0495614_0008035 3300048089 Bacteria 4689
549 Ga0496100_0050837 3300048903 Bacteria 2687
550 Ga0496100_0079007 3300048903 Bacteria 2216
551 Ga0496100_0333525 3300048903 Bacteria 1142
552 Ga0496100_0836980 3300048903 Bacteria 721
553 Ga0496100_1112777 3300048903 Bacteria 622
554 Ga0496101_0004836 3300048904 Bacteria 8543
555 Ga0496101_0274200 3300048904 Bacteria 1317
556 Ga0496102_0000095 3300048905 Bacteria 124981
557 Ga0496102_0107037 3300048905 Bacteria 2603
558 Ga0496102_1224706 3300048905 Bacteria 670
559 Ga0496102_1293012 3300048905 Bacteria 648
560 Ga0496103_0000084 3300048906 Bacteria 105728
561 Ga0496103_0010439 3300048906 Bacteria 5496
562 Ga0496104_0665331 3300048907 Bacteria 950
563 Ga0496106_0006680 3300048909 Bacteria 8538
564 Ga0496106_0322904 3300048909 Bacteria 1239
565 Ga0496106_0448747 3300048909 Bacteria 1036
566 Ga0496107_0019704 3300048910 Bacteria 4760
567 Ga0496108_0214452 3300048911 Bacteria 1671
568 Ga0496109_0229922 3300048912 Bacteria 1744
569 Ga0496109_0842607 3300048912 Bacteria 855
570 Ga0496109_1719055 3300048912 Bacteria 561
571 Ga0496110_0083325 3300048913 Bacteria 2852
572 Ga0496110_0324211 3300048913 Bacteria 1403
573 Ga0496110_0471848 3300048913 Bacteria 1143
574 Ga0496111_0671022 3300048914 Bacteria 755
575 Ga0496112_0068561 3300048915 Bacteria 3503
576 Ga0496113_0104902 3300048916 Bacteria 2194
577 Ga0496114_0042100 3300048917 Bacteria 3784
578 Ga0496114_1203896 3300048917 Bacteria 644
579 Ga0496115_0142309 3300048918 Bacteria 1979
580 Ga0496115_0256610 3300048918 Bacteria 1438
581 Ga0496116_0298600 3300048919 Bacteria 768
582 Ga0496117_0024205 3300048920 Bacteria 4810
583 Ga0496117_0065524 3300048920 Bacteria 2470
584 Ga0496117_0115834 3300048920 Bacteria 1658
585 Ga0496118_0000166 3300048921 Bacteria 119204
586 Ga0496118_0004002 3300048921 Bacteria 17939
587 Ga0496118_0010589 3300048921 Bacteria 9112
588 Ga0496118_0010829 3300048921 Bacteria 8982
589 Ga0496118_0094079 3300048921 Bacteria 2050
590 Ga0496119_0000253 3300048922 Bacteria 75779
591 Ga0496119_0034515 3300048922 Bacteria 3330
592 Ga0496120_0010572 3300048923 Bacteria 6423
593 Ga0496121_0000116 3300048924 Bacteria 177260
594 Ga0496121_0000119 3300048924 Bacteria 175072
595 Ga0496121_0040216 3300048924 Bacteria 4105
596 Ga0496121_0142498 3300048924 Bacteria 1776
597 Ga0496121_0197598 3300048924 Bacteria 1436
598 Ga0496122_0063587 3300048925 Bacteria 2691
599 Ga0496123_0111027 3300048926 Bacteria 1567
600 Ga0496125_0010386 3300048928 Bacteria 9418
601 Ga0496125_0032270 3300048928 Bacteria 4654
602 Ga0496125_0387376 3300048928 Bacteria 822
603 Ga0496126_0047470 3300048929 Bacteria 3931
604 Ga0496126_0463377 3300048929 Bacteria 1018
605 Ga0501031_0081561 3300049568 Bacteria 2109
606 Ga0501031_0431205 3300049568 Bacteria 852
607 Ga0501032_0066614 3300049569 Bacteria 2406
608 Ga0501032_0098705 3300049569 Bacteria 1935
609 Ga0501033_0047221 3300049570 Bacteria 3201
610 Ga0501034_0045275 3300049571 Bacteria 4447
611 Ga0501034_0195158 3300049571 Bacteria 1985
612 Ga0501034_0292568 3300049571 Bacteria 1566
613 Ga0501034_0572147 3300049571 Bacteria 1037
614 Ga0501034_0653242 3300049571 Bacteria 953
615 Ga0501034_1147998 3300049571 Bacteria 657
616 Ga0501036_0020014 3300049572 Bacteria 5619
617 Ga0501036_0053064 3300049572 Bacteria 3433
618 Ga0501036_0194784 3300049572 Bacteria 1705
619 Ga0501036_0332158 3300049572 Bacteria 1270
620 Ga0501037_0105757 3300049573 Bacteria 2028
621 Ga0501037_0378027 3300049573 Bacteria 974
622 Ga0501038_0100029 3300049574 Bacteria 2416
623 Ga0501038_0180933 3300049574 Bacteria 1701
624 Ga0501038_0252633 3300049574 Bacteria 1396
625 Ga0501038_0328374 3300049574 Bacteria 1195
626 Ga0501039_0138486 3300049575 Bacteria 1911
627 Ga0501039_0588046 3300049575 Bacteria 873
628 Ga0501039_1012199 3300049575 Bacteria 645
629 Ga0501040_0055918 3300049576 Bacteria 2707
630 Ga0501040_0141568 3300049576 Bacteria 1694
631 Ga0501040_1226025 3300049576 Bacteria 544
632 Ga0501041_0291658 3300049577 Bacteria 1027
633 Ga0501041_0571559 3300049577 Bacteria 721
634 Ga0501041_1154470 3300049577 Bacteria 500
635 Ga0501042_0023093 3300049578 Bacteria 4348
636 Ga0501042_0213544 3300049578 Bacteria 1392
637 Ga0501042_0432031 3300049578 Bacteria 954
638 Ga0501042_0496767 3300049578 Bacteria 886
639 Ga0501043_0124810 3300049579 Bacteria 2018
640 Ga0501043_0179168 3300049579 Bacteria 1651
641 Ga0501043_1190409 3300049579 Bacteria 535
642 Ga0501046_0108893 3300049580 Bacteria 2118
643 Ga0501046_0175441 3300049580 Bacteria 1605
644 Ga0501046_0323988 3300049580 Bacteria 1122
645 Ga0501046_0958060 3300049580 Bacteria 595
646 Ga0501047_0073171 3300049581 Bacteria 3299
647 Ga0501047_0233178 3300049581 Bacteria 1693
648 Ga0501047_0342579 3300049581 Bacteria 1332
649 Ga0501047_0915996 3300049581 Bacteria 690
650 Ga0501047_0984549 3300049581 Bacteria 656
651 Ga0501048_0057696 3300049582 Bacteria 2752
652 Ga0501048_0180350 3300049582 Bacteria 1497
653 Ga0501048_0444527 3300049582 Bacteria 928
654 Ga0501048_0683580 3300049582 Bacteria 737
655 Ga0501048_1048380 3300049582 Bacteria 587
656 Ga0501067_0007376 3300049583 Bacteria 6108
657 Ga0501067_0068733 3300049583 Bacteria 1961
658 Ga0501067_0094623 3300049583 Bacteria 1659
659 Ga0501067_0130874 3300049583 Bacteria 1396
660 Ga0501068_0008028 3300049584 Bacteria 5854
661 Ga0501068_0037983 3300049584 Bacteria 2883
662 Ga0501068_0142367 3300049584 Bacteria 1503
663 Ga0501068_0372752 3300049584 Bacteria 919
664 Ga0501069_0006995 3300049585 Bacteria 5903
665 Ga0501069_0060803 3300049585 Bacteria 2109
666 Ga0501070_0011801 3300049586 Bacteria 7380
667 Ga0501070_0012009 3300049586 Bacteria 7309
668 Ga0501070_0801855 3300049586 Bacteria 739
669 Ga0501071_0135861 3300049587 Bacteria 1829
670 Ga0501071_0391604 3300049587 Bacteria 1060
671 Ga0501071_1349922 3300049587 Bacteria 551
672 Ga0501072_0008201 3300049588 Bacteria 7933
673 Ga0501072_0057394 3300049588 Bacteria 3067
674 Ga0501072_1157987 3300049588 Bacteria 601
675 Ga0501073_0021062 3300049589 Bacteria 4702
676 Ga0501074_0000929 3300049590 Bacteria 18830
677 Ga0501074_0009402 3300049590 Bacteria 7105
678 Ga0501074_0984556 3300049590 Bacteria 593
679 Ga0501075_0323242 3300049591 Bacteria 1175
680 Ga0501076_0041812 3300049592 Bacteria 3607
681 Ga0501076_0356916 3300049592 Bacteria 1201
682 Ga0501076_0481347 3300049592 Bacteria 1023
683 Ga0501077_0018882 3300049593 Bacteria 4363
684 Ga0501077_0135692 3300049593 Bacteria 1561
685 Ga0501077_0221035 3300049593 Bacteria 1204
686 Ga0501079_0025350 3300049741 Bacteria 4549
687 Ga0501079_0094985 3300049741 Bacteria 2310
688 Ga0501079_0144862 3300049741 Bacteria 1851
689 Ga0501080_0058202 3300049742 Bacteria 3597
690 Ga0501080_0158358 3300049742 Bacteria 2092
691 Ga0501080_0720710 3300049742 Bacteria 879
692 Ga0501081_0339744 3300049743 Bacteria 1106
693 Ga0501081_0926549 3300049743 Bacteria 657
694 Ga0501083_0007880 3300049744 Bacteria 7546
695 Ga0501083_0095340 3300049744 Bacteria 1963
696 Ga0501035_0022531 3300049822 Bacteria 5785
697 Ga0501035_0150613 3300049822 Bacteria 2019
698 Ga0501035_1381942 3300049822 Bacteria 540
699 Ga0501044_0006279 3300049823 Bacteria 13133
700 Ga0501044_0012155 3300049823 Bacteria 9322
701 Ga0501044_0140927 3300049823 Bacteria 2399
702 Ga0501044_0187312 3300049823 Bacteria 2033
703 Ga0501044_0391864 3300049823 Bacteria 1303
704 Ga0501044_0482293 3300049823 Bacteria 1143
705 Ga0501044_1046115 3300049823 Bacteria 687
706 Ga0501045_0039934 3300049824 Bacteria 3414
707 Ga0501045_0802056 3300049824 Bacteria 693
708 nmdc:mga03683_412006_c1 3300050489 Bacteria 646
709 nmdc:mga05p37_100122_c1 3300050507 Bacteria 3569
710 nmdc:mga05p37_10123_c2 3300050507 Bacteria 9095
711 nmdc:mga05p37_2098_c1 3300050507 Bacteria 23270
712 nmdc:mga05p37_218890_c1 3300050507 Bacteria 2299
713 nmdc:mga05p37_950177_c1 3300050507 Bacteria 920
714 nmdc:mga09592_220646_c1 3300050508 Bacteria 1643
715 nmdc:mga09592_435609_c1 3300050508 Bacteria 1132
716 nmdc:mga09592_7292_c1 3300050508 Bacteria 8985
717 nmdc:mga09592_806497_c1 3300050508 Bacteria 794
718 nmdc:mga0qj67_388531_c1 3300050509 Bacteria 1127
719 nmdc:mga0qj67_71413_c1 3300050509 Bacteria 2771
720 nmdc:mga06r32_236782_c1 3300050510 Bacteria 1813
721 nmdc:mga06r32_87707_c1 3300050510 Bacteria 3037
722 nmdc:mga06r32_96033_c1 3300050510 Bacteria 2902
723 nmdc:mga08y16_11013_c1 3300050511 Bacteria 9495
724 nmdc:mga08y16_160270_c1 3300050511 Bacteria 2338
725 nmdc:mga0n895_1966157_c1 3300050512 Bacteria 543
726 nmdc:mga0n895_35139_c1 3300050512 Bacteria 4830
727 nmdc:mga0n895_521040_c1 3300050512 Bacteria 1196
728 nmdc:mga0rr50_138709_c1 3300050513 Bacteria 1954
729 nmdc:mga0rr50_923108_c1 3300050513 Bacteria 744
730 nmdc:mga0a205_1052859_c1 3300050515 Bacteria 661
731 nmdc:mga0a205_61016_c1 3300050515 Bacteria 3642
732 nmdc:mga0a205_746516_c1 3300050515 Bacteria 827
733 Ga0495655_0136379 3300053083 Bacteria 760
734 Ga0495619_0011192 3300053085 Bacteria 5642
735 Ga0500556_0007207 3300053104 Bacteria 3176
736 Ga0500568_0000915 3300053139 Bacteria 20350
737 Ga0501084_0087125 3300054114 Bacteria 2622
738 Ga0501084_0146270 3300054114 Bacteria 1990
739 Ga0501084_0373635 3300054114 Bacteria 1205
740 Ga0587101_109773 3300059623 Bacteria 558
741 Ga0501082_0045215 3300060353 Bacteria 3797
742 Ga0501082_0736023 3300060353 Bacteria 863
743 Ga0501082_0781871 3300060353 Bacteria 835
744 Ga0501082_1218909 3300060353 Bacteria 658
745 Ga0501082_1254410 3300060353 Bacteria 647
746 Ga0466962_0259349 3300061719 Bacteria 855
747 Ga0530510_0133558 3300061734 Bacteria 1827
748 Ga0530510_0489006 3300061734 Bacteria 932
749 Ga0530510_1188872 3300061734 Bacteria 584
750 2525557498 2524614729 Bacteria 3091755
751 2548699188 2547132424 Bacteria 8348532
752 2552109862 2551306166 Bacteria 9731570
753 2630649089 2627854209 Bacteria 3093011
754 2644444980 2643221679 Bacteria 3839507
755 2884338816 2884338543 Bacteria 4610696
756 2884413411 2884411467 Bacteria 5246714
757 2919394685 2919391150 Bacteria 4884741
758 2919717137 2919713450 Bacteria 7431245
759 2939600870 2939598168 Bacteria 4687164
760 2939612409 2939611941 Bacteria 3892017
761 2941472053 2941471342 Bacteria 5018624
762 2945959228 2945956166 Bacteria 5110334
763 2997608651 2997600082 Bacteria 9896405
764 8055070199 8055066027 Bacteria 9479577
765 Ga0081455_10103410
766 JGI24740J21852_10010228
767 JGI24739J22299_10005574
768 JGI24737J22298_10011930
769 JGI25152J39213_1036750
770 JGI25153J46596_10015908
771 rootH1_10025010
772 JGI25407J50210_10025965
773 JGI25407J50210_10050452
774 JGI25407J50210_10109230
775 Ga0006562J51391_1130019
776 Ga0006562J51391_1130020
777 Ga0055526_1000003
778 Ga0055537_1000002
779 Ga0055537_1026784
780 Ga0055524_1000002
781 Ga0055536_1002557
782 Ga0055534_1000005
783 Ga0055528_1000001
784 Ga0055540_1000445
785 JGI25405J52794_10031455
786 Ga0065165_1005730
787 Ga0070658_10615587
788 Ga0070658_11391430
789 Ga0070676_10322747
790 Ga0068869_100021305
791 Ga0070680_100000195
792 Ga0070682_100578887
793 Ga0070682_101041327
794 Ga0070660_100096232
795 Ga0070660_101066335
796 Ga0070691_10189658
797 Ga0070687_100122606
798 Ga0070661_100214200
799 Ga0070692_10455765
800 Ga0070668_100685706
801 Ga0070668_100687121
802 Ga0070668_101273669
803 Ga0070669_101323170
804 Ga0070675_100227960
805 Ga0070671_100087941
806 Ga0070673_100643418
807 Ga0070688_100347438
808 Ga0070659_100088040
809 Ga0070659_101156044
810 Ga0070667_100020116
811 Ga0070667_100622041
812 Ga0070703_10000026
813 Ga0070714_100000325
814 Ga0070714_100105441
815 Ga0070713_100474750
816 Ga0070710_10015201
817 Ga0070710_10126314
818 Ga0070701_10094761
819 Ga0070711_100051735
820 Ga0070705_100247617
821 Ga0070700_100484057
822 Ga0070708_100002199
823 Ga0070663_101323930
824 Ga0070678_100268974
825 Ga0070678_101021732
826 Ga0070678_101994484
827 Ga0070662_100971086
828 Ga0070681_10000051
829 Ga0070681_10034117
830 Ga0068867_100147798
831 Ga0070685_10241642
832 Ga0070706_100002391
833 Ga0070707_100033851
834 Ga0070707_101624194
835 Ga0070698_100013351
836 Ga0070679_100000058
837 Ga0070679_100701348
838 Ga0070684_100700769
839 Ga0070697_101350356
840 Ga0068853_100207849
841 Ga0070672_100783683
842 Ga0070686_100123904
843 Ga0070696_101060301
844 Ga0070693_100177888
845 Ga0070665_100344725
846 Ga0070665_101833977
847 Ga0070704_100177346
848 Ga0068855_100004616
849 Ga0068855_100229139
850 Ga0070664_101468968
851 Ga0068857_100000857
852 Ga0068857_100161242
853 Ga0068854_100000244
854 Ga0068854_100061048
855 Ga0068854_100878106
856 Ga0068856_100237646
857 Ga0068856_100614502
858 Ga0068856_100811987
859 Ga0068852_100265455
860 Ga0068859_100099975
861 Ga0068859_100100739
862 Ga0068859_103051291
863 Ga0068864_100063310
864 Ga0068866_10221356
865 Ga0068861_100470453
866 Ga0068851_10165361
867 Ga0068870_10023259
868 Ga0068863_100761374
869 Ga0068858_101120917
870 Ga0068858_101902260
871 Ga0081455_10000169
872 Ga0081455_10106108
873 Ga0081455_10197474
874 Ga0081538_10000867
875 Ga0081538_10001657
876 Ga0081538_10005786
877 Ga0081538_10010471
878 Ga0081538_10012280
879 Ga0081538_10018385
880 Ga0081538_10034087
881 Ga0081538_10036738
882 Ga0081538_10046198
883 Ga0081538_10050630
884 Ga0081538_10064895
885 Ga0081538_10077274
886 Ga0081540_1001154
887 Ga0081540_1056878
888 Ga0081540_1063768
889 Ga0081539_10008650
890 Ga0081539_10083253
891 Ga0081539_10327185
892 Ga0070717_10916734
893 Ga0075432_10073059
894 Ga0070715_10065459
895 Ga0070712_100014894
896 Ga0075427_10003986
897 Ga0075366_10266555
898 Ga0097621_100182911
899 Ga0097621_100874722
900 Ga0068871_100356934
901 Ga0075428_100432784
902 Ga0075430_100068566
903 Ga0075431_100002504
904 Ga0075433_10060163
905 Ga0075433_10529174
906 Ga0075434_100033910
907 Ga0075434_100966950
908 Ga0075429_100003246
909 Ga0075429_100038133
910 Ga0068865_100129928
911 Ga0097620_100099977
912 Ga0097620_100100736
913 Ga0099794_10001261
914 Ga0105240_10003880
915 Ga0105240_10016099
916 Ga0105240_10078879
917 Ga0105240_10194211
918 Ga0105240_11743307
919 Ga0111539_10002959
920 Ga0111539_10159513
921 Ga0111539_10421275
922 Ga0105245_10293464
923 Ga0105245_11277384
924 Ga0105247_10005585
925 Ga0105247_10392646
926 Ga0114129_10084161
927 Ga0114129_10135699
928 Ga0114129_10247837
929 Ga0114129_11540561
930 Ga0114129_12058217
931 Ga0105243_10004771
932 Ga0105243_10053524
933 Ga0105241_10576798
934 Ga0105241_11060646
935 Ga0105242_10113096
936 Ga0105248_10074659
937 Ga0105237_10003982
938 Ga0105237_10015583
939 Ga0105237_10379369
940 Ga0105238_10032549
941 Ga0105238_10076786
942 Ga0105238_10923184
943 Ga0105249_10614636
944 Ga0105249_11789522
945 Ga0105249_13168338
946 Ga0105239_10002709
947 Ga0105239_10048665
948 Ga0105239_10338949
949 Ga0105246_10012315
950 Ga0157343_1010801
951 Ga0157314_1001860
952 Ga0157370_10004200
953 Ga0157370_10031743
954 Ga0157369_10001250
955 Ga0157374_10046610
956 Ga0157374_10951334
957 Ga0157378_10051287
958 Ga0157378_10949554
959 Ga0163162_10605133
960 Ga0157372_10084383
961 Ga0157372_10312463
962 Ga0157375_10028488
963 Ga0163163_10062435
964 Ga0163163_10487274
965 Ga0163163_10603659
966 Ga0163163_11043053
967 Ga0157380_11520260
968 Ga0157380_11989518
969 Ga0182008_10657223
970 Ga0157377_10583137
971 Ga0157379_10054919
972 Ga0157376_10204948
973 Ga0182006_1063300
974 Ga0183369_1006
975 Ga0183360_10003
976 Ga0213873_10021443
977 Ga0213873_10142014
978 Ga0213874_10391130
979 Ga0213876_10095731
980 Ga0213876_10300294
981 Ga0213875_10013397
982 Ga0213875_10014726
983 Ga0213875_10046058
984 Ga0209435_107554
985 Ga0209566_105596
986 Ga0209147_103044
987 Ga0209646_1019215
988 Ga0209759_1002192
989 Ga0209129_1005275
990 Ga0209565_1000002
991 Ga0209565_1010764
992 Ga0209673_1000002
993 Ga0209675_1000002
994 Ga0209676_1000173
995 Ga0209564_1000004
996 Ga0209758_1007050
997 Ga0209758_1044448
998 Ga0209256_1000004
999 Ga0207426_1033392
1000 Ga0209051_1001620
1001 Ga0209257_1011491
1002 Ga0207656_10076646
1003 Ga0207653_10000009
1004 Ga0207692_10023089
1005 Ga0207710_10002878
1006 Ga0207688_10060585
1007 Ga0207688_11075748
1008 Ga0207647_10000002
1009 Ga0207647_10010791
1010 Ga0207647_10024562
1011 Ga0207685_10035440
1012 Ga0207645_10008114
1013 Ga0207643_10001214
1014 Ga0207705_10050898
1015 Ga0207684_10004245
1016 Ga0207707_10000113
1017 Ga0207707_10045836
1018 Ga0207695_10002657
1019 Ga0207695_10003783
1020 Ga0207695_10026238
1021 Ga0207671_10000050
1022 Ga0207671_10008231
1023 Ga0207671_11062560
1024 Ga0207693_10002095
1025 Ga0207663_10009152
1026 Ga0207663_10425788
1027 Ga0207660_10002393
1028 Ga0207662_10123605
1029 Ga0207662_10225848
1030 Ga0207649_10704012
1031 Ga0207652_10000123
1032 Ga0207646_10022796
1033 Ga0207681_10393071
1034 Ga0207694_10011703
1035 Ga0207694_10055477
1036 Ga0207650_10003176
1037 Ga0207659_10469567
1038 Ga0207687_10066124
1039 Ga0207687_10679499
1040 Ga0207700_10101565
1041 Ga0207664_10000235
1042 Ga0207664_10001291
1043 Ga0207690_10001981
1044 Ga0207690_10078950
1045 Ga0207690_10248423
1046 Ga0207706_10141065
1047 Ga0207686_10016934
1048 Ga0207709_10001019
1049 Ga0207709_10145296
1050 Ga0207709_10250589
1051 Ga0207709_10640606
1052 Ga0207704_10121534
1053 Ga0207665_10064077
1054 Ga0207691_11613235
1055 Ga0207711_10491706
1056 Ga0207711_11755979
1057 Ga0207689_10040594
1058 Ga0207661_10864051
1059 Ga0207679_11155782
1060 Ga0207667_10000031
1061 Ga0207667_10000125
1062 Ga0207667_10098936
1063 Ga0207712_10543768
1064 Ga0207640_10000090
1065 Ga0207640_10048571
1066 Ga0207640_10218566
1067 Ga0207658_10013712
1068 Ga0207677_10155682
1069 Ga0207703_10682955
1070 Ga0207703_11705433
1071 Ga0207639_10125511
1072 Ga0207639_10467810
1073 Ga0207678_10053881
1074 Ga0207708_10012363
1075 Ga0207702_10130587
1076 Ga0207702_10579327
1077 Ga0207702_10717375
1078 Ga0207641_10450527
1079 Ga0207648_10069943
1080 Ga0207648_10425965
1081 Ga0207676_10127854
1082 Ga0207674_10000178
1083 Ga0207674_10051172
1084 Ga0207674_10249841
1085 Ga0207675_100197663
1086 Ga0207675_102467295
1087 Ga0207683_10051893
1088 Ga0207683_10762801
1089 Ga0207683_11004339
1090 Ga0207698_10322822
1091 Ga0207698_10487293
1092 Ga0209588_1000338
1093 Ga0207428_10040198
1094 Ga0207428_10049313
1095 Ga0268266_10529908
1096 Ga0268266_11046323
1097 Ga0268264_10745607
1098 Ga0268264_12247260
1099 Ga0307515_10000176
1100 Ga0307513_10138607
1101 Ga0307513_10405419
1102 Ga0307408_100003816
1103 Ga0307516_10067572
1104 Ga0307405_10069525
1105 Ga0307405_10087617
1106 Ga0307413_10005546
1107 Ga0307413_10017521
1108 Ga0307410_10034811
1109 Ga0307410_10723957
1110 Ga0307406_10000628
1111 Ga0307406_10001833
1112 Ga0307406_10053857
1113 Ga0307407_10040654
1114 Ga0307412_10764893
1115 Ga0307409_100000139
1116 Ga0307409_101586855
1117 Ga0307416_100000106
1118 Ga0307416_100009780
1119 Ga0307416_101476469
1120 Ga0307414_10041073
1121 Ga0307411_10010748
1122 Ga0307411_11593051
1123 Ga0307415_100007060
1124 Ga0307415_100186216
1125 Ga0307415_100495301
1126 Ga0307415_100935204
1127 Ga0373959_0201496
1128 Ga0373926_0000130
1129 Ga0373934_0066295
1130 Ga0373944_0003171
1131 Ga0373923_0003598
1132 Ga0373936_0003072
1133 Ga0373945_0012751
1134 Ga0373943_0045236
1135 Ga0373946_0001387
1136 Ga0373961_0300192
1137 Ga0373924_0005362
1138 Ga0373935_0007995
1139 Ga0373935_1249218
1140 Ga0373927_0027055
1141 Ga0373933_0543057
1142 Ga0373947_0193931
1143 Ga0373937_0101907
1144 Ga0373925_0135108
1145 Ga0395899_0036147
1146 Ga0395899_0054235
1147 Ga0395900_0036126
1148 Ga0395900_0049774
1149 Ga0395900_0062883
1150 Ga0395900_0150991
1151 Ga0395900_0295786
1152 Ga0395900_0597069
1153 Ga0395898_0037022
1154 Ga0395898_1007626
1155 Ga0395905_0094954
1156 Ga0395905_0118232
1157 Ga0395905_0470697
1158 Ga0436364_0133441
1159 Ga0436364_0348025
1160 Ga0436364_0461116
1161 Ga0436364_0539572
1162 Ga0436364_0598521
1163 Ga0395901_0053172
1164 Ga0395901_0053562
1165 Ga0395901_0099410
1166 Ga0395901_0112000
1167 Ga0395901_0982399
1168 Ga0436365_0337423
1169 Ga0436365_0585665
1170 Ga0436365_0772299
1171 Ga0436365_0997281
1172 Ga0436365_1597380
1173 Ga0436361_0762095
1174 Ga0436363_0695125
1175 Ga0436363_1433098
1176 Ga0436362_0166660
1177 Ga0436362_0255063
1178 Ga0436362_0605423
1179 Ga0436362_0959228
1180 Ga0439436_0000734
1181 Ga0439436_0064939
1182 Ga0439447_046881
1183 Ga0439447_073027
1184 Ga0439461_0014644
1185 Ga0439465_0012246
1186 Ga0451791_0401375
1187 Ga0451791_1178751
1188 Ga0451807_0464853
1189 Ga0451837_0157811
1190 Ga0451843_0217512
1191 Ga0451853_2970361
1192 Ga0451853_3477429
1193 Ga0439431_0055532
1194 Ga0439442_017146
1195 Ga0439445_0000831
1196 Ga0439448_0034309
1197 Ga0439432_004175
1198 Ga0439449_0025925
1199 Ga0439449_0263564
1200 Ga0439450_042026
1201 Ga0439452_004789
1202 Ga0439456_171786
1203 Ga0439457_001103
1204 Ga0439457_003502
1205 Ga0439462_0007887
1206 Ga0439463_003069
1207 Ga0450917_011888
1208 Ga0450890_048161
1209 Ga0450906_043485
1210 Ga0439446_0031240
1211 Ga0450908_000020
1212 Ga0439435_0133086
1213 Ga0439464_0106294
1214 Ga0439440_0020009
1215 Ga0439440_0032233
1216 Ga0466972_0181646
1217 Ga0466965_0108493
1218 Ga0466965_0223713
1219 Ga0466965_0394619
1220 Ga0466966_0378242
1221 Ga0466961_0074239
1222 Ga0466961_0103317
1223 Ga0466963_0022890
1224 Ga0466963_0028923
1225 Ga0466963_0056806
1226 Ga0466963_0425427
1227 Ga0466964_0184496
1228 Ga0466964_0239714
1229 Ga0466964_0243307
1230 Ga0466964_0700707
1231 Ga0453684_1303092
1232 Ga0466971_0022451
1233 Ga0466971_0040624
1234 Ga0466971_0044303
1235 Ga0466971_0292744
1236 Ga0466968_0293544
1237 Ga0466970_0083552
1238 Ga0466957_0005404
1239 Ga0466957_0012216
1240 Ga0466957_0099053
1241 Ga0466957_0240062
1242 Ga0466957_0701621
1243 Ga0466960_0001216
1244 Ga0466960_0019357
1245 Ga0466959_0064286
1246 Ga0466959_0094002
1247 Ga0466959_0365713
1248 Ga0466958_0004953
1249 Ga0466958_0027842
1250 Ga0466958_0119334
1251 Ga0466958_0348857
1252 Ga0466967_0013711
1253 Ga0466967_0071221
1254 Ga0466967_0115919
1255 Ga0466967_0379165
1256 Ga0466967_0472410
1257 Ga0466967_0521101
1258 Ga0466967_0665899
1259 Ga0495603_0075715
1260 Ga0495629_0013150
1261 Ga0495641_0010328
1262 Ga0495653_0095745
1263 Ga0495580_0009482
1264 Ga0495580_0055600
1265 Ga0495582_0000984
1266 Ga0495582_0088801
1267 Ga0495639_0004291
1268 Ga0495639_0004767
1269 Ga0495662_0030890
1270 Ga0495664_0836713
1271 Ga0495585_0326201
1272 Ga0495585_0410653
1273 Ga0495594_0373838
1274 Ga0495607_0253461
1275 Ga0495630_0005925
1276 Ga0495644_0292482
1277 Ga0495663_0230421
1278 Ga0495666_0011148
1279 Ga0495665_0003710
1280 Ga0495665_0006058
1281 Ga0495640_0003627
1282 Ga0495586_0004717
1283 Ga0495586_0062738
1284 Ga0495667_0065299
1285 Ga0495656_0146891
1286 Ga0495656_0348413
1287 Ga0495634_0012336
1288 Ga0495634_0527007
1289 Ga0495635_0006509
1290 Ga0495659_0009155
1291 Ga0495661_0633268
1292 Ga0495588_0000578
1293 Ga0495588_0002176
1294 Ga0495647_0004266
1295 Ga0495658_0034870
1296 Ga0495613_0004995
1297 Ga0495624_0052955
1298 Ga0495670_0237700
1299 Ga0495670_0248766
1300 Ga0495671_0614268
1301 Ga0495589_0184755
1302 Ga0495589_0415258
1303 Ga0495600_0008169
1304 Ga0495581_0002947
1305 Ga0495674_0005372
1306 Ga0495676_0011903
1307 Ga0495680_0001169
1308 Ga0495680_0444344
1309 Ga0495686_0000426
1310 Ga0495593_0014328
1311 Ga0495593_0062553
1312 Ga0495614_0008035
1313 Ga0496100_0050837
1314 Ga0496100_0079007
1315 Ga0496100_0333525
1316 Ga0496100_0836980
1317 Ga0496100_1112777
1318 Ga0496101_0004836
1319 Ga0496101_0274200
1320 Ga0496102_0000095
1321 Ga0496102_0107037
1322 Ga0496102_1224706
1323 Ga0496102_1293012
1324 Ga0496103_0000084
1325 Ga0496103_0010439
1326 Ga0496104_0665331
1327 Ga0496106_0006680
1328 Ga0496106_0322904
1329 Ga0496106_0448747
1330 Ga0496107_0019704
1331 Ga0496108_0214452
1332 Ga0496109_0229922
1333 Ga0496109_0842607
1334 Ga0496109_1719055
1335 Ga0496110_0083325
1336 Ga0496110_0324211
1337 Ga0496110_0471848
1338 Ga0496111_0671022
1339 Ga0496112_0068561
1340 Ga0496113_0104902
1341 Ga0496114_0042100
1342 Ga0496114_1203896
1343 Ga0496115_0142309
1344 Ga0496115_0256610
1345 Ga0496116_0298600
1346 Ga0496117_0024205
1347 Ga0496117_0065524
1348 Ga0496117_0115834
1349 Ga0496118_0000166
1350 Ga0496118_0004002
1351 Ga0496118_0010589
1352 Ga0496118_0010829
1353 Ga0496118_0094079
1354 Ga0496119_0000253
1355 Ga0496119_0034515
1356 Ga0496120_0010572
1357 Ga0496121_0000116
1358 Ga0496121_0000119
1359 Ga0496121_0040216
1360 Ga0496121_0142498
1361 Ga0496121_0197598
1362 Ga0496122_0063587
1363 Ga0496123_0111027
1364 Ga0496125_0010386
1365 Ga0496125_0032270
1366 Ga0496125_0387376
1367 Ga0496126_0047470
1368 Ga0496126_0463377
1369 Ga0501031_0081561
1370 Ga0501031_0431205
1371 Ga0501032_0066614
1372 Ga0501032_0098705
1373 Ga0501033_0047221
1374 Ga0501034_0045275
1375 Ga0501034_0195158
1376 Ga0501034_0292568
1377 Ga0501034_0572147
1378 Ga0501034_0653242
1379 Ga0501034_1147998
1380 Ga0501036_0020014
1381 Ga0501036_0053064
1382 Ga0501036_0194784
1383 Ga0501036_0332158
1384 Ga0501037_0105757
1385 Ga0501037_0378027
1386 Ga0501038_0100029
1387 Ga0501038_0180933
1388 Ga0501038_0252633
1389 Ga0501038_0328374
1390 Ga0501039_0138486
1391 Ga0501039_0588046
1392 Ga0501039_1012199
1393 Ga0501040_0055918
1394 Ga0501040_0141568
1395 Ga0501040_1226025
1396 Ga0501041_0291658
1397 Ga0501041_0571559
1398 Ga0501041_1154470
1399 Ga0501042_0023093
1400 Ga0501042_0213544
1401 Ga0501042_0432031
1402 Ga0501042_0496767
1403 Ga0501043_0124810
1404 Ga0501043_0179168
1405 Ga0501043_1190409
1406 Ga0501046_0108893
1407 Ga0501046_0175441
1408 Ga0501046_0323988
1409 Ga0501046_0958060
1410 Ga0501047_0073171
1411 Ga0501047_0233178
1412 Ga0501047_0342579
1413 Ga0501047_0915996
1414 Ga0501047_0984549
1415 Ga0501048_0057696
1416 Ga0501048_0180350
1417 Ga0501048_0444527
1418 Ga0501048_0683580
1419 Ga0501048_1048380
1420 Ga0501067_0007376
1421 Ga0501067_0068733
1422 Ga0501067_0094623
1423 Ga0501067_0130874
1424 Ga0501068_0008028
1425 Ga0501068_0037983
1426 Ga0501068_0142367
1427 Ga0501068_0372752
1428 Ga0501069_0006995
1429 Ga0501069_0060803
1430 Ga0501070_0011801
1431 Ga0501070_0012009
1432 Ga0501070_0801855
1433 Ga0501071_0135861
1434 Ga0501071_0391604
1435 Ga0501071_1349922
1436 Ga0501072_0008201
1437 Ga0501072_0057394
1438 Ga0501072_1157987
1439 Ga0501073_0021062
1440 Ga0501074_0000929
1441 Ga0501074_0009402
1442 Ga0501074_0984556
1443 Ga0501075_0323242
1444 Ga0501076_0041812
1445 Ga0501076_0356916
1446 Ga0501076_0481347
1447 Ga0501077_0018882
1448 Ga0501077_0135692
1449 Ga0501077_0221035
1450 Ga0501079_0025350
1451 Ga0501079_0094985
1452 Ga0501079_0144862
1453 Ga0501080_0058202
1454 Ga0501080_0158358
1455 Ga0501080_0720710
1456 Ga0501081_0339744
1457 Ga0501081_0926549
1458 Ga0501083_0007880
1459 Ga0501083_0095340
1460 Ga0501035_0022531
1461 Ga0501035_0150613
1462 Ga0501035_1381942
1463 Ga0501044_0006279
1464 Ga0501044_0012155
1465 Ga0501044_0140927
1466 Ga0501044_0187312
1467 Ga0501044_0391864
1468 Ga0501044_0482293
1469 Ga0501044_1046115
1470 Ga0501045_0039934
1471 Ga0501045_0802056
1472 nmdc:mga03683_412006_c1
1473 nmdc:mga05p37_100122_c1
1474 nmdc:mga05p37_10123_c2
1475 nmdc:mga05p37_2098_c1
1476 nmdc:mga05p37_218890_c1
1477 nmdc:mga05p37_950177_c1
1478 nmdc:mga09592_220646_c1
1479 nmdc:mga09592_435609_c1
1480 nmdc:mga09592_7292_c1
1481 nmdc:mga09592_806497_c1
1482 nmdc:mga0qj67_388531_c1
1483 nmdc:mga0qj67_71413_c1
1484 nmdc:mga06r32_236782_c1
1485 nmdc:mga06r32_87707_c1
1486 nmdc:mga06r32_96033_c1
1487 nmdc:mga08y16_11013_c1
1488 nmdc:mga08y16_160270_c1
1489 nmdc:mga0n895_1966157_c1
1490 nmdc:mga0n895_35139_c1
1491 nmdc:mga0n895_521040_c1
1492 nmdc:mga0rr50_138709_c1
1493 nmdc:mga0rr50_923108_c1
1494 nmdc:mga0a205_1052859_c1
1495 nmdc:mga0a205_61016_c1
1496 nmdc:mga0a205_746516_c1
1497 Ga0495655_0136379
1498 Ga0495619_0011192
1499 Ga0500556_0007207
1500 Ga0500568_0000915
1501 Ga0501084_0087125
1502 Ga0501084_0146270
1503 Ga0501084_0373635
1504 Ga0587101_109773
1505 Ga0501082_0045215
1506 Ga0501082_0736023
1507 Ga0501082_0781871
1508 Ga0501082_1218909
1509 Ga0501082_1254410
1510 Ga0466962_0259349
1511 Ga0530510_0133558
1512 Ga0530510_0489006
1513 Ga0530510_1188872
1514 2525557498
1515 2548699188
1516 2552109862
1517 2630649089
1518 2644444980
1519 2884338816
1520 2884413411
1521 2919394685
1522 2919717137
1523 2939600870
1524 2939612409
1525 2941472053
1526 2945959228
1527 2997608651
1528 8055070199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

7

136

0.88

PF18029

Glyoxalase_6

Glyoxalase-like domain

10

137

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8871 1 133
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.883 1 135
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8824 2 133
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8769 1 135
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8683 1 133
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9439 83 132 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9263 83 134 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.875 83 132 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.872 84 136 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.849 83 134 3.30.720.110
ID Description Score Start End GO Terms
AF-W9CZ14-F1-model_v4 deleted 0.9973 86 136
AF-A0A846VCU9-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9931 1 136 GO:0016829
GO:0051213
AF-A0A6I6F2T9-F1-model_v4 VOC family protein 0.9888 1 136
AF-A0A5M7CC86-F1-model_v4 VOC family protein 0.9886 1 136
AF-A0A1I4BXU9-F1-model_v4 Uncharacterized conserved protein PhnB, glyoxalase superfamily 0.9885 1 136

Map