F479627
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 762 | 355 | 762 | 77 |
Family's Representative Sequence
| Representative Sequence | 3300007788|Ga0099795_10214645|Ga0099795_102146451 |
| Length | 73 |
| Sequence | MLILTRRAGEALRIGDDIEVTVMAVNGTQVRIGIKAPREVAVDREEIAERKRRDRENSDAIGKVEARSRLAVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 7 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 102 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 103 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 121 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 125 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 212 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 216 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 217 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 218 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 219 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 220 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 221 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 222 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 223 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 224 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 225 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 226 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 227 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 228 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 229 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 230 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 231 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 232 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 233 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 234 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 235 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 236 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 237 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 238 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 242 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 243 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 272 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 273 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 274 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 275 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 276 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 302 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 303 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 304 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 321 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 322 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 323 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 324 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 326 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 327 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 328 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 355 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.7 |
| Metatranscriptomes | 6.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.57 |
| Nodule | 0 |
| Rhizoplane | 5.25 |
| Rhizosphere | 92.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1012758 | 3300000546 | Bacteria | 895 |
| 2 | JGI24746J21847_1040169 | 3300001977 | Bacteria | 650 |
| 3 | JGI24737J22298_10186211 | 3300001990 | Bacteria | 613 |
| 4 | JGI24738J21930_10079422 | 3300002075 | Bacteria | 686 |
| 5 | JGI24744J21845_10032293 | 3300002077 | Bacteria | 999 |
| 6 | JGI25407J50210_10025407 | 3300003373 | Bacteria | 1536 |
| 7 | JGI25407J50210_10081871 | 3300003373 | Bacteria | 802 |
| 8 | JGI25407J50210_10090770 | 3300003373 | Bacteria | 756 |
| 9 | Ga0032354_1046075 | 3300003693 | Bacteria | 575 |
| 10 | Ga0058863_11835538 | 3300004799 | Bacteria | 672 |
| 11 | Ga0058863_11857311 | 3300004799 | Bacteria | 524 |
| 12 | Ga0058861_10010021 | 3300004800 | Bacteria | 555 |
| 13 | Ga0058862_12741778 | 3300004803 | Bacteria | 501 |
| 14 | Ga0058862_12879863 | 3300004803 | Bacteria | 594 |
| 15 | Ga0070658_10522189 | 3300005327 | Bacteria | 1027 |
| 16 | Ga0070658_10912952 | 3300005327 | Bacteria | 764 |
| 17 | Ga0070676_10975492 | 3300005328 | Bacteria | 635 |
| 18 | Ga0070683_100088801 | 3300005329 | Bacteria | 2900 |
| 19 | Ga0070683_100127469 | 3300005329 | Bacteria | 2406 |
| 20 | Ga0070683_100168642 | 3300005329 | Bacteria | 2077 |
| 21 | Ga0070683_100171800 | 3300005329 | Bacteria | 2057 |
| 22 | Ga0070683_100203832 | 3300005329 | Bacteria | 1879 |
| 23 | Ga0070683_101246879 | 3300005329 | Bacteria | 714 |
| 24 | Ga0070670_100892031 | 3300005331 | Bacteria | 806 |
| 25 | Ga0070677_10080870 | 3300005333 | Bacteria | 1390 |
| 26 | Ga0068869_100448007 | 3300005334 | Bacteria | 1070 |
| 27 | Ga0070666_10572404 | 3300005335 | Bacteria | 823 |
| 28 | Ga0070682_100779498 | 3300005337 | Bacteria | 775 |
| 29 | Ga0068868_100122964 | 3300005338 | Bacteria | 2117 |
| 30 | Ga0068868_100741804 | 3300005338 | Bacteria | 882 |
| 31 | Ga0070660_100448104 | 3300005339 | Bacteria | 1071 |
| 32 | Ga0070689_100628077 | 3300005340 | Bacteria | 933 |
| 33 | Ga0070689_100674192 | 3300005340 | Bacteria | 901 |
| 34 | Ga0070687_100231790 | 3300005343 | Bacteria | 1137 |
| 35 | Ga0070687_101102819 | 3300005343 | Bacteria | 581 |
| 36 | Ga0070661_100329028 | 3300005344 | Bacteria | 1195 |
| 37 | Ga0070661_100461682 | 3300005344 | Bacteria | 1011 |
| 38 | Ga0070661_100542165 | 3300005344 | Bacteria | 935 |
| 39 | Ga0070692_10081812 | 3300005345 | Bacteria | 1741 |
| 40 | Ga0070692_10805542 | 3300005345 | Bacteria | 642 |
| 41 | Ga0070668_100183660 | 3300005347 | Bacteria | 1710 |
| 42 | Ga0070668_100386819 | 3300005347 | Bacteria | 1192 |
| 43 | Ga0070668_101671656 | 3300005347 | Unclassified | 584 |
| 44 | Ga0070668_102277796 | 3300005347 | Bacteria | 501 |
| 45 | Ga0070669_100001369 | 3300005353 | Bacteria | 17574 |
| 46 | Ga0070669_101069562 | 3300005353 | Bacteria | 694 |
| 47 | Ga0070669_101708622 | 3300005353 | Bacteria | 549 |
| 48 | Ga0070675_101268715 | 3300005354 | Bacteria | 679 |
| 49 | Ga0070671_101877317 | 3300005355 | Bacteria | 533 |
| 50 | Ga0070674_100016281 | 3300005356 | Bacteria | 4659 |
| 51 | Ga0070674_100630013 | 3300005356 | Bacteria | 909 |
| 52 | Ga0070674_100977734 | 3300005356 | Bacteria | 741 |
| 53 | Ga0070673_101239063 | 3300005364 | Bacteria | 700 |
| 54 | Ga0070673_101692159 | 3300005364 | Bacteria | 599 |
| 55 | Ga0070659_100000163 | 3300005366 | Bacteria | 51399 |
| 56 | Ga0070659_100220265 | 3300005366 | Bacteria | 1566 |
| 57 | Ga0070659_100377491 | 3300005366 | Bacteria | 1193 |
| 58 | Ga0070659_100661089 | 3300005366 | Bacteria | 901 |
| 59 | Ga0070659_101071500 | 3300005366 | Bacteria | 709 |
| 60 | Ga0070714_100000038 | 3300005435 | Bacteria | 121712 |
| 61 | Ga0070710_11326063 | 3300005437 | Bacteria | 536 |
| 62 | Ga0070701_10242272 | 3300005438 | Bacteria | 1085 |
| 63 | Ga0070701_10270457 | 3300005438 | Bacteria | 1034 |
| 64 | Ga0070701_10683188 | 3300005438 | Bacteria | 689 |
| 65 | Ga0070701_10858159 | 3300005438 | Bacteria | 624 |
| 66 | Ga0070700_100358356 | 3300005441 | Bacteria | 1084 |
| 67 | Ga0070700_101478904 | 3300005441 | Bacteria | 577 |
| 68 | Ga0070663_100580360 | 3300005455 | Unclassified | 940 |
| 69 | Ga0070663_100823825 | 3300005455 | Bacteria | 797 |
| 70 | Ga0070663_100929876 | 3300005455 | Bacteria | 753 |
| 71 | Ga0070678_100169098 | 3300005456 | Bacteria | 1778 |
| 72 | Ga0070678_100823597 | 3300005456 | Bacteria | 844 |
| 73 | Ga0070678_101217379 | 3300005456 | Bacteria | 699 |
| 74 | Ga0070678_102212114 | 3300005456 | Bacteria | 522 |
| 75 | Ga0070662_100394713 | 3300005457 | Bacteria | 1141 |
| 76 | Ga0070681_10642934 | 3300005458 | Bacteria | 976 |
| 77 | Ga0068867_100085190 | 3300005459 | Bacteria | 2389 |
| 78 | Ga0068867_100138513 | 3300005459 | Bacteria | 1900 |
| 79 | Ga0068867_100481527 | 3300005459 | Bacteria | 1063 |
| 80 | Ga0068867_101189951 | 3300005459 | Bacteria | 699 |
| 81 | Ga0068867_101808990 | 3300005459 | Bacteria | 574 |
| 82 | Ga0070685_10732057 | 3300005466 | Bacteria | 724 |
| 83 | Ga0070685_11056158 | 3300005466 | Bacteria | 612 |
| 84 | Ga0070699_101029597 | 3300005518 | Bacteria | 755 |
| 85 | Ga0070679_100138786 | 3300005530 | Bacteria | 2412 |
| 86 | Ga0070684_100092313 | 3300005535 | Bacteria | 2694 |
| 87 | Ga0070684_100099586 | 3300005535 | Bacteria | 2594 |
| 88 | Ga0070684_100824793 | 3300005535 | Bacteria | 867 |
| 89 | Ga0070684_100992794 | 3300005535 | Bacteria | 788 |
| 90 | Ga0070684_101100938 | 3300005535 | Bacteria | 746 |
| 91 | Ga0070684_101219627 | 3300005535 | Bacteria | 708 |
| 92 | Ga0070697_100287310 | 3300005536 | Bacteria | 1412 |
| 93 | Ga0068853_100289582 | 3300005539 | Bacteria | 1512 |
| 94 | Ga0068853_101341377 | 3300005539 | Bacteria | 692 |
| 95 | Ga0068853_101810975 | 3300005539 | Bacteria | 592 |
| 96 | Ga0070672_101133816 | 3300005543 | Bacteria | 696 |
| 97 | Ga0070672_101310663 | 3300005543 | Bacteria | 647 |
| 98 | Ga0070686_100407398 | 3300005544 | Bacteria | 1036 |
| 99 | Ga0070686_100427844 | 3300005544 | Bacteria | 1013 |
| 100 | Ga0070686_100659065 | 3300005544 | Bacteria | 831 |
| 101 | Ga0070695_101251173 | 3300005545 | Bacteria | 612 |
| 102 | Ga0070696_100947156 | 3300005546 | Bacteria | 716 |
| 103 | Ga0070696_101247866 | 3300005546 | Bacteria | 629 |
| 104 | Ga0070693_100424248 | 3300005547 | Bacteria | 927 |
| 105 | Ga0070693_100744291 | 3300005547 | Bacteria | 722 |
| 106 | Ga0070693_101101363 | 3300005547 | Bacteria | 606 |
| 107 | Ga0070665_100803661 | 3300005548 | Bacteria | 953 |
| 108 | Ga0070665_100831143 | 3300005548 | Bacteria | 937 |
| 109 | Ga0070665_102085814 | 3300005548 | Bacteria | 572 |
| 110 | Ga0070704_100208246 | 3300005549 | Bacteria | 1583 |
| 111 | Ga0070704_100419981 | 3300005549 | Bacteria | 1145 |
| 112 | Ga0070704_102141733 | 3300005549 | Bacteria | 520 |
| 113 | Ga0068855_102123524 | 3300005563 | Unclassified | 565 |
| 114 | Ga0070664_100096782 | 3300005564 | Bacteria | 2562 |
| 115 | Ga0070664_100256282 | 3300005564 | Bacteria | 1573 |
| 116 | Ga0070664_100830768 | 3300005564 | Bacteria | 864 |
| 117 | Ga0070664_102082199 | 3300005564 | Bacteria | 538 |
| 118 | Ga0068857_100302818 | 3300005577 | Bacteria | 1474 |
| 119 | Ga0068857_100479257 | 3300005577 | Bacteria | 1166 |
| 120 | Ga0068857_100843086 | 3300005577 | Bacteria | 877 |
| 121 | Ga0068854_100095326 | 3300005578 | Bacteria | 2221 |
| 122 | Ga0068854_100372107 | 3300005578 | Unclassified | 1175 |
| 123 | Ga0068854_100629876 | 3300005578 | Unclassified | 919 |
| 124 | Ga0068854_102223065 | 3300005578 | Bacteria | 508 |
| 125 | Ga0068856_100579196 | 3300005614 | Unclassified | 1143 |
| 126 | Ga0068856_101047471 | 3300005614 | Bacteria | 834 |
| 127 | Ga0068856_101209963 | 3300005614 | Bacteria | 772 |
| 128 | Ga0068856_102505251 | 3300005614 | Bacteria | 523 |
| 129 | Ga0070702_100108743 | 3300005615 | Bacteria | 1715 |
| 130 | Ga0070702_100250424 | 3300005615 | Bacteria | 1200 |
| 131 | Ga0070702_100384748 | 3300005615 | Bacteria | 999 |
| 132 | Ga0070702_100388494 | 3300005615 | Bacteria | 995 |
| 133 | Ga0070702_100635650 | 3300005615 | Bacteria | 805 |
| 134 | Ga0068852_100391696 | 3300005616 | Bacteria | 1365 |
| 135 | Ga0068852_100462060 | 3300005616 | Bacteria | 1258 |
| 136 | Ga0068852_100616329 | 3300005616 | Bacteria | 1091 |
| 137 | Ga0068852_101150383 | 3300005616 | Bacteria | 797 |
| 138 | Ga0068852_101410145 | 3300005616 | Unclassified | 719 |
| 139 | Ga0068852_102248972 | 3300005616 | Bacteria | 566 |
| 140 | Ga0068864_100047501 | 3300005618 | Bacteria | 3687 |
| 141 | Ga0068866_10626014 | 3300005718 | Bacteria | 730 |
| 142 | Ga0068861_100031308 | 3300005719 | Bacteria | 3908 |
| 143 | Ga0068861_100144949 | 3300005719 | Bacteria | 1943 |
| 144 | Ga0068861_100180024 | 3300005719 | Bacteria | 1759 |
| 145 | Ga0068861_100632189 | 3300005719 | Bacteria | 986 |
| 146 | Ga0068851_10677946 | 3300005834 | Bacteria | 633 |
| 147 | Ga0068870_10209433 | 3300005840 | Bacteria | 1187 |
| 148 | Ga0068870_10423617 | 3300005840 | Bacteria | 871 |
| 149 | Ga0068858_100045636 | 3300005842 | Bacteria | 4062 |
| 150 | Ga0068858_100120054 | 3300005842 | Bacteria | 2458 |
| 151 | Ga0068858_100598301 | 3300005842 | Bacteria | 1070 |
| 152 | Ga0068858_101155491 | 3300005842 | Bacteria | 761 |
| 153 | Ga0068860_100724927 | 3300005843 | Bacteria | 1005 |
| 154 | Ga0068862_100395023 | 3300005844 | Bacteria | 1293 |
| 155 | Ga0068862_100730564 | 3300005844 | Bacteria | 962 |
| 156 | Ga0081455_10066658 | 3300005937 | Bacteria | 3005 |
| 157 | Ga0081455_10112615 | 3300005937 | Bacteria | 2159 |
| 158 | Ga0081455_10116703 | 3300005937 | Bacteria | 2111 |
| 159 | Ga0081455_10172862 | 3300005937 | Bacteria | 1644 |
| 160 | Ga0081455_10338365 | 3300005937 | Bacteria | 1066 |
| 161 | Ga0081455_10545478 | 3300005937 | Bacteria | 768 |
| 162 | Ga0081538_10000450 | 3300005981 | Bacteria | 46279 |
| 163 | Ga0081538_10001846 | 3300005981 | Bacteria | 21363 |
| 164 | Ga0081538_10014284 | 3300005981 | Bacteria | 6222 |
| 165 | Ga0081538_10019086 | 3300005981 | Bacteria | 5115 |
| 166 | Ga0081538_10023060 | 3300005981 | Bacteria | 4485 |
| 167 | Ga0081538_10029547 | 3300005981 | Bacteria | 3743 |
| 168 | Ga0081538_10175864 | 3300005981 | Bacteria | 925 |
| 169 | Ga0081538_10258358 | 3300005981 | Bacteria | 659 |
| 170 | Ga0081540_1113232 | 3300005983 | Bacteria | 1142 |
| 171 | Ga0081540_1224352 | 3300005983 | Bacteria | 667 |
| 172 | Ga0081539_10177518 | 3300005985 | Bacteria | 1002 |
| 173 | Ga0070717_10028957 | 3300006028 | Bacteria | 4438 |
| 174 | Ga0075365_10240014 | 3300006038 | Bacteria | 1273 |
| 175 | Ga0075365_10507640 | 3300006038 | Bacteria | 852 |
| 176 | Ga0075363_100928076 | 3300006048 | Bacteria | 534 |
| 177 | Ga0075364_10656810 | 3300006051 | Unclassified | 716 |
| 178 | Ga0075432_10210173 | 3300006058 | Bacteria | 774 |
| 179 | Ga0075432_10264181 | 3300006058 | Bacteria | 703 |
| 180 | Ga0070715_10990159 | 3300006163 | Bacteria | 523 |
| 181 | Ga0068871_100971474 | 3300006358 | Bacteria | 790 |
| 182 | Ga0068871_101907625 | 3300006358 | Bacteria | 565 |
| 183 | Ga0068871_102431051 | 3300006358 | Bacteria | 500 |
| 184 | Ga0075428_100040740 | 3300006844 | Bacteria | 5109 |
| 185 | Ga0075428_101304461 | 3300006844 | Bacteria | 763 |
| 186 | Ga0075428_102292577 | 3300006844 | Bacteria | 556 |
| 187 | Ga0075428_102446636 | 3300006844 | Bacteria | 535 |
| 188 | Ga0075431_100743300 | 3300006847 | Bacteria | 957 |
| 189 | Ga0075434_102052831 | 3300006871 | Bacteria | 577 |
| 190 | Ga0075429_101779028 | 3300006880 | Bacteria | 535 |
| 191 | Ga0068865_100049036 | 3300006881 | Bacteria | 2908 |
| 192 | Ga0068865_101308406 | 3300006881 | Bacteria | 645 |
| 193 | Ga0099795_10214645 | 3300007788 | Bacteria | 817 |
| 194 | Ga0105240_10004346 | 3300009093 | Bacteria | 21634 |
| 195 | Ga0105240_12578293 | 3300009093 | Bacteria | 525 |
| 196 | Ga0111539_10029334 | 3300009094 | Bacteria | 6703 |
| 197 | Ga0111539_10269561 | 3300009094 | Bacteria | 1982 |
| 198 | Ga0111539_10287971 | 3300009094 | Bacteria | 1911 |
| 199 | Ga0111539_10781214 | 3300009094 | Bacteria | 1111 |
| 200 | Ga0111539_11161066 | 3300009094 | Bacteria | 897 |
| 201 | Ga0105245_10009166 | 3300009098 | Bacteria | 8627 |
| 202 | Ga0105245_10300674 | 3300009098 | Bacteria | 1574 |
| 203 | Ga0105245_10360343 | 3300009098 | Bacteria | 1443 |
| 204 | Ga0105245_11375562 | 3300009098 | Bacteria | 756 |
| 205 | Ga0105247_10568427 | 3300009101 | Bacteria | 836 |
| 206 | Ga0114129_12309923 | 3300009147 | Bacteria | 645 |
| 207 | Ga0105243_10039614 | 3300009148 | Bacteria | 3675 |
| 208 | Ga0105243_10057996 | 3300009148 | Bacteria | 3085 |
| 209 | Ga0105243_10108212 | 3300009148 | Bacteria | 2320 |
| 210 | Ga0105243_10118532 | 3300009148 | Bacteria | 2227 |
| 211 | Ga0105243_10275620 | 3300009148 | Bacteria | 1513 |
| 212 | Ga0105243_10467247 | 3300009148 | Bacteria | 1188 |
| 213 | Ga0105243_10586263 | 3300009148 | Bacteria | 1071 |
| 214 | Ga0105241_10519319 | 3300009174 | Bacteria | 1065 |
| 215 | Ga0105241_11147056 | 3300009174 | Bacteria | 734 |
| 216 | Ga0105241_12207338 | 3300009174 | Bacteria | 546 |
| 217 | Ga0105242_10062382 | 3300009176 | Bacteria | 3067 |
| 218 | Ga0105242_10231295 | 3300009176 | Bacteria | 1657 |
| 219 | Ga0105242_10618310 | 3300009176 | Bacteria | 1049 |
| 220 | Ga0105242_11234335 | 3300009176 | Bacteria | 768 |
| 221 | Ga0105248_10544926 | 3300009177 | Bacteria | 1309 |
| 222 | Ga0105248_10547751 | 3300009177 | Bacteria | 1305 |
| 223 | Ga0105248_10779433 | 3300009177 | Bacteria | 1079 |
| 224 | Ga0105237_10559303 | 3300009545 | Bacteria | 1150 |
| 225 | Ga0105238_10453936 | 3300009551 | Bacteria | 1279 |
| 226 | Ga0105238_10850349 | 3300009551 | Bacteria | 929 |
| 227 | Ga0105249_10230734 | 3300009553 | Bacteria | 1825 |
| 228 | Ga0105249_10583083 | 3300009553 | Bacteria | 1171 |
| 229 | Ga0105249_12916858 | 3300009553 | Bacteria | 549 |
| 230 | Ga0099796_10042774 | 3300010159 | Bacteria | 1540 |
| 231 | Ga0105239_10147091 | 3300010375 | Bacteria | 2629 |
| 232 | Ga0105239_10333492 | 3300010375 | Bacteria | 1711 |
| 233 | Ga0105239_10609526 | 3300010375 | Bacteria | 1246 |
| 234 | Ga0105239_12332888 | 3300010375 | Bacteria | 623 |
| 235 | Ga0105246_10006461 | 3300011119 | Bacteria | 7161 |
| 236 | Ga0105246_10201263 | 3300011119 | Bacteria | 1548 |
| 237 | Ga0105246_10473626 | 3300011119 | Unclassified | 1058 |
| 238 | Ga0105246_10552015 | 3300011119 | Bacteria | 987 |
| 239 | Ga0105246_11320429 | 3300011119 | Bacteria | 669 |
| 240 | Ga0105246_11562535 | 3300011119 | Bacteria | 622 |
| 241 | Ga0157345_1016603 | 3300012498 | Bacteria | 709 |
| 242 | Ga0157324_1026337 | 3300012506 | Bacteria | 630 |
| 243 | Ga0157326_1039481 | 3300012513 | Bacteria | 657 |
| 244 | Ga0157371_10622174 | 3300013102 | Bacteria | 804 |
| 245 | Ga0157371_10627480 | 3300013102 | Unclassified | 801 |
| 246 | Ga0157371_10629219 | 3300013102 | Bacteria | 800 |
| 247 | Ga0157371_11511339 | 3300013102 | Bacteria | 524 |
| 248 | Ga0157370_11373060 | 3300013104 | Bacteria | 636 |
| 249 | Ga0157369_11287085 | 3300013105 | Bacteria | 745 |
| 250 | Ga0157374_12050308 | 3300013296 | Bacteria | 599 |
| 251 | Ga0157378_10327145 | 3300013297 | Bacteria | 1491 |
| 252 | Ga0157378_10864311 | 3300013297 | Bacteria | 933 |
| 253 | Ga0157378_11370853 | 3300013297 | Bacteria | 749 |
| 254 | Ga0157378_12775037 | 3300013297 | Bacteria | 542 |
| 255 | Ga0163162_10353807 | 3300013306 | Bacteria | 1601 |
| 256 | Ga0163162_10762318 | 3300013306 | Bacteria | 1086 |
| 257 | Ga0163162_12709653 | 3300013306 | Bacteria | 571 |
| 258 | Ga0157372_10128777 | 3300013307 | Bacteria | 2911 |
| 259 | Ga0157372_10650031 | 3300013307 | Bacteria | 1228 |
| 260 | Ga0157372_10769543 | 3300013307 | Bacteria | 1119 |
| 261 | Ga0157372_11414980 | 3300013307 | Bacteria | 802 |
| 262 | Ga0157372_12628893 | 3300013307 | Bacteria | 578 |
| 263 | Ga0157375_11189861 | 3300013308 | Bacteria | 894 |
| 264 | Ga0157375_12493461 | 3300013308 | Bacteria | 617 |
| 265 | Ga0157375_13780239 | 3300013308 | Bacteria | 503 |
| 266 | Ga0163163_10293285 | 3300014325 | Bacteria | 1679 |
| 267 | Ga0163163_11096261 | 3300014325 | Bacteria | 859 |
| 268 | Ga0163163_11647475 | 3300014325 | Unclassified | 702 |
| 269 | Ga0157380_10259732 | 3300014326 | Bacteria | 1577 |
| 270 | Ga0157380_10411131 | 3300014326 | Bacteria | 1287 |
| 271 | Ga0157380_10649427 | 3300014326 | Bacteria | 1052 |
| 272 | Ga0182008_10104627 | 3300014497 | Bacteria | 1400 |
| 273 | Ga0157377_10106798 | 3300014745 | Bacteria | 1677 |
| 274 | Ga0157377_10387709 | 3300014745 | Bacteria | 948 |
| 275 | Ga0157377_10825133 | 3300014745 | Bacteria | 686 |
| 276 | Ga0157379_10245528 | 3300014968 | Bacteria | 1624 |
| 277 | Ga0157379_11309877 | 3300014968 | Bacteria | 700 |
| 278 | Ga0157376_10806838 | 3300014969 | Bacteria | 951 |
| 279 | Ga0157376_12748890 | 3300014969 | Bacteria | 532 |
| 280 | Ga0163161_12017680 | 3300017792 | Bacteria | 513 |
| 281 | Ga0206356_11473832 | 3300020070 | Bacteria | 3873 |
| 282 | Ga0206356_11500562 | 3300020070 | Bacteria | 510 |
| 283 | Ga0206355_1414211 | 3300020076 | Unclassified | 502 |
| 284 | Ga0206350_10418688 | 3300020080 | Bacteria | 582 |
| 285 | Ga0206354_10237246 | 3300020081 | Bacteria | 673 |
| 286 | Ga0206354_11439709 | 3300020081 | Bacteria | 783 |
| 287 | Ga0206353_10284451 | 3300020082 | Bacteria | 677 |
| 288 | Ga0206353_10667699 | 3300020082 | Bacteria | 925 |
| 289 | Ga0213874_10398600 | 3300021377 | Bacteria | 535 |
| 290 | Ga0224712_10260989 | 3300022467 | Bacteria | 802 |
| 291 | Ga0224712_10311454 | 3300022467 | Bacteria | 738 |
| 292 | Ga0224712_10545383 | 3300022467 | Bacteria | 563 |
| 293 | Ga0207426_1043161 | 3300025302 | Bacteria | 1386 |
| 294 | Ga0207656_10269875 | 3300025321 | Bacteria | 837 |
| 295 | Ga0207656_10532980 | 3300025321 | Bacteria | 597 |
| 296 | Ga0207692_10070795 | 3300025898 | Bacteria | 1837 |
| 297 | Ga0207642_10203767 | 3300025899 | Bacteria | 1094 |
| 298 | Ga0207642_10206510 | 3300025899 | Bacteria | 1089 |
| 299 | Ga0207688_10023583 | 3300025901 | Bacteria | 3370 |
| 300 | Ga0207688_10207314 | 3300025901 | Bacteria | 1177 |
| 301 | Ga0207647_10531364 | 3300025904 | Bacteria | 654 |
| 302 | Ga0207645_10228028 | 3300025907 | Bacteria | 1229 |
| 303 | Ga0207645_11071730 | 3300025907 | Bacteria | 544 |
| 304 | Ga0207643_10095843 | 3300025908 | Bacteria | 1735 |
| 305 | Ga0207643_10130821 | 3300025908 | Bacteria | 1493 |
| 306 | Ga0207643_10171754 | 3300025908 | Bacteria | 1309 |
| 307 | Ga0207643_10277791 | 3300025908 | Bacteria | 1038 |
| 308 | Ga0207705_10758385 | 3300025909 | Bacteria | 754 |
| 309 | Ga0207705_10915255 | 3300025909 | Bacteria | 679 |
| 310 | Ga0207695_10042059 | 3300025913 | Bacteria | 4885 |
| 311 | Ga0207695_10536383 | 3300025913 | Bacteria | 1052 |
| 312 | Ga0207671_11252185 | 3300025914 | Bacteria | 579 |
| 313 | Ga0207660_10447815 | 3300025917 | Bacteria | 1044 |
| 314 | Ga0207660_10510331 | 3300025917 | Bacteria | 976 |
| 315 | Ga0207662_10171790 | 3300025918 | Bacteria | 1390 |
| 316 | Ga0207662_10276092 | 3300025918 | Bacteria | 1110 |
| 317 | Ga0207657_10123988 | 3300025919 | Bacteria | 2123 |
| 318 | Ga0207657_11399063 | 3300025919 | Bacteria | 525 |
| 319 | Ga0207649_10961634 | 3300025920 | Bacteria | 671 |
| 320 | Ga0207652_10252739 | 3300025921 | Bacteria | 1589 |
| 321 | Ga0207681_10001085 | 3300025923 | Bacteria | 17649 |
| 322 | Ga0207681_10893746 | 3300025923 | Bacteria | 744 |
| 323 | Ga0207681_11215566 | 3300025923 | Bacteria | 633 |
| 324 | Ga0207694_10807346 | 3300025924 | Bacteria | 793 |
| 325 | Ga0207650_10280737 | 3300025925 | Bacteria | 1356 |
| 326 | Ga0207659_10892909 | 3300025926 | Bacteria | 764 |
| 327 | Ga0207687_10060950 | 3300025927 | Bacteria | 2663 |
| 328 | Ga0207687_10099278 | 3300025927 | Bacteria | 2139 |
| 329 | Ga0207687_10229866 | 3300025927 | Bacteria | 1465 |
| 330 | Ga0207687_10542543 | 3300025927 | Bacteria | 975 |
| 331 | Ga0207687_10549704 | 3300025927 | Bacteria | 969 |
| 332 | Ga0207664_10000040 | 3300025929 | Bacteria | 158895 |
| 333 | Ga0207664_10143007 | 3300025929 | Bacteria | 2026 |
| 334 | Ga0207664_10943205 | 3300025929 | Bacteria | 774 |
| 335 | Ga0207644_10911536 | 3300025931 | Bacteria | 737 |
| 336 | Ga0207690_10000166 | 3300025932 | Bacteria | 51430 |
| 337 | Ga0207690_10323670 | 3300025932 | Bacteria | 1213 |
| 338 | Ga0207706_10043662 | 3300025933 | Bacteria | 3972 |
| 339 | Ga0207686_10160757 | 3300025934 | Bacteria | 1574 |
| 340 | Ga0207686_10588031 | 3300025934 | Bacteria | 874 |
| 341 | Ga0207709_10028379 | 3300025935 | Bacteria | 3235 |
| 342 | Ga0207709_10031902 | 3300025935 | Bacteria | 3082 |
| 343 | Ga0207709_10079912 | 3300025935 | Bacteria | 2104 |
| 344 | Ga0207709_10155445 | 3300025935 | Bacteria | 1589 |
| 345 | Ga0207709_10235774 | 3300025935 | Bacteria | 1328 |
| 346 | Ga0207709_11705293 | 3300025935 | Bacteria | 524 |
| 347 | Ga0207670_10302668 | 3300025936 | Bacteria | 1252 |
| 348 | Ga0207670_11304502 | 3300025936 | Bacteria | 616 |
| 349 | Ga0207669_10049960 | 3300025937 | Bacteria | 2497 |
| 350 | Ga0207669_10371662 | 3300025937 | Bacteria | 1111 |
| 351 | Ga0207669_10458085 | 3300025937 | Bacteria | 1012 |
| 352 | Ga0207704_10028200 | 3300025938 | Bacteria | 3111 |
| 353 | Ga0207704_10319627 | 3300025938 | Bacteria | 1197 |
| 354 | Ga0207704_10484685 | 3300025938 | Bacteria | 993 |
| 355 | Ga0207691_10109452 | 3300025940 | Bacteria | 2458 |
| 356 | Ga0207691_10167510 | 3300025940 | Bacteria | 1925 |
| 357 | Ga0207711_10535086 | 3300025941 | Bacteria | 1093 |
| 358 | Ga0207711_10542246 | 3300025941 | Bacteria | 1085 |
| 359 | Ga0207711_11016862 | 3300025941 | Bacteria | 769 |
| 360 | Ga0207689_10342529 | 3300025942 | Bacteria | 1242 |
| 361 | Ga0207689_10596401 | 3300025942 | Bacteria | 929 |
| 362 | Ga0207661_10045715 | 3300025944 | Bacteria | 3467 |
| 363 | Ga0207661_10053665 | 3300025944 | Bacteria | 3226 |
| 364 | Ga0207661_10098379 | 3300025944 | Bacteria | 2452 |
| 365 | Ga0207661_10248229 | 3300025944 | Bacteria | 1581 |
| 366 | Ga0207661_10335614 | 3300025944 | Bacteria | 1361 |
| 367 | Ga0207661_10548559 | 3300025944 | Bacteria | 1059 |
| 368 | Ga0207661_10871099 | 3300025944 | Bacteria | 829 |
| 369 | Ga0207661_12006947 | 3300025944 | Bacteria | 524 |
| 370 | Ga0207679_10735407 | 3300025945 | Bacteria | 897 |
| 371 | Ga0207679_10896251 | 3300025945 | Bacteria | 811 |
| 372 | Ga0207679_11230685 | 3300025945 | Bacteria | 687 |
| 373 | Ga0207712_10312349 | 3300025961 | Bacteria | 1294 |
| 374 | Ga0207712_10561724 | 3300025961 | Bacteria | 983 |
| 375 | Ga0207668_10360294 | 3300025972 | Bacteria | 1218 |
| 376 | Ga0207668_10836635 | 3300025972 | Bacteria | 816 |
| 377 | Ga0207668_10976807 | 3300025972 | Bacteria | 756 |
| 378 | Ga0207640_10187977 | 3300025981 | Bacteria | 1554 |
| 379 | Ga0207640_10422175 | 3300025981 | Bacteria | 1092 |
| 380 | Ga0207640_10603786 | 3300025981 | Bacteria | 929 |
| 381 | Ga0207640_10848514 | 3300025981 | Bacteria | 795 |
| 382 | Ga0207640_11183267 | 3300025981 | Unclassified | 679 |
| 383 | Ga0207677_10086851 | 3300026023 | Bacteria | 2263 |
| 384 | Ga0207677_10590170 | 3300026023 | Unclassified | 974 |
| 385 | Ga0207677_11200098 | 3300026023 | Bacteria | 694 |
| 386 | Ga0207703_10180352 | 3300026035 | Bacteria | 1863 |
| 387 | Ga0207703_10382988 | 3300026035 | Bacteria | 1301 |
| 388 | Ga0207703_10505497 | 3300026035 | Bacteria | 1135 |
| 389 | Ga0207703_10728730 | 3300026035 | Bacteria | 944 |
| 390 | Ga0207703_11462963 | 3300026035 | Bacteria | 657 |
| 391 | Ga0207639_10273731 | 3300026041 | Bacteria | 1482 |
| 392 | Ga0207639_11347431 | 3300026041 | Bacteria | 670 |
| 393 | Ga0207678_10181200 | 3300026067 | Bacteria | 1799 |
| 394 | Ga0207678_10220954 | 3300026067 | Bacteria | 1622 |
| 395 | Ga0207678_10266665 | 3300026067 | Bacteria | 1468 |
| 396 | Ga0207678_10306085 | 3300026067 | Bacteria | 1366 |
| 397 | Ga0207678_10433415 | 3300026067 | Bacteria | 1141 |
| 398 | Ga0207678_10788772 | 3300026067 | Bacteria | 838 |
| 399 | Ga0207708_10003129 | 3300026075 | Bacteria | 12181 |
| 400 | Ga0207708_10216848 | 3300026075 | Bacteria | 1532 |
| 401 | Ga0207708_10765864 | 3300026075 | Bacteria | 829 |
| 402 | Ga0207708_10986028 | 3300026075 | Bacteria | 732 |
| 403 | Ga0207708_11014272 | 3300026075 | Bacteria | 721 |
| 404 | Ga0207702_10023957 | 3300026078 | Bacteria | 5065 |
| 405 | Ga0207702_11179177 | 3300026078 | Unclassified | 760 |
| 406 | Ga0207702_11491755 | 3300026078 | Bacteria | 670 |
| 407 | Ga0207641_10611589 | 3300026088 | Bacteria | 1068 |
| 408 | Ga0207641_10904218 | 3300026088 | Bacteria | 877 |
| 409 | Ga0207641_11142855 | 3300026088 | Bacteria | 778 |
| 410 | Ga0207648_10190212 | 3300026089 | Bacteria | 1818 |
| 411 | Ga0207648_10367361 | 3300026089 | Bacteria | 1299 |
| 412 | Ga0207648_10408991 | 3300026089 | Bacteria | 1230 |
| 413 | Ga0207648_10911298 | 3300026089 | Bacteria | 821 |
| 414 | Ga0207648_11407595 | 3300026089 | Bacteria | 655 |
| 415 | Ga0207676_10100175 | 3300026095 | Bacteria | 2400 |
| 416 | Ga0207676_11183938 | 3300026095 | Bacteria | 757 |
| 417 | Ga0207674_10362681 | 3300026116 | Bacteria | 1400 |
| 418 | Ga0207674_10540250 | 3300026116 | Bacteria | 1126 |
| 419 | Ga0207675_100022121 | 3300026118 | Bacteria | 5919 |
| 420 | Ga0207675_100067353 | 3300026118 | Bacteria | 3347 |
| 421 | Ga0207675_100426657 | 3300026118 | Bacteria | 1310 |
| 422 | Ga0207675_100901054 | 3300026118 | Bacteria | 901 |
| 423 | Ga0207683_10077799 | 3300026121 | Bacteria | 2938 |
| 424 | Ga0207683_11267221 | 3300026121 | Bacteria | 683 |
| 425 | Ga0207683_11406880 | 3300026121 | Bacteria | 645 |
| 426 | Ga0207698_10379276 | 3300026142 | Bacteria | 1345 |
| 427 | Ga0207698_11012984 | 3300026142 | Bacteria | 842 |
| 428 | Ga0207698_11068320 | 3300026142 | Unclassified | 819 |
| 429 | Ga0209998_10057568 | 3300027717 | Bacteria | 910 |
| 430 | Ga0209974_10472213 | 3300027876 | Bacteria | 500 |
| 431 | Ga0207428_10041298 | 3300027907 | Bacteria | 3735 |
| 432 | Ga0207428_10207355 | 3300027907 | Bacteria | 1474 |
| 433 | Ga0207428_10314759 | 3300027907 | Bacteria | 1157 |
| 434 | Ga0268265_10198653 | 3300028380 | Bacteria | 1738 |
| 435 | Ga0268265_10424079 | 3300028380 | Bacteria | 1236 |
| 436 | Ga0268265_11571951 | 3300028380 | Bacteria | 662 |
| 437 | Ga0268264_10948347 | 3300028381 | Bacteria | 865 |
| 438 | Ga0265338_10041520 | 3300028800 | Bacteria | 4300 |
| 439 | Ga0265760_10063686 | 3300031090 | Bacteria | 1123 |
| 440 | Ga0265327_10111064 | 3300031251 | Bacteria | 1310 |
| 441 | Ga0307408_100059584 | 3300031548 | Bacteria | 2779 |
| 442 | Ga0307408_102247575 | 3300031548 | Bacteria | 528 |
| 443 | Ga0307516_10002256 | 3300031730 | Bacteria | 26004 |
| 444 | Ga0307405_10021930 | 3300031731 | Bacteria | 3601 |
| 445 | Ga0307405_10031980 | 3300031731 | Bacteria | 3104 |
| 446 | Ga0307405_10332989 | 3300031731 | Bacteria | 1164 |
| 447 | Ga0307405_11025780 | 3300031731 | Bacteria | 705 |
| 448 | Ga0307413_10041518 | 3300031824 | Bacteria | 2694 |
| 449 | Ga0307413_10537104 | 3300031824 | Bacteria | 946 |
| 450 | Ga0307413_10785686 | 3300031824 | Bacteria | 799 |
| 451 | Ga0307413_11454009 | 3300031824 | Bacteria | 604 |
| 452 | Ga0307410_10045594 | 3300031852 | Bacteria | 2920 |
| 453 | Ga0307410_10372875 | 3300031852 | Bacteria | 1146 |
| 454 | Ga0307410_12131334 | 3300031852 | Bacteria | 502 |
| 455 | Ga0326468_10028937 | 3300031889 | Bacteria | 720 |
| 456 | Ga0326468_10104625 | 3300031889 | Bacteria | 527 |
| 457 | Ga0307406_10086271 | 3300031901 | Bacteria | 2101 |
| 458 | Ga0307406_10117270 | 3300031901 | Bacteria | 1844 |
| 459 | Ga0307406_10572397 | 3300031901 | Bacteria | 927 |
| 460 | Ga0307406_10888887 | 3300031901 | Bacteria | 758 |
| 461 | Ga0307406_11015202 | 3300031901 | Bacteria | 712 |
| 462 | Ga0307406_11472946 | 3300031901 | Bacteria | 598 |
| 463 | Ga0307406_11570932 | 3300031901 | Bacteria | 580 |
| 464 | Ga0307406_12028759 | 3300031901 | Bacteria | 514 |
| 465 | Ga0307407_10319637 | 3300031903 | Bacteria | 1089 |
| 466 | Ga0307407_10554430 | 3300031903 | Bacteria | 850 |
| 467 | Ga0307407_11292726 | 3300031903 | Bacteria | 572 |
| 468 | Ga0307412_10015659 | 3300031911 | Bacteria | 4501 |
| 469 | Ga0307409_100010481 | 3300031995 | Bacteria | 5768 |
| 470 | Ga0307409_100289624 | 3300031995 | Bacteria | 1518 |
| 471 | Ga0307409_100409576 | 3300031995 | Bacteria | 1297 |
| 472 | Ga0307409_101939195 | 3300031995 | Bacteria | 618 |
| 473 | Ga0307409_102213745 | 3300031995 | Bacteria | 579 |
| 474 | Ga0307416_100091949 | 3300032002 | Bacteria | 2607 |
| 475 | Ga0307416_100259254 | 3300032002 | Bacteria | 1698 |
| 476 | Ga0307416_100412124 | 3300032002 | Bacteria | 1392 |
| 477 | Ga0307416_100474025 | 3300032002 | Bacteria | 1310 |
| 478 | Ga0307416_101069416 | 3300032002 | Bacteria | 911 |
| 479 | Ga0307416_101113540 | 3300032002 | Bacteria | 894 |
| 480 | Ga0307416_101211040 | 3300032002 | Bacteria | 861 |
| 481 | Ga0307416_102615881 | 3300032002 | Bacteria | 602 |
| 482 | Ga0307414_10032571 | 3300032004 | Bacteria | 3434 |
| 483 | Ga0307414_12027535 | 3300032004 | Bacteria | 537 |
| 484 | Ga0307414_12110678 | 3300032004 | Bacteria | 526 |
| 485 | Ga0307411_10091701 | 3300032005 | Bacteria | 2123 |
| 486 | Ga0307411_10325246 | 3300032005 | Bacteria | 1243 |
| 487 | Ga0307411_11991280 | 3300032005 | Bacteria | 542 |
| 488 | Ga0307415_100003903 | 3300032126 | Bacteria | 7662 |
| 489 | Ga0307415_100013966 | 3300032126 | Bacteria | 4704 |
| 490 | Ga0307415_100019768 | 3300032126 | Bacteria | 4096 |
| 491 | Ga0307415_100160966 | 3300032126 | Bacteria | 1740 |
| 492 | Ga0307415_100816966 | 3300032126 | Bacteria | 852 |
| 493 | Ga0307415_100855531 | 3300032126 | Bacteria | 835 |
| 494 | Ga0307415_101217444 | 3300032126 | Bacteria | 710 |
| 495 | Ga0373949_0033525 | 3300035090 | Bacteria | 1234 |
| 496 | Ga0373923_0142175 | 3300035111 | Unclassified | 1085 |
| 497 | Ga0373941_0002756 | 3300035115 | Bacteria | 3901 |
| 498 | Ga0373960_0006492 | 3300035121 | Bacteria | 2746 |
| 499 | Ga0373962_0032887 | 3300035242 | Bacteria | 1429 |
| 500 | Ga0373931_0212039 | 3300035691 | Bacteria | 1162 |
| 501 | Ga0395900_0014319 | 3300037418 | Bacteria | 8097 |
| 502 | Ga0395900_0218819 | 3300037418 | Bacteria | 1921 |
| 503 | Ga0395900_1299607 | 3300037418 | Bacteria | 641 |
| 504 | Ga0395900_1320965 | 3300037418 | Bacteria | 635 |
| 505 | Ga0395900_1489433 | 3300037418 | Bacteria | 589 |
| 506 | Ga0395900_1588082 | 3300037418 | Unclassified | 566 |
| 507 | Ga0395898_0164200 | 3300037466 | Bacteria | 2124 |
| 508 | Ga0395898_0266121 | 3300037466 | Bacteria | 1635 |
| 509 | Ga0395898_0306574 | 3300037466 | Bacteria | 1515 |
| 510 | Ga0395898_1298679 | 3300037466 | Bacteria | 657 |
| 511 | Ga0395898_1464395 | 3300037466 | Bacteria | 609 |
| 512 | Ga0395905_0013964 | 3300037471 | Bacteria | 7682 |
| 513 | Ga0395905_0566093 | 3300037471 | Bacteria | 1038 |
| 514 | Ga0395901_0010606 | 3300038443 | Bacteria | 9334 |
| 515 | Ga0395901_0055093 | 3300038443 | Bacteria | 4134 |
| 516 | Ga0395901_0200294 | 3300038443 | Bacteria | 2093 |
| 517 | Ga0395901_0784724 | 3300038443 | Bacteria | 943 |
| 518 | Ga0395901_0943677 | 3300038443 | Bacteria | 842 |
| 519 | Ga0395901_1525822 | 3300038443 | Bacteria | 623 |
| 520 | Ga0395901_1743716 | 3300038443 | Bacteria | 573 |
| 521 | Ga0436360_0286471 | 3300039438 | Bacteria | 522 |
| 522 | Ga0436363_0868929 | 3300039450 | Bacteria | 959 |
| 523 | Ga0436363_1403311 | 3300039450 | Bacteria | 535 |
| 524 | Ga0439453_0101691 | 3300041408 | Bacteria | 641 |
| 525 | Ga0451789_0740838 | 3300041443 | Unclassified | 549 |
| 526 | Ga0451797_1067062 | 3300041453 | Bacteria | 550 |
| 527 | Ga0451802_0735710 | 3300041460 | Bacteria | 926 |
| 528 | Ga0451802_1266157 | 3300041460 | Bacteria | 687 |
| 529 | Ga0451847_0113160 | 3300041503 | Bacteria | 527 |
| 530 | Ga0451855_0707975 | 3300041511 | Bacteria | 586 |
| 531 | Ga0451855_1197243 | 3300041511 | Bacteria | 579 |
| 532 | Ga0451855_1394352 | 3300041511 | Bacteria | 743 |
| 533 | Ga0439448_0137271 | 3300042005 | Bacteria | 845 |
| 534 | Ga0439448_0326166 | 3300042005 | Bacteria | 546 |
| 535 | Ga0439450_017523 | 3300042008 | Bacteria | 1494 |
| 536 | Ga0439454_011647 | 3300042011 | Bacteria | 1179 |
| 537 | Ga0439456_142608 | 3300042013 | Bacteria | 556 |
| 538 | Ga0439463_133979 | 3300042016 | Bacteria | 641 |
| 539 | Ga0450902_006060 | 3300042137 | Bacteria | 1844 |
| 540 | Ga0439458_0031983 | 3300042157 | Bacteria | 1256 |
| 541 | Ga0439444_0052872 | 3300042437 | Bacteria | 830 |
| 542 | Ga0439459_0104365 | 3300042438 | Bacteria | 697 |
| 543 | Ga0439464_0036643 | 3300042439 | Bacteria | 1388 |
| 544 | Ga0439460_0021737 | 3300042461 | Bacteria | 1756 |
| 545 | Ga0439440_0039689 | 3300042993 | Bacteria | 1143 |
| 546 | Ga0466969_0020586 | 3300044656 | Bacteria | 3415 |
| 547 | Ga0466965_0273961 | 3300044683 | Bacteria | 910 |
| 548 | Ga0466965_0300487 | 3300044683 | Bacteria | 871 |
| 549 | Ga0466965_0547023 | 3300044683 | Bacteria | 653 |
| 550 | Ga0466961_0084739 | 3300044693 | Bacteria | 2004 |
| 551 | Ga0466961_0327749 | 3300044693 | Bacteria | 933 |
| 552 | Ga0466963_0080716 | 3300044694 | Bacteria | 2202 |
| 553 | Ga0466963_0118022 | 3300044694 | Bacteria | 1824 |
| 554 | Ga0466963_0219460 | 3300044694 | Bacteria | 1331 |
| 555 | Ga0466963_0285048 | 3300044694 | Bacteria | 1161 |
| 556 | Ga0466963_0572240 | 3300044694 | Bacteria | 798 |
| 557 | Ga0466963_0669509 | 3300044694 | Bacteria | 732 |
| 558 | Ga0466963_0787822 | 3300044694 | Bacteria | 670 |
| 559 | Ga0466964_0455268 | 3300044706 | Bacteria | 679 |
| 560 | Ga0466964_0814817 | 3300044706 | Bacteria | 529 |
| 561 | Ga0466964_0836810 | 3300044706 | Bacteria | 522 |
| 562 | Ga0466971_0190928 | 3300044719 | Bacteria | 965 |
| 563 | Ga0466968_0101102 | 3300044735 | Bacteria | 1287 |
| 564 | Ga0466970_0018283 | 3300044765 | Bacteria | 3627 |
| 565 | Ga0466970_0498190 | 3300044765 | Bacteria | 701 |
| 566 | Ga0466970_0583917 | 3300044765 | Bacteria | 647 |
| 567 | Ga0466957_0099531 | 3300044842 | Bacteria | 1831 |
| 568 | Ga0466957_0152829 | 3300044842 | Bacteria | 1494 |
| 569 | Ga0466957_0326551 | 3300044842 | Bacteria | 1036 |
| 570 | Ga0466957_0517888 | 3300044842 | Bacteria | 828 |
| 571 | Ga0466960_0012800 | 3300044901 | Bacteria | 3550 |
| 572 | Ga0466960_0052851 | 3300044901 | Bacteria | 1967 |
| 573 | Ga0466960_0140337 | 3300044901 | Bacteria | 1283 |
| 574 | Ga0466960_0362378 | 3300044901 | Bacteria | 829 |
| 575 | Ga0466960_0417554 | 3300044901 | Bacteria | 775 |
| 576 | Ga0466959_0323740 | 3300045049 | Bacteria | 1053 |
| 577 | Ga0451576_1427861 | 3300045051 | Bacteria | 720 |
| 578 | Ga0466958_0003325 | 3300045836 | Bacteria | 8330 |
| 579 | Ga0466958_0281926 | 3300045836 | Bacteria | 1065 |
| 580 | Ga0466958_0615641 | 3300045836 | Bacteria | 706 |
| 581 | Ga0466958_0969358 | 3300045836 | Bacteria | 555 |
| 582 | Ga0466967_0001485 | 3300045976 | Bacteria | 13680 |
| 583 | Ga0466967_0597137 | 3300045976 | Bacteria | 1089 |
| 584 | Ga0466967_0758099 | 3300045976 | Bacteria | 963 |
| 585 | Ga0466967_0930526 | 3300045976 | Bacteria | 865 |
| 586 | Ga0466967_0961364 | 3300045976 | Bacteria | 850 |
| 587 | Ga0466967_1588685 | 3300045976 | Bacteria | 651 |
| 588 | Ga0495651_0129484 | 3300046462 | Bacteria | 1844 |
| 589 | Ga0495653_0000374 | 3300046463 | Bacteria | 36082 |
| 590 | Ga0495653_0336136 | 3300046463 | Bacteria | 975 |
| 591 | Ga0495653_0447033 | 3300046463 | Bacteria | 814 |
| 592 | Ga0495582_0468296 | 3300046473 | Unclassified | 728 |
| 593 | Ga0495582_0935658 | 3300046473 | Bacteria | 501 |
| 594 | Ga0495664_0000007 | 3300046477 | Bacteria | 386710 |
| 595 | Ga0495585_0337189 | 3300046492 | Bacteria | 735 |
| 596 | Ga0495596_0071425 | 3300046500 | Bacteria | 1348 |
| 597 | Ga0495596_0135506 | 3300046500 | Bacteria | 956 |
| 598 | Ga0495618_0000151 | 3300046514 | Bacteria | 49582 |
| 599 | Ga0495631_0297669 | 3300046518 | Bacteria | 687 |
| 600 | Ga0495643_0140308 | 3300046522 | Bacteria | 1206 |
| 601 | Ga0495666_0216105 | 3300046526 | Bacteria | 879 |
| 602 | Ga0495652_0337070 | 3300046529 | Bacteria | 1085 |
| 603 | Ga0495645_0000120 | 3300046543 | Bacteria | 53145 |
| 604 | Ga0495656_0094648 | 3300046615 | Bacteria | 1372 |
| 605 | Ga0495656_0633023 | 3300046615 | Bacteria | 574 |
| 606 | Ga0495646_0053387 | 3300046680 | Bacteria | 2437 |
| 607 | Ga0495671_0495088 | 3300046692 | Bacteria | 583 |
| 608 | Ga0495589_0379237 | 3300046794 | Bacteria | 650 |
| 609 | Ga0495600_0014182 | 3300046809 | Bacteria | 5020 |
| 610 | Ga0495660_0227447 | 3300046810 | Bacteria | 876 |
| 611 | Ga0495604_0000047 | 3300047317 | Bacteria | 109717 |
| 612 | Ga0495674_0479420 | 3300047319 | Bacteria | 997 |
| 613 | Ga0496102_0000002 | 3300048905 | Bacteria | 814588 |
| 614 | Ga0496102_0570186 | 3300048905 | Bacteria | 1055 |
| 615 | Ga0496102_0998028 | 3300048905 | Unclassified | 758 |
| 616 | Ga0496102_1073363 | 3300048905 | Bacteria | 725 |
| 617 | Ga0496103_0000046 | 3300048906 | Bacteria | 161981 |
| 618 | Ga0496103_0552734 | 3300048906 | Unclassified | 735 |
| 619 | Ga0496103_0577476 | 3300048906 | Bacteria | 717 |
| 620 | Ga0496104_0000001 | 3300048907 | Bacteria | 711867 |
| 621 | Ga0496104_0964511 | 3300048907 | Unclassified | 757 |
| 622 | Ga0496105_0500662 | 3300048908 | Bacteria | 954 |
| 623 | Ga0496105_0714456 | 3300048908 | Bacteria | 768 |
| 624 | Ga0496106_0028641 | 3300048909 | Bacteria | 4149 |
| 625 | Ga0496107_0435605 | 3300048910 | Bacteria | 974 |
| 626 | Ga0496107_0626680 | 3300048910 | Unclassified | 794 |
| 627 | Ga0496108_0207117 | 3300048911 | Bacteria | 1702 |
| 628 | Ga0496109_0611538 | 3300048912 | Bacteria | 1026 |
| 629 | Ga0496109_1374644 | 3300048912 | Bacteria | 642 |
| 630 | Ga0496109_1493353 | 3300048912 | Bacteria | 611 |
| 631 | Ga0496110_0000502 | 3300048913 | Bacteria | 26572 |
| 632 | Ga0496110_0129733 | 3300048913 | Bacteria | 2276 |
| 633 | Ga0496110_0325894 | 3300048913 | Unclassified | 1399 |
| 634 | Ga0496110_0637141 | 3300048913 | Bacteria | 965 |
| 635 | Ga0496110_0638969 | 3300048913 | Bacteria | 964 |
| 636 | Ga0496111_0001359 | 3300048914 | Bacteria | 13843 |
| 637 | Ga0496111_0192543 | 3300048914 | Unclassified | 1516 |
| 638 | Ga0496111_0396329 | 3300048914 | Bacteria | 1020 |
| 639 | Ga0496111_1121617 | 3300048914 | Bacteria | 560 |
| 640 | Ga0496112_0241655 | 3300048915 | Unclassified | 1758 |
| 641 | Ga0496112_0393554 | 3300048915 | Bacteria | 1326 |
| 642 | Ga0496112_0482570 | 3300048915 | Bacteria | 1176 |
| 643 | Ga0496112_1050299 | 3300048915 | Bacteria | 733 |
| 644 | Ga0496113_0151843 | 3300048916 | Bacteria | 1828 |
| 645 | Ga0496113_0402604 | 3300048916 | Bacteria | 1099 |
| 646 | Ga0496113_0553521 | 3300048916 | Bacteria | 923 |
| 647 | Ga0496113_1291478 | 3300048916 | Unclassified | 568 |
| 648 | Ga0496114_0904629 | 3300048917 | Bacteria | 764 |
| 649 | Ga0501309_099427 | 3300049129 | Bacteria | 503 |
| 650 | Ga0501317_083770 | 3300049533 | Bacteria | 555 |
| 651 | Ga0501325_033358 | 3300049541 | Bacteria | 599 |
| 652 | Ga0501031_0093232 | 3300049568 | Bacteria | 1965 |
| 653 | Ga0501031_0962906 | 3300049568 | Bacteria | 546 |
| 654 | Ga0501032_0404931 | 3300049569 | Unclassified | 876 |
| 655 | Ga0501034_0766087 | 3300049571 | Bacteria | 860 |
| 656 | Ga0501034_0852039 | 3300049571 | Bacteria | 801 |
| 657 | Ga0501036_0036303 | 3300049572 | Bacteria | 4170 |
| 658 | Ga0501036_0123223 | 3300049572 | Bacteria | 2189 |
| 659 | Ga0501037_0331041 | 3300049573 | Bacteria | 1053 |
| 660 | Ga0501038_0229351 | 3300049574 | Bacteria | 1478 |
| 661 | Ga0501038_0259070 | 3300049574 | Bacteria | 1375 |
| 662 | Ga0501039_0233964 | 3300049575 | Bacteria | 1444 |
| 663 | Ga0501039_0838932 | 3300049575 | Bacteria | 716 |
| 664 | Ga0501040_0034135 | 3300049576 | Bacteria | 3447 |
| 665 | Ga0501040_0156985 | 3300049576 | Bacteria | 1607 |
| 666 | Ga0501041_0095986 | 3300049577 | Bacteria | 1832 |
| 667 | Ga0501042_0055833 | 3300049578 | Bacteria | 2818 |
| 668 | Ga0501042_0288431 | 3300049578 | Bacteria | 1185 |
| 669 | Ga0501042_0377660 | 3300049578 | Bacteria | 1026 |
| 670 | Ga0501043_0546316 | 3300049579 | Bacteria | 861 |
| 671 | Ga0501046_0112761 | 3300049580 | Bacteria | 2076 |
| 672 | Ga0501046_0311722 | 3300049580 | Bacteria | 1148 |
| 673 | Ga0501047_0087714 | 3300049581 | Bacteria | 2989 |
| 674 | Ga0501048_0094394 | 3300049582 | Bacteria | 2110 |
| 675 | Ga0501069_0096734 | 3300049585 | Bacteria | 1673 |
| 676 | Ga0501070_0971405 | 3300049586 | Bacteria | 660 |
| 677 | Ga0501071_0110609 | 3300049587 | Bacteria | 2030 |
| 678 | Ga0501071_0565794 | 3300049587 | Bacteria | 873 |
| 679 | Ga0501072_0021253 | 3300049588 | Bacteria | 5034 |
| 680 | Ga0501073_0056140 | 3300049589 | Bacteria | 2755 |
| 681 | Ga0501073_0150386 | 3300049589 | Bacteria | 1614 |
| 682 | Ga0501075_0020369 | 3300049591 | Bacteria | 4824 |
| 683 | Ga0501075_0280308 | 3300049591 | Bacteria | 1270 |
| 684 | Ga0501075_0739160 | 3300049591 | Bacteria | 749 |
| 685 | Ga0501075_1268219 | 3300049591 | Bacteria | 559 |
| 686 | Ga0501076_0010634 | 3300049592 | Bacteria | 6835 |
| 687 | Ga0501076_0147035 | 3300049592 | Bacteria | 1916 |
| 688 | Ga0501076_1569208 | 3300049592 | Bacteria | 540 |
| 689 | Ga0501077_0214411 | 3300049593 | Bacteria | 1223 |
| 690 | Ga0501077_0245454 | 3300049593 | Bacteria | 1138 |
| 691 | Ga0501214_055151 | 3300049659 | Bacteria | 614 |
| 692 | Ga0501248_055261 | 3300049678 | Bacteria | 519 |
| 693 | Ga0501257_242522 | 3300049686 | Bacteria | 532 |
| 694 | Ga0501079_0383792 | 3300049741 | Bacteria | 1101 |
| 695 | Ga0501080_0090637 | 3300049742 | Bacteria | 2840 |
| 696 | Ga0501080_0188330 | 3300049742 | Bacteria | 1897 |
| 697 | Ga0501081_0228531 | 3300049743 | Bacteria | 1354 |
| 698 | Ga0501044_0340475 | 3300049823 | Bacteria | 1421 |
| 699 | Ga0501045_0054022 | 3300049824 | Bacteria | 2936 |
| 700 | nmdc:mga0yw44_731075_c1 | 3300050492 | Bacteria | 672 |
| 701 | nmdc:mga06z11_507970_c1 | 3300050494 | Bacteria | 730 |
| 702 | nmdc:mga05p37_1295495_c1 | 3300050507 | Bacteria | 743 |
| 703 | nmdc:mga05p37_1452584_c1 | 3300050507 | Bacteria | 686 |
| 704 | nmdc:mga05p37_1570519_c1 | 3300050507 | Unclassified | 650 |
| 705 | nmdc:mga05p37_837445_c1 | 3300050507 | Bacteria | 1001 |
| 706 | nmdc:mga09592_485899_c1 | 3300050508 | Bacteria | 1064 |
| 707 | nmdc:mga06r32_1650031_c1 | 3300050510 | Bacteria | 579 |
| 708 | nmdc:mga06r32_711765_c1 | 3300050510 | Bacteria | 969 |
| 709 | nmdc:mga08y16_1189065_c1 | 3300050511 | Bacteria | 734 |
| 710 | nmdc:mga08y16_757993_c1 | 3300050511 | Bacteria | 966 |
| 711 | nmdc:mga08y16_7698_c1 | 3300050511 | Bacteria | 11276 |
| 712 | nmdc:mga08y16_92808_c1 | 3300050511 | Bacteria | 3146 |
| 713 | nmdc:mga0n895_177896_c1 | 3300050512 | Bacteria | 2158 |
| 714 | nmdc:mga0n895_964546_c1 | 3300050512 | Bacteria | 835 |
| 715 | nmdc:mga0a205_117439_c1 | 3300050515 | Bacteria | 2558 |
| 716 | Ga0495601_0000276 | 3300053077 | Bacteria | 27580 |
| 717 | Ga0495601_0158159 | 3300053077 | Bacteria | 1480 |
| 718 | Ga0495601_0563100 | 3300053077 | Bacteria | 733 |
| 719 | Ga0495655_0098630 | 3300053083 | Bacteria | 862 |
| 720 | Ga0495619_0338284 | 3300053085 | Bacteria | 1042 |
| 721 | Ga0495619_0777727 | 3300053085 | Bacteria | 648 |
| 722 | Ga0500641_0052809 | 3300053096 | Bacteria | 1676 |
| 723 | Ga0500568_0301496 | 3300053139 | Bacteria | 581 |
| 724 | Ga0500588_0170648 | 3300053146 | Bacteria | 796 |
| 725 | Ga0500616_0028502 | 3300053153 | Bacteria | 3076 |
| 726 | Ga0500616_0140914 | 3300053153 | Bacteria | 1127 |
| 727 | Ga0501084_0213629 | 3300054114 | Bacteria | 1627 |
| 728 | Ga0501084_0413942 | 3300054114 | Bacteria | 1139 |
| 729 | Ga0590074_037814 | 3300059423 | Bacteria | 864 |
| 730 | Ga0590075_081173 | 3300059424 | Bacteria | 840 |
| 731 | Ga0590077_100746 | 3300059426 | Bacteria | 675 |
| 732 | Ga0587084_024069 | 3300059477 | Bacteria | 934 |
| 733 | Ga0587066_060200 | 3300059490 | Bacteria | 773 |
| 734 | Ga0587077_199073 | 3300059493 | Bacteria | 553 |
| 735 | Ga0587083_0249767 | 3300059505 | Bacteria | 528 |
| 736 | Ga0587085_152834 | 3300059506 | Bacteria | 534 |
| 737 | Ga0587086_043705 | 3300059507 | Unclassified | 702 |
| 738 | Ga0587088_085875 | 3300059508 | Bacteria | 681 |
| 739 | Ga0587089_047579 | 3300059509 | Bacteria | 680 |
| 740 | Ga0587090_132098 | 3300059510 | Bacteria | 551 |
| 741 | Ga0587092_159306 | 3300059512 | Bacteria | 509 |
| 742 | Ga0587098_096980 | 3300059604 | Bacteria | 510 |
| 743 | Ga0587101_131912 | 3300059623 | Bacteria | 526 |
| 744 | Ga0587109_143673 | 3300059624 | Bacteria | 584 |
| 745 | Ga0587122_057948 | 3300059628 | Bacteria | 515 |
| 746 | Ga0587062_135677 | 3300059639 | Bacteria | 510 |
| 747 | Ga0587067_059360 | 3300059640 | Bacteria | 797 |
| 748 | Ga0587068_104264 | 3300059641 | Bacteria | 599 |
| 749 | Ga0587072_200117 | 3300059643 | Bacteria | 507 |
| 750 | Ga0587075_092588 | 3300059644 | Bacteria | 593 |
| 751 | Ga0587076_156299 | 3300059645 | Bacteria | 557 |
| 752 | Ga0587076_210042 | 3300059645 | Bacteria | 505 |
| 753 | Ga0587078_039671 | 3300059646 | Bacteria | 662 |
| 754 | Ga0587079_152488 | 3300059647 | Bacteria | 598 |
| 755 | Ga0587107_127851 | 3300059652 | Bacteria | 531 |
| 756 | Ga0587110_069221 | 3300059654 | Bacteria | 500 |
| 757 | Ga0587124_049839 | 3300059660 | Bacteria | 508 |
| 758 | Ga0587071_104109 | 3300060344 | Bacteria | 660 |
| 759 | Ga0466962_0097870 | 3300061719 | Bacteria | 1408 |
| 760 | Ga0466962_0484546 | 3300061719 | Bacteria | 625 |
| 761 | Ga0530510_0135422 | 3300061734 | Bacteria | 1813 |
| 762 | Ga0530510_1244617 | 3300061734 | Bacteria | 571 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_12709653 | Ga0163162_127096531 | 61 |
| 2 | 3300007788 | Ga0099795_10214645 | Ga0099795_102146451 | 62 |
| 3 | 3300010159 | Ga0099796_10042774 | Ga0099796_100427742 | 62 |
| 4 | 3300031730 | Ga0307516_10002256 | Ga0307516_1000225615 | 62 |
| 5 | 3300005578 | Ga0068854_100629876 | Ga0068854_1006298761 | 67 |
| 6 | 3300005615 | Ga0070702_100635650 | Ga0070702_1006356502 | 67 |
| 7 | 3300025981 | Ga0207640_10422175 | Ga0207640_104221753 | 67 |
| 8 | 3300053096 | Ga0500641_0052809 | Ga0500641_0052809_1397_1615 | 67 |
| 9 | 3300053153 | Ga0500616_0028502 | Ga0500616_0028502_1250_1459 | 67 |
| 10 | 3300026075 | Ga0207708_10986028 | Ga0207708_109860282 | 68 |
| 11 | 3300027907 | Ga0207428_10207355 | Ga0207428_102073552 | 68 |
| 12 | 3300035090 | Ga0373949_0033525 | Ga0373949_0033525_574_801 | 68 |
| 13 | 3300035121 | Ga0373960_0006492 | Ga0373960_0006492_2382_2609 | 68 |
| 14 | 3300035242 | Ga0373962_0032887 | Ga0373962_0032887_278_505 | 68 |
| 15 | 3300035691 | Ga0373931_0212039 | Ga0373931_0212039_176_403 | 68 |
| 16 | 3300046500 | Ga0495596_0071425 | Ga0495596_0071425_260_487 | 68 |
| 17 | 3300046692 | Ga0495671_0495088 | Ga0495671_0495088_206_433 | 68 |
| 18 | 3300046810 | Ga0495660_0227447 | Ga0495660_0227447_302_529 | 68 |
| 19 | 3300050507 | nmdc:mga05p37_1452584_c1 | nmdc:mga05p37_1452584_c1_355_582 | 68 |
| 20 | 3300050511 | nmdc:mga08y16_92808_c1 | nmdc:mga08y16_92808_c1_1353_1580 | 68 |
| 21 | 3300050512 | nmdc:mga0n895_177896_c1 | nmdc:mga0n895_177896_c1_1084_1311 | 68 |
| 22 | 3300050515 | nmdc:mga0a205_117439_c1 | nmdc:mga0a205_117439_c1_445_672 | 68 |
| 23 | 3300053083 | Ga0495655_0098630 | Ga0495655_0098630_603_830 | 68 |
| 24 | 3300041443 | Ga0451789_0740838 | Ga0451789_0740838_163_441 | 69 |
| 25 | 3300005546 | Ga0070696_101247866 | Ga0070696_1012478661 | 70 |
| 26 | 3300005547 | Ga0070693_100744291 | Ga0070693_1007442912 | 70 |
| 27 | 3300005563 | Ga0068855_102123524 | Ga0068855_1021235242 | 70 |
| 28 | 3300005615 | Ga0070702_100250424 | Ga0070702_1002504242 | 70 |
| 29 | 3300005981 | Ga0081538_10000450 | Ga0081538_100004509 | 70 |
| 30 | 3300009148 | Ga0105243_10586263 | Ga0105243_105862632 | 70 |
| 31 | 3300013297 | Ga0157378_11370853 | Ga0157378_113708531 | 70 |
| 32 | 3300006051 | Ga0075364_10656810 | Ga0075364_106568101 | 71 |
| 33 | 3300044706 | Ga0466964_0836810 | Ga0466964_0836810_99_323 | 71 |
| 34 | 3300049580 | Ga0501046_0311722 | Ga0501046_0311722_104_328 | 71 |
| 35 | 3300049581 | Ga0501047_0087714 | Ga0501047_0087714_1217_1441 | 71 |
| 36 | 3300049589 | Ga0501073_0056140 | Ga0501073_0056140_1355_1579 | 71 |
| 37 | 3300049742 | Ga0501080_0090637 | Ga0501080_0090637_2018_2242 | 71 |
| 38 | 3300005338 | Ga0068868_100122964 | Ga0068868_1001229642 | 72 |
| 39 | 3300005347 | Ga0070668_101671656 | Ga0070668_1016716561 | 72 |
| 40 | 3300005578 | Ga0068854_100372107 | Ga0068854_1003721072 | 72 |
| 41 | 3300005614 | Ga0068856_100579196 | Ga0068856_1005791962 | 72 |
| 42 | 3300005616 | Ga0068852_101410145 | Ga0068852_1014101452 | 72 |
| 43 | 3300011119 | Ga0105246_10473626 | Ga0105246_104736262 | 72 |
| 44 | 3300013102 | Ga0157371_10627480 | Ga0157371_106274802 | 72 |
| 45 | 3300025981 | Ga0207640_11183267 | Ga0207640_111832672 | 72 |
| 46 | 3300026023 | Ga0207677_10590170 | Ga0207677_105901702 | 72 |
| 47 | 3300026078 | Ga0207702_11179177 | Ga0207702_111791772 | 72 |
| 48 | 3300026142 | Ga0207698_11068320 | Ga0207698_110683202 | 72 |
| 49 | 3300048905 | Ga0496102_0998028 | Ga0496102_0998028_83_310 | 72 |
| 50 | 3300048906 | Ga0496103_0552734 | Ga0496103_0552734_230_457 | 72 |
| 51 | 3300048907 | Ga0496104_0964511 | Ga0496104_0964511_116_343 | 72 |
| 52 | 3300048910 | Ga0496107_0626680 | Ga0496107_0626680_184_411 | 72 |
| 53 | 3300048913 | Ga0496110_0325894 | Ga0496110_0325894_688_915 | 72 |
| 54 | 3300048914 | Ga0496111_0192543 | Ga0496111_0192543_1248_1475 | 72 |
| 55 | 3300048915 | Ga0496112_0241655 | Ga0496112_0241655_1143_1370 | 72 |
| 56 | 3300048916 | Ga0496113_1291478 | Ga0496113_1291478_279_506 | 72 |
| 57 | 3300050507 | nmdc:mga05p37_1570519_c1 | nmdc:mga05p37_1570519_c1_29_295 | 72 |
| 58 | 3300005981 | Ga0081538_10014284 | Ga0081538_100142845 | 73 |
| 59 | 3300014325 | Ga0163163_11647475 | Ga0163163_116474752 | 73 |
| 60 | 3300037418 | Ga0395900_1299607 | Ga0395900_1299607_46_270 | 73 |
| 61 | 3300048915 | Ga0496112_1050299 | Ga0496112_1050299_315_539 | 73 |
| 62 | 3300005535 | Ga0070684_100992794 | Ga0070684_1009927942 | 74 |
| 63 | 3300005536 | Ga0070697_100287310 | Ga0070697_1002873101 | 74 |
| 64 | 3300005545 | Ga0070695_101251173 | Ga0070695_1012511732 | 74 |
| 65 | 3300005546 | Ga0070696_100947156 | Ga0070696_1009471562 | 74 |
| 66 | 3300005549 | Ga0070704_100208246 | Ga0070704_1002082461 | 74 |
| 67 | 3300005981 | Ga0081538_10175864 | Ga0081538_101758642 | 74 |
| 68 | 3300020081 | Ga0206354_11439709 | Ga0206354_114397092 | 74 |
| 69 | 3300020082 | Ga0206353_10667699 | Ga0206353_106676992 | 74 |
| 70 | 3300022467 | Ga0224712_10260989 | Ga0224712_102609891 | 74 |
| 71 | 3300025913 | Ga0207695_10536383 | Ga0207695_105363832 | 74 |
| 72 | 3300025935 | Ga0207709_11705293 | Ga0207709_117052931 | 74 |
| 73 | 3300037418 | Ga0395900_1588082 | Ga0395900_1588082_275_502 | 74 |
| 74 | 3300037471 | Ga0395905_0566093 | Ga0395905_0566093_508_735 | 74 |
| 75 | 3300038443 | Ga0395901_0943677 | Ga0395901_0943677_375_602 | 74 |
| 76 | 3300046473 | Ga0495582_0468296 | Ga0495582_0468296_132_365 | 74 |
| 77 | 3300046526 | Ga0495666_0216105 | Ga0495666_0216105_573_806 | 74 |
| 78 | 3300046529 | Ga0495652_0337070 | Ga0495652_0337070_279_512 | 74 |
| 79 | 3300005353 | Ga0070669_100001369 | Ga0070669_10000136920 | 75 |
| 80 | 3300005366 | Ga0070659_100000163 | Ga0070659_10000016313 | 75 |
| 81 | 3300005435 | Ga0070714_100000038 | Ga0070714_1000000388 | 75 |
| 82 | 3300005455 | Ga0070663_100823825 | Ga0070663_1008238251 | 75 |
| 83 | 3300011119 | Ga0105246_10006461 | Ga0105246_100064618 | 75 |
| 84 | 3300012506 | Ga0157324_1026337 | Ga0157324_10263372 | 75 |
| 85 | 3300014325 | Ga0163163_11096261 | Ga0163163_110962612 | 75 |
| 86 | 3300014745 | Ga0157377_10825133 | Ga0157377_108251332 | 75 |
| 87 | 3300025919 | Ga0207657_11399063 | Ga0207657_113990631 | 75 |
| 88 | 3300025923 | Ga0207681_10001085 | Ga0207681_100010856 | 75 |
| 89 | 3300025929 | Ga0207664_10000040 | Ga0207664_1000004047 | 75 |
| 90 | 3300025932 | Ga0207690_10000166 | Ga0207690_1000016645 | 75 |
| 91 | 3300025944 | Ga0207661_10053665 | Ga0207661_100536654 | 75 |
| 92 | 3300025944 | Ga0207661_10335614 | Ga0207661_103356144 | 75 |
| 93 | 3300026067 | Ga0207678_10266665 | Ga0207678_102666653 | 75 |
| 94 | 3300027717 | Ga0209998_10057568 | Ga0209998_100575681 | 75 |
| 95 | 3300028800 | Ga0265338_10041520 | Ga0265338_100415201 | 75 |
| 96 | 3300031251 | Ga0265327_10111064 | Ga0265327_101110641 | 75 |
| 97 | 3300037466 | Ga0395898_0306574 | Ga0395898_0306574_169_399 | 75 |
| 98 | 3300038443 | Ga0395901_0055093 | Ga0395901_0055093_2907_3137 | 75 |
| 99 | 3300046680 | Ga0495646_0053387 | Ga0495646_0053387_1132_1371 | 75 |
| 100 | 3300047317 | Ga0495604_0000047 | Ga0495604_0000047_50976_51215 | 75 |
| 101 | 3300053085 | Ga0495619_0777727 | Ga0495619_0777727_307_543 | 75 |
| 102 | 3300005339 | Ga0070660_100448104 | Ga0070660_1004481043 | 76 |
| 103 | 3300005340 | Ga0070689_100628077 | Ga0070689_1006280772 | 76 |
| 104 | 3300005343 | Ga0070687_101102819 | Ga0070687_1011028191 | 76 |
| 105 | 3300005344 | Ga0070661_100461682 | Ga0070661_1004616823 | 76 |
| 106 | 3300005347 | Ga0070668_100386819 | Ga0070668_1003868192 | 76 |
| 107 | 3300005356 | Ga0070674_100977734 | Ga0070674_1009777341 | 76 |
| 108 | 3300005364 | Ga0070673_101239063 | Ga0070673_1012390631 | 76 |
| 109 | 3300005364 | Ga0070673_101692159 | Ga0070673_1016921591 | 76 |
| 110 | 3300005366 | Ga0070659_101071500 | Ga0070659_1010715002 | 76 |
| 111 | 3300005438 | Ga0070701_10683188 | Ga0070701_106831881 | 76 |
| 112 | 3300005466 | Ga0070685_11056158 | Ga0070685_110561582 | 76 |
| 113 | 3300005539 | Ga0068853_101341377 | Ga0068853_1013413772 | 76 |
| 114 | 3300005543 | Ga0070672_101133816 | Ga0070672_1011338162 | 76 |
| 115 | 3300005564 | Ga0070664_102082199 | Ga0070664_1020821992 | 76 |
| 116 | 3300005577 | Ga0068857_100302818 | Ga0068857_1003028182 | 76 |
| 117 | 3300005615 | Ga0070702_100388494 | Ga0070702_1003884941 | 76 |
| 118 | 3300005616 | Ga0068852_100616329 | Ga0068852_1006163291 | 76 |
| 119 | 3300005618 | Ga0068864_100047501 | Ga0068864_1000475012 | 76 |
| 120 | 3300005719 | Ga0068861_100632189 | Ga0068861_1006321892 | 76 |
| 121 | 3300005840 | Ga0068870_10423617 | Ga0068870_104236173 | 76 |
| 122 | 3300005842 | Ga0068858_100598301 | Ga0068858_1005983013 | 76 |
| 123 | 3300005844 | Ga0068862_100395023 | Ga0068862_1003950232 | 76 |
| 124 | 3300006048 | Ga0075363_100928076 | Ga0075363_1009280761 | 76 |
| 125 | 3300009101 | Ga0105247_10568427 | Ga0105247_105684272 | 76 |
| 126 | 3300009148 | Ga0105243_10467247 | Ga0105243_104672473 | 76 |
| 127 | 3300009551 | Ga0105238_10453936 | Ga0105238_104539364 | 76 |
| 128 | 3300010375 | Ga0105239_10147091 | Ga0105239_101470913 | 76 |
| 129 | 3300013102 | Ga0157371_10622174 | Ga0157371_106221742 | 76 |
| 130 | 3300013308 | Ga0157375_12493461 | Ga0157375_124934611 | 76 |
| 131 | 3300014326 | Ga0157380_10649427 | Ga0157380_106494271 | 76 |
| 132 | 3300014969 | Ga0157376_10806838 | Ga0157376_108068382 | 76 |
| 133 | 3300017792 | Ga0163161_12017680 | Ga0163161_120176801 | 76 |
| 134 | 3300020070 | Ga0206356_11473832 | Ga0206356_114738327 | 76 |
| 135 | 3300025302 | Ga0207426_1043161 | Ga0207426_10431612 | 76 |
| 136 | 3300025321 | Ga0207656_10532980 | Ga0207656_105329801 | 76 |
| 137 | 3300025898 | Ga0207692_10070795 | Ga0207692_100707953 | 76 |
| 138 | 3300025904 | Ga0207647_10531364 | Ga0207647_105313641 | 76 |
| 139 | 3300025908 | Ga0207643_10130821 | Ga0207643_101308214 | 76 |
| 140 | 3300025919 | Ga0207657_10123988 | Ga0207657_101239882 | 76 |
| 141 | 3300025927 | Ga0207687_10060950 | Ga0207687_100609503 | 76 |
| 142 | 3300025935 | Ga0207709_10079912 | Ga0207709_100799123 | 76 |
| 143 | 3300025937 | Ga0207669_10371662 | Ga0207669_103716622 | 76 |
| 144 | 3300025940 | Ga0207691_10167510 | Ga0207691_101675103 | 76 |
| 145 | 3300025941 | Ga0207711_11016862 | Ga0207711_110168623 | 76 |
| 146 | 3300025972 | Ga0207668_10836635 | Ga0207668_108366352 | 76 |
| 147 | 3300025981 | Ga0207640_10187977 | Ga0207640_101879773 | 76 |
| 148 | 3300026035 | Ga0207703_11462963 | Ga0207703_114629632 | 76 |
| 149 | 3300026067 | Ga0207678_10788772 | Ga0207678_107887721 | 76 |
| 150 | 3300026075 | Ga0207708_10216848 | Ga0207708_102168483 | 76 |
| 151 | 3300026089 | Ga0207648_10367361 | Ga0207648_103673613 | 76 |
| 152 | 3300026095 | Ga0207676_10100175 | Ga0207676_101001754 | 76 |
| 153 | 3300026116 | Ga0207674_10540250 | Ga0207674_105402502 | 76 |
| 154 | 3300026142 | Ga0207698_10379276 | Ga0207698_103792761 | 76 |
| 155 | 3300028380 | Ga0268265_10198653 | Ga0268265_101986532 | 76 |
| 156 | 3300032004 | Ga0307414_12027535 | Ga0307414_120275352 | 76 |
| 157 | 3300032126 | Ga0307415_101217444 | Ga0307415_1012174441 | 76 |
| 158 | 3300037418 | Ga0395900_0014319 | Ga0395900_0014319_5365_5601 | 76 |
| 159 | 3300037418 | Ga0395900_1320965 | Ga0395900_1320965_71_301 | 76 |
| 160 | 3300037466 | Ga0395898_1464395 | Ga0395898_1464395_84_320 | 76 |
| 161 | 3300037471 | Ga0395905_0013964 | Ga0395905_0013964_4082_4318 | 76 |
| 162 | 3300038443 | Ga0395901_0010606 | Ga0395901_0010606_8929_9165 | 76 |
| 163 | 3300044694 | Ga0466963_0285048 | Ga0466963_0285048_404_649 | 76 |
| 164 | 3300044842 | Ga0466957_0326551 | Ga0466957_0326551_693_923 | 76 |
| 165 | 3300044901 | Ga0466960_0012800 | Ga0466960_0012800_1008_1247 | 76 |
| 166 | 3300044901 | Ga0466960_0052851 | Ga0466960_0052851_1399_1638 | 76 |
| 167 | 3300045836 | Ga0466958_0969358 | Ga0466958_0969358_201_431 | 76 |
| 168 | 3300045976 | Ga0466967_0597137 | Ga0466967_0597137_109_354 | 76 |
| 169 | 3300045976 | Ga0466967_0961364 | Ga0466967_0961364_93_323 | 76 |
| 170 | 3300045976 | Ga0466967_1588685 | Ga0466967_1588685_285_515 | 76 |
| 171 | 3300046462 | Ga0495651_0129484 | Ga0495651_0129484_1530_1769 | 76 |
| 172 | 3300046463 | Ga0495653_0000374 | Ga0495653_0000374_31141_31380 | 76 |
| 173 | 3300046463 | Ga0495653_0336136 | Ga0495653_0336136_314_553 | 76 |
| 174 | 3300046463 | Ga0495653_0447033 | Ga0495653_0447033_153_383 | 76 |
| 175 | 3300046477 | Ga0495664_0000007 | Ga0495664_0000007_25884_26153 | 76 |
| 176 | 3300046514 | Ga0495618_0000151 | Ga0495618_0000151_24703_24942 | 76 |
| 177 | 3300046543 | Ga0495645_0000120 | Ga0495645_0000120_1204_1446 | 76 |
| 178 | 3300048905 | Ga0496102_0000002 | Ga0496102_0000002_761093_761371 | 76 |
| 179 | 3300048906 | Ga0496103_0000046 | Ga0496103_0000046_51873_52151 | 76 |
| 180 | 3300049129 | Ga0501309_099427 | Ga0501309_099427_239_478 | 76 |
| 181 | 3300050494 | nmdc:mga06z11_507970_c1 | nmdc:mga06z11_507970_c1_280_510 | 76 |
| 182 | 3300053077 | Ga0495601_0000276 | Ga0495601_0000276_14993_15232 | 76 |
| 183 | 3300053077 | Ga0495601_0158159 | Ga0495601_0158159_1080_1319 | 76 |
| 184 | 3300053077 | Ga0495601_0563100 | Ga0495601_0563100_216_446 | 76 |
| 185 | 3300053085 | Ga0495619_0338284 | Ga0495619_0338284_184_414 | 76 |
| 186 | 3300059505 | Ga0587083_0249767 | Ga0587083_0249767_179_409 | 76 |
| 187 | 3300059604 | Ga0587098_096980 | Ga0587098_096980_155_385 | 76 |
| 188 | 3300001977 | JGI24746J21847_1040169 | JGI24746J21847_10401692 | 77 |
| 189 | 3300001990 | JGI24737J22298_10186211 | JGI24737J22298_101862111 | 77 |
| 190 | 3300002075 | JGI24738J21930_10079422 | JGI24738J21930_100794222 | 77 |
| 191 | 3300002077 | JGI24744J21845_10032293 | JGI24744J21845_100322931 | 77 |
| 192 | 3300003373 | JGI25407J50210_10025407 | JGI25407J50210_100254072 | 77 |
| 193 | 3300003373 | JGI25407J50210_10081871 | JGI25407J50210_100818712 | 77 |
| 194 | 3300003373 | JGI25407J50210_10090770 | JGI25407J50210_100907703 | 77 |
| 195 | 3300003693 | Ga0032354_1046075 | Ga0032354_10460751 | 77 |
| 196 | 3300004800 | Ga0058861_10010021 | Ga0058861_100100212 | 77 |
| 197 | 3300004803 | Ga0058862_12741778 | Ga0058862_127417782 | 77 |
| 198 | 3300005327 | Ga0070658_10522189 | Ga0070658_105221891 | 77 |
| 199 | 3300005327 | Ga0070658_10912952 | Ga0070658_109129522 | 77 |
| 200 | 3300005328 | Ga0070676_10975492 | Ga0070676_109754922 | 77 |
| 201 | 3300005329 | Ga0070683_100168642 | Ga0070683_1001686422 | 77 |
| 202 | 3300005329 | Ga0070683_100203832 | Ga0070683_1002038322 | 77 |
| 203 | 3300005329 | Ga0070683_101246879 | Ga0070683_1012468791 | 77 |
| 204 | 3300005331 | Ga0070670_100892031 | Ga0070670_1008920312 | 77 |
| 205 | 3300005333 | Ga0070677_10080870 | Ga0070677_100808702 | 77 |
| 206 | 3300005334 | Ga0068869_100448007 | Ga0068869_1004480072 | 77 |
| 207 | 3300005335 | Ga0070666_10572404 | Ga0070666_105724042 | 77 |
| 208 | 3300005337 | Ga0070682_100779498 | Ga0070682_1007794982 | 77 |
| 209 | 3300005338 | Ga0068868_100741804 | Ga0068868_1007418042 | 77 |
| 210 | 3300005340 | Ga0070689_100674192 | Ga0070689_1006741922 | 77 |
| 211 | 3300005344 | Ga0070661_100329028 | Ga0070661_1003290282 | 77 |
| 212 | 3300005344 | Ga0070661_100542165 | Ga0070661_1005421652 | 77 |
| 213 | 3300005345 | Ga0070692_10081812 | Ga0070692_100818124 | 77 |
| 214 | 3300005345 | Ga0070692_10805542 | Ga0070692_108055421 | 77 |
| 215 | 3300005347 | Ga0070668_100183660 | Ga0070668_1001836603 | 77 |
| 216 | 3300005347 | Ga0070668_102277796 | Ga0070668_1022777962 | 77 |
| 217 | 3300005353 | Ga0070669_101069562 | Ga0070669_1010695622 | 77 |
| 218 | 3300005353 | Ga0070669_101708622 | Ga0070669_1017086221 | 77 |
| 219 | 3300005354 | Ga0070675_101268715 | Ga0070675_1012687151 | 77 |
| 220 | 3300005356 | Ga0070674_100016281 | Ga0070674_1000162814 | 77 |
| 221 | 3300005366 | Ga0070659_100220265 | Ga0070659_1002202653 | 77 |
| 222 | 3300005366 | Ga0070659_100377491 | Ga0070659_1003774913 | 77 |
| 223 | 3300005366 | Ga0070659_100661089 | Ga0070659_1006610891 | 77 |
| 224 | 3300005438 | Ga0070701_10242272 | Ga0070701_102422722 | 77 |
| 225 | 3300005438 | Ga0070701_10270457 | Ga0070701_102704571 | 77 |
| 226 | 3300005438 | Ga0070701_10858159 | Ga0070701_108581591 | 77 |
| 227 | 3300005441 | Ga0070700_100358356 | Ga0070700_1003583562 | 77 |
| 228 | 3300005455 | Ga0070663_100929876 | Ga0070663_1009298761 | 77 |
| 229 | 3300005456 | Ga0070678_100169098 | Ga0070678_1001690984 | 77 |
| 230 | 3300005456 | Ga0070678_100823597 | Ga0070678_1008235971 | 77 |
| 231 | 3300005457 | Ga0070662_100394713 | Ga0070662_1003947131 | 77 |
| 232 | 3300005458 | Ga0070681_10642934 | Ga0070681_106429342 | 77 |
| 233 | 3300005459 | Ga0068867_100085190 | Ga0068867_1000851904 | 77 |
| 234 | 3300005459 | Ga0068867_100138513 | Ga0068867_1001385133 | 77 |
| 235 | 3300005459 | Ga0068867_100481527 | Ga0068867_1004815271 | 77 |
| 236 | 3300005459 | Ga0068867_101189951 | Ga0068867_1011899511 | 77 |
| 237 | 3300005459 | Ga0068867_101808990 | Ga0068867_1018089902 | 77 |
| 238 | 3300005466 | Ga0070685_10732057 | Ga0070685_107320571 | 77 |
| 239 | 3300005518 | Ga0070699_101029597 | Ga0070699_1010295971 | 77 |
| 240 | 3300005535 | Ga0070684_100824793 | Ga0070684_1008247932 | 77 |
| 241 | 3300005535 | Ga0070684_101219627 | Ga0070684_1012196272 | 77 |
| 242 | 3300005539 | Ga0068853_100289582 | Ga0068853_1002895822 | 77 |
| 243 | 3300005539 | Ga0068853_101810975 | Ga0068853_1018109752 | 77 |
| 244 | 3300005543 | Ga0070672_101310663 | Ga0070672_1013106632 | 77 |
| 245 | 3300005544 | Ga0070686_100407398 | Ga0070686_1004073982 | 77 |
| 246 | 3300005544 | Ga0070686_100427844 | Ga0070686_1004278443 | 77 |
| 247 | 3300005544 | Ga0070686_100659065 | Ga0070686_1006590651 | 77 |
| 248 | 3300005547 | Ga0070693_100424248 | Ga0070693_1004242482 | 77 |
| 249 | 3300005547 | Ga0070693_101101363 | Ga0070693_1011013631 | 77 |
| 250 | 3300005548 | Ga0070665_100831143 | Ga0070665_1008311432 | 77 |
| 251 | 3300005548 | Ga0070665_102085814 | Ga0070665_1020858142 | 77 |
| 252 | 3300005549 | Ga0070704_100419981 | Ga0070704_1004199812 | 77 |
| 253 | 3300005549 | Ga0070704_102141733 | Ga0070704_1021417331 | 77 |
| 254 | 3300005564 | Ga0070664_100256282 | Ga0070664_1002562823 | 77 |
| 255 | 3300005564 | Ga0070664_100830768 | Ga0070664_1008307682 | 77 |
| 256 | 3300005577 | Ga0068857_100479257 | Ga0068857_1004792572 | 77 |
| 257 | 3300005577 | Ga0068857_100843086 | Ga0068857_1008430862 | 77 |
| 258 | 3300005578 | Ga0068854_100095326 | Ga0068854_1000953262 | 77 |
| 259 | 3300005614 | Ga0068856_101209963 | Ga0068856_1012099632 | 77 |
| 260 | 3300005615 | Ga0070702_100384748 | Ga0070702_1003847482 | 77 |
| 261 | 3300005616 | Ga0068852_100391696 | Ga0068852_1003916963 | 77 |
| 262 | 3300005616 | Ga0068852_100462060 | Ga0068852_1004620603 | 77 |
| 263 | 3300005616 | Ga0068852_101150383 | Ga0068852_1011503831 | 77 |
| 264 | 3300005718 | Ga0068866_10626014 | Ga0068866_106260142 | 77 |
| 265 | 3300005719 | Ga0068861_100031308 | Ga0068861_1000313083 | 77 |
| 266 | 3300005719 | Ga0068861_100144949 | Ga0068861_1001449492 | 77 |
| 267 | 3300005719 | Ga0068861_100180024 | Ga0068861_1001800243 | 77 |
| 268 | 3300005834 | Ga0068851_10677946 | Ga0068851_106779462 | 77 |
| 269 | 3300005840 | Ga0068870_10209433 | Ga0068870_102094331 | 77 |
| 270 | 3300005842 | Ga0068858_100045636 | Ga0068858_1000456364 | 77 |
| 271 | 3300005842 | Ga0068858_100120054 | Ga0068858_1001200542 | 77 |
| 272 | 3300005842 | Ga0068858_101155491 | Ga0068858_1011554912 | 77 |
| 273 | 3300005843 | Ga0068860_100724927 | Ga0068860_1007249272 | 77 |
| 274 | 3300005937 | Ga0081455_10112615 | Ga0081455_101126153 | 77 |
| 275 | 3300005937 | Ga0081455_10116703 | Ga0081455_101167032 | 77 |
| 276 | 3300005937 | Ga0081455_10172862 | Ga0081455_101728623 | 77 |
| 277 | 3300005937 | Ga0081455_10338365 | Ga0081455_103383652 | 77 |
| 278 | 3300005937 | Ga0081455_10545478 | Ga0081455_105454781 | 77 |
| 279 | 3300005981 | Ga0081538_10001846 | Ga0081538_1000184610 | 77 |
| 280 | 3300005981 | Ga0081538_10019086 | Ga0081538_100190866 | 77 |
| 281 | 3300005981 | Ga0081538_10023060 | Ga0081538_100230605 | 77 |
| 282 | 3300005981 | Ga0081538_10029547 | Ga0081538_100295474 | 77 |
| 283 | 3300005981 | Ga0081538_10258358 | Ga0081538_102583582 | 77 |
| 284 | 3300005983 | Ga0081540_1224352 | Ga0081540_12243522 | 77 |
| 285 | 3300006058 | Ga0075432_10264181 | Ga0075432_102641811 | 77 |
| 286 | 3300006358 | Ga0068871_100971474 | Ga0068871_1009714742 | 77 |
| 287 | 3300006358 | Ga0068871_101907625 | Ga0068871_1019076251 | 77 |
| 288 | 3300006844 | Ga0075428_100040740 | Ga0075428_1000407403 | 77 |
| 289 | 3300006844 | Ga0075428_101304461 | Ga0075428_1013044613 | 77 |
| 290 | 3300006844 | Ga0075428_102292577 | Ga0075428_1022925771 | 77 |
| 291 | 3300006844 | Ga0075428_102446636 | Ga0075428_1024466361 | 77 |
| 292 | 3300006847 | Ga0075431_100743300 | Ga0075431_1007433002 | 77 |
| 293 | 3300006871 | Ga0075434_102052831 | Ga0075434_1020528311 | 77 |
| 294 | 3300006880 | Ga0075429_101779028 | Ga0075429_1017790282 | 77 |
| 295 | 3300006881 | Ga0068865_100049036 | Ga0068865_1000490364 | 77 |
| 296 | 3300009093 | Ga0105240_10004346 | Ga0105240_1000434618 | 77 |
| 297 | 3300009093 | Ga0105240_12578293 | Ga0105240_125782931 | 77 |
| 298 | 3300009094 | Ga0111539_10029334 | Ga0111539_100293346 | 77 |
| 299 | 3300009094 | Ga0111539_10269561 | Ga0111539_102695613 | 77 |
| 300 | 3300009094 | Ga0111539_10287971 | Ga0111539_102879714 | 77 |
| 301 | 3300009094 | Ga0111539_10781214 | Ga0111539_107812142 | 77 |
| 302 | 3300009094 | Ga0111539_11161066 | Ga0111539_111610662 | 77 |
| 303 | 3300009098 | Ga0105245_10009166 | Ga0105245_100091664 | 77 |
| 304 | 3300009098 | Ga0105245_10300674 | Ga0105245_103006743 | 77 |
| 305 | 3300009098 | Ga0105245_11375562 | Ga0105245_113755621 | 77 |
| 306 | 3300009147 | Ga0114129_12309923 | Ga0114129_123099231 | 77 |
| 307 | 3300009148 | Ga0105243_10039614 | Ga0105243_100396143 | 77 |
| 308 | 3300009148 | Ga0105243_10057996 | Ga0105243_100579964 | 77 |
| 309 | 3300009148 | Ga0105243_10118532 | Ga0105243_101185322 | 77 |
| 310 | 3300009174 | Ga0105241_10519319 | Ga0105241_105193192 | 77 |
| 311 | 3300009174 | Ga0105241_12207338 | Ga0105241_122073382 | 77 |
| 312 | 3300009176 | Ga0105242_10231295 | Ga0105242_102312953 | 77 |
| 313 | 3300009176 | Ga0105242_10618310 | Ga0105242_106183102 | 77 |
| 314 | 3300009176 | Ga0105242_11234335 | Ga0105242_112343352 | 77 |
| 315 | 3300009177 | Ga0105248_10547751 | Ga0105248_105477513 | 77 |
| 316 | 3300009177 | Ga0105248_10779433 | Ga0105248_107794333 | 77 |
| 317 | 3300009545 | Ga0105237_10559303 | Ga0105237_105593032 | 77 |
| 318 | 3300009551 | Ga0105238_10850349 | Ga0105238_108503492 | 77 |
| 319 | 3300009553 | Ga0105249_10230734 | Ga0105249_102307343 | 77 |
| 320 | 3300009553 | Ga0105249_10583083 | Ga0105249_105830832 | 77 |
| 321 | 3300009553 | Ga0105249_12916858 | Ga0105249_129168582 | 77 |
| 322 | 3300010375 | Ga0105239_10333492 | Ga0105239_103334923 | 77 |
| 323 | 3300010375 | Ga0105239_10609526 | Ga0105239_106095263 | 77 |
| 324 | 3300010375 | Ga0105239_12332888 | Ga0105239_123328881 | 77 |
| 325 | 3300011119 | Ga0105246_10201263 | Ga0105246_102012632 | 77 |
| 326 | 3300011119 | Ga0105246_10552015 | Ga0105246_105520152 | 77 |
| 327 | 3300011119 | Ga0105246_11320429 | Ga0105246_113204292 | 77 |
| 328 | 3300012498 | Ga0157345_1016603 | Ga0157345_10166032 | 77 |
| 329 | 3300012513 | Ga0157326_1039481 | Ga0157326_10394812 | 77 |
| 330 | 3300013102 | Ga0157371_10629219 | Ga0157371_106292191 | 77 |
| 331 | 3300013102 | Ga0157371_11511339 | Ga0157371_115113392 | 77 |
| 332 | 3300013104 | Ga0157370_11373060 | Ga0157370_113730602 | 77 |
| 333 | 3300013297 | Ga0157378_10327145 | Ga0157378_103271452 | 77 |
| 334 | 3300013297 | Ga0157378_10864311 | Ga0157378_108643112 | 77 |
| 335 | 3300013297 | Ga0157378_12775037 | Ga0157378_127750372 | 77 |
| 336 | 3300013306 | Ga0163162_10353807 | Ga0163162_103538072 | 77 |
| 337 | 3300013306 | Ga0163162_10762318 | Ga0163162_107623183 | 77 |
| 338 | 3300013307 | Ga0157372_10650031 | Ga0157372_106500313 | 77 |
| 339 | 3300013307 | Ga0157372_10769543 | Ga0157372_107695433 | 77 |
| 340 | 3300013307 | Ga0157372_11414980 | Ga0157372_114149801 | 77 |
| 341 | 3300013308 | Ga0157375_13780239 | Ga0157375_137802392 | 77 |
| 342 | 3300014325 | Ga0163163_10293285 | Ga0163163_102932853 | 77 |
| 343 | 3300014326 | Ga0157380_10259732 | Ga0157380_102597323 | 77 |
| 344 | 3300014326 | Ga0157380_10411131 | Ga0157380_104111312 | 77 |
| 345 | 3300014497 | Ga0182008_10104627 | Ga0182008_101046272 | 77 |
| 346 | 3300014745 | Ga0157377_10106798 | Ga0157377_101067981 | 77 |
| 347 | 3300014968 | Ga0157379_10245528 | Ga0157379_102455282 | 77 |
| 348 | 3300014968 | Ga0157379_11309877 | Ga0157379_113098771 | 77 |
| 349 | 3300014969 | Ga0157376_12748890 | Ga0157376_127488901 | 77 |
| 350 | 3300020070 | Ga0206356_11500562 | Ga0206356_115005622 | 77 |
| 351 | 3300020080 | Ga0206350_10418688 | Ga0206350_104186881 | 77 |
| 352 | 3300020081 | Ga0206354_10237246 | Ga0206354_102372462 | 77 |
| 353 | 3300020082 | Ga0206353_10284451 | Ga0206353_102844511 | 77 |
| 354 | 3300022467 | Ga0224712_10311454 | Ga0224712_103114541 | 77 |
| 355 | 3300022467 | Ga0224712_10545383 | Ga0224712_105453831 | 77 |
| 356 | 3300025321 | Ga0207656_10269875 | Ga0207656_102698752 | 77 |
| 357 | 3300025899 | Ga0207642_10203767 | Ga0207642_102037672 | 77 |
| 358 | 3300025901 | Ga0207688_10023583 | Ga0207688_100235832 | 77 |
| 359 | 3300025901 | Ga0207688_10207314 | Ga0207688_102073142 | 77 |
| 360 | 3300025907 | Ga0207645_10228028 | Ga0207645_102280283 | 77 |
| 361 | 3300025907 | Ga0207645_11071730 | Ga0207645_110717301 | 77 |
| 362 | 3300025908 | Ga0207643_10095843 | Ga0207643_100958431 | 77 |
| 363 | 3300025908 | Ga0207643_10171754 | Ga0207643_101717543 | 77 |
| 364 | 3300025908 | Ga0207643_10277791 | Ga0207643_102777913 | 77 |
| 365 | 3300025909 | Ga0207705_10915255 | Ga0207705_109152552 | 77 |
| 366 | 3300025913 | Ga0207695_10042059 | Ga0207695_100420596 | 77 |
| 367 | 3300025914 | Ga0207671_11252185 | Ga0207671_112521851 | 77 |
| 368 | 3300025917 | Ga0207660_10447815 | Ga0207660_104478152 | 77 |
| 369 | 3300025917 | Ga0207660_10510331 | Ga0207660_105103312 | 77 |
| 370 | 3300025918 | Ga0207662_10171790 | Ga0207662_101717902 | 77 |
| 371 | 3300025918 | Ga0207662_10276092 | Ga0207662_102760923 | 77 |
| 372 | 3300025920 | Ga0207649_10961634 | Ga0207649_109616342 | 77 |
| 373 | 3300025923 | Ga0207681_10893746 | Ga0207681_108937463 | 77 |
| 374 | 3300025923 | Ga0207681_11215566 | Ga0207681_112155661 | 77 |
| 375 | 3300025924 | Ga0207694_10807346 | Ga0207694_108073462 | 77 |
| 376 | 3300025925 | Ga0207650_10280737 | Ga0207650_102807372 | 77 |
| 377 | 3300025926 | Ga0207659_10892909 | Ga0207659_108929092 | 77 |
| 378 | 3300025927 | Ga0207687_10099278 | Ga0207687_100992783 | 77 |
| 379 | 3300025927 | Ga0207687_10229866 | Ga0207687_102298663 | 77 |
| 380 | 3300025927 | Ga0207687_10549704 | Ga0207687_105497043 | 77 |
| 381 | 3300025929 | Ga0207664_10143007 | Ga0207664_101430073 | 77 |
| 382 | 3300025929 | Ga0207664_10943205 | Ga0207664_109432052 | 77 |
| 383 | 3300025931 | Ga0207644_10911536 | Ga0207644_109115362 | 77 |
| 384 | 3300025932 | Ga0207690_10323670 | Ga0207690_103236702 | 77 |
| 385 | 3300025933 | Ga0207706_10043662 | Ga0207706_100436626 | 77 |
| 386 | 3300025934 | Ga0207686_10160757 | Ga0207686_101607572 | 77 |
| 387 | 3300025935 | Ga0207709_10028379 | Ga0207709_100283794 | 77 |
| 388 | 3300025935 | Ga0207709_10031902 | Ga0207709_100319024 | 77 |
| 389 | 3300025935 | Ga0207709_10155445 | Ga0207709_101554453 | 77 |
| 390 | 3300025936 | Ga0207670_10302668 | Ga0207670_103026683 | 77 |
| 391 | 3300025936 | Ga0207670_11304502 | Ga0207670_113045021 | 77 |
| 392 | 3300025937 | Ga0207669_10049960 | Ga0207669_100499603 | 77 |
| 393 | 3300025938 | Ga0207704_10028200 | Ga0207704_100282004 | 77 |
| 394 | 3300025938 | Ga0207704_10319627 | Ga0207704_103196273 | 77 |
| 395 | 3300025938 | Ga0207704_10484685 | Ga0207704_104846852 | 77 |
| 396 | 3300025940 | Ga0207691_10109452 | Ga0207691_101094523 | 77 |
| 397 | 3300025941 | Ga0207711_10535086 | Ga0207711_105350862 | 77 |
| 398 | 3300025941 | Ga0207711_10542246 | Ga0207711_105422463 | 77 |
| 399 | 3300025942 | Ga0207689_10342529 | Ga0207689_103425292 | 77 |
| 400 | 3300025942 | Ga0207689_10596401 | Ga0207689_105964012 | 77 |
| 401 | 3300025944 | Ga0207661_10248229 | Ga0207661_102482293 | 77 |
| 402 | 3300025944 | Ga0207661_10548559 | Ga0207661_105485592 | 77 |
| 403 | 3300025945 | Ga0207679_10735407 | Ga0207679_107354072 | 77 |
| 404 | 3300025961 | Ga0207712_10312349 | Ga0207712_103123493 | 77 |
| 405 | 3300025961 | Ga0207712_10561724 | Ga0207712_105617242 | 77 |
| 406 | 3300025972 | Ga0207668_10360294 | Ga0207668_103602942 | 77 |
| 407 | 3300025972 | Ga0207668_10976807 | Ga0207668_109768071 | 77 |
| 408 | 3300025981 | Ga0207640_10603786 | Ga0207640_106037861 | 77 |
| 409 | 3300026023 | Ga0207677_10086851 | Ga0207677_100868514 | 77 |
| 410 | 3300026023 | Ga0207677_11200098 | Ga0207677_112000982 | 77 |
| 411 | 3300026035 | Ga0207703_10180352 | Ga0207703_101803523 | 77 |
| 412 | 3300026035 | Ga0207703_10382988 | Ga0207703_103829883 | 77 |
| 413 | 3300026035 | Ga0207703_10728730 | Ga0207703_107287301 | 77 |
| 414 | 3300026041 | Ga0207639_10273731 | Ga0207639_102737312 | 77 |
| 415 | 3300026041 | Ga0207639_11347431 | Ga0207639_113474312 | 77 |
| 416 | 3300026067 | Ga0207678_10306085 | Ga0207678_103060853 | 77 |
| 417 | 3300026067 | Ga0207678_10433415 | Ga0207678_104334151 | 77 |
| 418 | 3300026075 | Ga0207708_10003129 | Ga0207708_100031295 | 77 |
| 419 | 3300026075 | Ga0207708_10765864 | Ga0207708_107658641 | 77 |
| 420 | 3300026078 | Ga0207702_11491755 | Ga0207702_114917551 | 77 |
| 421 | 3300026088 | Ga0207641_10904218 | Ga0207641_109042182 | 77 |
| 422 | 3300026089 | Ga0207648_10190212 | Ga0207648_101902122 | 77 |
| 423 | 3300026089 | Ga0207648_10408991 | Ga0207648_104089912 | 77 |
| 424 | 3300026089 | Ga0207648_10911298 | Ga0207648_109112981 | 77 |
| 425 | 3300026089 | Ga0207648_11407595 | Ga0207648_114075951 | 77 |
| 426 | 3300026095 | Ga0207676_11183938 | Ga0207676_111839382 | 77 |
| 427 | 3300026116 | Ga0207674_10362681 | Ga0207674_103626813 | 77 |
| 428 | 3300026118 | Ga0207675_100022121 | Ga0207675_1000221214 | 77 |
| 429 | 3300026118 | Ga0207675_100067353 | Ga0207675_1000673532 | 77 |
| 430 | 3300026118 | Ga0207675_100426657 | Ga0207675_1004266571 | 77 |
| 431 | 3300026118 | Ga0207675_100901054 | Ga0207675_1009010541 | 77 |
| 432 | 3300026121 | Ga0207683_10077799 | Ga0207683_100777993 | 77 |
| 433 | 3300026121 | Ga0207683_11267221 | Ga0207683_112672212 | 77 |
| 434 | 3300026142 | Ga0207698_11012984 | Ga0207698_110129843 | 77 |
| 435 | 3300027876 | Ga0209974_10472213 | Ga0209974_104722131 | 77 |
| 436 | 3300027907 | Ga0207428_10041298 | Ga0207428_100412985 | 77 |
| 437 | 3300027907 | Ga0207428_10314759 | Ga0207428_103147593 | 77 |
| 438 | 3300028380 | Ga0268265_10424079 | Ga0268265_104240791 | 77 |
| 439 | 3300028380 | Ga0268265_11571951 | Ga0268265_115719512 | 77 |
| 440 | 3300028381 | Ga0268264_10948347 | Ga0268264_109483472 | 77 |
| 441 | 3300031548 | Ga0307408_100059584 | Ga0307408_1000595842 | 77 |
| 442 | 3300031548 | Ga0307408_102247575 | Ga0307408_1022475752 | 77 |
| 443 | 3300031731 | Ga0307405_10021930 | Ga0307405_100219301 | 77 |
| 444 | 3300031731 | Ga0307405_10031980 | Ga0307405_100319803 | 77 |
| 445 | 3300031731 | Ga0307405_10332989 | Ga0307405_103329892 | 77 |
| 446 | 3300031731 | Ga0307405_11025780 | Ga0307405_110257802 | 77 |
| 447 | 3300031824 | Ga0307413_10041518 | Ga0307413_100415183 | 77 |
| 448 | 3300031824 | Ga0307413_10537104 | Ga0307413_105371043 | 77 |
| 449 | 3300031824 | Ga0307413_10785686 | Ga0307413_107856862 | 77 |
| 450 | 3300031824 | Ga0307413_11454009 | Ga0307413_114540091 | 77 |
| 451 | 3300031852 | Ga0307410_10045594 | Ga0307410_100455943 | 77 |
| 452 | 3300031852 | Ga0307410_10372875 | Ga0307410_103728752 | 77 |
| 453 | 3300031852 | Ga0307410_12131334 | Ga0307410_121313341 | 77 |
| 454 | 3300031889 | Ga0326468_10028937 | Ga0326468_100289371 | 77 |
| 455 | 3300031889 | Ga0326468_10104625 | Ga0326468_101046252 | 77 |
| 456 | 3300031901 | Ga0307406_10086271 | Ga0307406_100862714 | 77 |
| 457 | 3300031901 | Ga0307406_10117270 | Ga0307406_101172702 | 77 |
| 458 | 3300031901 | Ga0307406_10572397 | Ga0307406_105723973 | 77 |
| 459 | 3300031901 | Ga0307406_11472946 | Ga0307406_114729462 | 77 |
| 460 | 3300031901 | Ga0307406_11570932 | Ga0307406_115709322 | 77 |
| 461 | 3300031901 | Ga0307406_12028759 | Ga0307406_120287591 | 77 |
| 462 | 3300031903 | Ga0307407_10319637 | Ga0307407_103196371 | 77 |
| 463 | 3300031903 | Ga0307407_10554430 | Ga0307407_105544303 | 77 |
| 464 | 3300031903 | Ga0307407_11292726 | Ga0307407_112927261 | 77 |
| 465 | 3300031911 | Ga0307412_10015659 | Ga0307412_100156592 | 77 |
| 466 | 3300031995 | Ga0307409_100010481 | Ga0307409_1000104812 | 77 |
| 467 | 3300031995 | Ga0307409_100289624 | Ga0307409_1002896243 | 77 |
| 468 | 3300031995 | Ga0307409_100409576 | Ga0307409_1004095762 | 77 |
| 469 | 3300031995 | Ga0307409_101939195 | Ga0307409_1019391951 | 77 |
| 470 | 3300031995 | Ga0307409_102213745 | Ga0307409_1022137452 | 77 |
| 471 | 3300032002 | Ga0307416_100091949 | Ga0307416_1000919494 | 77 |
| 472 | 3300032002 | Ga0307416_100259254 | Ga0307416_1002592543 | 77 |
| 473 | 3300032002 | Ga0307416_100412124 | Ga0307416_1004121242 | 77 |
| 474 | 3300032002 | Ga0307416_100474025 | Ga0307416_1004740253 | 77 |
| 475 | 3300032002 | Ga0307416_101069416 | Ga0307416_1010694161 | 77 |
| 476 | 3300032002 | Ga0307416_101113540 | Ga0307416_1011135403 | 77 |
| 477 | 3300032004 | Ga0307414_10032571 | Ga0307414_100325713 | 77 |
| 478 | 3300032004 | Ga0307414_12110678 | Ga0307414_121106782 | 77 |
| 479 | 3300032005 | Ga0307411_10091701 | Ga0307411_100917013 | 77 |
| 480 | 3300032005 | Ga0307411_10325246 | Ga0307411_103252462 | 77 |
| 481 | 3300032126 | Ga0307415_100003903 | Ga0307415_1000039034 | 77 |
| 482 | 3300032126 | Ga0307415_100013966 | Ga0307415_1000139668 | 77 |
| 483 | 3300032126 | Ga0307415_100019768 | Ga0307415_1000197684 | 77 |
| 484 | 3300032126 | Ga0307415_100160966 | Ga0307415_1001609663 | 77 |
| 485 | 3300032126 | Ga0307415_100816966 | Ga0307415_1008169662 | 77 |
| 486 | 3300032126 | Ga0307415_100855531 | Ga0307415_1008555311 | 77 |
| 487 | 3300037418 | Ga0395900_0218819 | Ga0395900_0218819_1435_1668 | 77 |
| 488 | 3300037418 | Ga0395900_1489433 | Ga0395900_1489433_122_355 | 77 |
| 489 | 3300037466 | Ga0395898_0164200 | Ga0395898_0164200_1186_1419 | 77 |
| 490 | 3300037466 | Ga0395898_0266121 | Ga0395898_0266121_940_1173 | 77 |
| 491 | 3300037466 | Ga0395898_1298679 | Ga0395898_1298679_136_369 | 77 |
| 492 | 3300038443 | Ga0395901_0200294 | Ga0395901_0200294_382_615 | 77 |
| 493 | 3300038443 | Ga0395901_0784724 | Ga0395901_0784724_421_654 | 77 |
| 494 | 3300038443 | Ga0395901_1525822 | Ga0395901_1525822_336_569 | 77 |
| 495 | 3300039438 | Ga0436360_0286471 | Ga0436360_0286471_165_404 | 77 |
| 496 | 3300039450 | Ga0436363_0868929 | Ga0436363_0868929_182_415 | 77 |
| 497 | 3300041408 | Ga0439453_0101691 | Ga0439453_0101691_294_527 | 77 |
| 498 | 3300041460 | Ga0451802_0735710 | Ga0451802_0735710_442_675 | 77 |
| 499 | 3300041460 | Ga0451802_1266157 | Ga0451802_1266157_417_650 | 77 |
| 500 | 3300041511 | Ga0451855_1197243 | Ga0451855_1197243_135_368 | 77 |
| 501 | 3300041511 | Ga0451855_1394352 | Ga0451855_1394352_342_575 | 77 |
| 502 | 3300042005 | Ga0439448_0137271 | Ga0439448_0137271_329_562 | 77 |
| 503 | 3300042005 | Ga0439448_0326166 | Ga0439448_0326166_58_291 | 77 |
| 504 | 3300042008 | Ga0439450_017523 | Ga0439450_017523_694_927 | 77 |
| 505 | 3300042011 | Ga0439454_011647 | Ga0439454_011647_141_374 | 77 |
| 506 | 3300042013 | Ga0439456_142608 | Ga0439456_142608_187_420 | 77 |
| 507 | 3300042016 | Ga0439463_133979 | Ga0439463_133979_229_462 | 77 |
| 508 | 3300042137 | Ga0450902_006060 | Ga0450902_006060_100_333 | 77 |
| 509 | 3300042157 | Ga0439458_0031983 | Ga0439458_0031983_780_1013 | 77 |
| 510 | 3300042437 | Ga0439444_0052872 | Ga0439444_0052872_428_661 | 77 |
| 511 | 3300042438 | Ga0439459_0104365 | Ga0439459_0104365_304_537 | 77 |
| 512 | 3300042439 | Ga0439464_0036643 | Ga0439464_0036643_732_965 | 77 |
| 513 | 3300042461 | Ga0439460_0021737 | Ga0439460_0021737_687_920 | 77 |
| 514 | 3300042993 | Ga0439440_0039689 | Ga0439440_0039689_288_521 | 77 |
| 515 | 3300044656 | Ga0466969_0020586 | Ga0466969_0020586_1833_2066 | 77 |
| 516 | 3300044683 | Ga0466965_0300487 | Ga0466965_0300487_510_743 | 77 |
| 517 | 3300044693 | Ga0466961_0084739 | Ga0466961_0084739_1380_1613 | 77 |
| 518 | 3300044694 | Ga0466963_0118022 | Ga0466963_0118022_319_552 | 77 |
| 519 | 3300044694 | Ga0466963_0787822 | Ga0466963_0787822_50_283 | 77 |
| 520 | 3300044706 | Ga0466964_0455268 | Ga0466964_0455268_302_535 | 77 |
| 521 | 3300044735 | Ga0466968_0101102 | Ga0466968_0101102_791_1024 | 77 |
| 522 | 3300044765 | Ga0466970_0018283 | Ga0466970_0018283_423_656 | 77 |
| 523 | 3300044765 | Ga0466970_0583917 | Ga0466970_0583917_144_377 | 77 |
| 524 | 3300044842 | Ga0466957_0152829 | Ga0466957_0152829_388_621 | 77 |
| 525 | 3300044901 | Ga0466960_0140337 | Ga0466960_0140337_501_734 | 77 |
| 526 | 3300044901 | Ga0466960_0362378 | Ga0466960_0362378_107_340 | 77 |
| 527 | 3300044901 | Ga0466960_0417554 | Ga0466960_0417554_158_391 | 77 |
| 528 | 3300045049 | Ga0466959_0323740 | Ga0466959_0323740_19_252 | 77 |
| 529 | 3300045051 | Ga0451576_1427861 | Ga0451576_1427861_207_440 | 77 |
| 530 | 3300045836 | Ga0466958_0003325 | Ga0466958_0003325_2678_2911 | 77 |
| 531 | 3300045976 | Ga0466967_0758099 | Ga0466967_0758099_630_863 | 77 |
| 532 | 3300045976 | Ga0466967_0930526 | Ga0466967_0930526_87_320 | 77 |
| 533 | 3300046492 | Ga0495585_0337189 | Ga0495585_0337189_302_535 | 77 |
| 534 | 3300046518 | Ga0495631_0297669 | Ga0495631_0297669_159_392 | 77 |
| 535 | 3300046615 | Ga0495656_0633023 | Ga0495656_0633023_94_327 | 77 |
| 536 | 3300046809 | Ga0495600_0014182 | Ga0495600_0014182_151_393 | 77 |
| 537 | 3300048905 | Ga0496102_0570186 | Ga0496102_0570186_258_491 | 77 |
| 538 | 3300048905 | Ga0496102_1073363 | Ga0496102_1073363_303_536 | 77 |
| 539 | 3300048906 | Ga0496103_0577476 | Ga0496103_0577476_359_592 | 77 |
| 540 | 3300048907 | Ga0496104_0000001 | Ga0496104_0000001_236749_236991 | 77 |
| 541 | 3300048908 | Ga0496105_0500662 | Ga0496105_0500662_686_919 | 77 |
| 542 | 3300048908 | Ga0496105_0714456 | Ga0496105_0714456_304_546 | 77 |
| 543 | 3300048909 | Ga0496106_0028641 | Ga0496106_0028641_3690_3923 | 77 |
| 544 | 3300048910 | Ga0496107_0435605 | Ga0496107_0435605_363_596 | 77 |
| 545 | 3300048911 | Ga0496108_0207117 | Ga0496108_0207117_916_1149 | 77 |
| 546 | 3300048912 | Ga0496109_0611538 | Ga0496109_0611538_450_683 | 77 |
| 547 | 3300048913 | Ga0496110_0000502 | Ga0496110_0000502_22762_23004 | 77 |
| 548 | 3300048913 | Ga0496110_0637141 | Ga0496110_0637141_330_563 | 77 |
| 549 | 3300048913 | Ga0496110_0638969 | Ga0496110_0638969_569_802 | 77 |
| 550 | 3300048914 | Ga0496111_0001359 | Ga0496111_0001359_8005_8247 | 77 |
| 551 | 3300048914 | Ga0496111_0396329 | Ga0496111_0396329_392_625 | 77 |
| 552 | 3300048914 | Ga0496111_1121617 | Ga0496111_1121617_304_537 | 77 |
| 553 | 3300048916 | Ga0496113_0553521 | Ga0496113_0553521_573_806 | 77 |
| 554 | 3300048917 | Ga0496114_0904629 | Ga0496114_0904629_141_374 | 77 |
| 555 | 3300049533 | Ga0501317_083770 | Ga0501317_083770_12_245 | 77 |
| 556 | 3300049541 | Ga0501325_033358 | Ga0501325_033358_86_319 | 77 |
| 557 | 3300049568 | Ga0501031_0093232 | Ga0501031_0093232_226_459 | 77 |
| 558 | 3300049569 | Ga0501032_0404931 | Ga0501032_0404931_346_579 | 77 |
| 559 | 3300049571 | Ga0501034_0766087 | Ga0501034_0766087_517_750 | 77 |
| 560 | 3300049572 | Ga0501036_0036303 | Ga0501036_0036303_652_885 | 77 |
| 561 | 3300049572 | Ga0501036_0123223 | Ga0501036_0123223_1915_2148 | 77 |
| 562 | 3300049573 | Ga0501037_0331041 | Ga0501037_0331041_715_948 | 77 |
| 563 | 3300049574 | Ga0501038_0229351 | Ga0501038_0229351_812_1045 | 77 |
| 564 | 3300049574 | Ga0501038_0259070 | Ga0501038_0259070_38_271 | 77 |
| 565 | 3300049575 | Ga0501039_0233964 | Ga0501039_0233964_25_258 | 77 |
| 566 | 3300049575 | Ga0501039_0838932 | Ga0501039_0838932_443_676 | 77 |
| 567 | 3300049576 | Ga0501040_0034135 | Ga0501040_0034135_2509_2742 | 77 |
| 568 | 3300049576 | Ga0501040_0156985 | Ga0501040_0156985_56_289 | 77 |
| 569 | 3300049577 | Ga0501041_0095986 | Ga0501041_0095986_1515_1748 | 77 |
| 570 | 3300049578 | Ga0501042_0055833 | Ga0501042_0055833_2548_2781 | 77 |
| 571 | 3300049578 | Ga0501042_0288431 | Ga0501042_0288431_865_1098 | 77 |
| 572 | 3300049579 | Ga0501043_0546316 | Ga0501043_0546316_375_608 | 77 |
| 573 | 3300049580 | Ga0501046_0112761 | Ga0501046_0112761_892_1125 | 77 |
| 574 | 3300049582 | Ga0501048_0094394 | Ga0501048_0094394_1394_1627 | 77 |
| 575 | 3300049585 | Ga0501069_0096734 | Ga0501069_0096734_608_841 | 77 |
| 576 | 3300049586 | Ga0501070_0971405 | Ga0501070_0971405_215_448 | 77 |
| 577 | 3300049587 | Ga0501071_0110609 | Ga0501071_0110609_1735_1968 | 77 |
| 578 | 3300049587 | Ga0501071_0565794 | Ga0501071_0565794_63_296 | 77 |
| 579 | 3300049588 | Ga0501072_0021253 | Ga0501072_0021253_3430_3663 | 77 |
| 580 | 3300049589 | Ga0501073_0150386 | Ga0501073_0150386_712_945 | 77 |
| 581 | 3300049591 | Ga0501075_0020369 | Ga0501075_0020369_906_1139 | 77 |
| 582 | 3300049591 | Ga0501075_0280308 | Ga0501075_0280308_837_1070 | 77 |
| 583 | 3300049591 | Ga0501075_0739160 | Ga0501075_0739160_53_286 | 77 |
| 584 | 3300049591 | Ga0501075_1268219 | Ga0501075_1268219_46_279 | 77 |
| 585 | 3300049592 | Ga0501076_0010634 | Ga0501076_0010634_2255_2488 | 77 |
| 586 | 3300049592 | Ga0501076_0147035 | Ga0501076_0147035_389_622 | 77 |
| 587 | 3300049593 | Ga0501077_0214411 | Ga0501077_0214411_961_1194 | 77 |
| 588 | 3300049593 | Ga0501077_0245454 | Ga0501077_0245454_891_1124 | 77 |
| 589 | 3300049659 | Ga0501214_055151 | Ga0501214_055151_235_468 | 77 |
| 590 | 3300049678 | Ga0501248_055261 | Ga0501248_055261_196_429 | 77 |
| 591 | 3300049686 | Ga0501257_242522 | Ga0501257_242522_43_276 | 77 |
| 592 | 3300049741 | Ga0501079_0383792 | Ga0501079_0383792_779_1012 | 77 |
| 593 | 3300049742 | Ga0501080_0188330 | Ga0501080_0188330_584_817 | 77 |
| 594 | 3300049743 | Ga0501081_0228531 | Ga0501081_0228531_727_960 | 77 |
| 595 | 3300049823 | Ga0501044_0340475 | Ga0501044_0340475_220_453 | 77 |
| 596 | 3300049824 | Ga0501045_0054022 | Ga0501045_0054022_2654_2887 | 77 |
| 597 | 3300050507 | nmdc:mga05p37_1295495_c1 | nmdc:mga05p37_1295495_c1_467_700 | 77 |
| 598 | 3300050507 | nmdc:mga05p37_837445_c1 | nmdc:mga05p37_837445_c1_702_935 | 77 |
| 599 | 3300050508 | nmdc:mga09592_485899_c1 | nmdc:mga09592_485899_c1_284_517 | 77 |
| 600 | 3300050510 | nmdc:mga06r32_1650031_c1 | nmdc:mga06r32_1650031_c1_294_527 | 77 |
| 601 | 3300050510 | nmdc:mga06r32_711765_c1 | nmdc:mga06r32_711765_c1_605_838 | 77 |
| 602 | 3300050511 | nmdc:mga08y16_1189065_c1 | nmdc:mga08y16_1189065_c1_140_373 | 77 |
| 603 | 3300050511 | nmdc:mga08y16_757993_c1 | nmdc:mga08y16_757993_c1_359_592 | 77 |
| 604 | 3300050511 | nmdc:mga08y16_7698_c1 | nmdc:mga08y16_7698_c1_6987_7220 | 77 |
| 605 | 3300050512 | nmdc:mga0n895_964546_c1 | nmdc:mga0n895_964546_c1_305_538 | 77 |
| 606 | 3300054114 | Ga0501084_0213629 | Ga0501084_0213629_38_271 | 77 |
| 607 | 3300054114 | Ga0501084_0413942 | Ga0501084_0413942_48_281 | 77 |
| 608 | 3300059423 | Ga0590074_037814 | Ga0590074_037814_468_701 | 77 |
| 609 | 3300059506 | Ga0587085_152834 | Ga0587085_152834_168_401 | 77 |
| 610 | 3300059509 | Ga0587089_047579 | Ga0587089_047579_77_310 | 77 |
| 611 | 3300059512 | Ga0587092_159306 | Ga0587092_159306_75_308 | 77 |
| 612 | 3300060344 | Ga0587071_104109 | Ga0587071_104109_299_532 | 77 |
| 613 | 3300061719 | Ga0466962_0097870 | Ga0466962_0097870_341_574 | 77 |
| 614 | 3300061719 | Ga0466962_0484546 | Ga0466962_0484546_229_462 | 77 |
| 615 | 3300061734 | Ga0530510_0135422 | Ga0530510_0135422_694_927 | 77 |
| 616 | 3300000546 | LJNas_1012758 | LJNas_10127582 | 78 |
| 617 | 3300004799 | Ga0058863_11835538 | Ga0058863_118355381 | 78 |
| 618 | 3300004799 | Ga0058863_11857311 | Ga0058863_118573111 | 78 |
| 619 | 3300004803 | Ga0058862_12879863 | Ga0058862_128798631 | 78 |
| 620 | 3300005329 | Ga0070683_100088801 | Ga0070683_1000888013 | 78 |
| 621 | 3300005329 | Ga0070683_100127469 | Ga0070683_1001274694 | 78 |
| 622 | 3300005329 | Ga0070683_100171800 | Ga0070683_1001718002 | 78 |
| 623 | 3300005343 | Ga0070687_100231790 | Ga0070687_1002317903 | 78 |
| 624 | 3300005355 | Ga0070671_101877317 | Ga0070671_1018773171 | 78 |
| 625 | 3300005356 | Ga0070674_100630013 | Ga0070674_1006300131 | 78 |
| 626 | 3300005437 | Ga0070710_11326063 | Ga0070710_113260632 | 78 |
| 627 | 3300005441 | Ga0070700_101478904 | Ga0070700_1014789041 | 78 |
| 628 | 3300005455 | Ga0070663_100580360 | Ga0070663_1005803601 | 78 |
| 629 | 3300005456 | Ga0070678_101217379 | Ga0070678_1012173792 | 78 |
| 630 | 3300005456 | Ga0070678_102212114 | Ga0070678_1022121141 | 78 |
| 631 | 3300005530 | Ga0070679_100138786 | Ga0070679_1001387862 | 78 |
| 632 | 3300005535 | Ga0070684_100092313 | Ga0070684_1000923133 | 78 |
| 633 | 3300005535 | Ga0070684_100099586 | Ga0070684_1000995861 | 78 |
| 634 | 3300005535 | Ga0070684_101100938 | Ga0070684_1011009383 | 78 |
| 635 | 3300005548 | Ga0070665_100803661 | Ga0070665_1008036612 | 78 |
| 636 | 3300005564 | Ga0070664_100096782 | Ga0070664_1000967823 | 78 |
| 637 | 3300005578 | Ga0068854_102223065 | Ga0068854_1022230651 | 78 |
| 638 | 3300005614 | Ga0068856_101047471 | Ga0068856_1010474712 | 78 |
| 639 | 3300005614 | Ga0068856_102505251 | Ga0068856_1025052511 | 78 |
| 640 | 3300005615 | Ga0070702_100108743 | Ga0070702_1001087432 | 78 |
| 641 | 3300005616 | Ga0068852_102248972 | Ga0068852_1022489721 | 78 |
| 642 | 3300005844 | Ga0068862_100730564 | Ga0068862_1007305641 | 78 |
| 643 | 3300005937 | Ga0081455_10066658 | Ga0081455_100666586 | 78 |
| 644 | 3300005983 | Ga0081540_1113232 | Ga0081540_11132323 | 78 |
| 645 | 3300005985 | Ga0081539_10177518 | Ga0081539_101775183 | 78 |
| 646 | 3300006028 | Ga0070717_10028957 | Ga0070717_100289576 | 78 |
| 647 | 3300006038 | Ga0075365_10240014 | Ga0075365_102400143 | 78 |
| 648 | 3300006038 | Ga0075365_10507640 | Ga0075365_105076402 | 78 |
| 649 | 3300006058 | Ga0075432_10210173 | Ga0075432_102101733 | 78 |
| 650 | 3300006163 | Ga0070715_10990159 | Ga0070715_109901591 | 78 |
| 651 | 3300006358 | Ga0068871_102431051 | Ga0068871_1024310512 | 78 |
| 652 | 3300006881 | Ga0068865_101308406 | Ga0068865_1013084061 | 78 |
| 653 | 3300009098 | Ga0105245_10360343 | Ga0105245_103603433 | 78 |
| 654 | 3300009148 | Ga0105243_10108212 | Ga0105243_101082124 | 78 |
| 655 | 3300009148 | Ga0105243_10275620 | Ga0105243_102756202 | 78 |
| 656 | 3300009174 | Ga0105241_11147056 | Ga0105241_111470562 | 78 |
| 657 | 3300009176 | Ga0105242_10062382 | Ga0105242_100623826 | 78 |
| 658 | 3300009177 | Ga0105248_10544926 | Ga0105248_105449263 | 78 |
| 659 | 3300011119 | Ga0105246_11562535 | Ga0105246_115625352 | 78 |
| 660 | 3300013105 | Ga0157369_11287085 | Ga0157369_112870851 | 78 |
| 661 | 3300013296 | Ga0157374_12050308 | Ga0157374_120503082 | 78 |
| 662 | 3300013307 | Ga0157372_10128777 | Ga0157372_101287775 | 78 |
| 663 | 3300013307 | Ga0157372_12628893 | Ga0157372_126288931 | 78 |
| 664 | 3300013308 | Ga0157375_11189861 | Ga0157375_111898611 | 78 |
| 665 | 3300014745 | Ga0157377_10387709 | Ga0157377_103877091 | 78 |
| 666 | 3300020076 | Ga0206355_1414211 | Ga0206355_14142111 | 78 |
| 667 | 3300021377 | Ga0213874_10398600 | Ga0213874_103986001 | 78 |
| 668 | 3300025899 | Ga0207642_10206510 | Ga0207642_102065101 | 78 |
| 669 | 3300025909 | Ga0207705_10758385 | Ga0207705_107583852 | 78 |
| 670 | 3300025921 | Ga0207652_10252739 | Ga0207652_102527394 | 78 |
| 671 | 3300025927 | Ga0207687_10542543 | Ga0207687_105425433 | 78 |
| 672 | 3300025934 | Ga0207686_10588031 | Ga0207686_105880313 | 78 |
| 673 | 3300025935 | Ga0207709_10235774 | Ga0207709_102357743 | 78 |
| 674 | 3300025937 | Ga0207669_10458085 | Ga0207669_104580852 | 78 |
| 675 | 3300025944 | Ga0207661_10045715 | Ga0207661_100457156 | 78 |
| 676 | 3300025944 | Ga0207661_10098379 | Ga0207661_100983794 | 78 |
| 677 | 3300025944 | Ga0207661_10871099 | Ga0207661_108710991 | 78 |
| 678 | 3300025944 | Ga0207661_12006947 | Ga0207661_120069471 | 78 |
| 679 | 3300025945 | Ga0207679_10896251 | Ga0207679_108962511 | 78 |
| 680 | 3300025945 | Ga0207679_11230685 | Ga0207679_112306851 | 78 |
| 681 | 3300025981 | Ga0207640_10848514 | Ga0207640_108485142 | 78 |
| 682 | 3300026035 | Ga0207703_10505497 | Ga0207703_105054972 | 78 |
| 683 | 3300026067 | Ga0207678_10181200 | Ga0207678_101812003 | 78 |
| 684 | 3300026067 | Ga0207678_10220954 | Ga0207678_102209543 | 78 |
| 685 | 3300026075 | Ga0207708_11014272 | Ga0207708_110142722 | 78 |
| 686 | 3300026078 | Ga0207702_10023957 | Ga0207702_100239572 | 78 |
| 687 | 3300026088 | Ga0207641_10611589 | Ga0207641_106115892 | 78 |
| 688 | 3300026088 | Ga0207641_11142855 | Ga0207641_111428551 | 78 |
| 689 | 3300026121 | Ga0207683_11406880 | Ga0207683_114068802 | 78 |
| 690 | 3300031090 | Ga0265760_10063686 | Ga0265760_100636862 | 78 |
| 691 | 3300031901 | Ga0307406_10888887 | Ga0307406_108888871 | 78 |
| 692 | 3300031901 | Ga0307406_11015202 | Ga0307406_110152022 | 78 |
| 693 | 3300032002 | Ga0307416_101211040 | Ga0307416_1012110402 | 78 |
| 694 | 3300032002 | Ga0307416_102615881 | Ga0307416_1026158811 | 78 |
| 695 | 3300032005 | Ga0307411_11991280 | Ga0307411_119912801 | 78 |
| 696 | 3300035111 | Ga0373923_0142175 | Ga0373923_0142175_291_554 | 78 |
| 697 | 3300035115 | Ga0373941_0002756 | Ga0373941_0002756_336_599 | 78 |
| 698 | 3300038443 | Ga0395901_1743716 | Ga0395901_1743716_292_531 | 78 |
| 699 | 3300039450 | Ga0436363_1403311 | Ga0436363_1403311_67_309 | 78 |
| 700 | 3300041453 | Ga0451797_1067062 | Ga0451797_1067062_201_440 | 78 |
| 701 | 3300041503 | Ga0451847_0113160 | Ga0451847_0113160_155_391 | 78 |
| 702 | 3300041511 | Ga0451855_0707975 | Ga0451855_0707975_312_548 | 78 |
| 703 | 3300044683 | Ga0466965_0273961 | Ga0466965_0273961_566_805 | 78 |
| 704 | 3300044683 | Ga0466965_0547023 | Ga0466965_0547023_323_562 | 78 |
| 705 | 3300044693 | Ga0466961_0327749 | Ga0466961_0327749_616_855 | 78 |
| 706 | 3300044694 | Ga0466963_0080716 | Ga0466963_0080716_431_670 | 78 |
| 707 | 3300044694 | Ga0466963_0219460 | Ga0466963_0219460_419_658 | 78 |
| 708 | 3300044694 | Ga0466963_0572240 | Ga0466963_0572240_456_695 | 78 |
| 709 | 3300044694 | Ga0466963_0669509 | Ga0466963_0669509_227_466 | 78 |
| 710 | 3300044706 | Ga0466964_0814817 | Ga0466964_0814817_38_277 | 78 |
| 711 | 3300044719 | Ga0466971_0190928 | Ga0466971_0190928_661_900 | 78 |
| 712 | 3300044765 | Ga0466970_0498190 | Ga0466970_0498190_284_523 | 78 |
| 713 | 3300044842 | Ga0466957_0099531 | Ga0466957_0099531_1527_1766 | 78 |
| 714 | 3300044842 | Ga0466957_0517888 | Ga0466957_0517888_273_512 | 78 |
| 715 | 3300045836 | Ga0466958_0281926 | Ga0466958_0281926_550_789 | 78 |
| 716 | 3300045836 | Ga0466958_0615641 | Ga0466958_0615641_440_679 | 78 |
| 717 | 3300045976 | Ga0466967_0001485 | Ga0466967_0001485_10007_10246 | 78 |
| 718 | 3300046473 | Ga0495582_0935658 | Ga0495582_0935658_73_312 | 78 |
| 719 | 3300046500 | Ga0495596_0135506 | Ga0495596_0135506_704_940 | 78 |
| 720 | 3300046522 | Ga0495643_0140308 | Ga0495643_0140308_488_724 | 78 |
| 721 | 3300046615 | Ga0495656_0094648 | Ga0495656_0094648_537_773 | 78 |
| 722 | 3300046794 | Ga0495589_0379237 | Ga0495589_0379237_10_246 | 78 |
| 723 | 3300047319 | Ga0495674_0479420 | Ga0495674_0479420_655_894 | 78 |
| 724 | 3300048912 | Ga0496109_1374644 | Ga0496109_1374644_95_334 | 78 |
| 725 | 3300048912 | Ga0496109_1493353 | Ga0496109_1493353_137_388 | 78 |
| 726 | 3300048913 | Ga0496110_0129733 | Ga0496110_0129733_823_1062 | 78 |
| 727 | 3300048915 | Ga0496112_0393554 | Ga0496112_0393554_1074_1313 | 78 |
| 728 | 3300048915 | Ga0496112_0482570 | Ga0496112_0482570_910_1149 | 78 |
| 729 | 3300048916 | Ga0496113_0151843 | Ga0496113_0151843_626_862 | 78 |
| 730 | 3300048916 | Ga0496113_0402604 | Ga0496113_0402604_423_662 | 78 |
| 731 | 3300049568 | Ga0501031_0962906 | Ga0501031_0962906_69_308 | 78 |
| 732 | 3300049571 | Ga0501034_0852039 | Ga0501034_0852039_262_504 | 78 |
| 733 | 3300049578 | Ga0501042_0377660 | Ga0501042_0377660_534_773 | 78 |
| 734 | 3300049592 | Ga0501076_1569208 | Ga0501076_1569208_260_496 | 78 |
| 735 | 3300050492 | nmdc:mga0yw44_731075_c1 | nmdc:mga0yw44_731075_c1_98_337 | 78 |
| 736 | 3300053139 | Ga0500568_0301496 | Ga0500568_0301496_85_321 | 78 |
| 737 | 3300053146 | Ga0500588_0170648 | Ga0500588_0170648_129_365 | 78 |
| 738 | 3300053153 | Ga0500616_0140914 | Ga0500616_0140914_46_285 | 78 |
| 739 | 3300059424 | Ga0590075_081173 | Ga0590075_081173_491_727 | 78 |
| 740 | 3300059426 | Ga0590077_100746 | Ga0590077_100746_317_553 | 78 |
| 741 | 3300059477 | Ga0587084_024069 | Ga0587084_024069_261_500 | 78 |
| 742 | 3300059490 | Ga0587066_060200 | Ga0587066_060200_125_364 | 78 |
| 743 | 3300059493 | Ga0587077_199073 | Ga0587077_199073_148_387 | 78 |
| 744 | 3300059507 | Ga0587086_043705 | Ga0587086_043705_90_326 | 78 |
| 745 | 3300059508 | Ga0587088_085875 | Ga0587088_085875_406_645 | 78 |
| 746 | 3300059510 | Ga0587090_132098 | Ga0587090_132098_141_380 | 78 |
| 747 | 3300059623 | Ga0587101_131912 | Ga0587101_131912_169_405 | 78 |
| 748 | 3300059624 | Ga0587109_143673 | Ga0587109_143673_315_554 | 78 |
| 749 | 3300059628 | Ga0587122_057948 | Ga0587122_057948_169_408 | 78 |
| 750 | 3300059639 | Ga0587062_135677 | Ga0587062_135677_76_312 | 78 |
| 751 | 3300059640 | Ga0587067_059360 | Ga0587067_059360_236_475 | 78 |
| 752 | 3300059641 | Ga0587068_104264 | Ga0587068_104264_245_484 | 78 |
| 753 | 3300059643 | Ga0587072_200117 | Ga0587072_200117_153_392 | 78 |
| 754 | 3300059644 | Ga0587075_092588 | Ga0587075_092588_243_482 | 78 |
| 755 | 3300059645 | Ga0587076_156299 | Ga0587076_156299_80_319 | 78 |
| 756 | 3300059645 | Ga0587076_210042 | Ga0587076_210042_172_411 | 78 |
| 757 | 3300059646 | Ga0587078_039671 | Ga0587078_039671_103_339 | 78 |
| 758 | 3300059647 | Ga0587079_152488 | Ga0587079_152488_168_407 | 78 |
| 759 | 3300059652 | Ga0587107_127851 | Ga0587107_127851_138_374 | 78 |
| 760 | 3300059654 | Ga0587110_069221 | Ga0587110_069221_136_375 | 78 |
| 761 | 3300059660 | Ga0587124_049839 | Ga0587124_049839_193_432 | 78 |
| 762 | 3300061734 | Ga0530510_1244617 | Ga0530510_1244617_238_474 | 78 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar