F479627

General Info

Members Datasets Scaffolds Average Seq Length
762 355 762 77

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10214645|Ga0099795_102146451
Length 73
Sequence MLILTRRAGEALRIGDDIEVTVMAVNGTQVRIGIKAPREVAVDREEIAERKRRDRENSDAIGKVEARSRLAVP

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
102 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
103 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
121 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
200 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
212 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
213 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
214 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
215 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
216 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
217 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
218 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
219 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
220 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
221 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
222 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
223 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
224 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
225 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
226 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
227 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
228 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
229 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
230 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
231 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
232 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
233 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
234 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
235 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
247 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
248 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
258 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
302 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
303 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
317 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
318 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
319 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
320 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
321 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
322 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
323 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
326 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
327 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
328 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
355 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.7
Metatranscriptomes 6.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0
Rhizoplane 5.25
Rhizosphere 92.13
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1012758 3300000546 Bacteria 895
2 JGI24746J21847_1040169 3300001977 Bacteria 650
3 JGI24737J22298_10186211 3300001990 Bacteria 613
4 JGI24738J21930_10079422 3300002075 Bacteria 686
5 JGI24744J21845_10032293 3300002077 Bacteria 999
6 JGI25407J50210_10025407 3300003373 Bacteria 1536
7 JGI25407J50210_10081871 3300003373 Bacteria 802
8 JGI25407J50210_10090770 3300003373 Bacteria 756
9 Ga0032354_1046075 3300003693 Bacteria 575
10 Ga0058863_11835538 3300004799 Bacteria 672
11 Ga0058863_11857311 3300004799 Bacteria 524
12 Ga0058861_10010021 3300004800 Bacteria 555
13 Ga0058862_12741778 3300004803 Bacteria 501
14 Ga0058862_12879863 3300004803 Bacteria 594
15 Ga0070658_10522189 3300005327 Bacteria 1027
16 Ga0070658_10912952 3300005327 Bacteria 764
17 Ga0070676_10975492 3300005328 Bacteria 635
18 Ga0070683_100088801 3300005329 Bacteria 2900
19 Ga0070683_100127469 3300005329 Bacteria 2406
20 Ga0070683_100168642 3300005329 Bacteria 2077
21 Ga0070683_100171800 3300005329 Bacteria 2057
22 Ga0070683_100203832 3300005329 Bacteria 1879
23 Ga0070683_101246879 3300005329 Bacteria 714
24 Ga0070670_100892031 3300005331 Bacteria 806
25 Ga0070677_10080870 3300005333 Bacteria 1390
26 Ga0068869_100448007 3300005334 Bacteria 1070
27 Ga0070666_10572404 3300005335 Bacteria 823
28 Ga0070682_100779498 3300005337 Bacteria 775
29 Ga0068868_100122964 3300005338 Bacteria 2117
30 Ga0068868_100741804 3300005338 Bacteria 882
31 Ga0070660_100448104 3300005339 Bacteria 1071
32 Ga0070689_100628077 3300005340 Bacteria 933
33 Ga0070689_100674192 3300005340 Bacteria 901
34 Ga0070687_100231790 3300005343 Bacteria 1137
35 Ga0070687_101102819 3300005343 Bacteria 581
36 Ga0070661_100329028 3300005344 Bacteria 1195
37 Ga0070661_100461682 3300005344 Bacteria 1011
38 Ga0070661_100542165 3300005344 Bacteria 935
39 Ga0070692_10081812 3300005345 Bacteria 1741
40 Ga0070692_10805542 3300005345 Bacteria 642
41 Ga0070668_100183660 3300005347 Bacteria 1710
42 Ga0070668_100386819 3300005347 Bacteria 1192
43 Ga0070668_101671656 3300005347 Unclassified 584
44 Ga0070668_102277796 3300005347 Bacteria 501
45 Ga0070669_100001369 3300005353 Bacteria 17574
46 Ga0070669_101069562 3300005353 Bacteria 694
47 Ga0070669_101708622 3300005353 Bacteria 549
48 Ga0070675_101268715 3300005354 Bacteria 679
49 Ga0070671_101877317 3300005355 Bacteria 533
50 Ga0070674_100016281 3300005356 Bacteria 4659
51 Ga0070674_100630013 3300005356 Bacteria 909
52 Ga0070674_100977734 3300005356 Bacteria 741
53 Ga0070673_101239063 3300005364 Bacteria 700
54 Ga0070673_101692159 3300005364 Bacteria 599
55 Ga0070659_100000163 3300005366 Bacteria 51399
56 Ga0070659_100220265 3300005366 Bacteria 1566
57 Ga0070659_100377491 3300005366 Bacteria 1193
58 Ga0070659_100661089 3300005366 Bacteria 901
59 Ga0070659_101071500 3300005366 Bacteria 709
60 Ga0070714_100000038 3300005435 Bacteria 121712
61 Ga0070710_11326063 3300005437 Bacteria 536
62 Ga0070701_10242272 3300005438 Bacteria 1085
63 Ga0070701_10270457 3300005438 Bacteria 1034
64 Ga0070701_10683188 3300005438 Bacteria 689
65 Ga0070701_10858159 3300005438 Bacteria 624
66 Ga0070700_100358356 3300005441 Bacteria 1084
67 Ga0070700_101478904 3300005441 Bacteria 577
68 Ga0070663_100580360 3300005455 Unclassified 940
69 Ga0070663_100823825 3300005455 Bacteria 797
70 Ga0070663_100929876 3300005455 Bacteria 753
71 Ga0070678_100169098 3300005456 Bacteria 1778
72 Ga0070678_100823597 3300005456 Bacteria 844
73 Ga0070678_101217379 3300005456 Bacteria 699
74 Ga0070678_102212114 3300005456 Bacteria 522
75 Ga0070662_100394713 3300005457 Bacteria 1141
76 Ga0070681_10642934 3300005458 Bacteria 976
77 Ga0068867_100085190 3300005459 Bacteria 2389
78 Ga0068867_100138513 3300005459 Bacteria 1900
79 Ga0068867_100481527 3300005459 Bacteria 1063
80 Ga0068867_101189951 3300005459 Bacteria 699
81 Ga0068867_101808990 3300005459 Bacteria 574
82 Ga0070685_10732057 3300005466 Bacteria 724
83 Ga0070685_11056158 3300005466 Bacteria 612
84 Ga0070699_101029597 3300005518 Bacteria 755
85 Ga0070679_100138786 3300005530 Bacteria 2412
86 Ga0070684_100092313 3300005535 Bacteria 2694
87 Ga0070684_100099586 3300005535 Bacteria 2594
88 Ga0070684_100824793 3300005535 Bacteria 867
89 Ga0070684_100992794 3300005535 Bacteria 788
90 Ga0070684_101100938 3300005535 Bacteria 746
91 Ga0070684_101219627 3300005535 Bacteria 708
92 Ga0070697_100287310 3300005536 Bacteria 1412
93 Ga0068853_100289582 3300005539 Bacteria 1512
94 Ga0068853_101341377 3300005539 Bacteria 692
95 Ga0068853_101810975 3300005539 Bacteria 592
96 Ga0070672_101133816 3300005543 Bacteria 696
97 Ga0070672_101310663 3300005543 Bacteria 647
98 Ga0070686_100407398 3300005544 Bacteria 1036
99 Ga0070686_100427844 3300005544 Bacteria 1013
100 Ga0070686_100659065 3300005544 Bacteria 831
101 Ga0070695_101251173 3300005545 Bacteria 612
102 Ga0070696_100947156 3300005546 Bacteria 716
103 Ga0070696_101247866 3300005546 Bacteria 629
104 Ga0070693_100424248 3300005547 Bacteria 927
105 Ga0070693_100744291 3300005547 Bacteria 722
106 Ga0070693_101101363 3300005547 Bacteria 606
107 Ga0070665_100803661 3300005548 Bacteria 953
108 Ga0070665_100831143 3300005548 Bacteria 937
109 Ga0070665_102085814 3300005548 Bacteria 572
110 Ga0070704_100208246 3300005549 Bacteria 1583
111 Ga0070704_100419981 3300005549 Bacteria 1145
112 Ga0070704_102141733 3300005549 Bacteria 520
113 Ga0068855_102123524 3300005563 Unclassified 565
114 Ga0070664_100096782 3300005564 Bacteria 2562
115 Ga0070664_100256282 3300005564 Bacteria 1573
116 Ga0070664_100830768 3300005564 Bacteria 864
117 Ga0070664_102082199 3300005564 Bacteria 538
118 Ga0068857_100302818 3300005577 Bacteria 1474
119 Ga0068857_100479257 3300005577 Bacteria 1166
120 Ga0068857_100843086 3300005577 Bacteria 877
121 Ga0068854_100095326 3300005578 Bacteria 2221
122 Ga0068854_100372107 3300005578 Unclassified 1175
123 Ga0068854_100629876 3300005578 Unclassified 919
124 Ga0068854_102223065 3300005578 Bacteria 508
125 Ga0068856_100579196 3300005614 Unclassified 1143
126 Ga0068856_101047471 3300005614 Bacteria 834
127 Ga0068856_101209963 3300005614 Bacteria 772
128 Ga0068856_102505251 3300005614 Bacteria 523
129 Ga0070702_100108743 3300005615 Bacteria 1715
130 Ga0070702_100250424 3300005615 Bacteria 1200
131 Ga0070702_100384748 3300005615 Bacteria 999
132 Ga0070702_100388494 3300005615 Bacteria 995
133 Ga0070702_100635650 3300005615 Bacteria 805
134 Ga0068852_100391696 3300005616 Bacteria 1365
135 Ga0068852_100462060 3300005616 Bacteria 1258
136 Ga0068852_100616329 3300005616 Bacteria 1091
137 Ga0068852_101150383 3300005616 Bacteria 797
138 Ga0068852_101410145 3300005616 Unclassified 719
139 Ga0068852_102248972 3300005616 Bacteria 566
140 Ga0068864_100047501 3300005618 Bacteria 3687
141 Ga0068866_10626014 3300005718 Bacteria 730
142 Ga0068861_100031308 3300005719 Bacteria 3908
143 Ga0068861_100144949 3300005719 Bacteria 1943
144 Ga0068861_100180024 3300005719 Bacteria 1759
145 Ga0068861_100632189 3300005719 Bacteria 986
146 Ga0068851_10677946 3300005834 Bacteria 633
147 Ga0068870_10209433 3300005840 Bacteria 1187
148 Ga0068870_10423617 3300005840 Bacteria 871
149 Ga0068858_100045636 3300005842 Bacteria 4062
150 Ga0068858_100120054 3300005842 Bacteria 2458
151 Ga0068858_100598301 3300005842 Bacteria 1070
152 Ga0068858_101155491 3300005842 Bacteria 761
153 Ga0068860_100724927 3300005843 Bacteria 1005
154 Ga0068862_100395023 3300005844 Bacteria 1293
155 Ga0068862_100730564 3300005844 Bacteria 962
156 Ga0081455_10066658 3300005937 Bacteria 3005
157 Ga0081455_10112615 3300005937 Bacteria 2159
158 Ga0081455_10116703 3300005937 Bacteria 2111
159 Ga0081455_10172862 3300005937 Bacteria 1644
160 Ga0081455_10338365 3300005937 Bacteria 1066
161 Ga0081455_10545478 3300005937 Bacteria 768
162 Ga0081538_10000450 3300005981 Bacteria 46279
163 Ga0081538_10001846 3300005981 Bacteria 21363
164 Ga0081538_10014284 3300005981 Bacteria 6222
165 Ga0081538_10019086 3300005981 Bacteria 5115
166 Ga0081538_10023060 3300005981 Bacteria 4485
167 Ga0081538_10029547 3300005981 Bacteria 3743
168 Ga0081538_10175864 3300005981 Bacteria 925
169 Ga0081538_10258358 3300005981 Bacteria 659
170 Ga0081540_1113232 3300005983 Bacteria 1142
171 Ga0081540_1224352 3300005983 Bacteria 667
172 Ga0081539_10177518 3300005985 Bacteria 1002
173 Ga0070717_10028957 3300006028 Bacteria 4438
174 Ga0075365_10240014 3300006038 Bacteria 1273
175 Ga0075365_10507640 3300006038 Bacteria 852
176 Ga0075363_100928076 3300006048 Bacteria 534
177 Ga0075364_10656810 3300006051 Unclassified 716
178 Ga0075432_10210173 3300006058 Bacteria 774
179 Ga0075432_10264181 3300006058 Bacteria 703
180 Ga0070715_10990159 3300006163 Bacteria 523
181 Ga0068871_100971474 3300006358 Bacteria 790
182 Ga0068871_101907625 3300006358 Bacteria 565
183 Ga0068871_102431051 3300006358 Bacteria 500
184 Ga0075428_100040740 3300006844 Bacteria 5109
185 Ga0075428_101304461 3300006844 Bacteria 763
186 Ga0075428_102292577 3300006844 Bacteria 556
187 Ga0075428_102446636 3300006844 Bacteria 535
188 Ga0075431_100743300 3300006847 Bacteria 957
189 Ga0075434_102052831 3300006871 Bacteria 577
190 Ga0075429_101779028 3300006880 Bacteria 535
191 Ga0068865_100049036 3300006881 Bacteria 2908
192 Ga0068865_101308406 3300006881 Bacteria 645
193 Ga0099795_10214645 3300007788 Bacteria 817
194 Ga0105240_10004346 3300009093 Bacteria 21634
195 Ga0105240_12578293 3300009093 Bacteria 525
196 Ga0111539_10029334 3300009094 Bacteria 6703
197 Ga0111539_10269561 3300009094 Bacteria 1982
198 Ga0111539_10287971 3300009094 Bacteria 1911
199 Ga0111539_10781214 3300009094 Bacteria 1111
200 Ga0111539_11161066 3300009094 Bacteria 897
201 Ga0105245_10009166 3300009098 Bacteria 8627
202 Ga0105245_10300674 3300009098 Bacteria 1574
203 Ga0105245_10360343 3300009098 Bacteria 1443
204 Ga0105245_11375562 3300009098 Bacteria 756
205 Ga0105247_10568427 3300009101 Bacteria 836
206 Ga0114129_12309923 3300009147 Bacteria 645
207 Ga0105243_10039614 3300009148 Bacteria 3675
208 Ga0105243_10057996 3300009148 Bacteria 3085
209 Ga0105243_10108212 3300009148 Bacteria 2320
210 Ga0105243_10118532 3300009148 Bacteria 2227
211 Ga0105243_10275620 3300009148 Bacteria 1513
212 Ga0105243_10467247 3300009148 Bacteria 1188
213 Ga0105243_10586263 3300009148 Bacteria 1071
214 Ga0105241_10519319 3300009174 Bacteria 1065
215 Ga0105241_11147056 3300009174 Bacteria 734
216 Ga0105241_12207338 3300009174 Bacteria 546
217 Ga0105242_10062382 3300009176 Bacteria 3067
218 Ga0105242_10231295 3300009176 Bacteria 1657
219 Ga0105242_10618310 3300009176 Bacteria 1049
220 Ga0105242_11234335 3300009176 Bacteria 768
221 Ga0105248_10544926 3300009177 Bacteria 1309
222 Ga0105248_10547751 3300009177 Bacteria 1305
223 Ga0105248_10779433 3300009177 Bacteria 1079
224 Ga0105237_10559303 3300009545 Bacteria 1150
225 Ga0105238_10453936 3300009551 Bacteria 1279
226 Ga0105238_10850349 3300009551 Bacteria 929
227 Ga0105249_10230734 3300009553 Bacteria 1825
228 Ga0105249_10583083 3300009553 Bacteria 1171
229 Ga0105249_12916858 3300009553 Bacteria 549
230 Ga0099796_10042774 3300010159 Bacteria 1540
231 Ga0105239_10147091 3300010375 Bacteria 2629
232 Ga0105239_10333492 3300010375 Bacteria 1711
233 Ga0105239_10609526 3300010375 Bacteria 1246
234 Ga0105239_12332888 3300010375 Bacteria 623
235 Ga0105246_10006461 3300011119 Bacteria 7161
236 Ga0105246_10201263 3300011119 Bacteria 1548
237 Ga0105246_10473626 3300011119 Unclassified 1058
238 Ga0105246_10552015 3300011119 Bacteria 987
239 Ga0105246_11320429 3300011119 Bacteria 669
240 Ga0105246_11562535 3300011119 Bacteria 622
241 Ga0157345_1016603 3300012498 Bacteria 709
242 Ga0157324_1026337 3300012506 Bacteria 630
243 Ga0157326_1039481 3300012513 Bacteria 657
244 Ga0157371_10622174 3300013102 Bacteria 804
245 Ga0157371_10627480 3300013102 Unclassified 801
246 Ga0157371_10629219 3300013102 Bacteria 800
247 Ga0157371_11511339 3300013102 Bacteria 524
248 Ga0157370_11373060 3300013104 Bacteria 636
249 Ga0157369_11287085 3300013105 Bacteria 745
250 Ga0157374_12050308 3300013296 Bacteria 599
251 Ga0157378_10327145 3300013297 Bacteria 1491
252 Ga0157378_10864311 3300013297 Bacteria 933
253 Ga0157378_11370853 3300013297 Bacteria 749
254 Ga0157378_12775037 3300013297 Bacteria 542
255 Ga0163162_10353807 3300013306 Bacteria 1601
256 Ga0163162_10762318 3300013306 Bacteria 1086
257 Ga0163162_12709653 3300013306 Bacteria 571
258 Ga0157372_10128777 3300013307 Bacteria 2911
259 Ga0157372_10650031 3300013307 Bacteria 1228
260 Ga0157372_10769543 3300013307 Bacteria 1119
261 Ga0157372_11414980 3300013307 Bacteria 802
262 Ga0157372_12628893 3300013307 Bacteria 578
263 Ga0157375_11189861 3300013308 Bacteria 894
264 Ga0157375_12493461 3300013308 Bacteria 617
265 Ga0157375_13780239 3300013308 Bacteria 503
266 Ga0163163_10293285 3300014325 Bacteria 1679
267 Ga0163163_11096261 3300014325 Bacteria 859
268 Ga0163163_11647475 3300014325 Unclassified 702
269 Ga0157380_10259732 3300014326 Bacteria 1577
270 Ga0157380_10411131 3300014326 Bacteria 1287
271 Ga0157380_10649427 3300014326 Bacteria 1052
272 Ga0182008_10104627 3300014497 Bacteria 1400
273 Ga0157377_10106798 3300014745 Bacteria 1677
274 Ga0157377_10387709 3300014745 Bacteria 948
275 Ga0157377_10825133 3300014745 Bacteria 686
276 Ga0157379_10245528 3300014968 Bacteria 1624
277 Ga0157379_11309877 3300014968 Bacteria 700
278 Ga0157376_10806838 3300014969 Bacteria 951
279 Ga0157376_12748890 3300014969 Bacteria 532
280 Ga0163161_12017680 3300017792 Bacteria 513
281 Ga0206356_11473832 3300020070 Bacteria 3873
282 Ga0206356_11500562 3300020070 Bacteria 510
283 Ga0206355_1414211 3300020076 Unclassified 502
284 Ga0206350_10418688 3300020080 Bacteria 582
285 Ga0206354_10237246 3300020081 Bacteria 673
286 Ga0206354_11439709 3300020081 Bacteria 783
287 Ga0206353_10284451 3300020082 Bacteria 677
288 Ga0206353_10667699 3300020082 Bacteria 925
289 Ga0213874_10398600 3300021377 Bacteria 535
290 Ga0224712_10260989 3300022467 Bacteria 802
291 Ga0224712_10311454 3300022467 Bacteria 738
292 Ga0224712_10545383 3300022467 Bacteria 563
293 Ga0207426_1043161 3300025302 Bacteria 1386
294 Ga0207656_10269875 3300025321 Bacteria 837
295 Ga0207656_10532980 3300025321 Bacteria 597
296 Ga0207692_10070795 3300025898 Bacteria 1837
297 Ga0207642_10203767 3300025899 Bacteria 1094
298 Ga0207642_10206510 3300025899 Bacteria 1089
299 Ga0207688_10023583 3300025901 Bacteria 3370
300 Ga0207688_10207314 3300025901 Bacteria 1177
301 Ga0207647_10531364 3300025904 Bacteria 654
302 Ga0207645_10228028 3300025907 Bacteria 1229
303 Ga0207645_11071730 3300025907 Bacteria 544
304 Ga0207643_10095843 3300025908 Bacteria 1735
305 Ga0207643_10130821 3300025908 Bacteria 1493
306 Ga0207643_10171754 3300025908 Bacteria 1309
307 Ga0207643_10277791 3300025908 Bacteria 1038
308 Ga0207705_10758385 3300025909 Bacteria 754
309 Ga0207705_10915255 3300025909 Bacteria 679
310 Ga0207695_10042059 3300025913 Bacteria 4885
311 Ga0207695_10536383 3300025913 Bacteria 1052
312 Ga0207671_11252185 3300025914 Bacteria 579
313 Ga0207660_10447815 3300025917 Bacteria 1044
314 Ga0207660_10510331 3300025917 Bacteria 976
315 Ga0207662_10171790 3300025918 Bacteria 1390
316 Ga0207662_10276092 3300025918 Bacteria 1110
317 Ga0207657_10123988 3300025919 Bacteria 2123
318 Ga0207657_11399063 3300025919 Bacteria 525
319 Ga0207649_10961634 3300025920 Bacteria 671
320 Ga0207652_10252739 3300025921 Bacteria 1589
321 Ga0207681_10001085 3300025923 Bacteria 17649
322 Ga0207681_10893746 3300025923 Bacteria 744
323 Ga0207681_11215566 3300025923 Bacteria 633
324 Ga0207694_10807346 3300025924 Bacteria 793
325 Ga0207650_10280737 3300025925 Bacteria 1356
326 Ga0207659_10892909 3300025926 Bacteria 764
327 Ga0207687_10060950 3300025927 Bacteria 2663
328 Ga0207687_10099278 3300025927 Bacteria 2139
329 Ga0207687_10229866 3300025927 Bacteria 1465
330 Ga0207687_10542543 3300025927 Bacteria 975
331 Ga0207687_10549704 3300025927 Bacteria 969
332 Ga0207664_10000040 3300025929 Bacteria 158895
333 Ga0207664_10143007 3300025929 Bacteria 2026
334 Ga0207664_10943205 3300025929 Bacteria 774
335 Ga0207644_10911536 3300025931 Bacteria 737
336 Ga0207690_10000166 3300025932 Bacteria 51430
337 Ga0207690_10323670 3300025932 Bacteria 1213
338 Ga0207706_10043662 3300025933 Bacteria 3972
339 Ga0207686_10160757 3300025934 Bacteria 1574
340 Ga0207686_10588031 3300025934 Bacteria 874
341 Ga0207709_10028379 3300025935 Bacteria 3235
342 Ga0207709_10031902 3300025935 Bacteria 3082
343 Ga0207709_10079912 3300025935 Bacteria 2104
344 Ga0207709_10155445 3300025935 Bacteria 1589
345 Ga0207709_10235774 3300025935 Bacteria 1328
346 Ga0207709_11705293 3300025935 Bacteria 524
347 Ga0207670_10302668 3300025936 Bacteria 1252
348 Ga0207670_11304502 3300025936 Bacteria 616
349 Ga0207669_10049960 3300025937 Bacteria 2497
350 Ga0207669_10371662 3300025937 Bacteria 1111
351 Ga0207669_10458085 3300025937 Bacteria 1012
352 Ga0207704_10028200 3300025938 Bacteria 3111
353 Ga0207704_10319627 3300025938 Bacteria 1197
354 Ga0207704_10484685 3300025938 Bacteria 993
355 Ga0207691_10109452 3300025940 Bacteria 2458
356 Ga0207691_10167510 3300025940 Bacteria 1925
357 Ga0207711_10535086 3300025941 Bacteria 1093
358 Ga0207711_10542246 3300025941 Bacteria 1085
359 Ga0207711_11016862 3300025941 Bacteria 769
360 Ga0207689_10342529 3300025942 Bacteria 1242
361 Ga0207689_10596401 3300025942 Bacteria 929
362 Ga0207661_10045715 3300025944 Bacteria 3467
363 Ga0207661_10053665 3300025944 Bacteria 3226
364 Ga0207661_10098379 3300025944 Bacteria 2452
365 Ga0207661_10248229 3300025944 Bacteria 1581
366 Ga0207661_10335614 3300025944 Bacteria 1361
367 Ga0207661_10548559 3300025944 Bacteria 1059
368 Ga0207661_10871099 3300025944 Bacteria 829
369 Ga0207661_12006947 3300025944 Bacteria 524
370 Ga0207679_10735407 3300025945 Bacteria 897
371 Ga0207679_10896251 3300025945 Bacteria 811
372 Ga0207679_11230685 3300025945 Bacteria 687
373 Ga0207712_10312349 3300025961 Bacteria 1294
374 Ga0207712_10561724 3300025961 Bacteria 983
375 Ga0207668_10360294 3300025972 Bacteria 1218
376 Ga0207668_10836635 3300025972 Bacteria 816
377 Ga0207668_10976807 3300025972 Bacteria 756
378 Ga0207640_10187977 3300025981 Bacteria 1554
379 Ga0207640_10422175 3300025981 Bacteria 1092
380 Ga0207640_10603786 3300025981 Bacteria 929
381 Ga0207640_10848514 3300025981 Bacteria 795
382 Ga0207640_11183267 3300025981 Unclassified 679
383 Ga0207677_10086851 3300026023 Bacteria 2263
384 Ga0207677_10590170 3300026023 Unclassified 974
385 Ga0207677_11200098 3300026023 Bacteria 694
386 Ga0207703_10180352 3300026035 Bacteria 1863
387 Ga0207703_10382988 3300026035 Bacteria 1301
388 Ga0207703_10505497 3300026035 Bacteria 1135
389 Ga0207703_10728730 3300026035 Bacteria 944
390 Ga0207703_11462963 3300026035 Bacteria 657
391 Ga0207639_10273731 3300026041 Bacteria 1482
392 Ga0207639_11347431 3300026041 Bacteria 670
393 Ga0207678_10181200 3300026067 Bacteria 1799
394 Ga0207678_10220954 3300026067 Bacteria 1622
395 Ga0207678_10266665 3300026067 Bacteria 1468
396 Ga0207678_10306085 3300026067 Bacteria 1366
397 Ga0207678_10433415 3300026067 Bacteria 1141
398 Ga0207678_10788772 3300026067 Bacteria 838
399 Ga0207708_10003129 3300026075 Bacteria 12181
400 Ga0207708_10216848 3300026075 Bacteria 1532
401 Ga0207708_10765864 3300026075 Bacteria 829
402 Ga0207708_10986028 3300026075 Bacteria 732
403 Ga0207708_11014272 3300026075 Bacteria 721
404 Ga0207702_10023957 3300026078 Bacteria 5065
405 Ga0207702_11179177 3300026078 Unclassified 760
406 Ga0207702_11491755 3300026078 Bacteria 670
407 Ga0207641_10611589 3300026088 Bacteria 1068
408 Ga0207641_10904218 3300026088 Bacteria 877
409 Ga0207641_11142855 3300026088 Bacteria 778
410 Ga0207648_10190212 3300026089 Bacteria 1818
411 Ga0207648_10367361 3300026089 Bacteria 1299
412 Ga0207648_10408991 3300026089 Bacteria 1230
413 Ga0207648_10911298 3300026089 Bacteria 821
414 Ga0207648_11407595 3300026089 Bacteria 655
415 Ga0207676_10100175 3300026095 Bacteria 2400
416 Ga0207676_11183938 3300026095 Bacteria 757
417 Ga0207674_10362681 3300026116 Bacteria 1400
418 Ga0207674_10540250 3300026116 Bacteria 1126
419 Ga0207675_100022121 3300026118 Bacteria 5919
420 Ga0207675_100067353 3300026118 Bacteria 3347
421 Ga0207675_100426657 3300026118 Bacteria 1310
422 Ga0207675_100901054 3300026118 Bacteria 901
423 Ga0207683_10077799 3300026121 Bacteria 2938
424 Ga0207683_11267221 3300026121 Bacteria 683
425 Ga0207683_11406880 3300026121 Bacteria 645
426 Ga0207698_10379276 3300026142 Bacteria 1345
427 Ga0207698_11012984 3300026142 Bacteria 842
428 Ga0207698_11068320 3300026142 Unclassified 819
429 Ga0209998_10057568 3300027717 Bacteria 910
430 Ga0209974_10472213 3300027876 Bacteria 500
431 Ga0207428_10041298 3300027907 Bacteria 3735
432 Ga0207428_10207355 3300027907 Bacteria 1474
433 Ga0207428_10314759 3300027907 Bacteria 1157
434 Ga0268265_10198653 3300028380 Bacteria 1738
435 Ga0268265_10424079 3300028380 Bacteria 1236
436 Ga0268265_11571951 3300028380 Bacteria 662
437 Ga0268264_10948347 3300028381 Bacteria 865
438 Ga0265338_10041520 3300028800 Bacteria 4300
439 Ga0265760_10063686 3300031090 Bacteria 1123
440 Ga0265327_10111064 3300031251 Bacteria 1310
441 Ga0307408_100059584 3300031548 Bacteria 2779
442 Ga0307408_102247575 3300031548 Bacteria 528
443 Ga0307516_10002256 3300031730 Bacteria 26004
444 Ga0307405_10021930 3300031731 Bacteria 3601
445 Ga0307405_10031980 3300031731 Bacteria 3104
446 Ga0307405_10332989 3300031731 Bacteria 1164
447 Ga0307405_11025780 3300031731 Bacteria 705
448 Ga0307413_10041518 3300031824 Bacteria 2694
449 Ga0307413_10537104 3300031824 Bacteria 946
450 Ga0307413_10785686 3300031824 Bacteria 799
451 Ga0307413_11454009 3300031824 Bacteria 604
452 Ga0307410_10045594 3300031852 Bacteria 2920
453 Ga0307410_10372875 3300031852 Bacteria 1146
454 Ga0307410_12131334 3300031852 Bacteria 502
455 Ga0326468_10028937 3300031889 Bacteria 720
456 Ga0326468_10104625 3300031889 Bacteria 527
457 Ga0307406_10086271 3300031901 Bacteria 2101
458 Ga0307406_10117270 3300031901 Bacteria 1844
459 Ga0307406_10572397 3300031901 Bacteria 927
460 Ga0307406_10888887 3300031901 Bacteria 758
461 Ga0307406_11015202 3300031901 Bacteria 712
462 Ga0307406_11472946 3300031901 Bacteria 598
463 Ga0307406_11570932 3300031901 Bacteria 580
464 Ga0307406_12028759 3300031901 Bacteria 514
465 Ga0307407_10319637 3300031903 Bacteria 1089
466 Ga0307407_10554430 3300031903 Bacteria 850
467 Ga0307407_11292726 3300031903 Bacteria 572
468 Ga0307412_10015659 3300031911 Bacteria 4501
469 Ga0307409_100010481 3300031995 Bacteria 5768
470 Ga0307409_100289624 3300031995 Bacteria 1518
471 Ga0307409_100409576 3300031995 Bacteria 1297
472 Ga0307409_101939195 3300031995 Bacteria 618
473 Ga0307409_102213745 3300031995 Bacteria 579
474 Ga0307416_100091949 3300032002 Bacteria 2607
475 Ga0307416_100259254 3300032002 Bacteria 1698
476 Ga0307416_100412124 3300032002 Bacteria 1392
477 Ga0307416_100474025 3300032002 Bacteria 1310
478 Ga0307416_101069416 3300032002 Bacteria 911
479 Ga0307416_101113540 3300032002 Bacteria 894
480 Ga0307416_101211040 3300032002 Bacteria 861
481 Ga0307416_102615881 3300032002 Bacteria 602
482 Ga0307414_10032571 3300032004 Bacteria 3434
483 Ga0307414_12027535 3300032004 Bacteria 537
484 Ga0307414_12110678 3300032004 Bacteria 526
485 Ga0307411_10091701 3300032005 Bacteria 2123
486 Ga0307411_10325246 3300032005 Bacteria 1243
487 Ga0307411_11991280 3300032005 Bacteria 542
488 Ga0307415_100003903 3300032126 Bacteria 7662
489 Ga0307415_100013966 3300032126 Bacteria 4704
490 Ga0307415_100019768 3300032126 Bacteria 4096
491 Ga0307415_100160966 3300032126 Bacteria 1740
492 Ga0307415_100816966 3300032126 Bacteria 852
493 Ga0307415_100855531 3300032126 Bacteria 835
494 Ga0307415_101217444 3300032126 Bacteria 710
495 Ga0373949_0033525 3300035090 Bacteria 1234
496 Ga0373923_0142175 3300035111 Unclassified 1085
497 Ga0373941_0002756 3300035115 Bacteria 3901
498 Ga0373960_0006492 3300035121 Bacteria 2746
499 Ga0373962_0032887 3300035242 Bacteria 1429
500 Ga0373931_0212039 3300035691 Bacteria 1162
501 Ga0395900_0014319 3300037418 Bacteria 8097
502 Ga0395900_0218819 3300037418 Bacteria 1921
503 Ga0395900_1299607 3300037418 Bacteria 641
504 Ga0395900_1320965 3300037418 Bacteria 635
505 Ga0395900_1489433 3300037418 Bacteria 589
506 Ga0395900_1588082 3300037418 Unclassified 566
507 Ga0395898_0164200 3300037466 Bacteria 2124
508 Ga0395898_0266121 3300037466 Bacteria 1635
509 Ga0395898_0306574 3300037466 Bacteria 1515
510 Ga0395898_1298679 3300037466 Bacteria 657
511 Ga0395898_1464395 3300037466 Bacteria 609
512 Ga0395905_0013964 3300037471 Bacteria 7682
513 Ga0395905_0566093 3300037471 Bacteria 1038
514 Ga0395901_0010606 3300038443 Bacteria 9334
515 Ga0395901_0055093 3300038443 Bacteria 4134
516 Ga0395901_0200294 3300038443 Bacteria 2093
517 Ga0395901_0784724 3300038443 Bacteria 943
518 Ga0395901_0943677 3300038443 Bacteria 842
519 Ga0395901_1525822 3300038443 Bacteria 623
520 Ga0395901_1743716 3300038443 Bacteria 573
521 Ga0436360_0286471 3300039438 Bacteria 522
522 Ga0436363_0868929 3300039450 Bacteria 959
523 Ga0436363_1403311 3300039450 Bacteria 535
524 Ga0439453_0101691 3300041408 Bacteria 641
525 Ga0451789_0740838 3300041443 Unclassified 549
526 Ga0451797_1067062 3300041453 Bacteria 550
527 Ga0451802_0735710 3300041460 Bacteria 926
528 Ga0451802_1266157 3300041460 Bacteria 687
529 Ga0451847_0113160 3300041503 Bacteria 527
530 Ga0451855_0707975 3300041511 Bacteria 586
531 Ga0451855_1197243 3300041511 Bacteria 579
532 Ga0451855_1394352 3300041511 Bacteria 743
533 Ga0439448_0137271 3300042005 Bacteria 845
534 Ga0439448_0326166 3300042005 Bacteria 546
535 Ga0439450_017523 3300042008 Bacteria 1494
536 Ga0439454_011647 3300042011 Bacteria 1179
537 Ga0439456_142608 3300042013 Bacteria 556
538 Ga0439463_133979 3300042016 Bacteria 641
539 Ga0450902_006060 3300042137 Bacteria 1844
540 Ga0439458_0031983 3300042157 Bacteria 1256
541 Ga0439444_0052872 3300042437 Bacteria 830
542 Ga0439459_0104365 3300042438 Bacteria 697
543 Ga0439464_0036643 3300042439 Bacteria 1388
544 Ga0439460_0021737 3300042461 Bacteria 1756
545 Ga0439440_0039689 3300042993 Bacteria 1143
546 Ga0466969_0020586 3300044656 Bacteria 3415
547 Ga0466965_0273961 3300044683 Bacteria 910
548 Ga0466965_0300487 3300044683 Bacteria 871
549 Ga0466965_0547023 3300044683 Bacteria 653
550 Ga0466961_0084739 3300044693 Bacteria 2004
551 Ga0466961_0327749 3300044693 Bacteria 933
552 Ga0466963_0080716 3300044694 Bacteria 2202
553 Ga0466963_0118022 3300044694 Bacteria 1824
554 Ga0466963_0219460 3300044694 Bacteria 1331
555 Ga0466963_0285048 3300044694 Bacteria 1161
556 Ga0466963_0572240 3300044694 Bacteria 798
557 Ga0466963_0669509 3300044694 Bacteria 732
558 Ga0466963_0787822 3300044694 Bacteria 670
559 Ga0466964_0455268 3300044706 Bacteria 679
560 Ga0466964_0814817 3300044706 Bacteria 529
561 Ga0466964_0836810 3300044706 Bacteria 522
562 Ga0466971_0190928 3300044719 Bacteria 965
563 Ga0466968_0101102 3300044735 Bacteria 1287
564 Ga0466970_0018283 3300044765 Bacteria 3627
565 Ga0466970_0498190 3300044765 Bacteria 701
566 Ga0466970_0583917 3300044765 Bacteria 647
567 Ga0466957_0099531 3300044842 Bacteria 1831
568 Ga0466957_0152829 3300044842 Bacteria 1494
569 Ga0466957_0326551 3300044842 Bacteria 1036
570 Ga0466957_0517888 3300044842 Bacteria 828
571 Ga0466960_0012800 3300044901 Bacteria 3550
572 Ga0466960_0052851 3300044901 Bacteria 1967
573 Ga0466960_0140337 3300044901 Bacteria 1283
574 Ga0466960_0362378 3300044901 Bacteria 829
575 Ga0466960_0417554 3300044901 Bacteria 775
576 Ga0466959_0323740 3300045049 Bacteria 1053
577 Ga0451576_1427861 3300045051 Bacteria 720
578 Ga0466958_0003325 3300045836 Bacteria 8330
579 Ga0466958_0281926 3300045836 Bacteria 1065
580 Ga0466958_0615641 3300045836 Bacteria 706
581 Ga0466958_0969358 3300045836 Bacteria 555
582 Ga0466967_0001485 3300045976 Bacteria 13680
583 Ga0466967_0597137 3300045976 Bacteria 1089
584 Ga0466967_0758099 3300045976 Bacteria 963
585 Ga0466967_0930526 3300045976 Bacteria 865
586 Ga0466967_0961364 3300045976 Bacteria 850
587 Ga0466967_1588685 3300045976 Bacteria 651
588 Ga0495651_0129484 3300046462 Bacteria 1844
589 Ga0495653_0000374 3300046463 Bacteria 36082
590 Ga0495653_0336136 3300046463 Bacteria 975
591 Ga0495653_0447033 3300046463 Bacteria 814
592 Ga0495582_0468296 3300046473 Unclassified 728
593 Ga0495582_0935658 3300046473 Bacteria 501
594 Ga0495664_0000007 3300046477 Bacteria 386710
595 Ga0495585_0337189 3300046492 Bacteria 735
596 Ga0495596_0071425 3300046500 Bacteria 1348
597 Ga0495596_0135506 3300046500 Bacteria 956
598 Ga0495618_0000151 3300046514 Bacteria 49582
599 Ga0495631_0297669 3300046518 Bacteria 687
600 Ga0495643_0140308 3300046522 Bacteria 1206
601 Ga0495666_0216105 3300046526 Bacteria 879
602 Ga0495652_0337070 3300046529 Bacteria 1085
603 Ga0495645_0000120 3300046543 Bacteria 53145
604 Ga0495656_0094648 3300046615 Bacteria 1372
605 Ga0495656_0633023 3300046615 Bacteria 574
606 Ga0495646_0053387 3300046680 Bacteria 2437
607 Ga0495671_0495088 3300046692 Bacteria 583
608 Ga0495589_0379237 3300046794 Bacteria 650
609 Ga0495600_0014182 3300046809 Bacteria 5020
610 Ga0495660_0227447 3300046810 Bacteria 876
611 Ga0495604_0000047 3300047317 Bacteria 109717
612 Ga0495674_0479420 3300047319 Bacteria 997
613 Ga0496102_0000002 3300048905 Bacteria 814588
614 Ga0496102_0570186 3300048905 Bacteria 1055
615 Ga0496102_0998028 3300048905 Unclassified 758
616 Ga0496102_1073363 3300048905 Bacteria 725
617 Ga0496103_0000046 3300048906 Bacteria 161981
618 Ga0496103_0552734 3300048906 Unclassified 735
619 Ga0496103_0577476 3300048906 Bacteria 717
620 Ga0496104_0000001 3300048907 Bacteria 711867
621 Ga0496104_0964511 3300048907 Unclassified 757
622 Ga0496105_0500662 3300048908 Bacteria 954
623 Ga0496105_0714456 3300048908 Bacteria 768
624 Ga0496106_0028641 3300048909 Bacteria 4149
625 Ga0496107_0435605 3300048910 Bacteria 974
626 Ga0496107_0626680 3300048910 Unclassified 794
627 Ga0496108_0207117 3300048911 Bacteria 1702
628 Ga0496109_0611538 3300048912 Bacteria 1026
629 Ga0496109_1374644 3300048912 Bacteria 642
630 Ga0496109_1493353 3300048912 Bacteria 611
631 Ga0496110_0000502 3300048913 Bacteria 26572
632 Ga0496110_0129733 3300048913 Bacteria 2276
633 Ga0496110_0325894 3300048913 Unclassified 1399
634 Ga0496110_0637141 3300048913 Bacteria 965
635 Ga0496110_0638969 3300048913 Bacteria 964
636 Ga0496111_0001359 3300048914 Bacteria 13843
637 Ga0496111_0192543 3300048914 Unclassified 1516
638 Ga0496111_0396329 3300048914 Bacteria 1020
639 Ga0496111_1121617 3300048914 Bacteria 560
640 Ga0496112_0241655 3300048915 Unclassified 1758
641 Ga0496112_0393554 3300048915 Bacteria 1326
642 Ga0496112_0482570 3300048915 Bacteria 1176
643 Ga0496112_1050299 3300048915 Bacteria 733
644 Ga0496113_0151843 3300048916 Bacteria 1828
645 Ga0496113_0402604 3300048916 Bacteria 1099
646 Ga0496113_0553521 3300048916 Bacteria 923
647 Ga0496113_1291478 3300048916 Unclassified 568
648 Ga0496114_0904629 3300048917 Bacteria 764
649 Ga0501309_099427 3300049129 Bacteria 503
650 Ga0501317_083770 3300049533 Bacteria 555
651 Ga0501325_033358 3300049541 Bacteria 599
652 Ga0501031_0093232 3300049568 Bacteria 1965
653 Ga0501031_0962906 3300049568 Bacteria 546
654 Ga0501032_0404931 3300049569 Unclassified 876
655 Ga0501034_0766087 3300049571 Bacteria 860
656 Ga0501034_0852039 3300049571 Bacteria 801
657 Ga0501036_0036303 3300049572 Bacteria 4170
658 Ga0501036_0123223 3300049572 Bacteria 2189
659 Ga0501037_0331041 3300049573 Bacteria 1053
660 Ga0501038_0229351 3300049574 Bacteria 1478
661 Ga0501038_0259070 3300049574 Bacteria 1375
662 Ga0501039_0233964 3300049575 Bacteria 1444
663 Ga0501039_0838932 3300049575 Bacteria 716
664 Ga0501040_0034135 3300049576 Bacteria 3447
665 Ga0501040_0156985 3300049576 Bacteria 1607
666 Ga0501041_0095986 3300049577 Bacteria 1832
667 Ga0501042_0055833 3300049578 Bacteria 2818
668 Ga0501042_0288431 3300049578 Bacteria 1185
669 Ga0501042_0377660 3300049578 Bacteria 1026
670 Ga0501043_0546316 3300049579 Bacteria 861
671 Ga0501046_0112761 3300049580 Bacteria 2076
672 Ga0501046_0311722 3300049580 Bacteria 1148
673 Ga0501047_0087714 3300049581 Bacteria 2989
674 Ga0501048_0094394 3300049582 Bacteria 2110
675 Ga0501069_0096734 3300049585 Bacteria 1673
676 Ga0501070_0971405 3300049586 Bacteria 660
677 Ga0501071_0110609 3300049587 Bacteria 2030
678 Ga0501071_0565794 3300049587 Bacteria 873
679 Ga0501072_0021253 3300049588 Bacteria 5034
680 Ga0501073_0056140 3300049589 Bacteria 2755
681 Ga0501073_0150386 3300049589 Bacteria 1614
682 Ga0501075_0020369 3300049591 Bacteria 4824
683 Ga0501075_0280308 3300049591 Bacteria 1270
684 Ga0501075_0739160 3300049591 Bacteria 749
685 Ga0501075_1268219 3300049591 Bacteria 559
686 Ga0501076_0010634 3300049592 Bacteria 6835
687 Ga0501076_0147035 3300049592 Bacteria 1916
688 Ga0501076_1569208 3300049592 Bacteria 540
689 Ga0501077_0214411 3300049593 Bacteria 1223
690 Ga0501077_0245454 3300049593 Bacteria 1138
691 Ga0501214_055151 3300049659 Bacteria 614
692 Ga0501248_055261 3300049678 Bacteria 519
693 Ga0501257_242522 3300049686 Bacteria 532
694 Ga0501079_0383792 3300049741 Bacteria 1101
695 Ga0501080_0090637 3300049742 Bacteria 2840
696 Ga0501080_0188330 3300049742 Bacteria 1897
697 Ga0501081_0228531 3300049743 Bacteria 1354
698 Ga0501044_0340475 3300049823 Bacteria 1421
699 Ga0501045_0054022 3300049824 Bacteria 2936
700 nmdc:mga0yw44_731075_c1 3300050492 Bacteria 672
701 nmdc:mga06z11_507970_c1 3300050494 Bacteria 730
702 nmdc:mga05p37_1295495_c1 3300050507 Bacteria 743
703 nmdc:mga05p37_1452584_c1 3300050507 Bacteria 686
704 nmdc:mga05p37_1570519_c1 3300050507 Unclassified 650
705 nmdc:mga05p37_837445_c1 3300050507 Bacteria 1001
706 nmdc:mga09592_485899_c1 3300050508 Bacteria 1064
707 nmdc:mga06r32_1650031_c1 3300050510 Bacteria 579
708 nmdc:mga06r32_711765_c1 3300050510 Bacteria 969
709 nmdc:mga08y16_1189065_c1 3300050511 Bacteria 734
710 nmdc:mga08y16_757993_c1 3300050511 Bacteria 966
711 nmdc:mga08y16_7698_c1 3300050511 Bacteria 11276
712 nmdc:mga08y16_92808_c1 3300050511 Bacteria 3146
713 nmdc:mga0n895_177896_c1 3300050512 Bacteria 2158
714 nmdc:mga0n895_964546_c1 3300050512 Bacteria 835
715 nmdc:mga0a205_117439_c1 3300050515 Bacteria 2558
716 Ga0495601_0000276 3300053077 Bacteria 27580
717 Ga0495601_0158159 3300053077 Bacteria 1480
718 Ga0495601_0563100 3300053077 Bacteria 733
719 Ga0495655_0098630 3300053083 Bacteria 862
720 Ga0495619_0338284 3300053085 Bacteria 1042
721 Ga0495619_0777727 3300053085 Bacteria 648
722 Ga0500641_0052809 3300053096 Bacteria 1676
723 Ga0500568_0301496 3300053139 Bacteria 581
724 Ga0500588_0170648 3300053146 Bacteria 796
725 Ga0500616_0028502 3300053153 Bacteria 3076
726 Ga0500616_0140914 3300053153 Bacteria 1127
727 Ga0501084_0213629 3300054114 Bacteria 1627
728 Ga0501084_0413942 3300054114 Bacteria 1139
729 Ga0590074_037814 3300059423 Bacteria 864
730 Ga0590075_081173 3300059424 Bacteria 840
731 Ga0590077_100746 3300059426 Bacteria 675
732 Ga0587084_024069 3300059477 Bacteria 934
733 Ga0587066_060200 3300059490 Bacteria 773
734 Ga0587077_199073 3300059493 Bacteria 553
735 Ga0587083_0249767 3300059505 Bacteria 528
736 Ga0587085_152834 3300059506 Bacteria 534
737 Ga0587086_043705 3300059507 Unclassified 702
738 Ga0587088_085875 3300059508 Bacteria 681
739 Ga0587089_047579 3300059509 Bacteria 680
740 Ga0587090_132098 3300059510 Bacteria 551
741 Ga0587092_159306 3300059512 Bacteria 509
742 Ga0587098_096980 3300059604 Bacteria 510
743 Ga0587101_131912 3300059623 Bacteria 526
744 Ga0587109_143673 3300059624 Bacteria 584
745 Ga0587122_057948 3300059628 Bacteria 515
746 Ga0587062_135677 3300059639 Bacteria 510
747 Ga0587067_059360 3300059640 Bacteria 797
748 Ga0587068_104264 3300059641 Bacteria 599
749 Ga0587072_200117 3300059643 Bacteria 507
750 Ga0587075_092588 3300059644 Bacteria 593
751 Ga0587076_156299 3300059645 Bacteria 557
752 Ga0587076_210042 3300059645 Bacteria 505
753 Ga0587078_039671 3300059646 Bacteria 662
754 Ga0587079_152488 3300059647 Bacteria 598
755 Ga0587107_127851 3300059652 Bacteria 531
756 Ga0587110_069221 3300059654 Bacteria 500
757 Ga0587124_049839 3300059660 Bacteria 508
758 Ga0587071_104109 3300060344 Bacteria 660
759 Ga0466962_0097870 3300061719 Bacteria 1408
760 Ga0466962_0484546 3300061719 Bacteria 625
761 Ga0530510_0135422 3300061734 Bacteria 1813
762 Ga0530510_1244617 3300061734 Bacteria 571

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_12709653 Ga0163162_127096531 61
2 3300007788 Ga0099795_10214645 Ga0099795_102146451 62
3 3300010159 Ga0099796_10042774 Ga0099796_100427742 62
4 3300031730 Ga0307516_10002256 Ga0307516_1000225615 62
5 3300005578 Ga0068854_100629876 Ga0068854_1006298761 67
6 3300005615 Ga0070702_100635650 Ga0070702_1006356502 67
7 3300025981 Ga0207640_10422175 Ga0207640_104221753 67
8 3300053096 Ga0500641_0052809 Ga0500641_0052809_1397_1615 67
9 3300053153 Ga0500616_0028502 Ga0500616_0028502_1250_1459 67
10 3300026075 Ga0207708_10986028 Ga0207708_109860282 68
11 3300027907 Ga0207428_10207355 Ga0207428_102073552 68
12 3300035090 Ga0373949_0033525 Ga0373949_0033525_574_801 68
13 3300035121 Ga0373960_0006492 Ga0373960_0006492_2382_2609 68
14 3300035242 Ga0373962_0032887 Ga0373962_0032887_278_505 68
15 3300035691 Ga0373931_0212039 Ga0373931_0212039_176_403 68
16 3300046500 Ga0495596_0071425 Ga0495596_0071425_260_487 68
17 3300046692 Ga0495671_0495088 Ga0495671_0495088_206_433 68
18 3300046810 Ga0495660_0227447 Ga0495660_0227447_302_529 68
19 3300050507 nmdc:mga05p37_1452584_c1 nmdc:mga05p37_1452584_c1_355_582 68
20 3300050511 nmdc:mga08y16_92808_c1 nmdc:mga08y16_92808_c1_1353_1580 68
21 3300050512 nmdc:mga0n895_177896_c1 nmdc:mga0n895_177896_c1_1084_1311 68
22 3300050515 nmdc:mga0a205_117439_c1 nmdc:mga0a205_117439_c1_445_672 68
23 3300053083 Ga0495655_0098630 Ga0495655_0098630_603_830 68
24 3300041443 Ga0451789_0740838 Ga0451789_0740838_163_441 69
25 3300005546 Ga0070696_101247866 Ga0070696_1012478661 70
26 3300005547 Ga0070693_100744291 Ga0070693_1007442912 70
27 3300005563 Ga0068855_102123524 Ga0068855_1021235242 70
28 3300005615 Ga0070702_100250424 Ga0070702_1002504242 70
29 3300005981 Ga0081538_10000450 Ga0081538_100004509 70
30 3300009148 Ga0105243_10586263 Ga0105243_105862632 70
31 3300013297 Ga0157378_11370853 Ga0157378_113708531 70
32 3300006051 Ga0075364_10656810 Ga0075364_106568101 71
33 3300044706 Ga0466964_0836810 Ga0466964_0836810_99_323 71
34 3300049580 Ga0501046_0311722 Ga0501046_0311722_104_328 71
35 3300049581 Ga0501047_0087714 Ga0501047_0087714_1217_1441 71
36 3300049589 Ga0501073_0056140 Ga0501073_0056140_1355_1579 71
37 3300049742 Ga0501080_0090637 Ga0501080_0090637_2018_2242 71
38 3300005338 Ga0068868_100122964 Ga0068868_1001229642 72
39 3300005347 Ga0070668_101671656 Ga0070668_1016716561 72
40 3300005578 Ga0068854_100372107 Ga0068854_1003721072 72
41 3300005614 Ga0068856_100579196 Ga0068856_1005791962 72
42 3300005616 Ga0068852_101410145 Ga0068852_1014101452 72
43 3300011119 Ga0105246_10473626 Ga0105246_104736262 72
44 3300013102 Ga0157371_10627480 Ga0157371_106274802 72
45 3300025981 Ga0207640_11183267 Ga0207640_111832672 72
46 3300026023 Ga0207677_10590170 Ga0207677_105901702 72
47 3300026078 Ga0207702_11179177 Ga0207702_111791772 72
48 3300026142 Ga0207698_11068320 Ga0207698_110683202 72
49 3300048905 Ga0496102_0998028 Ga0496102_0998028_83_310 72
50 3300048906 Ga0496103_0552734 Ga0496103_0552734_230_457 72
51 3300048907 Ga0496104_0964511 Ga0496104_0964511_116_343 72
52 3300048910 Ga0496107_0626680 Ga0496107_0626680_184_411 72
53 3300048913 Ga0496110_0325894 Ga0496110_0325894_688_915 72
54 3300048914 Ga0496111_0192543 Ga0496111_0192543_1248_1475 72
55 3300048915 Ga0496112_0241655 Ga0496112_0241655_1143_1370 72
56 3300048916 Ga0496113_1291478 Ga0496113_1291478_279_506 72
57 3300050507 nmdc:mga05p37_1570519_c1 nmdc:mga05p37_1570519_c1_29_295 72
58 3300005981 Ga0081538_10014284 Ga0081538_100142845 73
59 3300014325 Ga0163163_11647475 Ga0163163_116474752 73
60 3300037418 Ga0395900_1299607 Ga0395900_1299607_46_270 73
61 3300048915 Ga0496112_1050299 Ga0496112_1050299_315_539 73
62 3300005535 Ga0070684_100992794 Ga0070684_1009927942 74
63 3300005536 Ga0070697_100287310 Ga0070697_1002873101 74
64 3300005545 Ga0070695_101251173 Ga0070695_1012511732 74
65 3300005546 Ga0070696_100947156 Ga0070696_1009471562 74
66 3300005549 Ga0070704_100208246 Ga0070704_1002082461 74
67 3300005981 Ga0081538_10175864 Ga0081538_101758642 74
68 3300020081 Ga0206354_11439709 Ga0206354_114397092 74
69 3300020082 Ga0206353_10667699 Ga0206353_106676992 74
70 3300022467 Ga0224712_10260989 Ga0224712_102609891 74
71 3300025913 Ga0207695_10536383 Ga0207695_105363832 74
72 3300025935 Ga0207709_11705293 Ga0207709_117052931 74
73 3300037418 Ga0395900_1588082 Ga0395900_1588082_275_502 74
74 3300037471 Ga0395905_0566093 Ga0395905_0566093_508_735 74
75 3300038443 Ga0395901_0943677 Ga0395901_0943677_375_602 74
76 3300046473 Ga0495582_0468296 Ga0495582_0468296_132_365 74
77 3300046526 Ga0495666_0216105 Ga0495666_0216105_573_806 74
78 3300046529 Ga0495652_0337070 Ga0495652_0337070_279_512 74
79 3300005353 Ga0070669_100001369 Ga0070669_10000136920 75
80 3300005366 Ga0070659_100000163 Ga0070659_10000016313 75
81 3300005435 Ga0070714_100000038 Ga0070714_1000000388 75
82 3300005455 Ga0070663_100823825 Ga0070663_1008238251 75
83 3300011119 Ga0105246_10006461 Ga0105246_100064618 75
84 3300012506 Ga0157324_1026337 Ga0157324_10263372 75
85 3300014325 Ga0163163_11096261 Ga0163163_110962612 75
86 3300014745 Ga0157377_10825133 Ga0157377_108251332 75
87 3300025919 Ga0207657_11399063 Ga0207657_113990631 75
88 3300025923 Ga0207681_10001085 Ga0207681_100010856 75
89 3300025929 Ga0207664_10000040 Ga0207664_1000004047 75
90 3300025932 Ga0207690_10000166 Ga0207690_1000016645 75
91 3300025944 Ga0207661_10053665 Ga0207661_100536654 75
92 3300025944 Ga0207661_10335614 Ga0207661_103356144 75
93 3300026067 Ga0207678_10266665 Ga0207678_102666653 75
94 3300027717 Ga0209998_10057568 Ga0209998_100575681 75
95 3300028800 Ga0265338_10041520 Ga0265338_100415201 75
96 3300031251 Ga0265327_10111064 Ga0265327_101110641 75
97 3300037466 Ga0395898_0306574 Ga0395898_0306574_169_399 75
98 3300038443 Ga0395901_0055093 Ga0395901_0055093_2907_3137 75
99 3300046680 Ga0495646_0053387 Ga0495646_0053387_1132_1371 75
100 3300047317 Ga0495604_0000047 Ga0495604_0000047_50976_51215 75
101 3300053085 Ga0495619_0777727 Ga0495619_0777727_307_543 75
102 3300005339 Ga0070660_100448104 Ga0070660_1004481043 76
103 3300005340 Ga0070689_100628077 Ga0070689_1006280772 76
104 3300005343 Ga0070687_101102819 Ga0070687_1011028191 76
105 3300005344 Ga0070661_100461682 Ga0070661_1004616823 76
106 3300005347 Ga0070668_100386819 Ga0070668_1003868192 76
107 3300005356 Ga0070674_100977734 Ga0070674_1009777341 76
108 3300005364 Ga0070673_101239063 Ga0070673_1012390631 76
109 3300005364 Ga0070673_101692159 Ga0070673_1016921591 76
110 3300005366 Ga0070659_101071500 Ga0070659_1010715002 76
111 3300005438 Ga0070701_10683188 Ga0070701_106831881 76
112 3300005466 Ga0070685_11056158 Ga0070685_110561582 76
113 3300005539 Ga0068853_101341377 Ga0068853_1013413772 76
114 3300005543 Ga0070672_101133816 Ga0070672_1011338162 76
115 3300005564 Ga0070664_102082199 Ga0070664_1020821992 76
116 3300005577 Ga0068857_100302818 Ga0068857_1003028182 76
117 3300005615 Ga0070702_100388494 Ga0070702_1003884941 76
118 3300005616 Ga0068852_100616329 Ga0068852_1006163291 76
119 3300005618 Ga0068864_100047501 Ga0068864_1000475012 76
120 3300005719 Ga0068861_100632189 Ga0068861_1006321892 76
121 3300005840 Ga0068870_10423617 Ga0068870_104236173 76
122 3300005842 Ga0068858_100598301 Ga0068858_1005983013 76
123 3300005844 Ga0068862_100395023 Ga0068862_1003950232 76
124 3300006048 Ga0075363_100928076 Ga0075363_1009280761 76
125 3300009101 Ga0105247_10568427 Ga0105247_105684272 76
126 3300009148 Ga0105243_10467247 Ga0105243_104672473 76
127 3300009551 Ga0105238_10453936 Ga0105238_104539364 76
128 3300010375 Ga0105239_10147091 Ga0105239_101470913 76
129 3300013102 Ga0157371_10622174 Ga0157371_106221742 76
130 3300013308 Ga0157375_12493461 Ga0157375_124934611 76
131 3300014326 Ga0157380_10649427 Ga0157380_106494271 76
132 3300014969 Ga0157376_10806838 Ga0157376_108068382 76
133 3300017792 Ga0163161_12017680 Ga0163161_120176801 76
134 3300020070 Ga0206356_11473832 Ga0206356_114738327 76
135 3300025302 Ga0207426_1043161 Ga0207426_10431612 76
136 3300025321 Ga0207656_10532980 Ga0207656_105329801 76
137 3300025898 Ga0207692_10070795 Ga0207692_100707953 76
138 3300025904 Ga0207647_10531364 Ga0207647_105313641 76
139 3300025908 Ga0207643_10130821 Ga0207643_101308214 76
140 3300025919 Ga0207657_10123988 Ga0207657_101239882 76
141 3300025927 Ga0207687_10060950 Ga0207687_100609503 76
142 3300025935 Ga0207709_10079912 Ga0207709_100799123 76
143 3300025937 Ga0207669_10371662 Ga0207669_103716622 76
144 3300025940 Ga0207691_10167510 Ga0207691_101675103 76
145 3300025941 Ga0207711_11016862 Ga0207711_110168623 76
146 3300025972 Ga0207668_10836635 Ga0207668_108366352 76
147 3300025981 Ga0207640_10187977 Ga0207640_101879773 76
148 3300026035 Ga0207703_11462963 Ga0207703_114629632 76
149 3300026067 Ga0207678_10788772 Ga0207678_107887721 76
150 3300026075 Ga0207708_10216848 Ga0207708_102168483 76
151 3300026089 Ga0207648_10367361 Ga0207648_103673613 76
152 3300026095 Ga0207676_10100175 Ga0207676_101001754 76
153 3300026116 Ga0207674_10540250 Ga0207674_105402502 76
154 3300026142 Ga0207698_10379276 Ga0207698_103792761 76
155 3300028380 Ga0268265_10198653 Ga0268265_101986532 76
156 3300032004 Ga0307414_12027535 Ga0307414_120275352 76
157 3300032126 Ga0307415_101217444 Ga0307415_1012174441 76
158 3300037418 Ga0395900_0014319 Ga0395900_0014319_5365_5601 76
159 3300037418 Ga0395900_1320965 Ga0395900_1320965_71_301 76
160 3300037466 Ga0395898_1464395 Ga0395898_1464395_84_320 76
161 3300037471 Ga0395905_0013964 Ga0395905_0013964_4082_4318 76
162 3300038443 Ga0395901_0010606 Ga0395901_0010606_8929_9165 76
163 3300044694 Ga0466963_0285048 Ga0466963_0285048_404_649 76
164 3300044842 Ga0466957_0326551 Ga0466957_0326551_693_923 76
165 3300044901 Ga0466960_0012800 Ga0466960_0012800_1008_1247 76
166 3300044901 Ga0466960_0052851 Ga0466960_0052851_1399_1638 76
167 3300045836 Ga0466958_0969358 Ga0466958_0969358_201_431 76
168 3300045976 Ga0466967_0597137 Ga0466967_0597137_109_354 76
169 3300045976 Ga0466967_0961364 Ga0466967_0961364_93_323 76
170 3300045976 Ga0466967_1588685 Ga0466967_1588685_285_515 76
171 3300046462 Ga0495651_0129484 Ga0495651_0129484_1530_1769 76
172 3300046463 Ga0495653_0000374 Ga0495653_0000374_31141_31380 76
173 3300046463 Ga0495653_0336136 Ga0495653_0336136_314_553 76
174 3300046463 Ga0495653_0447033 Ga0495653_0447033_153_383 76
175 3300046477 Ga0495664_0000007 Ga0495664_0000007_25884_26153 76
176 3300046514 Ga0495618_0000151 Ga0495618_0000151_24703_24942 76
177 3300046543 Ga0495645_0000120 Ga0495645_0000120_1204_1446 76
178 3300048905 Ga0496102_0000002 Ga0496102_0000002_761093_761371 76
179 3300048906 Ga0496103_0000046 Ga0496103_0000046_51873_52151 76
180 3300049129 Ga0501309_099427 Ga0501309_099427_239_478 76
181 3300050494 nmdc:mga06z11_507970_c1 nmdc:mga06z11_507970_c1_280_510 76
182 3300053077 Ga0495601_0000276 Ga0495601_0000276_14993_15232 76
183 3300053077 Ga0495601_0158159 Ga0495601_0158159_1080_1319 76
184 3300053077 Ga0495601_0563100 Ga0495601_0563100_216_446 76
185 3300053085 Ga0495619_0338284 Ga0495619_0338284_184_414 76
186 3300059505 Ga0587083_0249767 Ga0587083_0249767_179_409 76
187 3300059604 Ga0587098_096980 Ga0587098_096980_155_385 76
188 3300001977 JGI24746J21847_1040169 JGI24746J21847_10401692 77
189 3300001990 JGI24737J22298_10186211 JGI24737J22298_101862111 77
190 3300002075 JGI24738J21930_10079422 JGI24738J21930_100794222 77
191 3300002077 JGI24744J21845_10032293 JGI24744J21845_100322931 77
192 3300003373 JGI25407J50210_10025407 JGI25407J50210_100254072 77
193 3300003373 JGI25407J50210_10081871 JGI25407J50210_100818712 77
194 3300003373 JGI25407J50210_10090770 JGI25407J50210_100907703 77
195 3300003693 Ga0032354_1046075 Ga0032354_10460751 77
196 3300004800 Ga0058861_10010021 Ga0058861_100100212 77
197 3300004803 Ga0058862_12741778 Ga0058862_127417782 77
198 3300005327 Ga0070658_10522189 Ga0070658_105221891 77
199 3300005327 Ga0070658_10912952 Ga0070658_109129522 77
200 3300005328 Ga0070676_10975492 Ga0070676_109754922 77
201 3300005329 Ga0070683_100168642 Ga0070683_1001686422 77
202 3300005329 Ga0070683_100203832 Ga0070683_1002038322 77
203 3300005329 Ga0070683_101246879 Ga0070683_1012468791 77
204 3300005331 Ga0070670_100892031 Ga0070670_1008920312 77
205 3300005333 Ga0070677_10080870 Ga0070677_100808702 77
206 3300005334 Ga0068869_100448007 Ga0068869_1004480072 77
207 3300005335 Ga0070666_10572404 Ga0070666_105724042 77
208 3300005337 Ga0070682_100779498 Ga0070682_1007794982 77
209 3300005338 Ga0068868_100741804 Ga0068868_1007418042 77
210 3300005340 Ga0070689_100674192 Ga0070689_1006741922 77
211 3300005344 Ga0070661_100329028 Ga0070661_1003290282 77
212 3300005344 Ga0070661_100542165 Ga0070661_1005421652 77
213 3300005345 Ga0070692_10081812 Ga0070692_100818124 77
214 3300005345 Ga0070692_10805542 Ga0070692_108055421 77
215 3300005347 Ga0070668_100183660 Ga0070668_1001836603 77
216 3300005347 Ga0070668_102277796 Ga0070668_1022777962 77
217 3300005353 Ga0070669_101069562 Ga0070669_1010695622 77
218 3300005353 Ga0070669_101708622 Ga0070669_1017086221 77
219 3300005354 Ga0070675_101268715 Ga0070675_1012687151 77
220 3300005356 Ga0070674_100016281 Ga0070674_1000162814 77
221 3300005366 Ga0070659_100220265 Ga0070659_1002202653 77
222 3300005366 Ga0070659_100377491 Ga0070659_1003774913 77
223 3300005366 Ga0070659_100661089 Ga0070659_1006610891 77
224 3300005438 Ga0070701_10242272 Ga0070701_102422722 77
225 3300005438 Ga0070701_10270457 Ga0070701_102704571 77
226 3300005438 Ga0070701_10858159 Ga0070701_108581591 77
227 3300005441 Ga0070700_100358356 Ga0070700_1003583562 77
228 3300005455 Ga0070663_100929876 Ga0070663_1009298761 77
229 3300005456 Ga0070678_100169098 Ga0070678_1001690984 77
230 3300005456 Ga0070678_100823597 Ga0070678_1008235971 77
231 3300005457 Ga0070662_100394713 Ga0070662_1003947131 77
232 3300005458 Ga0070681_10642934 Ga0070681_106429342 77
233 3300005459 Ga0068867_100085190 Ga0068867_1000851904 77
234 3300005459 Ga0068867_100138513 Ga0068867_1001385133 77
235 3300005459 Ga0068867_100481527 Ga0068867_1004815271 77
236 3300005459 Ga0068867_101189951 Ga0068867_1011899511 77
237 3300005459 Ga0068867_101808990 Ga0068867_1018089902 77
238 3300005466 Ga0070685_10732057 Ga0070685_107320571 77
239 3300005518 Ga0070699_101029597 Ga0070699_1010295971 77
240 3300005535 Ga0070684_100824793 Ga0070684_1008247932 77
241 3300005535 Ga0070684_101219627 Ga0070684_1012196272 77
242 3300005539 Ga0068853_100289582 Ga0068853_1002895822 77
243 3300005539 Ga0068853_101810975 Ga0068853_1018109752 77
244 3300005543 Ga0070672_101310663 Ga0070672_1013106632 77
245 3300005544 Ga0070686_100407398 Ga0070686_1004073982 77
246 3300005544 Ga0070686_100427844 Ga0070686_1004278443 77
247 3300005544 Ga0070686_100659065 Ga0070686_1006590651 77
248 3300005547 Ga0070693_100424248 Ga0070693_1004242482 77
249 3300005547 Ga0070693_101101363 Ga0070693_1011013631 77
250 3300005548 Ga0070665_100831143 Ga0070665_1008311432 77
251 3300005548 Ga0070665_102085814 Ga0070665_1020858142 77
252 3300005549 Ga0070704_100419981 Ga0070704_1004199812 77
253 3300005549 Ga0070704_102141733 Ga0070704_1021417331 77
254 3300005564 Ga0070664_100256282 Ga0070664_1002562823 77
255 3300005564 Ga0070664_100830768 Ga0070664_1008307682 77
256 3300005577 Ga0068857_100479257 Ga0068857_1004792572 77
257 3300005577 Ga0068857_100843086 Ga0068857_1008430862 77
258 3300005578 Ga0068854_100095326 Ga0068854_1000953262 77
259 3300005614 Ga0068856_101209963 Ga0068856_1012099632 77
260 3300005615 Ga0070702_100384748 Ga0070702_1003847482 77
261 3300005616 Ga0068852_100391696 Ga0068852_1003916963 77
262 3300005616 Ga0068852_100462060 Ga0068852_1004620603 77
263 3300005616 Ga0068852_101150383 Ga0068852_1011503831 77
264 3300005718 Ga0068866_10626014 Ga0068866_106260142 77
265 3300005719 Ga0068861_100031308 Ga0068861_1000313083 77
266 3300005719 Ga0068861_100144949 Ga0068861_1001449492 77
267 3300005719 Ga0068861_100180024 Ga0068861_1001800243 77
268 3300005834 Ga0068851_10677946 Ga0068851_106779462 77
269 3300005840 Ga0068870_10209433 Ga0068870_102094331 77
270 3300005842 Ga0068858_100045636 Ga0068858_1000456364 77
271 3300005842 Ga0068858_100120054 Ga0068858_1001200542 77
272 3300005842 Ga0068858_101155491 Ga0068858_1011554912 77
273 3300005843 Ga0068860_100724927 Ga0068860_1007249272 77
274 3300005937 Ga0081455_10112615 Ga0081455_101126153 77
275 3300005937 Ga0081455_10116703 Ga0081455_101167032 77
276 3300005937 Ga0081455_10172862 Ga0081455_101728623 77
277 3300005937 Ga0081455_10338365 Ga0081455_103383652 77
278 3300005937 Ga0081455_10545478 Ga0081455_105454781 77
279 3300005981 Ga0081538_10001846 Ga0081538_1000184610 77
280 3300005981 Ga0081538_10019086 Ga0081538_100190866 77
281 3300005981 Ga0081538_10023060 Ga0081538_100230605 77
282 3300005981 Ga0081538_10029547 Ga0081538_100295474 77
283 3300005981 Ga0081538_10258358 Ga0081538_102583582 77
284 3300005983 Ga0081540_1224352 Ga0081540_12243522 77
285 3300006058 Ga0075432_10264181 Ga0075432_102641811 77
286 3300006358 Ga0068871_100971474 Ga0068871_1009714742 77
287 3300006358 Ga0068871_101907625 Ga0068871_1019076251 77
288 3300006844 Ga0075428_100040740 Ga0075428_1000407403 77
289 3300006844 Ga0075428_101304461 Ga0075428_1013044613 77
290 3300006844 Ga0075428_102292577 Ga0075428_1022925771 77
291 3300006844 Ga0075428_102446636 Ga0075428_1024466361 77
292 3300006847 Ga0075431_100743300 Ga0075431_1007433002 77
293 3300006871 Ga0075434_102052831 Ga0075434_1020528311 77
294 3300006880 Ga0075429_101779028 Ga0075429_1017790282 77
295 3300006881 Ga0068865_100049036 Ga0068865_1000490364 77
296 3300009093 Ga0105240_10004346 Ga0105240_1000434618 77
297 3300009093 Ga0105240_12578293 Ga0105240_125782931 77
298 3300009094 Ga0111539_10029334 Ga0111539_100293346 77
299 3300009094 Ga0111539_10269561 Ga0111539_102695613 77
300 3300009094 Ga0111539_10287971 Ga0111539_102879714 77
301 3300009094 Ga0111539_10781214 Ga0111539_107812142 77
302 3300009094 Ga0111539_11161066 Ga0111539_111610662 77
303 3300009098 Ga0105245_10009166 Ga0105245_100091664 77
304 3300009098 Ga0105245_10300674 Ga0105245_103006743 77
305 3300009098 Ga0105245_11375562 Ga0105245_113755621 77
306 3300009147 Ga0114129_12309923 Ga0114129_123099231 77
307 3300009148 Ga0105243_10039614 Ga0105243_100396143 77
308 3300009148 Ga0105243_10057996 Ga0105243_100579964 77
309 3300009148 Ga0105243_10118532 Ga0105243_101185322 77
310 3300009174 Ga0105241_10519319 Ga0105241_105193192 77
311 3300009174 Ga0105241_12207338 Ga0105241_122073382 77
312 3300009176 Ga0105242_10231295 Ga0105242_102312953 77
313 3300009176 Ga0105242_10618310 Ga0105242_106183102 77
314 3300009176 Ga0105242_11234335 Ga0105242_112343352 77
315 3300009177 Ga0105248_10547751 Ga0105248_105477513 77
316 3300009177 Ga0105248_10779433 Ga0105248_107794333 77
317 3300009545 Ga0105237_10559303 Ga0105237_105593032 77
318 3300009551 Ga0105238_10850349 Ga0105238_108503492 77
319 3300009553 Ga0105249_10230734 Ga0105249_102307343 77
320 3300009553 Ga0105249_10583083 Ga0105249_105830832 77
321 3300009553 Ga0105249_12916858 Ga0105249_129168582 77
322 3300010375 Ga0105239_10333492 Ga0105239_103334923 77
323 3300010375 Ga0105239_10609526 Ga0105239_106095263 77
324 3300010375 Ga0105239_12332888 Ga0105239_123328881 77
325 3300011119 Ga0105246_10201263 Ga0105246_102012632 77
326 3300011119 Ga0105246_10552015 Ga0105246_105520152 77
327 3300011119 Ga0105246_11320429 Ga0105246_113204292 77
328 3300012498 Ga0157345_1016603 Ga0157345_10166032 77
329 3300012513 Ga0157326_1039481 Ga0157326_10394812 77
330 3300013102 Ga0157371_10629219 Ga0157371_106292191 77
331 3300013102 Ga0157371_11511339 Ga0157371_115113392 77
332 3300013104 Ga0157370_11373060 Ga0157370_113730602 77
333 3300013297 Ga0157378_10327145 Ga0157378_103271452 77
334 3300013297 Ga0157378_10864311 Ga0157378_108643112 77
335 3300013297 Ga0157378_12775037 Ga0157378_127750372 77
336 3300013306 Ga0163162_10353807 Ga0163162_103538072 77
337 3300013306 Ga0163162_10762318 Ga0163162_107623183 77
338 3300013307 Ga0157372_10650031 Ga0157372_106500313 77
339 3300013307 Ga0157372_10769543 Ga0157372_107695433 77
340 3300013307 Ga0157372_11414980 Ga0157372_114149801 77
341 3300013308 Ga0157375_13780239 Ga0157375_137802392 77
342 3300014325 Ga0163163_10293285 Ga0163163_102932853 77
343 3300014326 Ga0157380_10259732 Ga0157380_102597323 77
344 3300014326 Ga0157380_10411131 Ga0157380_104111312 77
345 3300014497 Ga0182008_10104627 Ga0182008_101046272 77
346 3300014745 Ga0157377_10106798 Ga0157377_101067981 77
347 3300014968 Ga0157379_10245528 Ga0157379_102455282 77
348 3300014968 Ga0157379_11309877 Ga0157379_113098771 77
349 3300014969 Ga0157376_12748890 Ga0157376_127488901 77
350 3300020070 Ga0206356_11500562 Ga0206356_115005622 77
351 3300020080 Ga0206350_10418688 Ga0206350_104186881 77
352 3300020081 Ga0206354_10237246 Ga0206354_102372462 77
353 3300020082 Ga0206353_10284451 Ga0206353_102844511 77
354 3300022467 Ga0224712_10311454 Ga0224712_103114541 77
355 3300022467 Ga0224712_10545383 Ga0224712_105453831 77
356 3300025321 Ga0207656_10269875 Ga0207656_102698752 77
357 3300025899 Ga0207642_10203767 Ga0207642_102037672 77
358 3300025901 Ga0207688_10023583 Ga0207688_100235832 77
359 3300025901 Ga0207688_10207314 Ga0207688_102073142 77
360 3300025907 Ga0207645_10228028 Ga0207645_102280283 77
361 3300025907 Ga0207645_11071730 Ga0207645_110717301 77
362 3300025908 Ga0207643_10095843 Ga0207643_100958431 77
363 3300025908 Ga0207643_10171754 Ga0207643_101717543 77
364 3300025908 Ga0207643_10277791 Ga0207643_102777913 77
365 3300025909 Ga0207705_10915255 Ga0207705_109152552 77
366 3300025913 Ga0207695_10042059 Ga0207695_100420596 77
367 3300025914 Ga0207671_11252185 Ga0207671_112521851 77
368 3300025917 Ga0207660_10447815 Ga0207660_104478152 77
369 3300025917 Ga0207660_10510331 Ga0207660_105103312 77
370 3300025918 Ga0207662_10171790 Ga0207662_101717902 77
371 3300025918 Ga0207662_10276092 Ga0207662_102760923 77
372 3300025920 Ga0207649_10961634 Ga0207649_109616342 77
373 3300025923 Ga0207681_10893746 Ga0207681_108937463 77
374 3300025923 Ga0207681_11215566 Ga0207681_112155661 77
375 3300025924 Ga0207694_10807346 Ga0207694_108073462 77
376 3300025925 Ga0207650_10280737 Ga0207650_102807372 77
377 3300025926 Ga0207659_10892909 Ga0207659_108929092 77
378 3300025927 Ga0207687_10099278 Ga0207687_100992783 77
379 3300025927 Ga0207687_10229866 Ga0207687_102298663 77
380 3300025927 Ga0207687_10549704 Ga0207687_105497043 77
381 3300025929 Ga0207664_10143007 Ga0207664_101430073 77
382 3300025929 Ga0207664_10943205 Ga0207664_109432052 77
383 3300025931 Ga0207644_10911536 Ga0207644_109115362 77
384 3300025932 Ga0207690_10323670 Ga0207690_103236702 77
385 3300025933 Ga0207706_10043662 Ga0207706_100436626 77
386 3300025934 Ga0207686_10160757 Ga0207686_101607572 77
387 3300025935 Ga0207709_10028379 Ga0207709_100283794 77
388 3300025935 Ga0207709_10031902 Ga0207709_100319024 77
389 3300025935 Ga0207709_10155445 Ga0207709_101554453 77
390 3300025936 Ga0207670_10302668 Ga0207670_103026683 77
391 3300025936 Ga0207670_11304502 Ga0207670_113045021 77
392 3300025937 Ga0207669_10049960 Ga0207669_100499603 77
393 3300025938 Ga0207704_10028200 Ga0207704_100282004 77
394 3300025938 Ga0207704_10319627 Ga0207704_103196273 77
395 3300025938 Ga0207704_10484685 Ga0207704_104846852 77
396 3300025940 Ga0207691_10109452 Ga0207691_101094523 77
397 3300025941 Ga0207711_10535086 Ga0207711_105350862 77
398 3300025941 Ga0207711_10542246 Ga0207711_105422463 77
399 3300025942 Ga0207689_10342529 Ga0207689_103425292 77
400 3300025942 Ga0207689_10596401 Ga0207689_105964012 77
401 3300025944 Ga0207661_10248229 Ga0207661_102482293 77
402 3300025944 Ga0207661_10548559 Ga0207661_105485592 77
403 3300025945 Ga0207679_10735407 Ga0207679_107354072 77
404 3300025961 Ga0207712_10312349 Ga0207712_103123493 77
405 3300025961 Ga0207712_10561724 Ga0207712_105617242 77
406 3300025972 Ga0207668_10360294 Ga0207668_103602942 77
407 3300025972 Ga0207668_10976807 Ga0207668_109768071 77
408 3300025981 Ga0207640_10603786 Ga0207640_106037861 77
409 3300026023 Ga0207677_10086851 Ga0207677_100868514 77
410 3300026023 Ga0207677_11200098 Ga0207677_112000982 77
411 3300026035 Ga0207703_10180352 Ga0207703_101803523 77
412 3300026035 Ga0207703_10382988 Ga0207703_103829883 77
413 3300026035 Ga0207703_10728730 Ga0207703_107287301 77
414 3300026041 Ga0207639_10273731 Ga0207639_102737312 77
415 3300026041 Ga0207639_11347431 Ga0207639_113474312 77
416 3300026067 Ga0207678_10306085 Ga0207678_103060853 77
417 3300026067 Ga0207678_10433415 Ga0207678_104334151 77
418 3300026075 Ga0207708_10003129 Ga0207708_100031295 77
419 3300026075 Ga0207708_10765864 Ga0207708_107658641 77
420 3300026078 Ga0207702_11491755 Ga0207702_114917551 77
421 3300026088 Ga0207641_10904218 Ga0207641_109042182 77
422 3300026089 Ga0207648_10190212 Ga0207648_101902122 77
423 3300026089 Ga0207648_10408991 Ga0207648_104089912 77
424 3300026089 Ga0207648_10911298 Ga0207648_109112981 77
425 3300026089 Ga0207648_11407595 Ga0207648_114075951 77
426 3300026095 Ga0207676_11183938 Ga0207676_111839382 77
427 3300026116 Ga0207674_10362681 Ga0207674_103626813 77
428 3300026118 Ga0207675_100022121 Ga0207675_1000221214 77
429 3300026118 Ga0207675_100067353 Ga0207675_1000673532 77
430 3300026118 Ga0207675_100426657 Ga0207675_1004266571 77
431 3300026118 Ga0207675_100901054 Ga0207675_1009010541 77
432 3300026121 Ga0207683_10077799 Ga0207683_100777993 77
433 3300026121 Ga0207683_11267221 Ga0207683_112672212 77
434 3300026142 Ga0207698_11012984 Ga0207698_110129843 77
435 3300027876 Ga0209974_10472213 Ga0209974_104722131 77
436 3300027907 Ga0207428_10041298 Ga0207428_100412985 77
437 3300027907 Ga0207428_10314759 Ga0207428_103147593 77
438 3300028380 Ga0268265_10424079 Ga0268265_104240791 77
439 3300028380 Ga0268265_11571951 Ga0268265_115719512 77
440 3300028381 Ga0268264_10948347 Ga0268264_109483472 77
441 3300031548 Ga0307408_100059584 Ga0307408_1000595842 77
442 3300031548 Ga0307408_102247575 Ga0307408_1022475752 77
443 3300031731 Ga0307405_10021930 Ga0307405_100219301 77
444 3300031731 Ga0307405_10031980 Ga0307405_100319803 77
445 3300031731 Ga0307405_10332989 Ga0307405_103329892 77
446 3300031731 Ga0307405_11025780 Ga0307405_110257802 77
447 3300031824 Ga0307413_10041518 Ga0307413_100415183 77
448 3300031824 Ga0307413_10537104 Ga0307413_105371043 77
449 3300031824 Ga0307413_10785686 Ga0307413_107856862 77
450 3300031824 Ga0307413_11454009 Ga0307413_114540091 77
451 3300031852 Ga0307410_10045594 Ga0307410_100455943 77
452 3300031852 Ga0307410_10372875 Ga0307410_103728752 77
453 3300031852 Ga0307410_12131334 Ga0307410_121313341 77
454 3300031889 Ga0326468_10028937 Ga0326468_100289371 77
455 3300031889 Ga0326468_10104625 Ga0326468_101046252 77
456 3300031901 Ga0307406_10086271 Ga0307406_100862714 77
457 3300031901 Ga0307406_10117270 Ga0307406_101172702 77
458 3300031901 Ga0307406_10572397 Ga0307406_105723973 77
459 3300031901 Ga0307406_11472946 Ga0307406_114729462 77
460 3300031901 Ga0307406_11570932 Ga0307406_115709322 77
461 3300031901 Ga0307406_12028759 Ga0307406_120287591 77
462 3300031903 Ga0307407_10319637 Ga0307407_103196371 77
463 3300031903 Ga0307407_10554430 Ga0307407_105544303 77
464 3300031903 Ga0307407_11292726 Ga0307407_112927261 77
465 3300031911 Ga0307412_10015659 Ga0307412_100156592 77
466 3300031995 Ga0307409_100010481 Ga0307409_1000104812 77
467 3300031995 Ga0307409_100289624 Ga0307409_1002896243 77
468 3300031995 Ga0307409_100409576 Ga0307409_1004095762 77
469 3300031995 Ga0307409_101939195 Ga0307409_1019391951 77
470 3300031995 Ga0307409_102213745 Ga0307409_1022137452 77
471 3300032002 Ga0307416_100091949 Ga0307416_1000919494 77
472 3300032002 Ga0307416_100259254 Ga0307416_1002592543 77
473 3300032002 Ga0307416_100412124 Ga0307416_1004121242 77
474 3300032002 Ga0307416_100474025 Ga0307416_1004740253 77
475 3300032002 Ga0307416_101069416 Ga0307416_1010694161 77
476 3300032002 Ga0307416_101113540 Ga0307416_1011135403 77
477 3300032004 Ga0307414_10032571 Ga0307414_100325713 77
478 3300032004 Ga0307414_12110678 Ga0307414_121106782 77
479 3300032005 Ga0307411_10091701 Ga0307411_100917013 77
480 3300032005 Ga0307411_10325246 Ga0307411_103252462 77
481 3300032126 Ga0307415_100003903 Ga0307415_1000039034 77
482 3300032126 Ga0307415_100013966 Ga0307415_1000139668 77
483 3300032126 Ga0307415_100019768 Ga0307415_1000197684 77
484 3300032126 Ga0307415_100160966 Ga0307415_1001609663 77
485 3300032126 Ga0307415_100816966 Ga0307415_1008169662 77
486 3300032126 Ga0307415_100855531 Ga0307415_1008555311 77
487 3300037418 Ga0395900_0218819 Ga0395900_0218819_1435_1668 77
488 3300037418 Ga0395900_1489433 Ga0395900_1489433_122_355 77
489 3300037466 Ga0395898_0164200 Ga0395898_0164200_1186_1419 77
490 3300037466 Ga0395898_0266121 Ga0395898_0266121_940_1173 77
491 3300037466 Ga0395898_1298679 Ga0395898_1298679_136_369 77
492 3300038443 Ga0395901_0200294 Ga0395901_0200294_382_615 77
493 3300038443 Ga0395901_0784724 Ga0395901_0784724_421_654 77
494 3300038443 Ga0395901_1525822 Ga0395901_1525822_336_569 77
495 3300039438 Ga0436360_0286471 Ga0436360_0286471_165_404 77
496 3300039450 Ga0436363_0868929 Ga0436363_0868929_182_415 77
497 3300041408 Ga0439453_0101691 Ga0439453_0101691_294_527 77
498 3300041460 Ga0451802_0735710 Ga0451802_0735710_442_675 77
499 3300041460 Ga0451802_1266157 Ga0451802_1266157_417_650 77
500 3300041511 Ga0451855_1197243 Ga0451855_1197243_135_368 77
501 3300041511 Ga0451855_1394352 Ga0451855_1394352_342_575 77
502 3300042005 Ga0439448_0137271 Ga0439448_0137271_329_562 77
503 3300042005 Ga0439448_0326166 Ga0439448_0326166_58_291 77
504 3300042008 Ga0439450_017523 Ga0439450_017523_694_927 77
505 3300042011 Ga0439454_011647 Ga0439454_011647_141_374 77
506 3300042013 Ga0439456_142608 Ga0439456_142608_187_420 77
507 3300042016 Ga0439463_133979 Ga0439463_133979_229_462 77
508 3300042137 Ga0450902_006060 Ga0450902_006060_100_333 77
509 3300042157 Ga0439458_0031983 Ga0439458_0031983_780_1013 77
510 3300042437 Ga0439444_0052872 Ga0439444_0052872_428_661 77
511 3300042438 Ga0439459_0104365 Ga0439459_0104365_304_537 77
512 3300042439 Ga0439464_0036643 Ga0439464_0036643_732_965 77
513 3300042461 Ga0439460_0021737 Ga0439460_0021737_687_920 77
514 3300042993 Ga0439440_0039689 Ga0439440_0039689_288_521 77
515 3300044656 Ga0466969_0020586 Ga0466969_0020586_1833_2066 77
516 3300044683 Ga0466965_0300487 Ga0466965_0300487_510_743 77
517 3300044693 Ga0466961_0084739 Ga0466961_0084739_1380_1613 77
518 3300044694 Ga0466963_0118022 Ga0466963_0118022_319_552 77
519 3300044694 Ga0466963_0787822 Ga0466963_0787822_50_283 77
520 3300044706 Ga0466964_0455268 Ga0466964_0455268_302_535 77
521 3300044735 Ga0466968_0101102 Ga0466968_0101102_791_1024 77
522 3300044765 Ga0466970_0018283 Ga0466970_0018283_423_656 77
523 3300044765 Ga0466970_0583917 Ga0466970_0583917_144_377 77
524 3300044842 Ga0466957_0152829 Ga0466957_0152829_388_621 77
525 3300044901 Ga0466960_0140337 Ga0466960_0140337_501_734 77
526 3300044901 Ga0466960_0362378 Ga0466960_0362378_107_340 77
527 3300044901 Ga0466960_0417554 Ga0466960_0417554_158_391 77
528 3300045049 Ga0466959_0323740 Ga0466959_0323740_19_252 77
529 3300045051 Ga0451576_1427861 Ga0451576_1427861_207_440 77
530 3300045836 Ga0466958_0003325 Ga0466958_0003325_2678_2911 77
531 3300045976 Ga0466967_0758099 Ga0466967_0758099_630_863 77
532 3300045976 Ga0466967_0930526 Ga0466967_0930526_87_320 77
533 3300046492 Ga0495585_0337189 Ga0495585_0337189_302_535 77
534 3300046518 Ga0495631_0297669 Ga0495631_0297669_159_392 77
535 3300046615 Ga0495656_0633023 Ga0495656_0633023_94_327 77
536 3300046809 Ga0495600_0014182 Ga0495600_0014182_151_393 77
537 3300048905 Ga0496102_0570186 Ga0496102_0570186_258_491 77
538 3300048905 Ga0496102_1073363 Ga0496102_1073363_303_536 77
539 3300048906 Ga0496103_0577476 Ga0496103_0577476_359_592 77
540 3300048907 Ga0496104_0000001 Ga0496104_0000001_236749_236991 77
541 3300048908 Ga0496105_0500662 Ga0496105_0500662_686_919 77
542 3300048908 Ga0496105_0714456 Ga0496105_0714456_304_546 77
543 3300048909 Ga0496106_0028641 Ga0496106_0028641_3690_3923 77
544 3300048910 Ga0496107_0435605 Ga0496107_0435605_363_596 77
545 3300048911 Ga0496108_0207117 Ga0496108_0207117_916_1149 77
546 3300048912 Ga0496109_0611538 Ga0496109_0611538_450_683 77
547 3300048913 Ga0496110_0000502 Ga0496110_0000502_22762_23004 77
548 3300048913 Ga0496110_0637141 Ga0496110_0637141_330_563 77
549 3300048913 Ga0496110_0638969 Ga0496110_0638969_569_802 77
550 3300048914 Ga0496111_0001359 Ga0496111_0001359_8005_8247 77
551 3300048914 Ga0496111_0396329 Ga0496111_0396329_392_625 77
552 3300048914 Ga0496111_1121617 Ga0496111_1121617_304_537 77
553 3300048916 Ga0496113_0553521 Ga0496113_0553521_573_806 77
554 3300048917 Ga0496114_0904629 Ga0496114_0904629_141_374 77
555 3300049533 Ga0501317_083770 Ga0501317_083770_12_245 77
556 3300049541 Ga0501325_033358 Ga0501325_033358_86_319 77
557 3300049568 Ga0501031_0093232 Ga0501031_0093232_226_459 77
558 3300049569 Ga0501032_0404931 Ga0501032_0404931_346_579 77
559 3300049571 Ga0501034_0766087 Ga0501034_0766087_517_750 77
560 3300049572 Ga0501036_0036303 Ga0501036_0036303_652_885 77
561 3300049572 Ga0501036_0123223 Ga0501036_0123223_1915_2148 77
562 3300049573 Ga0501037_0331041 Ga0501037_0331041_715_948 77
563 3300049574 Ga0501038_0229351 Ga0501038_0229351_812_1045 77
564 3300049574 Ga0501038_0259070 Ga0501038_0259070_38_271 77
565 3300049575 Ga0501039_0233964 Ga0501039_0233964_25_258 77
566 3300049575 Ga0501039_0838932 Ga0501039_0838932_443_676 77
567 3300049576 Ga0501040_0034135 Ga0501040_0034135_2509_2742 77
568 3300049576 Ga0501040_0156985 Ga0501040_0156985_56_289 77
569 3300049577 Ga0501041_0095986 Ga0501041_0095986_1515_1748 77
570 3300049578 Ga0501042_0055833 Ga0501042_0055833_2548_2781 77
571 3300049578 Ga0501042_0288431 Ga0501042_0288431_865_1098 77
572 3300049579 Ga0501043_0546316 Ga0501043_0546316_375_608 77
573 3300049580 Ga0501046_0112761 Ga0501046_0112761_892_1125 77
574 3300049582 Ga0501048_0094394 Ga0501048_0094394_1394_1627 77
575 3300049585 Ga0501069_0096734 Ga0501069_0096734_608_841 77
576 3300049586 Ga0501070_0971405 Ga0501070_0971405_215_448 77
577 3300049587 Ga0501071_0110609 Ga0501071_0110609_1735_1968 77
578 3300049587 Ga0501071_0565794 Ga0501071_0565794_63_296 77
579 3300049588 Ga0501072_0021253 Ga0501072_0021253_3430_3663 77
580 3300049589 Ga0501073_0150386 Ga0501073_0150386_712_945 77
581 3300049591 Ga0501075_0020369 Ga0501075_0020369_906_1139 77
582 3300049591 Ga0501075_0280308 Ga0501075_0280308_837_1070 77
583 3300049591 Ga0501075_0739160 Ga0501075_0739160_53_286 77
584 3300049591 Ga0501075_1268219 Ga0501075_1268219_46_279 77
585 3300049592 Ga0501076_0010634 Ga0501076_0010634_2255_2488 77
586 3300049592 Ga0501076_0147035 Ga0501076_0147035_389_622 77
587 3300049593 Ga0501077_0214411 Ga0501077_0214411_961_1194 77
588 3300049593 Ga0501077_0245454 Ga0501077_0245454_891_1124 77
589 3300049659 Ga0501214_055151 Ga0501214_055151_235_468 77
590 3300049678 Ga0501248_055261 Ga0501248_055261_196_429 77
591 3300049686 Ga0501257_242522 Ga0501257_242522_43_276 77
592 3300049741 Ga0501079_0383792 Ga0501079_0383792_779_1012 77
593 3300049742 Ga0501080_0188330 Ga0501080_0188330_584_817 77
594 3300049743 Ga0501081_0228531 Ga0501081_0228531_727_960 77
595 3300049823 Ga0501044_0340475 Ga0501044_0340475_220_453 77
596 3300049824 Ga0501045_0054022 Ga0501045_0054022_2654_2887 77
597 3300050507 nmdc:mga05p37_1295495_c1 nmdc:mga05p37_1295495_c1_467_700 77
598 3300050507 nmdc:mga05p37_837445_c1 nmdc:mga05p37_837445_c1_702_935 77
599 3300050508 nmdc:mga09592_485899_c1 nmdc:mga09592_485899_c1_284_517 77
600 3300050510 nmdc:mga06r32_1650031_c1 nmdc:mga06r32_1650031_c1_294_527 77
601 3300050510 nmdc:mga06r32_711765_c1 nmdc:mga06r32_711765_c1_605_838 77
602 3300050511 nmdc:mga08y16_1189065_c1 nmdc:mga08y16_1189065_c1_140_373 77
603 3300050511 nmdc:mga08y16_757993_c1 nmdc:mga08y16_757993_c1_359_592 77
604 3300050511 nmdc:mga08y16_7698_c1 nmdc:mga08y16_7698_c1_6987_7220 77
605 3300050512 nmdc:mga0n895_964546_c1 nmdc:mga0n895_964546_c1_305_538 77
606 3300054114 Ga0501084_0213629 Ga0501084_0213629_38_271 77
607 3300054114 Ga0501084_0413942 Ga0501084_0413942_48_281 77
608 3300059423 Ga0590074_037814 Ga0590074_037814_468_701 77
609 3300059506 Ga0587085_152834 Ga0587085_152834_168_401 77
610 3300059509 Ga0587089_047579 Ga0587089_047579_77_310 77
611 3300059512 Ga0587092_159306 Ga0587092_159306_75_308 77
612 3300060344 Ga0587071_104109 Ga0587071_104109_299_532 77
613 3300061719 Ga0466962_0097870 Ga0466962_0097870_341_574 77
614 3300061719 Ga0466962_0484546 Ga0466962_0484546_229_462 77
615 3300061734 Ga0530510_0135422 Ga0530510_0135422_694_927 77
616 3300000546 LJNas_1012758 LJNas_10127582 78
617 3300004799 Ga0058863_11835538 Ga0058863_118355381 78
618 3300004799 Ga0058863_11857311 Ga0058863_118573111 78
619 3300004803 Ga0058862_12879863 Ga0058862_128798631 78
620 3300005329 Ga0070683_100088801 Ga0070683_1000888013 78
621 3300005329 Ga0070683_100127469 Ga0070683_1001274694 78
622 3300005329 Ga0070683_100171800 Ga0070683_1001718002 78
623 3300005343 Ga0070687_100231790 Ga0070687_1002317903 78
624 3300005355 Ga0070671_101877317 Ga0070671_1018773171 78
625 3300005356 Ga0070674_100630013 Ga0070674_1006300131 78
626 3300005437 Ga0070710_11326063 Ga0070710_113260632 78
627 3300005441 Ga0070700_101478904 Ga0070700_1014789041 78
628 3300005455 Ga0070663_100580360 Ga0070663_1005803601 78
629 3300005456 Ga0070678_101217379 Ga0070678_1012173792 78
630 3300005456 Ga0070678_102212114 Ga0070678_1022121141 78
631 3300005530 Ga0070679_100138786 Ga0070679_1001387862 78
632 3300005535 Ga0070684_100092313 Ga0070684_1000923133 78
633 3300005535 Ga0070684_100099586 Ga0070684_1000995861 78
634 3300005535 Ga0070684_101100938 Ga0070684_1011009383 78
635 3300005548 Ga0070665_100803661 Ga0070665_1008036612 78
636 3300005564 Ga0070664_100096782 Ga0070664_1000967823 78
637 3300005578 Ga0068854_102223065 Ga0068854_1022230651 78
638 3300005614 Ga0068856_101047471 Ga0068856_1010474712 78
639 3300005614 Ga0068856_102505251 Ga0068856_1025052511 78
640 3300005615 Ga0070702_100108743 Ga0070702_1001087432 78
641 3300005616 Ga0068852_102248972 Ga0068852_1022489721 78
642 3300005844 Ga0068862_100730564 Ga0068862_1007305641 78
643 3300005937 Ga0081455_10066658 Ga0081455_100666586 78
644 3300005983 Ga0081540_1113232 Ga0081540_11132323 78
645 3300005985 Ga0081539_10177518 Ga0081539_101775183 78
646 3300006028 Ga0070717_10028957 Ga0070717_100289576 78
647 3300006038 Ga0075365_10240014 Ga0075365_102400143 78
648 3300006038 Ga0075365_10507640 Ga0075365_105076402 78
649 3300006058 Ga0075432_10210173 Ga0075432_102101733 78
650 3300006163 Ga0070715_10990159 Ga0070715_109901591 78
651 3300006358 Ga0068871_102431051 Ga0068871_1024310512 78
652 3300006881 Ga0068865_101308406 Ga0068865_1013084061 78
653 3300009098 Ga0105245_10360343 Ga0105245_103603433 78
654 3300009148 Ga0105243_10108212 Ga0105243_101082124 78
655 3300009148 Ga0105243_10275620 Ga0105243_102756202 78
656 3300009174 Ga0105241_11147056 Ga0105241_111470562 78
657 3300009176 Ga0105242_10062382 Ga0105242_100623826 78
658 3300009177 Ga0105248_10544926 Ga0105248_105449263 78
659 3300011119 Ga0105246_11562535 Ga0105246_115625352 78
660 3300013105 Ga0157369_11287085 Ga0157369_112870851 78
661 3300013296 Ga0157374_12050308 Ga0157374_120503082 78
662 3300013307 Ga0157372_10128777 Ga0157372_101287775 78
663 3300013307 Ga0157372_12628893 Ga0157372_126288931 78
664 3300013308 Ga0157375_11189861 Ga0157375_111898611 78
665 3300014745 Ga0157377_10387709 Ga0157377_103877091 78
666 3300020076 Ga0206355_1414211 Ga0206355_14142111 78
667 3300021377 Ga0213874_10398600 Ga0213874_103986001 78
668 3300025899 Ga0207642_10206510 Ga0207642_102065101 78
669 3300025909 Ga0207705_10758385 Ga0207705_107583852 78
670 3300025921 Ga0207652_10252739 Ga0207652_102527394 78
671 3300025927 Ga0207687_10542543 Ga0207687_105425433 78
672 3300025934 Ga0207686_10588031 Ga0207686_105880313 78
673 3300025935 Ga0207709_10235774 Ga0207709_102357743 78
674 3300025937 Ga0207669_10458085 Ga0207669_104580852 78
675 3300025944 Ga0207661_10045715 Ga0207661_100457156 78
676 3300025944 Ga0207661_10098379 Ga0207661_100983794 78
677 3300025944 Ga0207661_10871099 Ga0207661_108710991 78
678 3300025944 Ga0207661_12006947 Ga0207661_120069471 78
679 3300025945 Ga0207679_10896251 Ga0207679_108962511 78
680 3300025945 Ga0207679_11230685 Ga0207679_112306851 78
681 3300025981 Ga0207640_10848514 Ga0207640_108485142 78
682 3300026035 Ga0207703_10505497 Ga0207703_105054972 78
683 3300026067 Ga0207678_10181200 Ga0207678_101812003 78
684 3300026067 Ga0207678_10220954 Ga0207678_102209543 78
685 3300026075 Ga0207708_11014272 Ga0207708_110142722 78
686 3300026078 Ga0207702_10023957 Ga0207702_100239572 78
687 3300026088 Ga0207641_10611589 Ga0207641_106115892 78
688 3300026088 Ga0207641_11142855 Ga0207641_111428551 78
689 3300026121 Ga0207683_11406880 Ga0207683_114068802 78
690 3300031090 Ga0265760_10063686 Ga0265760_100636862 78
691 3300031901 Ga0307406_10888887 Ga0307406_108888871 78
692 3300031901 Ga0307406_11015202 Ga0307406_110152022 78
693 3300032002 Ga0307416_101211040 Ga0307416_1012110402 78
694 3300032002 Ga0307416_102615881 Ga0307416_1026158811 78
695 3300032005 Ga0307411_11991280 Ga0307411_119912801 78
696 3300035111 Ga0373923_0142175 Ga0373923_0142175_291_554 78
697 3300035115 Ga0373941_0002756 Ga0373941_0002756_336_599 78
698 3300038443 Ga0395901_1743716 Ga0395901_1743716_292_531 78
699 3300039450 Ga0436363_1403311 Ga0436363_1403311_67_309 78
700 3300041453 Ga0451797_1067062 Ga0451797_1067062_201_440 78
701 3300041503 Ga0451847_0113160 Ga0451847_0113160_155_391 78
702 3300041511 Ga0451855_0707975 Ga0451855_0707975_312_548 78
703 3300044683 Ga0466965_0273961 Ga0466965_0273961_566_805 78
704 3300044683 Ga0466965_0547023 Ga0466965_0547023_323_562 78
705 3300044693 Ga0466961_0327749 Ga0466961_0327749_616_855 78
706 3300044694 Ga0466963_0080716 Ga0466963_0080716_431_670 78
707 3300044694 Ga0466963_0219460 Ga0466963_0219460_419_658 78
708 3300044694 Ga0466963_0572240 Ga0466963_0572240_456_695 78
709 3300044694 Ga0466963_0669509 Ga0466963_0669509_227_466 78
710 3300044706 Ga0466964_0814817 Ga0466964_0814817_38_277 78
711 3300044719 Ga0466971_0190928 Ga0466971_0190928_661_900 78
712 3300044765 Ga0466970_0498190 Ga0466970_0498190_284_523 78
713 3300044842 Ga0466957_0099531 Ga0466957_0099531_1527_1766 78
714 3300044842 Ga0466957_0517888 Ga0466957_0517888_273_512 78
715 3300045836 Ga0466958_0281926 Ga0466958_0281926_550_789 78
716 3300045836 Ga0466958_0615641 Ga0466958_0615641_440_679 78
717 3300045976 Ga0466967_0001485 Ga0466967_0001485_10007_10246 78
718 3300046473 Ga0495582_0935658 Ga0495582_0935658_73_312 78
719 3300046500 Ga0495596_0135506 Ga0495596_0135506_704_940 78
720 3300046522 Ga0495643_0140308 Ga0495643_0140308_488_724 78
721 3300046615 Ga0495656_0094648 Ga0495656_0094648_537_773 78
722 3300046794 Ga0495589_0379237 Ga0495589_0379237_10_246 78
723 3300047319 Ga0495674_0479420 Ga0495674_0479420_655_894 78
724 3300048912 Ga0496109_1374644 Ga0496109_1374644_95_334 78
725 3300048912 Ga0496109_1493353 Ga0496109_1493353_137_388 78
726 3300048913 Ga0496110_0129733 Ga0496110_0129733_823_1062 78
727 3300048915 Ga0496112_0393554 Ga0496112_0393554_1074_1313 78
728 3300048915 Ga0496112_0482570 Ga0496112_0482570_910_1149 78
729 3300048916 Ga0496113_0151843 Ga0496113_0151843_626_862 78
730 3300048916 Ga0496113_0402604 Ga0496113_0402604_423_662 78
731 3300049568 Ga0501031_0962906 Ga0501031_0962906_69_308 78
732 3300049571 Ga0501034_0852039 Ga0501034_0852039_262_504 78
733 3300049578 Ga0501042_0377660 Ga0501042_0377660_534_773 78
734 3300049592 Ga0501076_1569208 Ga0501076_1569208_260_496 78
735 3300050492 nmdc:mga0yw44_731075_c1 nmdc:mga0yw44_731075_c1_98_337 78
736 3300053139 Ga0500568_0301496 Ga0500568_0301496_85_321 78
737 3300053146 Ga0500588_0170648 Ga0500588_0170648_129_365 78
738 3300053153 Ga0500616_0140914 Ga0500616_0140914_46_285 78
739 3300059424 Ga0590075_081173 Ga0590075_081173_491_727 78
740 3300059426 Ga0590077_100746 Ga0590077_100746_317_553 78
741 3300059477 Ga0587084_024069 Ga0587084_024069_261_500 78
742 3300059490 Ga0587066_060200 Ga0587066_060200_125_364 78
743 3300059493 Ga0587077_199073 Ga0587077_199073_148_387 78
744 3300059507 Ga0587086_043705 Ga0587086_043705_90_326 78
745 3300059508 Ga0587088_085875 Ga0587088_085875_406_645 78
746 3300059510 Ga0587090_132098 Ga0587090_132098_141_380 78
747 3300059623 Ga0587101_131912 Ga0587101_131912_169_405 78
748 3300059624 Ga0587109_143673 Ga0587109_143673_315_554 78
749 3300059628 Ga0587122_057948 Ga0587122_057948_169_408 78
750 3300059639 Ga0587062_135677 Ga0587062_135677_76_312 78
751 3300059640 Ga0587067_059360 Ga0587067_059360_236_475 78
752 3300059641 Ga0587068_104264 Ga0587068_104264_245_484 78
753 3300059643 Ga0587072_200117 Ga0587072_200117_153_392 78
754 3300059644 Ga0587075_092588 Ga0587075_092588_243_482 78
755 3300059645 Ga0587076_156299 Ga0587076_156299_80_319 78
756 3300059645 Ga0587076_210042 Ga0587076_210042_172_411 78
757 3300059646 Ga0587078_039671 Ga0587078_039671_103_339 78
758 3300059647 Ga0587079_152488 Ga0587079_152488_168_407 78
759 3300059652 Ga0587107_127851 Ga0587107_127851_138_374 78
760 3300059654 Ga0587110_069221 Ga0587110_069221_136_375 78
761 3300059660 Ga0587124_049839 Ga0587124_049839_193_432 78
762 3300061734 Ga0530510_1244617 Ga0530510_1244617_238_474 78

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02599

CsrA

Global regulator protein family

1

53

0.97

Feature Viewer

pLDDT pTM Quality
79.62 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map