F479397

General Info

Members Datasets Scaffolds Average Seq Length
757 404 1514 198

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10010863|Ga0307407_100108635
Length 218
Sequence MFKNRQDTSHKRYLINLAMLISGRGSNMDAILAAIKSGRIGNAKPCIVISNKPEAAGLKIASEKYGIPTKVIPSDGLKGWHYDQNIVTILHEHGVTPQSGLVCLAGFTRIISPELVRQYRMRIMNIHPALLPAFPGLHAQKQALDYGVKVSGCTVHFVDEGMDSGPVILQKAVPVVEGDNEECLSARILEQEHELYPEAVRLFCEGRIKIEGRRVSII

Samples

Sample ID Description Type Environment
1 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
13 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
14 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300003380 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM Metagenome Rhizosphere
16 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
17 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
18 3300003398 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM Metagenome Rhizosphere
19 3300003400 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM Metagenome Rhizosphere
20 3300003405 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM Metagenome Rhizosphere
21 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
22 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
23 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
24 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
114 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
115 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
116 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
117 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
118 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
119 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
120 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
121 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
122 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
123 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
124 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
125 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
126 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
127 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
128 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
129 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
130 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
131 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
132 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
133 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
139 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
140 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
141 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
209 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
210 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
211 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
212 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
213 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
227 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
228 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
229 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
230 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
231 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
232 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
233 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
235 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
236 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
237 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
238 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
239 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
240 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
241 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
242 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
249 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
250 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
251 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
252 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
253 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
254 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
255 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
256 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
257 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
258 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
259 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
260 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
261 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
262 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
263 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
264 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
265 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
266 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
267 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
268 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
269 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
270 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
271 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
272 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
273 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
274 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
275 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
280 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
281 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
286 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
287 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
288 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
291 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
292 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
293 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
294 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
298 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
314 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
315 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
316 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
317 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
318 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
319 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
320 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
321 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
334 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
335 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
336 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
337 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
338 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
339 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
340 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
341 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
342 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
343 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
344 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
345 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
346 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
347 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
348 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
349 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
350 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
351 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
352 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
353 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
354 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
355 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
356 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
357 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
358 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
359 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
360 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
361 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
362 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
363 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
364 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
365 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
366 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
367 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
368 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
369 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
370 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
373 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
374 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
375 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
376 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
377 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
378 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
379 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
380 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
381 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
386 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
387 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
388 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
389 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
390 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
391 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
392 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
393 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
394 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
395 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
396 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
397 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
398 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
399 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
400 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
401 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
402 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
403 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
404 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 1.32
Rhizosphere 97.89
Stem 0
Stem Tuber 0
Unclassified 12.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307407_10010863 3300031903 Archaea 4312
2 SwRhRL2b_contig_1053944 2162886007 Archaea 978
3 2214809110 2209111006 Archaea 1989
4 ARcpr5oldR_c000096 3300000041 Archaea 16069
5 ARSoilYngRDRAFT_c00183 3300000042 Archaea 10571
6 ARcpr5yngRDRAFT_c000081 3300000043 Archaea 15640
7 ARcpr5yngRDRAFT_c000728 3300000043 Archaea 4067
8 ARSoilOldRDRAFT_c000734 3300000044 Archaea 3363
9 ARCol0oldRDRAFT_c01827 3300000045 Archaea 1172
10 JGI24746J21847_1019801 3300001977 Archaea 946
11 JGI24033J26618_1003033 3300002155 Unclassified 1752
12 JGI24033J26618_1007337 3300002155 Archaea 1252
13 rootL2_10117772 3300003322 Archaea 1270
14 JGI26129J50193_1000060 3300003349 Archaea 6270
15 JGI26145J50221_1006062 3300003371 Archaea 1007
16 JGI25407J50210_10009057 3300003373 Archaea 2516
17 JGI26144J50225_100401 3300003380 Archaea 1746
18 JGI26140J50224_100272 3300003383 Archaea 2755
19 JGI26134J50242_100046 3300003392 Archaea 6654
20 JGI26130J50248_100661 3300003398 Archaea 1174
21 JGI26131J50246_100307 3300003400 Archaea 2030
22 JGI26132J50249_100592 3300003405 Archaea 1092
23 JGI26143J51219_1001925 3300003502 Unclassified 880
24 JGI26141J51220_1002607 3300003503 Archaea 1100
25 Ga0065717_1000325 3300005276 Archaea 1188
26 Ga0065716_1002521 3300005277 Archaea 1708
27 Ga0065704_10001327 3300005289 Archaea 19666
28 Ga0065704_10072501 3300005289 Archaea 8419
29 Ga0065704_10085605 3300005289 Bacteria 3205
30 Ga0065704_10280051 3300005289 Unclassified 924
31 Ga0065715_10088900 3300005293 Archaea 52511
32 Ga0065715_10098682 3300005293 Archaea 3512
33 Ga0065707_10000175 3300005295 Bacteria 2077
34 Ga0065707_10000649 3300005295 Archaea 16721
35 Ga0065707_10009381 3300005295 Bacteria 2593
36 Ga0070658_10011451 3300005327 Bacteria 7113
37 Ga0070676_10002597 3300005328 Archaea 9294
38 Ga0070676_10007578 3300005328 Archaea 5830
39 Ga0070676_10274993 3300005328 Archaea 1132
40 Ga0070683_100003539 3300005329 Bacteria 12714
41 Ga0070683_100006512 3300005329 Bacteria 9805
42 Ga0070683_101400535 3300005329 Unclassified 672
43 Ga0070690_100062480 3300005330 Bacteria 2401
44 Ga0070670_100018948 3300005331 Archaea 5902
45 Ga0070670_100483741 3300005331 Archaea 1099
46 Ga0068869_100208677 3300005334 Archaea 1543
47 Ga0070680_100010867 3300005336 Bacteria 7033
48 Ga0070680_100012749 3300005336 Archaea 6536
49 Ga0070680_100545073 3300005336 Archaea 994
50 Ga0070680_100562435 3300005336 Bacteria 978
51 Ga0070682_100327246 3300005337 Bacteria 1134
52 Ga0070660_100002610 3300005339 Bacteria 12372
53 Ga0070660_100317633 3300005339 Archaea 1279
54 Ga0070660_101014348 3300005339 Archaea 701
55 Ga0070689_100053877 3300005340 Bacteria 3114
56 Ga0070691_10003896 3300005341 Bacteria 6751
57 Ga0070691_10190817 3300005341 Archaea 1072
58 Ga0070687_100025056 3300005343 Archaea 2857
59 Ga0070661_100053609 3300005344 Archaea 2953
60 Ga0070668_100042977 3300005347 Archaea 3464
61 Ga0070668_100351265 3300005347 Bacteria 1248
62 Ga0070668_100627618 3300005347 Unclassified 942
63 Ga0070669_100002284 3300005353 Archaea 13901
64 Ga0070669_100738326 3300005353 Archaea 833
65 Ga0070675_100029961 3300005354 Archaea 4391
66 Ga0070674_100391268 3300005356 Archaea 1133
67 Ga0070673_100624913 3300005364 Bacteria 984
68 Ga0070659_100081597 3300005366 Archaea 2583
69 Ga0070667_100011049 3300005367 Archaea 7469
70 Ga0070713_100031368 3300005436 Bacteria 4233
71 Ga0070705_100005773 3300005440 Archaea 6049
72 Ga0070700_100000641 3300005441 Archaea 17308
73 Ga0070700_100495315 3300005441 Unclassified 939
74 Ga0070694_100091057 3300005444 Archaea 2140
75 Ga0070694_100174322 3300005444 Archaea 1586
76 Ga0070708_100025553 3300005445 Archaea 5049
77 Ga0070708_100030635 3300005445 Bacteria 4652
78 Ga0070708_100485928 3300005445 Archaea 1165
79 Ga0070662_100096418 3300005457 Archaea 2231
80 Ga0070662_100109909 3300005457 Archaea 2098
81 Ga0070662_100332493 3300005457 Archaea 1241
82 Ga0070681_10001551 3300005458 Bacteria 20353
83 Ga0070681_10020595 3300005458 Archaea 6609
84 Ga0070681_10307330 3300005458 Unclassified 1495
85 Ga0068867_100007358 3300005459 Archaea 7790
86 Ga0068867_100523880 3300005459 Archaea 1022
87 Ga0070706_100167140 3300005467 Archaea 2054
88 Ga0070698_100020990 3300005471 Archaea 6844
89 Ga0070699_100108217 3300005518 Archaea 2439
90 Ga0070699_100158248 3300005518 Archaea 2004
91 Ga0070699_100175241 3300005518 Archaea 1901
92 Ga0070679_100056777 3300005530 Bacteria 3901
93 Ga0070684_100009672 3300005535 Bacteria 7605
94 Ga0070684_100054490 3300005535 Bacteria 3485
95 Ga0070684_100225022 3300005535 Bacteria 1712
96 Ga0070684_101471531 3300005535 Bacteria 642
97 Ga0070697_100099374 3300005536 Archaea 2416
98 Ga0070697_100116900 3300005536 Unclassified 2228
99 Ga0070697_100151115 3300005536 Archaea 1957
100 Ga0068853_100099590 3300005539 Bacteria 2568
101 Ga0068853_100129013 3300005539 Bacteria 2262
102 Ga0068853_100183724 3300005539 Archaea 1897
103 Ga0070672_100048645 3300005543 Archaea 3296
104 Ga0070672_100322121 3300005543 Archaea 1314
105 Ga0070686_100255908 3300005544 Archaea 1281
106 Ga0070695_100021051 3300005545 Archaea 3987
107 Ga0070695_100037722 3300005545 Bacteria 3047
108 Ga0070695_100634344 3300005545 Bacteria 842
109 Ga0070695_100802358 3300005545 Archaea 754
110 Ga0070696_100008694 3300005546 Archaea 6795
111 Ga0070696_100016138 3300005546 Archaea 5024
112 Ga0070696_100034527 3300005546 Archaea 3479
113 Ga0070696_100437179 3300005546 Bacteria 1030
114 Ga0070693_100002477 3300005547 Archaea 8505
115 Ga0070693_100083338 3300005547 Archaea 1911
116 Ga0070704_100108297 3300005549 Archaea 2109
117 Ga0070704_100691452 3300005549 Bacteria 904
118 Ga0070704_100858484 3300005549 Archaea 814
119 Ga0068855_100017086 3300005563 Bacteria 8728
120 Ga0068855_100030181 3300005563 Bacteria 6485
121 Ga0068855_100225672 3300005563 Bacteria 2099
122 Ga0070664_100234319 3300005564 Archaea 1646
123 Ga0068857_100000274 3300005577 Bacteria 35189
124 Ga0068857_100079153 3300005577 Archaea 2934
125 Ga0068856_100001029 3300005614 Bacteria 29689
126 Ga0068856_100027445 3300005614 Bacteria 5555
127 Ga0068856_100777173 3300005614 Bacteria 978
128 Ga0070702_100010321 3300005615 Archaea 4594
129 Ga0070702_100017421 3300005615 Archaea 3706
130 Ga0068852_100010033 3300005616 Bacteria 7048
131 Ga0068852_100886616 3300005616 Unclassified 909
132 Ga0068859_100151233 3300005617 Bacteria 2397
133 Ga0068859_100326155 3300005617 Unclassified 1629
134 Ga0068859_100512360 3300005617 Archaea 1295
135 Ga0068864_100059319 3300005618 Archaea 3310
136 Ga0068864_100368331 3300005618 Archaea 1359
137 Ga0068866_10032118 3300005718 Unclassified 2535
138 Ga0068870_10001699 3300005840 Archaea 9001
139 Ga0068870_10002108 3300005840 Archaea 8239
140 Ga0068870_10010762 3300005840 Archaea 4213
141 Ga0068863_100144229 3300005841 Bacteria 2277
142 Ga0068858_100040655 3300005842 Bacteria 4313
143 Ga0068860_100001273 3300005843 Archaea 27431
144 Ga0068860_100094852 3300005843 Archaea 2843
145 Ga0068860_100245669 3300005843 Bacteria 1741
146 Ga0068860_100659380 3300005843 Bacteria 1054
147 Ga0068862_100055904 3300005844 Bacteria 3381
148 Ga0081455_10000104 3300005937 Archaea 93372
149 Ga0081455_10009878 3300005937 Archaea 9765
150 Ga0081455_10050875 3300005937 Bacteria 3558
151 Ga0081538_10002365 3300005981 Archaea 18534
152 Ga0081540_1029301 3300005983 Bacteria 3069
153 Ga0070717_10255483 3300006028 Unclassified 1549
154 Ga0075432_10003873 3300006058 Archaea 5099
155 Ga0075432_10068091 3300006058 Archaea 1276
156 Ga0075427_10002177 3300006194 Bacteria 2606
157 Ga0075427_10004703 3300006194 Archaea 1923
158 Ga0097621_100020197 3300006237 Bacteria 5131
159 Ga0097621_100219997 3300006237 Bacteria 1654
160 Ga0075428_100000340 3300006844 Bacteria 46263
161 Ga0075428_100039152 3300006844 Archaea 5217
162 Ga0075428_100103227 3300006844 Archaea 3109
163 Ga0075428_100237364 3300006844 Archaea 1967
164 Ga0075428_100398846 3300006844 Bacteria 1474
165 Ga0075428_100605400 3300006844 Bacteria 1170
166 Ga0075430_100000503 3300006846 Archaea 29338
167 Ga0075430_100008347 3300006846 Archaea 8747
168 Ga0075430_100046646 3300006846 Bacteria 3659
169 Ga0075430_100206176 3300006846 Unclassified 1632
170 Ga0075431_100023766 3300006847 Archaea 6274
171 Ga0075431_100031366 3300006847 Bacteria 5474
172 Ga0075431_100034450 3300006847 Archaea 5217
173 Ga0075431_100561869 3300006847 Archaea 1128
174 Ga0075433_10002271 3300006852 Archaea 14615
175 Ga0075434_100005657 3300006871 Archaea 11403
176 Ga0075429_100011350 3300006880 Archaea 7713
177 Ga0075429_100038156 3300006880 Bacteria 4182
178 Ga0075429_100079919 3300006880 Archaea 2850
179 Ga0075429_100206860 3300006880 Bacteria 1719
180 Ga0068865_100226366 3300006881 Unclassified 1465
181 Ga0075436_100000209 3300006914 Archaea 36162
182 Ga0075436_100113727 3300006914 Bacteria 1890
183 Ga0097620_100151234 3300006931 Bacteria 2397
184 Ga0097620_100326131 3300006931 Unclassified 1629
185 Ga0097620_100512320 3300006931 Archaea 1295
186 Ga0075435_100005959 3300007076 Archaea 8575
187 Ga0075435_100088074 3300007076 Archaea 2559
188 Ga0105244_10175284 3300009036 Archaea 1019
189 Ga0105240_10001321 3300009093 Bacteria 42794
190 Ga0105240_10035521 3300009093 Bacteria 6421
191 Ga0105240_10221062 3300009093 Bacteria 2207
192 Ga0105240_10479236 3300009093 Bacteria 1387
193 Ga0111539_10009140 3300009094 Archaea 12536
194 Ga0111539_10039319 3300009094 Bacteria 5703
195 Ga0111539_10238719 3300009094 Archaea 2116
196 Ga0105245_10048489 3300009098 Bacteria 3800
197 Ga0105245_10051832 3300009098 Bacteria 3679
198 Ga0114129_10003830 3300009147 Archaea 21199
199 Ga0114129_10005756 3300009147 Archaea 17563
200 Ga0114129_10046348 3300009147 Archaea 6110
201 Ga0114129_10085620 3300009147 Archaea 4373
202 Ga0114129_10118811 3300009147 Archaea 3642
203 Ga0114129_10677097 3300009147 Unclassified 1328
204 Ga0105241_10004180 3300009174 Bacteria 10656
205 Ga0105242_10061149 3300009176 Archaea 3097
206 Ga0105242_10071765 3300009176 Archaea 2874
207 Ga0105242_10281809 3300009176 Bacteria 1510
208 Ga0105248_10072900 3300009177 Bacteria 3860
209 Ga0105248_10200032 3300009177 Bacteria 2251
210 Ga0105248_10773346 3300009177 Unclassified 1084
211 Ga0105237_10005322 3300009545 Bacteria 14554
212 Ga0105237_10006646 3300009545 Bacteria 12782
213 Ga0105237_10107692 3300009545 Archaea 2779
214 Ga0105238_10001543 3300009551 Bacteria 23080
215 Ga0105238_10027015 3300009551 Bacteria 5850
216 Ga0105249_10006628 3300009553 Bacteria 10074
217 Ga0105249_10048680 3300009553 Archaea 3864
218 Ga0105249_10821945 3300009553 Unclassified 994
219 Ga0105239_10005012 3300010375 Bacteria 15636
220 Ga0105239_10143257 3300010375 Bacteria 2664
221 Ga0105239_10529569 3300010375 Archaea 1341
222 Ga0105239_10623400 3300010375 Archaea 1231
223 Ga0105239_11814046 3300010375 Bacteria 707
224 Ga0105246_10001769 3300011119 Archaea 12926
225 Ga0105246_10157273 3300011119 Archaea 1728
226 Ga0105246_10219557 3300011119 Archaea 1489
227 Ga0105246_10486554 3300011119 Archaea 1045
228 Ga0157344_1001324 3300012476 Archaea 1161
229 Ga0157336_1000055 3300012477 Archaea 4458
230 Ga0157328_1000059 3300012478 Archaea 3401
231 Ga0157346_1003293 3300012480 Archaea 894
232 Ga0157337_1000043 3300012483 Archaea 5158
233 Ga0157325_1000035 3300012485 Archaea 5690
234 Ga0157321_1002365 3300012487 Unclassified 1048
235 Ga0157343_1000156 3300012488 Archaea 2363
236 Ga0157322_1000564 3300012490 Archaea 1455
237 Ga0157341_1000208 3300012494 Archaea 2694
238 Ga0157323_1000099 3300012495 Archaea 3836
239 Ga0157319_1004225 3300012497 Unclassified 932
240 Ga0157345_1000397 3300012498 Archaea 4634
241 Ga0157314_1000615 3300012500 Archaea 3245
242 Ga0157313_1001110 3300012503 Archaea 1395
243 Ga0157324_1001265 3300012506 Archaea 1369
244 Ga0157342_1000938 3300012507 Archaea 1996
245 Ga0157316_1000151 3300012510 Archaea 3325
246 Ga0157327_1000064 3300012512 Unclassified 4431
247 Ga0157326_1001471 3300012513 Archaea 2603
248 Ga0157338_1000085 3300012515 Archaea 4058
249 Ga0157371_10175352 3300013102 Archaea 1533
250 Ga0157370_10021976 3300013104 Bacteria 6353
251 Ga0157370_10023547 3300013104 Bacteria 6111
252 Ga0157369_10014331 3300013105 Bacteria 8953
253 Ga0157369_10036228 3300013105 Bacteria 5406
254 Ga0157374_10195426 3300013296 Bacteria 1980
255 Ga0157378_10000690 3300013297 Archaea 31757
256 Ga0157378_10038119 3300013297 Archaea 4259
257 Ga0157378_10088345 3300013297 Archaea 2813
258 Ga0163162_10187679 3300013306 Bacteria 2194
259 Ga0163162_10699702 3300013306 Archaea 1135
260 Ga0157372_10006277 3300013307 Bacteria 12644
261 Ga0157372_10013713 3300013307 Archaea 8663
262 Ga0157375_10001761 3300013308 Bacteria 18567
263 Ga0157375_10009734 3300013308 Archaea 8449
264 Ga0157375_10445491 3300013308 Archaea 1460
265 Ga0163163_10129806 3300014325 Bacteria 2560
266 Ga0163163_10498985 3300014325 Bacteria 1279
267 Ga0163163_10648135 3300014325 Unclassified 1120
268 Ga0157380_10741536 3300014326 Unclassified 992
269 Ga0157380_10856196 3300014326 Archaea 931
270 Ga0182008_10005472 3300014497 Archaea 7232
271 Ga0157377_10212742 3300014745 Archaea 1234
272 Ga0157379_10029872 3300014968 Archaea 4847
273 Ga0157379_10093983 3300014968 Bacteria 2690
274 Ga0157379_10140628 3300014968 Bacteria 2176
275 Ga0157376_10052711 3300014969 Bacteria 3383
276 Ga0157376_10066730 3300014969 Bacteria 3042
277 Ga0157376_10296746 3300014969 Bacteria 1528
278 Ga0157376_10348718 3300014969 Unclassified 1416
279 Ga0163161_10001344 3300017792 Archaea 18297
280 Ga0207697_10000194 3300025315 Archaea 32139
281 Ga0207682_10012843 3300025893 Archaea 3267
282 Ga0207688_10003752 3300025901 Archaea 8293
283 Ga0207647_10007183 3300025904 Archaea 8072
284 Ga0207647_10070252 3300025904 Archaea 2115
285 Ga0207699_10118452 3300025906 Bacteria 1708
286 Ga0207645_10000495 3300025907 Archaea 32481
287 Ga0207645_10054069 3300025907 Unclassified 2565
288 Ga0207645_10580008 3300025907 Archaea 761
289 Ga0207643_10000033 3300025908 Archaea 94319
290 Ga0207643_10000910 3300025908 Archaea 17695
291 Ga0207643_10007098 3300025908 Archaea 6006
292 Ga0207684_10301777 3300025910 Archaea 1381
293 Ga0207654_10002192 3300025911 Bacteria 9997
294 Ga0207707_10000705 3300025912 Bacteria 33231
295 Ga0207707_10056179 3300025912 Bacteria 3425
296 Ga0207707_10168239 3300025912 Archaea 1915
297 Ga0207707_10660825 3300025912 Archaea 880
298 Ga0207695_10000843 3300025913 Bacteria 56294
299 Ga0207695_10002384 3300025913 Bacteria 27871
300 Ga0207695_10257587 3300025913 Bacteria 1643
301 Ga0207671_10010637 3300025914 Bacteria 7569
302 Ga0207671_10088684 3300025914 Bacteria 2327
303 Ga0207671_10224625 3300025914 Bacteria 1472
304 Ga0207660_10019014 3300025917 Bacteria 4590
305 Ga0207662_10000238 3300025918 Archaea 25395
306 Ga0207662_10022374 3300025918 Archaea 3624
307 Ga0207662_10067505 3300025918 Archaea 2157
308 Ga0207657_10037228 3300025919 Bacteria 4346
309 Ga0207649_10427128 3300025920 Archaea 996
310 Ga0207652_10044242 3300025921 Bacteria 3793
311 Ga0207646_11080828 3300025922 Archaea 707
312 Ga0207681_10003191 3300025923 Archaea 10287
313 Ga0207681_10010414 3300025923 Archaea 5689
314 Ga0207694_10000435 3300025924 Bacteria 38792
315 Ga0207650_10011479 3300025925 Archaea 6098
316 Ga0207650_10101399 3300025925 Archaea 2216
317 Ga0207650_10420944 3300025925 Unclassified 1108
318 Ga0207659_10041063 3300025926 Archaea 3239
319 Ga0207687_10001664 3300025927 Bacteria 15341
320 Ga0207644_10451828 3300025931 Archaea 1056
321 Ga0207690_10133054 3300025932 Archaea 1823
322 Ga0207690_10221346 3300025932 Archaea 1448
323 Ga0207706_10003857 3300025933 Archaea 14281
324 Ga0207706_10041817 3300025933 Archaea 4062
325 Ga0207670_10025424 3300025936 Bacteria 3716
326 Ga0207669_10355828 3300025937 Archaea 1133
327 Ga0207704_10039277 3300025938 Archaea 2754
328 Ga0207704_10039386 3300025938 Bacteria 2751
329 Ga0207691_10000554 3300025940 Archaea 37396
330 Ga0207691_10159189 3300025940 Archaea 1982
331 Ga0207711_10010697 3300025941 Bacteria 7631
332 Ga0207711_10104613 3300025941 Bacteria 2509
333 Ga0207689_10008673 3300025942 Archaea 8850
334 Ga0207689_10040810 3300025942 Archaea 3840
335 Ga0207661_10003635 3300025944 Bacteria 10745
336 Ga0207661_10042505 3300025944 Bacteria 3583
337 Ga0207667_10002003 3300025949 Bacteria 25560
338 Ga0207667_10005392 3300025949 Bacteria 15597
339 Ga0207712_10004789 3300025961 Archaea 8548
340 Ga0207712_10006064 3300025961 Archaea 7627
341 Ga0207712_10019052 3300025961 Bacteria 4477
342 Ga0207668_10325902 3300025972 Bacteria 1276
343 Ga0207668_10442458 3300025972 Archaea 1107
344 Ga0207658_10033798 3300025986 Archaea 3649
345 Ga0207677_10061141 3300026023 Archaea 2607
346 Ga0207703_10391855 3300026035 Bacteria 1287
347 Ga0207639_10113964 3300026041 Bacteria 2209
348 Ga0207639_10174223 3300026041 Archaea 1825
349 Ga0207639_10261828 3300026041 Archaea 1513
350 Ga0207708_10000173 3300026075 Archaea 51383
351 Ga0207708_10312343 3300026075 Bacteria 1281
352 Ga0207702_10001718 3300026078 Bacteria 21566
353 Ga0207702_10023382 3300026078 Bacteria 5125
354 Ga0207702_10113551 3300026078 Bacteria 2413
355 Ga0207648_10000065 3300026089 Archaea 98577
356 Ga0207648_10003045 3300026089 Archaea 17713
357 Ga0207648_10005477 3300026089 Archaea 12790
358 Ga0207674_10000110 3300026116 Bacteria 94822
359 Ga0207674_10013966 3300026116 Archaea 8883
360 Ga0207675_100875862 3300026118 Archaea 913
361 Ga0207698_10013951 3300026142 Bacteria 5322
362 Ga0207698_10084784 3300026142 Archaea 2570
363 Ga0209973_1004419 3300027252 Archaea 1444
364 Ga0209969_1010390 3300027360 Archaea 1332
365 Ga0209981_1001110 3300027378 Archaea 3413
366 Ga0209984_1001082 3300027424 Unclassified 2912
367 Ga0209984_1006150 3300027424 Archaea 1465
368 Ga0209995_1001295 3300027471 Archaea 3848
369 Ga0209983_1019494 3300027665 Archaea 1411
370 Ga0209971_1011041 3300027682 Unclassified 2139
371 Ga0209971_1051154 3300027682 Archaea 998
372 Ga0209966_1000502 3300027695 Archaea 10304
373 Ga0209998_10001541 3300027717 Archaea 5539
374 Ga0209974_10000551 3300027876 Archaea 12500
375 Ga0209974_10022841 3300027876 Archaea 2070
376 Ga0207428_10000042 3300027907 Archaea 200337
377 Ga0207428_10000126 3300027907 Archaea 105456
378 Ga0207428_10000157 3300027907 Archaea 93146
379 Ga0207428_10015328 3300027907 Bacteria 6632
380 Ga0207428_10132567 3300027907 Archaea 1906
381 Ga0207428_10537736 3300027907 Unclassified 846
382 Ga0268265_10254558 3300028380 Archaea 1557
383 Ga0268265_10868900 3300028380 Archaea 883
384 Ga0268264_10013518 3300028381 Archaea 6723
385 Ga0265337_1012888 3300028556 Bacteria 2825
386 Ga0265319_1000889 3300028563 Bacteria 18881
387 Ga0265319_1032723 3300028563 Bacteria 1800
388 Ga0265334_10063359 3300028573 Bacteria 1390
389 Ga0265318_10009226 3300028577 Bacteria 4352
390 Ga0265336_10020778 3300028666 Bacteria 2104
391 Ga0265338_10017176 3300028800 Bacteria 7817
392 Ga0265338_10113817 3300028800 Bacteria 2172
393 Ga0307408_100008598 3300031548 Archaea 6741
394 Ga0307408_100088595 3300031548 Unclassified 2331
395 Ga0265313_10002398 3300031595 Bacteria 16232
396 Ga0265314_10009420 3300031711 Bacteria 8236
397 Ga0307405_10061035 3300031731 Archaea 2381
398 Ga0307413_10009902 3300031824 Archaea 4589
399 Ga0307410_10001681 3300031852 Archaea 10176
400 Ga0307410_10011939 3300031852 Archaea 4994
401 Ga0307410_10053940 3300031852 Unclassified 2722
402 Ga0307406_10009044 3300031901 Archaea 5571
403 Ga0307406_10834593 3300031901 Archaea 780
404 Ga0307406_11040225 3300031901 Archaea 704
405 Ga0307407_10001049 3300031903 Archaea 9564
406 Ga0307412_10096775 3300031911 Archaea 2078
407 Ga0307409_100009193 3300031995 Archaea 6057
408 Ga0307416_100000587 3300032002 Archaea 18639
409 Ga0307416_100019874 3300032002 Archaea 4774
410 Ga0307416_100367348 3300032002 Unclassified 1463
411 Ga0307416_100770562 3300032002 Archaea 1056
412 Ga0307414_10002407 3300032004 Archaea 9797
413 Ga0307414_10010069 3300032004 Archaea 5464
414 Ga0307414_10267303 3300032004 Unclassified 1430
415 Ga0307414_10699137 3300032004 Archaea 918
416 Ga0307411_10206364 3300032005 Archaea 1513
417 Ga0307415_100006607 3300032126 Archaea 6272
418 Ga0307415_100010752 3300032126 Archaea 5200
419 Ga0307415_100018964 3300032126 Archaea 4167
420 Ga0307415_100061375 3300032126 Unclassified 2602
421 Ga0373930_0018343 3300034816 Bacteria 1344
422 Ga0373948_0004804 3300034817 Archaea 2158
423 Ga0373959_0042987 3300034820 Unclassified 954
424 Ga0373928_0075540 3300035084 Archaea 841
425 Ga0373951_0162569 3300035091 Bacteria 632
426 Ga0373952_0084498 3300035092 Archaea 815
427 Ga0373923_0217922 3300035111 Bacteria 886
428 Ga0373932_0007367 3300035112 Archaea 2620
429 Ga0373932_0021598 3300035112 Bacteria 1701
430 Ga0373953_0003967 3300035117 Bacteria 4667
431 Ga0373953_0202291 3300035117 Bacteria 859
432 Ga0373954_0005816 3300035118 Bacteria 5355
433 Ga0373956_0045384 3300035119 Bacteria 1961
434 Ga0373960_0008253 3300035121 Archaea 2491
435 Ga0373960_0230253 3300035121 Archaea 666
436 Ga0373946_0016624 3300035171 Bacteria 2805
437 Ga0373942_0038759 3300035207 Unclassified 1293
438 Ga0373961_0006471 3300035241 Archaea 2812
439 Ga0373962_0037096 3300035242 Archaea 1360
440 Ga0373931_0001566 3300035691 Bacteria 9874
441 Ga0373931_0008802 3300035691 Bacteria 4803
442 Ga0373931_0039417 3300035691 Archaea 2475
443 Ga0373935_0392193 3300035692 Bacteria 996
444 Ga0373927_0231810 3300035695 Bacteria 1213
445 Ga0373933_0047040 3300035724 Bacteria 2564
446 Ga0373937_0007604 3300036401 Bacteria 9388
447 Ga0373937_0053879 3300036401 Bacteria 3690
448 Ga0373937_0200004 3300036401 Bacteria 1878
449 Ga0373925_0000342 3300037068 Bacteria 48487
450 Ga0373925_0028514 3300037068 Bacteria 4091
451 Ga0436365_0313593 3300039437 Bacteria 874
452 Ga0436362_0184775 3300039453 Bacteria 1824
453 Ga0439438_032674 3300041405 Unclassified 1379
454 Ga0439453_0000080 3300041408 Archaea 7250
455 Ga0439461_0029541 3300041410 Unclassified 1135
456 Ga0439466_0071172 3300041411 Unclassified 1107
457 Ga0439441_000139 3300042001 Archaea 6133
458 Ga0439443_000156 3300042003 Archaea 4833
459 Ga0439448_0027612 3300042005 Bacteria 1790
460 Ga0439432_011852 3300042006 Unclassified 2996
461 Ga0439450_001124 3300042008 Unclassified 3795
462 Ga0439451_001457 3300042009 Archaea 4677
463 Ga0439451_006123 3300042009 Bacteria 2459
464 Ga0439452_004537 3300042010 Unclassified 4641
465 Ga0439454_000290 3300042011 Archaea 3706
466 Ga0439456_006805 3300042013 Unclassified 2339
467 Ga0439456_018928 3300042013 Bacteria 1447
468 Ga0439463_001571 3300042016 Archaea 6015
469 Ga0439463_033853 3300042016 Archaea 1293
470 Ga0450923_000120 3300042125 Archaea 6757
471 Ga0450906_044739 3300042145 Unclassified 781
472 Ga0439435_0002194 3300042436 Unclassified 3821
473 Ga0439444_0000082 3300042437 Archaea 7169
474 Ga0439444_0010669 3300042437 Unclassified 1472
475 Ga0439464_0064878 3300042439 Archaea 1073
476 Ga0439460_0022327 3300042461 Archaea 1735
477 Ga0439460_0022367 3300042461 Unclassified 1733
478 Ga0439460_0037220 3300042461 Archaea 1414
479 Ga0439460_0060142 3300042461 Bacteria 1158
480 Ga0451577_0016038 3300042876 Bacteria 6950
481 Ga0451577_0041378 3300042876 Bacteria 4136
482 Ga0451577_0262544 3300042876 Archaea 1564
483 Ga0439440_0000686 3300042993 Archaea 5799
484 Ga0439440_0001139 3300042993 Archaea 4760
485 Ga0439440_0011564 3300042993 Bacteria 1863
486 Ga0453683_0435106 3300044673 Archaea 847
487 Ga0453684_0497480 3300044712 Bacteria 1350
488 Ga0453684_1037972 3300044712 Bacteria 870
489 Ga0451576_0103607 3300045051 Bacteria 2960
490 Ga0495629_0000010 3300046459 Bacteria 340114
491 Ga0495580_0037476 3300046472 Bacteria 3480
492 Ga0495580_0196830 3300046472 Bacteria 1389
493 Ga0495582_0055439 3300046473 Bacteria 2185
494 Ga0495639_0000018 3300046475 Bacteria 74700
495 Ga0495662_0263510 3300046476 Bacteria 848
496 Ga0495584_0028153 3300046491 Bacteria 2847
497 Ga0495630_0647924 3300046517 Unclassified 809
498 Ga0495666_0000033 3300046526 Bacteria 53208
499 Ga0495652_0448016 3300046529 Bacteria 904
500 Ga0495586_0000023 3300046535 Bacteria 106547
501 Ga0495587_0004473 3300046536 Bacteria 9197
502 Ga0495587_0046063 3300046536 Bacteria 2590
503 Ga0495587_0109361 3300046536 Bacteria 1589
504 Ga0495667_0383498 3300046559 Bacteria 886
505 Ga0495656_0000029 3300046615 Bacteria 79472
506 Ga0495635_0001791 3300046663 Bacteria 14509
507 Ga0495659_0000502 3300046664 Bacteria 14414
508 Ga0495659_0002515 3300046664 Bacteria 5918
509 Ga0495659_0005507 3300046664 Bacteria 3984
510 Ga0495599_0060574 3300046678 Bacteria 2367
511 Ga0495647_0024299 3300046681 Bacteria 2205
512 Ga0495613_0031592 3300046689 Bacteria 3934
513 Ga0495600_0087433 3300046809 Bacteria 2033
514 Ga0495581_0006724 3300047315 Bacteria 6668
515 Ga0495674_0871846 3300047319 Unclassified 696
516 Ga0495676_0071841 3300047321 Bacteria 2659
517 Ga0495680_0006320 3300047322 Bacteria 11026
518 Ga0495675_0102508 3300047444 Bacteria 1790
519 Ga0495684_0014712 3300047471 Bacteria 6023
520 Ga0495684_0239293 3300047471 Bacteria 1325
521 Ga0495602_0053850 3300048088 Bacteria 3559
522 Ga0496100_0065105 3300048903 Archaea 2414
523 Ga0496101_0339200 3300048904 Bacteria 1180
524 Ga0496102_0026490 3300048905 Archaea 5172
525 Ga0496103_0286434 3300048906 Archaea 1060
526 Ga0496104_0894241 3300048907 Bacteria 793
527 Ga0496106_0074580 3300048909 Archaea 2597
528 Ga0496106_1049905 3300048909 Unclassified 640
529 Ga0496107_0059170 3300048910 Archaea 2772
530 Ga0496109_0544218 3300048912 Archaea 1095
531 Ga0496112_0011290 3300048915 Bacteria 8148
532 Ga0496122_0376708 3300048925 Bacteria 730
533 Ga0496125_0002283 3300048928 Bacteria 25392
534 Ga0496125_0005228 3300048928 Bacteria 14550
535 Ga0501291_000383 3300049514 Archaea 5393
536 Ga0501292_000167 3300049515 Archaea 10755
537 Ga0501292_006294 3300049515 Archaea 1683
538 Ga0501294_005434 3300049517 Unclassified 1207
539 Ga0501298_002133 3300049521 Unclassified 2971
540 Ga0501298_007740 3300049521 Archaea 1789
541 Ga0501299_000607 3300049522 Archaea 4257
542 Ga0501300_023324 3300049523 Unclassified 905
543 Ga0501302_006995 3300049525 Unclassified 744
544 Ga0501303_004977 3300049526 Unclassified 1115
545 Ga0501031_0036763 3300049568 Archaea 3195
546 Ga0501031_0098277 3300049568 Unclassified 1910
547 Ga0501033_0083462 3300049570 Archaea 2342
548 Ga0501033_0215868 3300049570 Unclassified 1367
549 Ga0501036_0025646 3300049572 Archaea 4975
550 Ga0501036_0039782 3300049572 Archaea 3978
551 Ga0501036_0049102 3300049572 Archaea 3573
552 Ga0501037_0035788 3300049573 Archaea 3659
553 Ga0501037_0040633 3300049573 Archaea 3422
554 Ga0501038_0011320 3300049574 Archaea 8145
555 Ga0501038_0066670 3300049574 Archaea 3065
556 Ga0501038_0088953 3300049574 Unclassified 2591
557 Ga0501038_0189327 3300049574 Unclassified 1656
558 Ga0501038_0369319 3300049574 Unclassified 1115
559 Ga0501039_0001295 3300049575 Archaea 18260
560 Ga0501039_0001891 3300049575 Archaea 15485
561 Ga0501039_0066752 3300049575 Archaea 2793
562 Ga0501039_0148811 3300049575 Unclassified 1840
563 Ga0501039_0578646 3300049575 Unclassified 881
564 Ga0501039_0658982 3300049575 Unclassified 819
565 Ga0501040_0002037 3300049576 Archaea 13006
566 Ga0501040_0013958 3300049576 Archaea 5290
567 Ga0501040_0091199 3300049576 Archaea 2118
568 Ga0501040_0117037 3300049576 Archaea 1867
569 Ga0501040_0166483 3300049576 Unclassified 1560
570 Ga0501040_0283418 3300049576 Unclassified 1183
571 Ga0501041_0000770 3300049577 Archaea 17163
572 Ga0501041_0004496 3300049577 Archaea 8085
573 Ga0501041_0011452 3300049577 Bacteria 5242
574 Ga0501041_0037826 3300049577 Bacteria 2925
575 Ga0501041_0316480 3300049577 Unclassified 984
576 Ga0501042_0018288 3300049578 Unclassified 4850
577 Ga0501042_0021310 3300049578 Bacteria 4514
578 Ga0501042_0026309 3300049578 Archaea 4090
579 Ga0501042_0042332 3300049578 Archaea 3241
580 Ga0501042_0054213 3300049578 Bacteria 2860
581 Ga0501042_0070848 3300049578 Archaea 2494
582 Ga0501043_0076200 3300049579 Archaea 2635
583 Ga0501043_0145522 3300049579 Archaea 1856
584 Ga0501043_0398279 3300049579 Bacteria 1041
585 Ga0501046_0006065 3300049580 Archaea 10751
586 Ga0501046_0025524 3300049580 Archaea 4836
587 Ga0501046_0119362 3300049580 Unclassified 2008
588 Ga0501048_0003037 3300049582 Archaea 12809
589 Ga0501048_0007438 3300049582 Archaea 8303
590 Ga0501048_0040655 3300049582 Archaea 3331
591 Ga0501068_0026713 3300049584 Archaea 3404
592 Ga0501068_0105911 3300049584 Bacteria 1746
593 Ga0501068_0174395 3300049584 Bacteria 1358
594 Ga0501069_0634494 3300049585 Unclassified 642
595 Ga0501070_0161528 3300049586 Archaea 1847
596 Ga0501071_0000095 3300049587 Archaea 33472
597 Ga0501071_0012590 3300049587 Archaea 5743
598 Ga0501071_0092083 3300049587 Archaea 2227
599 Ga0501071_0120825 3300049587 Unclassified 1942
600 Ga0501071_0512239 3300049587 Bacteria 920
601 Ga0501072_0000186 3300049588 Archaea 45036
602 Ga0501072_0000357 3300049588 Archaea 32599
603 Ga0501072_0007277 3300049588 Archaea 8395
604 Ga0501072_0132885 3300049588 Archaea 1984
605 Ga0501073_0393089 3300049589 Archaea 958
606 Ga0501074_0008049 3300049590 Archaea 7635
607 Ga0501074_0179234 3300049590 Bacteria 1512
608 Ga0501075_0009712 3300049591 Archaea 6743
609 Ga0501075_0012716 3300049591 Archaea 5989
610 Ga0501075_0013049 3300049591 Archaea 5922
611 Ga0501075_0051080 3300049591 Archaea 3108
612 Ga0501075_0150029 3300049591 Unclassified 1777
613 Ga0501075_0515171 3300049591 Archaea 913
614 Ga0501076_0001250 3300049592 Archaea 16937
615 Ga0501076_0010407 3300049592 Archaea 6902
616 Ga0501076_0026859 3300049592 Archaea 4462
617 Ga0501076_0027035 3300049592 Archaea 4449
618 Ga0501076_0109984 3300049592 Unclassified 2227
619 Ga0501076_0131643 3300049592 Archaea 2029
620 Ga0501076_0258457 3300049592 Bacteria 1425
621 Ga0501077_0000938 3300049593 Archaea 17578
622 Ga0501077_0056273 3300049593 Archaea 2496
623 Ga0501077_0074169 3300049593 Archaea 2155
624 Ga0501077_0102300 3300049593 Archaea 1815
625 Ga0501077_0222307 3300049593 Archaea 1200
626 Ga0501198_000372 3300049649 Archaea 5615
627 Ga0501199_000104 3300049650 Archaea 6271
628 Ga0501199_008100 3300049650 Archaea 1095
629 Ga0501201_000745 3300049651 Archaea 3049
630 Ga0501202_000336 3300049652 Archaea 6557
631 Ga0501202_005222 3300049652 Archaea 2299
632 Ga0501207_005262 3300049654 Unclassified 1786
633 Ga0501207_018548 3300049654 Archaea 1095
634 Ga0501208_000056 3300049655 Archaea 6296
635 Ga0501209_000508 3300049656 Archaea 4788
636 Ga0501209_000982 3300049656 Archaea 3770
637 Ga0501209_124513 3300049656 Archaea 766
638 Ga0501211_001801 3300049658 Unclassified 2288
639 Ga0501216_020845 3300049660 Archaea 1148
640 Ga0501217_001052 3300049661 Archaea 5015
641 Ga0501227_002818 3300049665 Archaea 3816
642 Ga0501228_001314 3300049666 Unclassified 1787
643 Ga0501233_004138 3300049668 Archaea 2643
644 Ga0501235_000414 3300049669 Archaea 8273
645 Ga0501243_000056 3300049675 Archaea 10934
646 Ga0501243_001963 3300049675 Archaea 2992
647 Ga0501249_003978 3300049679 Archaea 2991
648 Ga0501252_000436 3300049682 Archaea 3157
649 Ga0501253_000660 3300049683 Archaea 3093
650 Ga0501253_011838 3300049683 Archaea 1351
651 Ga0501256_000159 3300049685 Archaea 3702
652 Ga0501256_002237 3300049685 Archaea 1519
653 Ga0501258_004264 3300049687 Unclassified 1347
654 Ga0501259_000225 3300049688 Archaea 8803
655 Ga0501259_008480 3300049688 Archaea 1655
656 Ga0501260_005021 3300049689 Unclassified 1235
657 Ga0501261_002109 3300049690 Unclassified 2443
658 Ga0501221_001906 3300049704 Archaea 3481
659 Ga0501221_024646 3300049704 Archaea 1209
660 Ga0501225_0005181 3300049705 Archaea 3837
661 Ga0501225_0012275 3300049705 Archaea 2406
662 Ga0501234_000166 3300049707 Archaea 9010
663 Ga0501245_002006 3300049708 Archaea 2692
664 Ga0501079_0003318 3300049741 Archaea 11801
665 Ga0501079_0003429 3300049741 Archaea 11641
666 Ga0501079_0250826 3300049741 Bacteria 1383
667 Ga0501080_0007735 3300049742 Archaea 9716
668 Ga0501080_0190934 3300049742 Archaea 1882
669 Ga0501081_0001650 3300049743 Archaea 13802
670 Ga0501081_0002331 3300049743 Archaea 11954
671 Ga0501081_0003683 3300049743 Archaea 9809
672 Ga0501081_0006185 3300049743 Archaea 7755
673 Ga0501081_0048955 3300049743 Unclassified 2909
674 Ga0501083_0046514 3300049744 Archaea 2934
675 Ga0501083_0420285 3300049744 Archaea 870
676 Ga0501232_000298 3300049757 Archaea 3132
677 Ga0501232_003968 3300049757 Unclassified 1385
678 Ga0501264_001267 3300049761 Archaea 2827
679 Ga0501265_001991 3300049762 Unclassified 2328
680 Ga0501268_003342 3300049765 Unclassified 2187
681 Ga0501275_000093 3300049772 Archaea 9187
682 Ga0501278_000119 3300049774 Archaea 5946
683 Ga0501282_008818 3300049778 Archaea 1083
684 Ga0501283_000711 3300049779 Archaea 4383
685 Ga0501035_0017604 3300049822 Archaea 6593
686 Ga0501035_0039291 3300049822 Unclassified 4283
687 Ga0501035_0053116 3300049822 Archaea 3625
688 Ga0501035_0192549 3300049822 Archaea 1753
689 Ga0501044_0155521 3300049823 Bacteria 2266
690 Ga0501044_0252977 3300049823 Unclassified 1702
691 Ga0501045_0000115 3300049824 Archaea 40788
692 Ga0501045_0001336 3300049824 Archaea 16343
693 Ga0501045_0074038 3300049824 Unclassified 2508
694 Ga0501045_0103101 3300049824 Bacteria 2112
695 Ga0501045_0149727 3300049824 Unclassified 1736
696 Ga0501045_0393344 3300049824 Unclassified 1032
697 Ga0501204_000096 3300049850 Archaea 6421
698 Ga0501212_000201 3300049851 Archaea 5223
699 nmdc:mga05p37_17401_c1 3300050507 Archaea 8674
700 nmdc:mga05p37_2053_c1 3300050507 Archaea 23466
701 nmdc:mga05p37_303677_c1 3300050507 Archaea 1895
702 nmdc:mga05p37_3902_c2 3300050507 Archaea 6722
703 nmdc:mga05p37_64487_c1 3300050507 Archaea 4508
704 nmdc:mga05p37_712648_c1 3300050507 Unclassified 1113
705 nmdc:mga05p37_8242_c1 3300050507 Archaea 12322
706 nmdc:mga09592_117063_c1 3300050508 Archaea 2287
707 nmdc:mga09592_145753_c1 3300050508 Bacteria 2042
708 nmdc:mga09592_161180_c1 3300050508 Unclassified 1938
709 nmdc:mga09592_256839_c1 3300050508 Unclassified 1515
710 nmdc:mga09592_3408_c1 3300050508 Archaea 12846
711 nmdc:mga09592_8792_c1 3300050508 Bacteria 8219
712 nmdc:mga0qj67_141142_c1 3300050509 Unclassified 1954
713 nmdc:mga0qj67_207697_c1 3300050509 Archaea 1591
714 nmdc:mga0qj67_36546_c1 3300050509 Archaea 3843
715 nmdc:mga0qj67_613_c1 3300050509 Archaea 24433
716 nmdc:mga06r32_11286_c1 3300050510 Bacteria 8047
717 nmdc:mga06r32_39857_c1 3300050510 Archaea 4459
718 nmdc:mga06r32_68586_c1 3300050510 Archaea 3426
719 nmdc:mga06r32_735068_c1 3300050510 Archaea 951
720 nmdc:mga06r32_782828_c1 3300050510 Archaea 915
721 nmdc:mga08y16_129456_c1 3300050511 Archaea 2626
722 nmdc:mga08y16_13878_c1 3300050511 Bacteria 8477
723 nmdc:mga08y16_19404_c1 3300050511 Bacteria 7169
724 nmdc:mga08y16_41218_c1 3300050511 Unclassified 4838
725 nmdc:mga08y16_43_c1 3300050511 Archaea 122170
726 nmdc:mga0n895_1020970_c1 3300050512 Archaea 807
727 nmdc:mga0n895_152_c1 3300050512 Archaea 42709
728 nmdc:mga0n895_261956_c1 3300050512 Unclassified 1755
729 nmdc:mga0rr50_127_c1 3300050513 Archaea 41863
730 nmdc:mga0rr50_952446_c1 3300050513 Unclassified 732
731 nmdc:mga08x19_2851_c1 3300050514 Archaea 10421
732 nmdc:mga0a205_29478_c1 3300050515 Archaea 5252
733 nmdc:mga0a205_3302_c1 3300050515 Archaea 14352
734 nmdc:mga0a205_43298_c1 3300050515 Bacteria 4341
735 Ga0495601_0474743 3300053077 Bacteria 808
736 Ga0500566_0121446 3300053094 Bacteria 1408
737 Ga0501084_0002706 3300054114 Archaea 14276
738 Ga0501084_0006857 3300054114 Archaea 9377
739 Ga0501084_0017899 3300054114 Archaea 5899
740 Ga0501084_0086501 3300054114 Bacteria 2632
741 Ga0501084_0264207 3300054114 Unclassified 1453
742 Ga0590071_003075 3300059421 Archaea 4135
743 Ga0590074_002548 3300059423 Unclassified 2993
744 Ga0590075_001435 3300059424 Archaea 5969
745 Ga0590075_001895 3300059424 Archaea 5075
746 Ga0590075_048808 3300059424 Archaea 1085
747 Ga0590077_004370 3300059426 Archaea 2903
748 Ga0501082_0001582 3300060353 Archaea 20071
749 Ga0501082_0003552 3300060353 Archaea 13615
750 Ga0501082_0010799 3300060353 Archaea 7864
751 Ga0501082_0015685 3300060353 Archaea 6518
752 Ga0501082_0263706 3300060353 Unclassified 1499
753 Ga0530510_0000564 3300061734 Archaea 23886
754 Ga0530510_0000846 3300061734 Bacteria 20180
755 Ga0530510_0010539 3300061734 Archaea 6480
756 Ga0530510_0012280 3300061734 Bacteria 6013
757 Ga0530510_0033179 3300061734 Unclassified 3717
758 Ga0307407_10010863
759 SwRhRL2b_contig_1053944
760 2214809110
761 ARcpr5oldR_c000096
762 ARSoilYngRDRAFT_c00183
763 ARcpr5yngRDRAFT_c000081
764 ARcpr5yngRDRAFT_c000728
765 ARSoilOldRDRAFT_c000734
766 ARCol0oldRDRAFT_c01827
767 JGI24746J21847_1019801
768 JGI24033J26618_1003033
769 JGI24033J26618_1007337
770 rootL2_10117772
771 JGI26129J50193_1000060
772 JGI26145J50221_1006062
773 JGI25407J50210_10009057
774 JGI26144J50225_100401
775 JGI26140J50224_100272
776 JGI26134J50242_100046
777 JGI26130J50248_100661
778 JGI26131J50246_100307
779 JGI26132J50249_100592
780 JGI26143J51219_1001925
781 JGI26141J51220_1002607
782 Ga0065717_1000325
783 Ga0065716_1002521
784 Ga0065704_10001327
785 Ga0065704_10072501
786 Ga0065704_10085605
787 Ga0065704_10280051
788 Ga0065715_10088900
789 Ga0065715_10098682
790 Ga0065707_10000175
791 Ga0065707_10000649
792 Ga0065707_10009381
793 Ga0070658_10011451
794 Ga0070676_10002597
795 Ga0070676_10007578
796 Ga0070676_10274993
797 Ga0070683_100003539
798 Ga0070683_100006512
799 Ga0070683_101400535
800 Ga0070690_100062480
801 Ga0070670_100018948
802 Ga0070670_100483741
803 Ga0068869_100208677
804 Ga0070680_100010867
805 Ga0070680_100012749
806 Ga0070680_100545073
807 Ga0070680_100562435
808 Ga0070682_100327246
809 Ga0070660_100002610
810 Ga0070660_100317633
811 Ga0070660_101014348
812 Ga0070689_100053877
813 Ga0070691_10003896
814 Ga0070691_10190817
815 Ga0070687_100025056
816 Ga0070661_100053609
817 Ga0070668_100042977
818 Ga0070668_100351265
819 Ga0070668_100627618
820 Ga0070669_100002284
821 Ga0070669_100738326
822 Ga0070675_100029961
823 Ga0070674_100391268
824 Ga0070673_100624913
825 Ga0070659_100081597
826 Ga0070667_100011049
827 Ga0070713_100031368
828 Ga0070705_100005773
829 Ga0070700_100000641
830 Ga0070700_100495315
831 Ga0070694_100091057
832 Ga0070694_100174322
833 Ga0070708_100025553
834 Ga0070708_100030635
835 Ga0070708_100485928
836 Ga0070662_100096418
837 Ga0070662_100109909
838 Ga0070662_100332493
839 Ga0070681_10001551
840 Ga0070681_10020595
841 Ga0070681_10307330
842 Ga0068867_100007358
843 Ga0068867_100523880
844 Ga0070706_100167140
845 Ga0070698_100020990
846 Ga0070699_100108217
847 Ga0070699_100158248
848 Ga0070699_100175241
849 Ga0070679_100056777
850 Ga0070684_100009672
851 Ga0070684_100054490
852 Ga0070684_100225022
853 Ga0070684_101471531
854 Ga0070697_100099374
855 Ga0070697_100116900
856 Ga0070697_100151115
857 Ga0068853_100099590
858 Ga0068853_100129013
859 Ga0068853_100183724
860 Ga0070672_100048645
861 Ga0070672_100322121
862 Ga0070686_100255908
863 Ga0070695_100021051
864 Ga0070695_100037722
865 Ga0070695_100634344
866 Ga0070695_100802358
867 Ga0070696_100008694
868 Ga0070696_100016138
869 Ga0070696_100034527
870 Ga0070696_100437179
871 Ga0070693_100002477
872 Ga0070693_100083338
873 Ga0070704_100108297
874 Ga0070704_100691452
875 Ga0070704_100858484
876 Ga0068855_100017086
877 Ga0068855_100030181
878 Ga0068855_100225672
879 Ga0070664_100234319
880 Ga0068857_100000274
881 Ga0068857_100079153
882 Ga0068856_100001029
883 Ga0068856_100027445
884 Ga0068856_100777173
885 Ga0070702_100010321
886 Ga0070702_100017421
887 Ga0068852_100010033
888 Ga0068852_100886616
889 Ga0068859_100151233
890 Ga0068859_100326155
891 Ga0068859_100512360
892 Ga0068864_100059319
893 Ga0068864_100368331
894 Ga0068866_10032118
895 Ga0068870_10001699
896 Ga0068870_10002108
897 Ga0068870_10010762
898 Ga0068863_100144229
899 Ga0068858_100040655
900 Ga0068860_100001273
901 Ga0068860_100094852
902 Ga0068860_100245669
903 Ga0068860_100659380
904 Ga0068862_100055904
905 Ga0081455_10000104
906 Ga0081455_10009878
907 Ga0081455_10050875
908 Ga0081538_10002365
909 Ga0081540_1029301
910 Ga0070717_10255483
911 Ga0075432_10003873
912 Ga0075432_10068091
913 Ga0075427_10002177
914 Ga0075427_10004703
915 Ga0097621_100020197
916 Ga0097621_100219997
917 Ga0075428_100000340
918 Ga0075428_100039152
919 Ga0075428_100103227
920 Ga0075428_100237364
921 Ga0075428_100398846
922 Ga0075428_100605400
923 Ga0075430_100000503
924 Ga0075430_100008347
925 Ga0075430_100046646
926 Ga0075430_100206176
927 Ga0075431_100023766
928 Ga0075431_100031366
929 Ga0075431_100034450
930 Ga0075431_100561869
931 Ga0075433_10002271
932 Ga0075434_100005657
933 Ga0075429_100011350
934 Ga0075429_100038156
935 Ga0075429_100079919
936 Ga0075429_100206860
937 Ga0068865_100226366
938 Ga0075436_100000209
939 Ga0075436_100113727
940 Ga0097620_100151234
941 Ga0097620_100326131
942 Ga0097620_100512320
943 Ga0075435_100005959
944 Ga0075435_100088074
945 Ga0105244_10175284
946 Ga0105240_10001321
947 Ga0105240_10035521
948 Ga0105240_10221062
949 Ga0105240_10479236
950 Ga0111539_10009140
951 Ga0111539_10039319
952 Ga0111539_10238719
953 Ga0105245_10048489
954 Ga0105245_10051832
955 Ga0114129_10003830
956 Ga0114129_10005756
957 Ga0114129_10046348
958 Ga0114129_10085620
959 Ga0114129_10118811
960 Ga0114129_10677097
961 Ga0105241_10004180
962 Ga0105242_10061149
963 Ga0105242_10071765
964 Ga0105242_10281809
965 Ga0105248_10072900
966 Ga0105248_10200032
967 Ga0105248_10773346
968 Ga0105237_10005322
969 Ga0105237_10006646
970 Ga0105237_10107692
971 Ga0105238_10001543
972 Ga0105238_10027015
973 Ga0105249_10006628
974 Ga0105249_10048680
975 Ga0105249_10821945
976 Ga0105239_10005012
977 Ga0105239_10143257
978 Ga0105239_10529569
979 Ga0105239_10623400
980 Ga0105239_11814046
981 Ga0105246_10001769
982 Ga0105246_10157273
983 Ga0105246_10219557
984 Ga0105246_10486554
985 Ga0157344_1001324
986 Ga0157336_1000055
987 Ga0157328_1000059
988 Ga0157346_1003293
989 Ga0157337_1000043
990 Ga0157325_1000035
991 Ga0157321_1002365
992 Ga0157343_1000156
993 Ga0157322_1000564
994 Ga0157341_1000208
995 Ga0157323_1000099
996 Ga0157319_1004225
997 Ga0157345_1000397
998 Ga0157314_1000615
999 Ga0157313_1001110
1000 Ga0157324_1001265
1001 Ga0157342_1000938
1002 Ga0157316_1000151
1003 Ga0157327_1000064
1004 Ga0157326_1001471
1005 Ga0157338_1000085
1006 Ga0157371_10175352
1007 Ga0157370_10021976
1008 Ga0157370_10023547
1009 Ga0157369_10014331
1010 Ga0157369_10036228
1011 Ga0157374_10195426
1012 Ga0157378_10000690
1013 Ga0157378_10038119
1014 Ga0157378_10088345
1015 Ga0163162_10187679
1016 Ga0163162_10699702
1017 Ga0157372_10006277
1018 Ga0157372_10013713
1019 Ga0157375_10001761
1020 Ga0157375_10009734
1021 Ga0157375_10445491
1022 Ga0163163_10129806
1023 Ga0163163_10498985
1024 Ga0163163_10648135
1025 Ga0157380_10741536
1026 Ga0157380_10856196
1027 Ga0182008_10005472
1028 Ga0157377_10212742
1029 Ga0157379_10029872
1030 Ga0157379_10093983
1031 Ga0157379_10140628
1032 Ga0157376_10052711
1033 Ga0157376_10066730
1034 Ga0157376_10296746
1035 Ga0157376_10348718
1036 Ga0163161_10001344
1037 Ga0207697_10000194
1038 Ga0207682_10012843
1039 Ga0207688_10003752
1040 Ga0207647_10007183
1041 Ga0207647_10070252
1042 Ga0207699_10118452
1043 Ga0207645_10000495
1044 Ga0207645_10054069
1045 Ga0207645_10580008
1046 Ga0207643_10000033
1047 Ga0207643_10000910
1048 Ga0207643_10007098
1049 Ga0207684_10301777
1050 Ga0207654_10002192
1051 Ga0207707_10000705
1052 Ga0207707_10056179
1053 Ga0207707_10168239
1054 Ga0207707_10660825
1055 Ga0207695_10000843
1056 Ga0207695_10002384
1057 Ga0207695_10257587
1058 Ga0207671_10010637
1059 Ga0207671_10088684
1060 Ga0207671_10224625
1061 Ga0207660_10019014
1062 Ga0207662_10000238
1063 Ga0207662_10022374
1064 Ga0207662_10067505
1065 Ga0207657_10037228
1066 Ga0207649_10427128
1067 Ga0207652_10044242
1068 Ga0207646_11080828
1069 Ga0207681_10003191
1070 Ga0207681_10010414
1071 Ga0207694_10000435
1072 Ga0207650_10011479
1073 Ga0207650_10101399
1074 Ga0207650_10420944
1075 Ga0207659_10041063
1076 Ga0207687_10001664
1077 Ga0207644_10451828
1078 Ga0207690_10133054
1079 Ga0207690_10221346
1080 Ga0207706_10003857
1081 Ga0207706_10041817
1082 Ga0207670_10025424
1083 Ga0207669_10355828
1084 Ga0207704_10039277
1085 Ga0207704_10039386
1086 Ga0207691_10000554
1087 Ga0207691_10159189
1088 Ga0207711_10010697
1089 Ga0207711_10104613
1090 Ga0207689_10008673
1091 Ga0207689_10040810
1092 Ga0207661_10003635
1093 Ga0207661_10042505
1094 Ga0207667_10002003
1095 Ga0207667_10005392
1096 Ga0207712_10004789
1097 Ga0207712_10006064
1098 Ga0207712_10019052
1099 Ga0207668_10325902
1100 Ga0207668_10442458
1101 Ga0207658_10033798
1102 Ga0207677_10061141
1103 Ga0207703_10391855
1104 Ga0207639_10113964
1105 Ga0207639_10174223
1106 Ga0207639_10261828
1107 Ga0207708_10000173
1108 Ga0207708_10312343
1109 Ga0207702_10001718
1110 Ga0207702_10023382
1111 Ga0207702_10113551
1112 Ga0207648_10000065
1113 Ga0207648_10003045
1114 Ga0207648_10005477
1115 Ga0207674_10000110
1116 Ga0207674_10013966
1117 Ga0207675_100875862
1118 Ga0207698_10013951
1119 Ga0207698_10084784
1120 Ga0209973_1004419
1121 Ga0209969_1010390
1122 Ga0209981_1001110
1123 Ga0209984_1001082
1124 Ga0209984_1006150
1125 Ga0209995_1001295
1126 Ga0209983_1019494
1127 Ga0209971_1011041
1128 Ga0209971_1051154
1129 Ga0209966_1000502
1130 Ga0209998_10001541
1131 Ga0209974_10000551
1132 Ga0209974_10022841
1133 Ga0207428_10000042
1134 Ga0207428_10000126
1135 Ga0207428_10000157
1136 Ga0207428_10015328
1137 Ga0207428_10132567
1138 Ga0207428_10537736
1139 Ga0268265_10254558
1140 Ga0268265_10868900
1141 Ga0268264_10013518
1142 Ga0265337_1012888
1143 Ga0265319_1000889
1144 Ga0265319_1032723
1145 Ga0265334_10063359
1146 Ga0265318_10009226
1147 Ga0265336_10020778
1148 Ga0265338_10017176
1149 Ga0265338_10113817
1150 Ga0307408_100008598
1151 Ga0307408_100088595
1152 Ga0265313_10002398
1153 Ga0265314_10009420
1154 Ga0307405_10061035
1155 Ga0307413_10009902
1156 Ga0307410_10001681
1157 Ga0307410_10011939
1158 Ga0307410_10053940
1159 Ga0307406_10009044
1160 Ga0307406_10834593
1161 Ga0307406_11040225
1162 Ga0307407_10001049
1163 Ga0307412_10096775
1164 Ga0307409_100009193
1165 Ga0307416_100000587
1166 Ga0307416_100019874
1167 Ga0307416_100367348
1168 Ga0307416_100770562
1169 Ga0307414_10002407
1170 Ga0307414_10010069
1171 Ga0307414_10267303
1172 Ga0307414_10699137
1173 Ga0307411_10206364
1174 Ga0307415_100006607
1175 Ga0307415_100010752
1176 Ga0307415_100018964
1177 Ga0307415_100061375
1178 Ga0373930_0018343
1179 Ga0373948_0004804
1180 Ga0373959_0042987
1181 Ga0373928_0075540
1182 Ga0373951_0162569
1183 Ga0373952_0084498
1184 Ga0373923_0217922
1185 Ga0373932_0007367
1186 Ga0373932_0021598
1187 Ga0373953_0003967
1188 Ga0373953_0202291
1189 Ga0373954_0005816
1190 Ga0373956_0045384
1191 Ga0373960_0008253
1192 Ga0373960_0230253
1193 Ga0373946_0016624
1194 Ga0373942_0038759
1195 Ga0373961_0006471
1196 Ga0373962_0037096
1197 Ga0373931_0001566
1198 Ga0373931_0008802
1199 Ga0373931_0039417
1200 Ga0373935_0392193
1201 Ga0373927_0231810
1202 Ga0373933_0047040
1203 Ga0373937_0007604
1204 Ga0373937_0053879
1205 Ga0373937_0200004
1206 Ga0373925_0000342
1207 Ga0373925_0028514
1208 Ga0436365_0313593
1209 Ga0436362_0184775
1210 Ga0439438_032674
1211 Ga0439453_0000080
1212 Ga0439461_0029541
1213 Ga0439466_0071172
1214 Ga0439441_000139
1215 Ga0439443_000156
1216 Ga0439448_0027612
1217 Ga0439432_011852
1218 Ga0439450_001124
1219 Ga0439451_001457
1220 Ga0439451_006123
1221 Ga0439452_004537
1222 Ga0439454_000290
1223 Ga0439456_006805
1224 Ga0439456_018928
1225 Ga0439463_001571
1226 Ga0439463_033853
1227 Ga0450923_000120
1228 Ga0450906_044739
1229 Ga0439435_0002194
1230 Ga0439444_0000082
1231 Ga0439444_0010669
1232 Ga0439464_0064878
1233 Ga0439460_0022327
1234 Ga0439460_0022367
1235 Ga0439460_0037220
1236 Ga0439460_0060142
1237 Ga0451577_0016038
1238 Ga0451577_0041378
1239 Ga0451577_0262544
1240 Ga0439440_0000686
1241 Ga0439440_0001139
1242 Ga0439440_0011564
1243 Ga0453683_0435106
1244 Ga0453684_0497480
1245 Ga0453684_1037972
1246 Ga0451576_0103607
1247 Ga0495629_0000010
1248 Ga0495580_0037476
1249 Ga0495580_0196830
1250 Ga0495582_0055439
1251 Ga0495639_0000018
1252 Ga0495662_0263510
1253 Ga0495584_0028153
1254 Ga0495630_0647924
1255 Ga0495666_0000033
1256 Ga0495652_0448016
1257 Ga0495586_0000023
1258 Ga0495587_0004473
1259 Ga0495587_0046063
1260 Ga0495587_0109361
1261 Ga0495667_0383498
1262 Ga0495656_0000029
1263 Ga0495635_0001791
1264 Ga0495659_0000502
1265 Ga0495659_0002515
1266 Ga0495659_0005507
1267 Ga0495599_0060574
1268 Ga0495647_0024299
1269 Ga0495613_0031592
1270 Ga0495600_0087433
1271 Ga0495581_0006724
1272 Ga0495674_0871846
1273 Ga0495676_0071841
1274 Ga0495680_0006320
1275 Ga0495675_0102508
1276 Ga0495684_0014712
1277 Ga0495684_0239293
1278 Ga0495602_0053850
1279 Ga0496100_0065105
1280 Ga0496101_0339200
1281 Ga0496102_0026490
1282 Ga0496103_0286434
1283 Ga0496104_0894241
1284 Ga0496106_0074580
1285 Ga0496106_1049905
1286 Ga0496107_0059170
1287 Ga0496109_0544218
1288 Ga0496112_0011290
1289 Ga0496122_0376708
1290 Ga0496125_0002283
1291 Ga0496125_0005228
1292 Ga0501291_000383
1293 Ga0501292_000167
1294 Ga0501292_006294
1295 Ga0501294_005434
1296 Ga0501298_002133
1297 Ga0501298_007740
1298 Ga0501299_000607
1299 Ga0501300_023324
1300 Ga0501302_006995
1301 Ga0501303_004977
1302 Ga0501031_0036763
1303 Ga0501031_0098277
1304 Ga0501033_0083462
1305 Ga0501033_0215868
1306 Ga0501036_0025646
1307 Ga0501036_0039782
1308 Ga0501036_0049102
1309 Ga0501037_0035788
1310 Ga0501037_0040633
1311 Ga0501038_0011320
1312 Ga0501038_0066670
1313 Ga0501038_0088953
1314 Ga0501038_0189327
1315 Ga0501038_0369319
1316 Ga0501039_0001295
1317 Ga0501039_0001891
1318 Ga0501039_0066752
1319 Ga0501039_0148811
1320 Ga0501039_0578646
1321 Ga0501039_0658982
1322 Ga0501040_0002037
1323 Ga0501040_0013958
1324 Ga0501040_0091199
1325 Ga0501040_0117037
1326 Ga0501040_0166483
1327 Ga0501040_0283418
1328 Ga0501041_0000770
1329 Ga0501041_0004496
1330 Ga0501041_0011452
1331 Ga0501041_0037826
1332 Ga0501041_0316480
1333 Ga0501042_0018288
1334 Ga0501042_0021310
1335 Ga0501042_0026309
1336 Ga0501042_0042332
1337 Ga0501042_0054213
1338 Ga0501042_0070848
1339 Ga0501043_0076200
1340 Ga0501043_0145522
1341 Ga0501043_0398279
1342 Ga0501046_0006065
1343 Ga0501046_0025524
1344 Ga0501046_0119362
1345 Ga0501048_0003037
1346 Ga0501048_0007438
1347 Ga0501048_0040655
1348 Ga0501068_0026713
1349 Ga0501068_0105911
1350 Ga0501068_0174395
1351 Ga0501069_0634494
1352 Ga0501070_0161528
1353 Ga0501071_0000095
1354 Ga0501071_0012590
1355 Ga0501071_0092083
1356 Ga0501071_0120825
1357 Ga0501071_0512239
1358 Ga0501072_0000186
1359 Ga0501072_0000357
1360 Ga0501072_0007277
1361 Ga0501072_0132885
1362 Ga0501073_0393089
1363 Ga0501074_0008049
1364 Ga0501074_0179234
1365 Ga0501075_0009712
1366 Ga0501075_0012716
1367 Ga0501075_0013049
1368 Ga0501075_0051080
1369 Ga0501075_0150029
1370 Ga0501075_0515171
1371 Ga0501076_0001250
1372 Ga0501076_0010407
1373 Ga0501076_0026859
1374 Ga0501076_0027035
1375 Ga0501076_0109984
1376 Ga0501076_0131643
1377 Ga0501076_0258457
1378 Ga0501077_0000938
1379 Ga0501077_0056273
1380 Ga0501077_0074169
1381 Ga0501077_0102300
1382 Ga0501077_0222307
1383 Ga0501198_000372
1384 Ga0501199_000104
1385 Ga0501199_008100
1386 Ga0501201_000745
1387 Ga0501202_000336
1388 Ga0501202_005222
1389 Ga0501207_005262
1390 Ga0501207_018548
1391 Ga0501208_000056
1392 Ga0501209_000508
1393 Ga0501209_000982
1394 Ga0501209_124513
1395 Ga0501211_001801
1396 Ga0501216_020845
1397 Ga0501217_001052
1398 Ga0501227_002818
1399 Ga0501228_001314
1400 Ga0501233_004138
1401 Ga0501235_000414
1402 Ga0501243_000056
1403 Ga0501243_001963
1404 Ga0501249_003978
1405 Ga0501252_000436
1406 Ga0501253_000660
1407 Ga0501253_011838
1408 Ga0501256_000159
1409 Ga0501256_002237
1410 Ga0501258_004264
1411 Ga0501259_000225
1412 Ga0501259_008480
1413 Ga0501260_005021
1414 Ga0501261_002109
1415 Ga0501221_001906
1416 Ga0501221_024646
1417 Ga0501225_0005181
1418 Ga0501225_0012275
1419 Ga0501234_000166
1420 Ga0501245_002006
1421 Ga0501079_0003318
1422 Ga0501079_0003429
1423 Ga0501079_0250826
1424 Ga0501080_0007735
1425 Ga0501080_0190934
1426 Ga0501081_0001650
1427 Ga0501081_0002331
1428 Ga0501081_0003683
1429 Ga0501081_0006185
1430 Ga0501081_0048955
1431 Ga0501083_0046514
1432 Ga0501083_0420285
1433 Ga0501232_000298
1434 Ga0501232_003968
1435 Ga0501264_001267
1436 Ga0501265_001991
1437 Ga0501268_003342
1438 Ga0501275_000093
1439 Ga0501278_000119
1440 Ga0501282_008818
1441 Ga0501283_000711
1442 Ga0501035_0017604
1443 Ga0501035_0039291
1444 Ga0501035_0053116
1445 Ga0501035_0192549
1446 Ga0501044_0155521
1447 Ga0501044_0252977
1448 Ga0501045_0000115
1449 Ga0501045_0001336
1450 Ga0501045_0074038
1451 Ga0501045_0103101
1452 Ga0501045_0149727
1453 Ga0501045_0393344
1454 Ga0501204_000096
1455 Ga0501212_000201
1456 nmdc:mga05p37_17401_c1
1457 nmdc:mga05p37_2053_c1
1458 nmdc:mga05p37_303677_c1
1459 nmdc:mga05p37_3902_c2
1460 nmdc:mga05p37_64487_c1
1461 nmdc:mga05p37_712648_c1
1462 nmdc:mga05p37_8242_c1
1463 nmdc:mga09592_117063_c1
1464 nmdc:mga09592_145753_c1
1465 nmdc:mga09592_161180_c1
1466 nmdc:mga09592_256839_c1
1467 nmdc:mga09592_3408_c1
1468 nmdc:mga09592_8792_c1
1469 nmdc:mga0qj67_141142_c1
1470 nmdc:mga0qj67_207697_c1
1471 nmdc:mga0qj67_36546_c1
1472 nmdc:mga0qj67_613_c1
1473 nmdc:mga06r32_11286_c1
1474 nmdc:mga06r32_39857_c1
1475 nmdc:mga06r32_68586_c1
1476 nmdc:mga06r32_735068_c1
1477 nmdc:mga06r32_782828_c1
1478 nmdc:mga08y16_129456_c1
1479 nmdc:mga08y16_13878_c1
1480 nmdc:mga08y16_19404_c1
1481 nmdc:mga08y16_41218_c1
1482 nmdc:mga08y16_43_c1
1483 nmdc:mga0n895_1020970_c1
1484 nmdc:mga0n895_152_c1
1485 nmdc:mga0n895_261956_c1
1486 nmdc:mga0rr50_127_c1
1487 nmdc:mga0rr50_952446_c1
1488 nmdc:mga08x19_2851_c1
1489 nmdc:mga0a205_29478_c1
1490 nmdc:mga0a205_3302_c1
1491 nmdc:mga0a205_43298_c1
1492 Ga0495601_0474743
1493 Ga0500566_0121446
1494 Ga0501084_0002706
1495 Ga0501084_0006857
1496 Ga0501084_0017899
1497 Ga0501084_0086501
1498 Ga0501084_0264207
1499 Ga0590071_003075
1500 Ga0590074_002548
1501 Ga0590075_001435
1502 Ga0590075_001895
1503 Ga0590075_048808
1504 Ga0590077_004370
1505 Ga0501082_0001582
1506 Ga0501082_0003552
1507 Ga0501082_0010799
1508 Ga0501082_0015685
1509 Ga0501082_0263706
1510 Ga0530510_0000564
1511 Ga0530510_0000846
1512 Ga0530510_0010539
1513 Ga0530510_0012280
1514 Ga0530510_0033179

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

15

200

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kcq-assembly1.cif.gz_A crystal structure of phosphoribosylglycinamide formyltransferase from anaplasma phagocytophilum 0.9634 15 191
2ywr-assembly1.cif.gz_A crystal structure of gar transformylase from aquifex aeolicus 0.9468 2 189
5j9f-assembly2.cif.gz_A human gar transformylase in complex with gar and (4-{[2-(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)ethyl]amino}benzoyl)-l-glutamic acid (agf183) 0.9389 2 189
3auf-assembly1.cif.gz_A-2 crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii 0.9386 2 190
1men-assembly1.cif.gz_A complex structure of human gar tfase and substrate beta-gar 0.9363 2 189
ID Description Score Start End Superfamily
af_Q20143_783_975_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9689 1 177 3.40.50.170
2ywrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9443 2 189 3.40.50.170
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9386 2 190 3.40.50.170
af_Q2FZI7_1_188_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9321 2 172 3.40.50.170
3kcqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.929 3 191 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A7X3WHV1-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) 0.9914 78 190 GO:0004644
GO:0005829
GO:0006189
AF-A0A7X7QZ70-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) 0.9882 79 191 GO:0004644
GO:0005829
GO:0006189
AF-A0A7X3WHV1-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) 0.9828 78 190 GO:0004644
GO:0005829
GO:0006189
AF-A0A3C0KBB1-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) 0.9796 93 176 GO:0004644
GO:0005829
GO:0006189
AF-A0A7X7QZ70-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) 0.9796 79 191 GO:0004644
GO:0005829
GO:0006189

Map