F479264

General Info

Members Datasets Scaffolds Average Seq Length
754 337 721 356

Family's Representative Sequence

Representative Sequence 3300042124|Ga0450922_001319|Ga0450922_001319_518_1585
Length 345
Sequence MSKYRAGVLFGEELEALLKDAKDNQFALPAVNTIGTNTINATLETAAKVNSPVIVQFSNGGAQFIAGKGMPNDKLQANISGAISGALHIHNVAKYYGVPVVLHTDHAAKKWLPWISGLIDAGVEFNKEKGQPLFSSHMLDLSEEPLEENIQTSVEFFKRMAPLGMGIEIELGVTGGEEDGVDNSDLYTQPAHVELSKVGKLFTVAAAFGNVHGVYKSGNVQLTPIILHNSQVHIEKKLGTGPKPVYFVFHGGSGSPQHQIREAISYGAIKMNLDTDLQWAFWEGVLNNYKKSESYLQGQLGNPEGPDSPNKKYYDPRVWLRKGEESFIKRLEVAFEDLNCVNRNA

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
3 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
4 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
5 2738541278 Niastella sp. CF465 Isolate Unclassified
6 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
7 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
8 2818991444 Filimonas endophytica 3197 Isolate Unclassified
9 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
10 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
11 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
12 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
13 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
14 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
15 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
16 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
17 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
18 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
19 2914759650 Rhizosphaericola mali Isolate Rhizosphere
20 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
21 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
22 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
23 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
24 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
25 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
26 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
27 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
28 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
29 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
30 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
31 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
32 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
33 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
36 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
37 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
41 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
52 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
130 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
192 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
193 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
194 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
195 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
204 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
205 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
206 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
207 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
208 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
215 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
216 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
221 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
222 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
223 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
224 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
231 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
234 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
235 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
236 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
237 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
238 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
239 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
240 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
241 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
242 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
243 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
246 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
247 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
251 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
252 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
262 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
263 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
266 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
269 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
294 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
295 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
296 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
297 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
298 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
299 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
300 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
301 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
302 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
303 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
306 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
307 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
311 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
315 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
318 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
319 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
320 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
321 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
322 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
323 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
324 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
325 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
326 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
327 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
328 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
329 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
330 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
331 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
332 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
333 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
335 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified
336 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
337 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.56
Metatranscriptomes 1.06
Isolates 4.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.11
Nodule 0
Rhizoplane 0.4
Rhizosphere 89.79
Stem 0
Stem Tuber 0
Unclassified 5.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10000005 3300001991 Bacteria 22941
2 JGI24033J26618_1000119 3300002155 Bacteria 10596
3 JGI24751J29686_10008130 3300002459 Bacteria 2145
4 rootH2_10000149 3300003320 Bacteria 14845
5 rootH2_10009508 3300003320 Bacteria 78035
6 rootH2_10030789 3300003320 Bacteria 26106
7 rootH2_10033273 3300003320 Bacteria 7449
8 rootH2_10162427 3300003320 Bacteria 1472
9 rootL2_10090605 3300003322 Bacteria 5299
10 rootH1_10064317 3300003323 Bacteria 25294
11 JGI25160J50197_1002187 3300003354 Bacteria 9203
12 Ga0055530_10000315 3300003791 Bacteria 43745
13 Ga0065165_1000060 3300005262 Bacteria 180226
14 Ga0065704_10096676 3300005289 Bacteria 2366
15 Ga0065704_10115828 3300005289 Bacteria 1852
16 Ga0065712_10014468 3300005290 Bacteria 4898
17 Ga0065712_10081375 3300005290 Bacteria 3012
18 Ga0070658_10000095 3300005327 Bacteria 77839
19 Ga0070658_10008866 3300005327 Bacteria 8084
20 Ga0070658_10231933 3300005327 Bacteria 1563
21 Ga0070658_10267109 3300005327 Bacteria 1454
22 Ga0070676_10000252 3300005328 Bacteria 23270
23 Ga0070676_10009134 3300005328 Bacteria 5363
24 Ga0070683_100003259 3300005329 Bacteria 13114
25 Ga0070683_100025140 3300005329 Bacteria 5344
26 Ga0070690_100140451 3300005330 Bacteria 1639
27 Ga0070690_100226063 3300005330 Bacteria 1313
28 Ga0070670_100007971 3300005331 Bacteria 9008
29 Ga0070670_100014145 3300005331 Bacteria 6844
30 Ga0070670_100036514 3300005331 Bacteria 4229
31 Ga0070670_100078424 3300005331 Bacteria 2837
32 Ga0070670_100156232 3300005331 Bacteria 1975
33 Ga0070670_100194295 3300005331 Unclassified 1763
34 Ga0068869_100008995 3300005334 Bacteria 6469
35 Ga0068869_100013406 3300005334 Bacteria 5452
36 Ga0068869_100018447 3300005334 Bacteria 4750
37 Ga0068869_100048072 3300005334 Bacteria 3083
38 Ga0070666_10000616 3300005335 Bacteria 21365
39 Ga0070666_10009653 3300005335 Bacteria 6025
40 Ga0070666_10130184 3300005335 Bacteria 1748
41 Ga0070682_100010522 3300005337 Bacteria 5250
42 Ga0070682_100031550 3300005337 Bacteria 3205
43 Ga0068868_100000091 3300005338 Bacteria 55405
44 Ga0068868_100051846 3300005338 Bacteria 3229
45 Ga0070689_100027356 3300005340 Bacteria 4299
46 Ga0070689_100114899 3300005340 Bacteria 2145
47 Ga0070691_10016494 3300005341 Bacteria 3393
48 Ga0070661_100001232 3300005344 Bacteria 18015
49 Ga0070668_100000043 3300005347 Bacteria 78564
50 Ga0070668_100044375 3300005347 Bacteria 3411
51 Ga0070668_100336312 3300005347 Bacteria 1275
52 Ga0070669_100040844 3300005353 Bacteria 3372
53 Ga0070675_100040358 3300005354 Bacteria 3809
54 Ga0070675_100048827 3300005354 Bacteria 3471
55 Ga0070675_100160301 3300005354 Bacteria 1934
56 Ga0070671_100027742 3300005355 Bacteria 4662
57 Ga0070671_100055549 3300005355 Bacteria 3294
58 Ga0070671_100107623 3300005355 Bacteria 2341
59 Ga0070674_100026685 3300005356 Bacteria 3776
60 Ga0070674_100032734 3300005356 Bacteria 3454
61 Ga0070673_100000283 3300005364 Bacteria 26297
62 Ga0070673_100012211 3300005364 Bacteria 5890
63 Ga0070673_100031990 3300005364 Bacteria 3955
64 Ga0070688_100012566 3300005365 Bacteria 4746
65 Ga0070659_100041296 3300005366 Bacteria 3605
66 Ga0070659_100090583 3300005366 Bacteria 2451
67 Ga0070667_100000254 3300005367 Bacteria 60664
68 Ga0070667_100001284 3300005367 Bacteria 22707
69 Ga0070667_100016664 3300005367 Bacteria 6082
70 Ga0070667_100199438 3300005367 Bacteria 1775
71 Ga0070667_100323849 3300005367 Bacteria 1391
72 Ga0070663_100165609 3300005455 Bacteria 1705
73 Ga0070678_100042090 3300005456 Bacteria 3244
74 Ga0070662_100002778 3300005457 Bacteria 10836
75 Ga0070662_100006706 3300005457 Bacteria 7438
76 Ga0070681_10025679 3300005458 Bacteria 5925
77 Ga0070681_10081003 3300005458 Bacteria 3202
78 Ga0070681_10147131 3300005458 Bacteria 2284
79 Ga0068867_100005482 3300005459 Bacteria 8980
80 Ga0068867_100016258 3300005459 Bacteria 5284
81 Ga0068867_100157290 3300005459 Bacteria 1790
82 Ga0068867_100225940 3300005459 Bacteria 1511
83 Ga0070685_10028768 3300005466 Bacteria 3082
84 Ga0070706_100200107 3300005467 Bacteria 1866
85 Ga0070698_100001232 3300005471 Bacteria 28474
86 Ga0070698_100132976 3300005471 Bacteria 2442
87 Ga0070679_100031738 3300005530 Bacteria 5222
88 Ga0070679_100156060 3300005530 Bacteria 2257
89 Ga0070684_100007323 3300005535 Bacteria 8578
90 Ga0070684_100271675 3300005535 Bacteria 1552
91 Ga0068853_100000675 3300005539 Bacteria 23525
92 Ga0068853_100004921 3300005539 Bacteria 10399
93 Ga0068853_100022678 3300005539 Bacteria 5247
94 Ga0068853_100037199 3300005539 Bacteria 4141
95 Ga0068853_100324852 3300005539 Bacteria 1427
96 Ga0070672_100000160 3300005543 Bacteria 37362
97 Ga0070672_100114886 3300005543 Bacteria 2198
98 Ga0070665_100000001 3300005548 Bacteria 1083363
99 Ga0070665_100000350 3300005548 Bacteria 69455
100 Ga0070665_100012508 3300005548 Bacteria 8551
101 Ga0068855_100000089 3300005563 Bacteria 110845
102 Ga0068855_100002600 3300005563 Bacteria 22255
103 Ga0068855_100023787 3300005563 Bacteria 7339
104 Ga0068855_100046257 3300005563 Bacteria 5145
105 Ga0068855_100066665 3300005563 Bacteria 4197
106 Ga0068855_100079334 3300005563 Bacteria 3807
107 Ga0068855_100158975 3300005563 Bacteria 2566
108 Ga0070664_100002175 3300005564 Bacteria 15745
109 Ga0070664_100046003 3300005564 Bacteria 3686
110 Ga0068854_100026248 3300005578 Bacteria 4002
111 Ga0068856_100000313 3300005614 Bacteria 53232
112 Ga0068856_100009691 3300005614 Bacteria 9355
113 Ga0068856_100042851 3300005614 Bacteria 4453
114 Ga0068856_100049149 3300005614 Bacteria 4157
115 Ga0068856_100478334 3300005614 Bacteria 1266
116 Ga0070702_100080937 3300005615 Bacteria 1945
117 Ga0068852_100000655 3300005616 Bacteria 22706
118 Ga0068852_100015276 3300005616 Bacteria 5946
119 Ga0068852_100019201 3300005616 Bacteria 5402
120 Ga0068859_100000100 3300005617 Bacteria 79844
121 Ga0068859_100010659 3300005617 Bacteria 9252
122 Ga0068859_100014583 3300005617 Bacteria 7894
123 Ga0068859_100332443 3300005617 Bacteria 1614
124 Ga0068864_100001658 3300005618 Bacteria 18334
125 Ga0068864_100013342 3300005618 Bacteria 6807
126 Ga0068864_100138887 3300005618 Bacteria 2190
127 Ga0068864_100359796 3300005618 Bacteria 1375
128 Ga0068864_100362130 3300005618 Bacteria 1371
129 Ga0068866_10143259 3300005718 Bacteria 1375
130 Ga0068861_100003609 3300005719 Bacteria 10306
131 Ga0068861_100006042 3300005719 Bacteria 8234
132 Ga0068861_100013501 3300005719 Bacteria 5717
133 Ga0068861_100061933 3300005719 Bacteria 2872
134 Ga0068851_10004456 3300005834 Bacteria 6317
135 Ga0068851_10058388 3300005834 Bacteria 1972
136 Ga0068863_100018881 3300005841 Bacteria 6598
137 Ga0068863_100022470 3300005841 Bacteria 6024
138 Ga0068863_100038477 3300005841 Bacteria 4551
139 Ga0068863_100039594 3300005841 Bacteria 4484
140 Ga0068863_100079599 3300005841 Bacteria 3103
141 Ga0068863_100310984 3300005841 Bacteria 1529
142 Ga0068858_100000199 3300005842 Bacteria 64607
143 Ga0068858_100001301 3300005842 Bacteria 25780
144 Ga0068858_100225034 3300005842 Bacteria 1778
145 Ga0068858_100340636 3300005842 Bacteria 1435
146 Ga0068860_100000111 3300005843 Bacteria 131004
147 Ga0068860_100000846 3300005843 Bacteria 34263
148 Ga0068860_100001512 3300005843 Bacteria 25045
149 Ga0068860_100003412 3300005843 Bacteria 16333
150 Ga0068860_100005552 3300005843 Bacteria 12767
151 Ga0068860_100042932 3300005843 Bacteria 4315
152 Ga0068860_100139432 3300005843 Bacteria 2330
153 Ga0068862_100058563 3300005844 Bacteria 3304
154 Ga0075366_10018779 3300006195 Bacteria 3995
155 Ga0075366_10116478 3300006195 Bacteria 1609
156 Ga0097621_100002436 3300006237 Bacteria 12739
157 Ga0097621_100002531 3300006237 Bacteria 12524
158 Ga0097621_100003700 3300006237 Bacteria 10581
159 Ga0097621_100020533 3300006237 Bacteria 5090
160 Ga0097621_100051241 3300006237 Bacteria 3359
161 Ga0068871_100004030 3300006358 Bacteria 10146
162 Ga0068871_100010137 3300006358 Bacteria 6858
163 Ga0068871_100027019 3300006358 Bacteria 4484
164 Ga0068871_100031740 3300006358 Bacteria 4168
165 Ga0068871_100039362 3300006358 Bacteria 3783
166 Ga0068871_100044639 3300006358 Bacteria 3565
167 Ga0068871_100062039 3300006358 Bacteria 3054
168 Ga0068871_100198721 3300006358 Bacteria 1730
169 Ga0075428_100013181 3300006844 Bacteria 9196
170 Ga0075428_100015528 3300006844 Bacteria 8442
171 Ga0075428_100041517 3300006844 Bacteria 5059
172 Ga0075428_100251468 3300006844 Bacteria 1905
173 Ga0075430_100051698 3300006846 Bacteria 3462
174 Ga0075431_100140517 3300006847 Bacteria 2489
175 Ga0075429_100003290 3300006880 Bacteria 13752
176 Ga0075429_100222922 3300006880 Bacteria 1651
177 Ga0068865_100005344 3300006881 Bacteria 7779
178 Ga0068865_100007446 3300006881 Bacteria 6735
179 Ga0097620_100000100 3300006931 Bacteria 79844
180 Ga0097620_100010659 3300006931 Bacteria 9252
181 Ga0097620_100014582 3300006931 Bacteria 7894
182 Ga0097620_100332454 3300006931 Bacteria 1614
183 Ga0105240_10000074 3300009093 Bacteria 199611
184 Ga0105240_10000513 3300009093 Bacteria 71427
185 Ga0105240_10007118 3300009093 Bacteria 16295
186 Ga0105240_10008360 3300009093 Bacteria 14812
187 Ga0105240_10041056 3300009093 Bacteria 5910
188 Ga0105240_10111783 3300009093 Bacteria 3304
189 Ga0105240_10375346 3300009093 Bacteria 1607
190 Ga0111539_10028901 3300009094 Bacteria 6760
191 Ga0111539_10218562 3300009094 Unclassified 2220
192 Ga0111539_10330721 3300009094 Bacteria 1774
193 Ga0111539_10447995 3300009094 Bacteria 1503
194 Ga0105245_10025045 3300009098 Bacteria 5245
195 Ga0105247_10002103 3300009101 Bacteria 13758
196 Ga0105247_10005256 3300009101 Bacteria 8167
197 Ga0114129_10004929 3300009147 Bacteria 18833
198 Ga0105243_10177594 3300009148 Bacteria 1849
199 Ga0105243_10213245 3300009148 Bacteria 1702
200 Ga0105241_10011399 3300009174 Bacteria 6517
201 Ga0105241_10023976 3300009174 Bacteria 4529
202 Ga0105242_10035646 3300009176 Bacteria 3989
203 Ga0105242_10041681 3300009176 Bacteria 3704
204 Ga0105242_10101424 3300009176 Bacteria 2439
205 Ga0105242_10119202 3300009176 Bacteria 2262
206 Ga0105242_10147822 3300009176 Bacteria 2046
207 Ga0105248_10031375 3300009177 Bacteria 5940
208 Ga0105248_10190771 3300009177 Bacteria 2309
209 Ga0105237_10000528 3300009545 Bacteria 53756
210 Ga0105237_10002821 3300009545 Bacteria 21127
211 Ga0105237_10005077 3300009545 Bacteria 14955
212 Ga0105237_10007087 3300009545 Bacteria 12326
213 Ga0105237_10026166 3300009545 Bacteria 5963
214 Ga0105237_10088422 3300009545 Bacteria 3088
215 Ga0105237_10488158 3300009545 Bacteria 1238
216 Ga0105238_10001119 3300009551 Bacteria 27090
217 Ga0105238_10107514 3300009551 Bacteria 2770
218 Ga0105238_10254852 3300009551 Bacteria 1734
219 Ga0105249_10000420 3300009553 Bacteria 40445
220 Ga0105249_10004140 3300009553 Bacteria 12524
221 Ga0105249_10012201 3300009553 Bacteria 7569
222 Ga0105249_10020079 3300009553 Bacteria 5968
223 Ga0105239_10000048 3300010375 Bacteria 177855
224 Ga0105239_10000314 3300010375 Bacteria 71313
225 Ga0105239_10000853 3300010375 Bacteria 43358
226 Ga0105239_10002727 3300010375 Bacteria 22170
227 Ga0105239_10026069 3300010375 Bacteria 6436
228 Ga0105239_10033395 3300010375 Bacteria 5651
229 Ga0105239_10039449 3300010375 Bacteria 5173
230 Ga0105239_10237363 3300010375 Bacteria 2046
231 Ga0105239_10387523 3300010375 Bacteria 1580
232 Ga0105239_10532817 3300010375 Bacteria 1337
233 Ga0105246_10037365 3300011119 Bacteria 3259
234 Ga0157373_10034570 3300013100 Bacteria 3630
235 Ga0157373_10036183 3300013100 Bacteria 3544
236 Ga0157371_10019068 3300013102 Bacteria 5064
237 Ga0157371_10063215 3300013102 Bacteria 2624
238 Ga0157371_10087974 3300013102 Bacteria 2199
239 Ga0157371_10201521 3300013102 Bacteria 1427
240 Ga0157370_10007951 3300013104 Bacteria 11487
241 Ga0157370_10018014 3300013104 Bacteria 7108
242 Ga0157370_10075884 3300013104 Unclassified 3168
243 Ga0157370_10195942 3300013104 Bacteria 1875
244 Ga0157370_10233657 3300013104 Bacteria 1701
245 Ga0157369_10010273 3300013105 Bacteria 10679
246 Ga0157369_10067695 3300013105 Bacteria 3838
247 Ga0157369_10223780 3300013105 Unclassified 1969
248 Ga0157374_10000026 3300013296 Bacteria 238236
249 Ga0157374_10000084 3300013296 Bacteria 94138
250 Ga0157374_10005000 3300013296 Bacteria 11124
251 Ga0157374_10012628 3300013296 Bacteria 7354
252 Ga0157374_10076666 3300013296 Bacteria 3161
253 Ga0157374_10265730 3300013296 Bacteria 1691
254 Ga0157374_10325660 3300013296 Bacteria 1523
255 Ga0157378_10001185 3300013297 Bacteria 23694
256 Ga0157378_10001872 3300013297 Bacteria 18898
257 Ga0157378_10027692 3300013297 Bacteria 4998
258 Ga0157378_10032561 3300013297 Bacteria 4606
259 Ga0157378_10098402 3300013297 Bacteria 2667
260 Ga0163162_10000101 3300013306 Bacteria 77114
261 Ga0163162_10000113 3300013306 Bacteria 71491
262 Ga0163162_10003148 3300013306 Bacteria 15759
263 Ga0163162_10005141 3300013306 Bacteria 12609
264 Ga0163162_10011934 3300013306 Bacteria 8472
265 Ga0163162_10024246 3300013306 Bacteria 5987
266 Ga0163162_10071459 3300013306 Bacteria 3523
267 Ga0163162_10097769 3300013306 Bacteria 3024
268 Ga0157372_10001128 3300013307 Bacteria 28999
269 Ga0157372_10005133 3300013307 Bacteria 13917
270 Ga0157372_10005538 3300013307 Bacteria 13428
271 Ga0157372_10030568 3300013307 Bacteria 5892
272 Ga0157372_10049581 3300013307 Bacteria 4669
273 Ga0157372_10069083 3300013307 Bacteria 3973
274 Ga0157372_10073750 3300013307 Bacteria 3847
275 Ga0157372_10152955 3300013307 Bacteria 2663
276 Ga0157372_10434416 3300013307 Bacteria 1530
277 Ga0157372_10479499 3300013307 Bacteria 1450
278 Ga0157375_10000565 3300013308 Bacteria 33320
279 Ga0157375_10009092 3300013308 Bacteria 8702
280 Ga0157375_10067247 3300013308 Bacteria 3580
281 Ga0157375_10069207 3300013308 Bacteria 3535
282 Ga0157375_10070596 3300013308 Bacteria 3503
283 Ga0157375_10122613 3300013308 Bacteria 2711
284 Ga0157375_10162918 3300013308 Bacteria 2373
285 Ga0163163_10000306 3300014325 Bacteria 48215
286 Ga0163163_10025324 3300014325 Bacteria 5657
287 Ga0163163_10361098 3300014325 Bacteria 1509
288 Ga0157380_10034657 3300014326 Bacteria 3894
289 Ga0157380_10042141 3300014326 Bacteria 3567
290 Ga0157380_10118025 3300014326 Bacteria 2242
291 Ga0157377_10085237 3300014745 Bacteria 1854
292 Ga0157379_10000245 3300014968 Bacteria 42570
293 Ga0157379_10016583 3300014968 Bacteria 6479
294 Ga0157376_10002364 3300014969 Bacteria 12733
295 Ga0157376_10003646 3300014969 Bacteria 10632
296 Ga0157376_10003682 3300014969 Bacteria 10581
297 Ga0157376_10004318 3300014969 Bacteria 9876
298 Ga0157376_10023777 3300014969 Bacteria 4802
299 Ga0157376_10089937 3300014969 Bacteria 2655
300 Ga0157376_10156558 3300014969 Bacteria 2061
301 Ga0157376_10190896 3300014969 Bacteria 1878
302 Ga0157376_10418779 3300014969 Bacteria 1299
303 Ga0163161_10037411 3300017792 Bacteria 3479
304 Ga0163161_10095390 3300017792 Bacteria 2206
305 Ga0163161_10126070 3300017792 Bacteria 1928
306 Ga0209646_1001404 3300025246 Bacteria 6542
307 Ga0209676_1000351 3300025292 Bacteria 87135
308 Ga0207426_1000009 3300025302 Bacteria 797229
309 Ga0209257_1000089 3300025304 Bacteria 277925
310 Ga0207697_10047494 3300025315 Bacteria 1770
311 Ga0207656_10002387 3300025321 Bacteria 6317
312 Ga0207710_10011655 3300025900 Bacteria 3699
313 Ga0207710_10017547 3300025900 Bacteria 3036
314 Ga0207688_10029845 3300025901 Bacteria 3005
315 Ga0207680_10003112 3300025903 Bacteria 7794
316 Ga0207680_10013728 3300025903 Bacteria 4169
317 Ga0207647_10004545 3300025904 Bacteria 10283
318 Ga0207647_10026889 3300025904 Bacteria 3758
319 Ga0207645_10000378 3300025907 Bacteria 36697
320 Ga0207645_10001750 3300025907 Bacteria 17617
321 Ga0207643_10052782 3300025908 Bacteria 2309
322 Ga0207705_10014193 3300025909 Bacteria 5738
323 Ga0207705_10146201 3300025909 Bacteria 1769
324 Ga0207705_10194595 3300025909 Bacteria 1535
325 Ga0207654_10001221 3300025911 Bacteria 13725
326 Ga0207654_10001953 3300025911 Bacteria 10692
327 Ga0207654_10008832 3300025911 Bacteria 5112
328 Ga0207707_10002099 3300025912 Bacteria 18023
329 Ga0207707_10130640 3300025912 Bacteria 2197
330 Ga0207695_10000071 3300025913 Bacteria 315568
331 Ga0207695_10000084 3300025913 Bacteria 282392
332 Ga0207695_10000323 3300025913 Bacteria 114265
333 Ga0207695_10001425 3300025913 Bacteria 40250
334 Ga0207695_10007632 3300025913 Bacteria 13711
335 Ga0207695_10011249 3300025913 Bacteria 10851
336 Ga0207695_10071661 3300025913 Bacteria 3539
337 Ga0207671_10001584 3300025914 Bacteria 25863
338 Ga0207671_10001605 3300025914 Bacteria 25707
339 Ga0207671_10008236 3300025914 Bacteria 8874
340 Ga0207671_10010848 3300025914 Bacteria 7475
341 Ga0207671_10016277 3300025914 Bacteria 5784
342 Ga0207671_10021869 3300025914 Bacteria 4845
343 Ga0207671_10336752 3300025914 Bacteria 1195
344 Ga0207660_10001416 3300025917 Bacteria 16098
345 Ga0207660_10053726 3300025917 Bacteria 2872
346 Ga0207662_10023264 3300025918 Bacteria 3558
347 Ga0207657_10151871 3300025919 Bacteria 1886
348 Ga0207657_10188794 3300025919 Bacteria 1664
349 Ga0207649_10000935 3300025920 Bacteria 18362
350 Ga0207652_10000986 3300025921 Bacteria 26359
351 Ga0207652_10131105 3300025921 Bacteria 2236
352 Ga0207681_10039294 3300025923 Bacteria 3141
353 Ga0207694_10069297 3300025924 Bacteria 2755
354 Ga0207694_10115743 3300025924 Bacteria 2136
355 Ga0207650_10011294 3300025925 Bacteria 6145
356 Ga0207650_10041445 3300025925 Bacteria 3374
357 Ga0207650_10071800 3300025925 Bacteria 2605
358 Ga0207650_10076405 3300025925 Bacteria 2530
359 Ga0207650_10090530 3300025925 Bacteria 2337
360 Ga0207659_10017041 3300025926 Bacteria 4740
361 Ga0207659_10105532 3300025926 Bacteria 2132
362 Ga0207659_10132703 3300025926 Bacteria 1925
363 Ga0207659_10324805 3300025926 Bacteria 1270
364 Ga0207687_10027927 3300025927 Bacteria 3788
365 Ga0207644_10058787 3300025931 Bacteria 2780
366 Ga0207644_10088847 3300025931 Bacteria 2299
367 Ga0207690_10113536 3300025932 Bacteria 1955
368 Ga0207706_10005553 3300025933 Bacteria 11758
369 Ga0207706_10014031 3300025933 Bacteria 7266
370 Ga0207686_10030128 3300025934 Bacteria 3209
371 Ga0207686_10041764 3300025934 Bacteria 2799
372 Ga0207686_10073887 3300025934 Bacteria 2201
373 Ga0207686_10081034 3300025934 Bacteria 2117
374 Ga0207670_10025122 3300025936 Bacteria 3735
375 Ga0207669_10045391 3300025937 Bacteria 2589
376 Ga0207669_10103394 3300025937 Bacteria 1889
377 Ga0207704_10001110 3300025938 Bacteria 11965
378 Ga0207704_10018773 3300025938 Bacteria 3617
379 Ga0207691_10000227 3300025940 Bacteria 54652
380 Ga0207691_10184848 3300025940 Bacteria 1820
381 Ga0207691_10343081 3300025940 Bacteria 1278
382 Ga0207689_10008011 3300025942 Bacteria 9224
383 Ga0207689_10010699 3300025942 Bacteria 7893
384 Ga0207689_10035224 3300025942 Bacteria 4159
385 Ga0207689_10094949 3300025942 Bacteria 2449
386 Ga0207689_10126332 3300025942 Bacteria 2104
387 Ga0207679_10032303 3300025945 Bacteria 3672
388 Ga0207679_10094266 3300025945 Bacteria 2324
389 Ga0207667_10000135 3300025949 Bacteria 111565
390 Ga0207667_10000177 3300025949 Bacteria 92852
391 Ga0207667_10009580 3300025949 Bacteria 11399
392 Ga0207667_10025965 3300025949 Bacteria 6407
393 Ga0207667_10060186 3300025949 Bacteria 3975
394 Ga0207667_10205788 3300025949 Unclassified 2018
395 Ga0207651_10001142 3300025960 Bacteria 11852
396 Ga0207651_10336240 3300025960 Bacteria 1267
397 Ga0207712_10001272 3300025961 Bacteria 17359
398 Ga0207712_10004770 3300025961 Bacteria 8561
399 Ga0207712_10006837 3300025961 Bacteria 7197
400 Ga0207712_10025027 3300025961 Bacteria 3962
401 Ga0207712_10112040 3300025961 Bacteria 2048
402 Ga0207712_10183222 3300025961 Bacteria 1647
403 Ga0207668_10000821 3300025972 Bacteria 18944
404 Ga0207668_10028723 3300025972 Bacteria 3640
405 Ga0207668_10116285 3300025972 Bacteria 2016
406 Ga0207640_10174974 3300025981 Bacteria 1603
407 Ga0207658_10000176 3300025986 Bacteria 68501
408 Ga0207658_10036237 3300025986 Bacteria 3536
409 Ga0207658_10043302 3300025986 Bacteria 3272
410 Ga0207658_10054994 3300025986 Bacteria 2947
411 Ga0207677_10002439 3300026023 Bacteria 9762
412 Ga0207677_10032982 3300026023 Bacteria 3335
413 Ga0207703_10003978 3300026035 Bacteria 12248
414 Ga0207703_10034234 3300026035 Bacteria 4030
415 Ga0207703_10072524 3300026035 Bacteria 2846
416 Ga0207703_10172950 3300026035 Bacteria 1901
417 Ga0207639_10005083 3300026041 Bacteria 8861
418 Ga0207639_10010154 3300026041 Bacteria 6515
419 Ga0207639_10138096 3300026041 Bacteria 2027
420 Ga0207639_10138862 3300026041 Bacteria 2022
421 Ga0207708_10045746 3300026075 Bacteria 3335
422 Ga0207702_10001517 3300026078 Bacteria 22953
423 Ga0207702_10067898 3300026078 Bacteria 3061
424 Ga0207641_10000038 3300026088 Bacteria 205418
425 Ga0207641_10010883 3300026088 Bacteria 7453
426 Ga0207641_10013810 3300026088 Bacteria 6622
427 Ga0207641_10072010 3300026088 Bacteria 2975
428 Ga0207641_10119402 3300026088 Bacteria 2350
429 Ga0207641_10289755 3300026088 Bacteria 1543
430 Ga0207648_10002605 3300026089 Bacteria 19328
431 Ga0207648_10010813 3300026089 Bacteria 8624
432 Ga0207648_10020336 3300026089 Bacteria 5980
433 Ga0207648_10040329 3300026089 Bacteria 4103
434 Ga0207648_10052734 3300026089 Bacteria 3556
435 Ga0207648_10068486 3300026089 Bacteria 3092
436 Ga0207648_10104514 3300026089 Bacteria 2484
437 Ga0207648_10263920 3300026089 Bacteria 1537
438 Ga0207676_10002713 3300026095 Bacteria 12603
439 Ga0207676_10009517 3300026095 Bacteria 6917
440 Ga0207676_10037153 3300026095 Bacteria 3710
441 Ga0207676_10088603 3300026095 Bacteria 2534
442 Ga0207676_10236217 3300026095 Bacteria 1637
443 Ga0207676_10361174 3300026095 Bacteria 1346
444 Ga0207674_10054739 3300026116 Bacteria 4061
445 Ga0207674_10082423 3300026116 Bacteria 3217
446 Ga0207674_10269078 3300026116 Bacteria 1651
447 Ga0207675_100008753 3300026118 Bacteria 9508
448 Ga0207675_100017817 3300026118 Bacteria 6627
449 Ga0207675_100018829 3300026118 Bacteria 6442
450 Ga0207675_100043196 3300026118 Bacteria 4209
451 Ga0207675_100047989 3300026118 Bacteria 3986
452 Ga0207675_100086517 3300026118 Bacteria 2943
453 Ga0207683_10027744 3300026121 Bacteria 4892
454 Ga0207698_10005625 3300026142 Bacteria 7756
455 Ga0207428_10178649 3300027907 Unclassified 1604
456 Ga0268266_10000049 3300028379 Bacteria 307763
457 Ga0268266_10010154 3300028379 Bacteria 8251
458 Ga0268265_10014355 3300028380 Bacteria 5396
459 Ga0268264_10000313 3300028381 Bacteria 77820
460 Ga0268264_10010078 3300028381 Bacteria 7823
461 Ga0268264_10011115 3300028381 Bacteria 7438
462 Ga0268264_10012858 3300028381 Bacteria 6887
463 Ga0307517_10002780 3300028786 Bacteria 27837
464 Ga0307517_10095134 3300028786 Bacteria 2400
465 Ga0307515_10000072 3300028794 Bacteria 237798
466 Ga0265338_10012873 3300028800 Bacteria 9505
467 Ga0265324_10002213 3300029957 Bacteria 10160
468 Ga0316181_1156517 3300030744 Bacteria 1208
469 Ga0265328_10001168 3300031239 Bacteria 12129
470 Ga0265329_10001743 3300031242 Bacteria 10381
471 Ga0265331_10006131 3300031250 Bacteria 7151
472 Ga0265327_10000168 3300031251 Bacteria 141392
473 Ga0265327_10000196 3300031251 Bacteria 127325
474 Ga0265327_10000866 3300031251 Bacteria 44980
475 Ga0265327_10004598 3300031251 Bacteria 12131
476 Ga0265327_10026564 3300031251 Bacteria 3350
477 Ga0265316_10000478 3300031344 Bacteria 45572
478 Ga0265316_10007268 3300031344 Bacteria 10450
479 Ga0265316_10128142 3300031344 Bacteria 1913
480 Ga0307513_10267995 3300031456 Bacteria 1493
481 Ga0307509_10068086 3300031507 Bacteria 3726
482 Ga0307408_100000005 3300031548 Bacteria 529098
483 Ga0307408_100000139 3300031548 Bacteria 80738
484 Ga0307508_10003548 3300031616 Bacteria 15725
485 Ga0307508_10273194 3300031616 Bacteria 1284
486 Ga0265314_10038479 3300031711 Bacteria 3454
487 Ga0265342_10095345 3300031712 Bacteria 1701
488 Ga0316576_10004148 3300031727 Bacteria 8646
489 Ga0316576_10067243 3300031727 Bacteria 2638
490 Ga0316576_10071140 3300031727 Bacteria 2566
491 Ga0316578_10003667 3300031728 Bacteria 7085
492 Ga0316578_10006133 3300031728 Bacteria 5905
493 Ga0316578_10061165 3300031728 Bacteria 2218
494 Ga0307516_10000646 3300031730 Bacteria 47161
495 Ga0316577_10013408 3300031733 Bacteria 4479
496 Ga0307410_10199947 3300031852 Bacteria 1525
497 Ga0307406_10000214 3300031901 Bacteria 34819
498 Ga0307412_10207918 3300031911 Bacteria 1491
499 Ga0307416_100203674 3300032002 Bacteria 1880
500 Ga0307414_10000072 3300032004 Bacteria 94883
501 Ga0307414_10003862 3300032004 Bacteria 8065
502 Ga0307414_10095708 3300032004 Bacteria 2220
503 Ga0307411_10238352 3300032005 Bacteria 1422
504 Ga0316585_10013447 3300032137 Bacteria 2436
505 Ga0316580_10013097 3300032139 Bacteria 2528
506 Ga0316593_10002062 3300032168 Bacteria 4654
507 Ga0316593_10011558 3300032168 Bacteria 2569
508 Ga0316593_10020484 3300032168 Bacteria 2057
509 Ga0316592_1017350 3300033524 Bacteria 1510
510 Ga0316587_1004236 3300033529 Bacteria 2074
511 Ga0316596_1002416 3300033541 Bacteria 3982
512 Ga0316596_1016204 3300033541 Bacteria 1865
513 Ga0373934_0031995 3300035086 Bacteria 2062
514 Ga0373945_0042753 3300035116 Bacteria 1643
515 Ga0316574_0005453 3300035398 Bacteria 6783
516 Ga0316582_0003920 3300036647 Bacteria 7421
517 Ga0316582_0050110 3300036647 Bacteria 2644
518 Ga0316582_0235889 3300036647 Bacteria 1252
519 Ga0316584_0000096 3300036712 Bacteria 35816
520 Ga0316584_0000480 3300036712 Bacteria 21015
521 Ga0316584_0088813 3300036712 Bacteria 2314
522 Ga0316584_0089844 3300036712 Bacteria 2300
523 Ga0316584_0106334 3300036712 Bacteria 2100
524 Ga0316584_0122322 3300036712 Bacteria 1944
525 Ga0316584_0175901 3300036712 Bacteria 1586
526 Ga0395899_0000022 3300037312 Bacteria 378509
527 Ga0395899_0186443 3300037312 Bacteria 1454
528 Ga0395900_0007723 3300037418 Bacteria 11092
529 Ga0395900_0101169 3300037418 Bacteria 2960
530 Ga0395898_0000012 3300037466 Bacteria 480882
531 Ga0395905_0000007 3300037471 Bacteria 521849
532 Ga0395905_0000494 3300037471 Bacteria 54156
533 Ga0395905_0167138 3300037471 Bacteria 2067
534 Ga0395905_0284453 3300037471 Bacteria 1540
535 Ga0395901_0298399 3300038443 Bacteria 1671
536 Ga0400486_17517 3300038742 Bacteria 3115
537 Ga0400483_069014 3300039062 Bacteria 11319
538 Ga0400483_078471 3300039062 Bacteria 1485
539 Ga0400483_174753 3300039062 Bacteria 26112
540 Ga0436365_1600972 3300039437 Bacteria 4033
541 Ga0439436_0004744 3300041404 Bacteria 4169
542 Ga0439436_0029713 3300041404 Bacteria 1591
543 Ga0439439_0018409 3300041406 Bacteria 1725
544 Ga0439461_0015025 3300041410 Bacteria 1480
545 Ga0451853_1566562 3300041512 Bacteria 2213
546 Ga0439431_0019848 3300041997 Bacteria 1601
547 Ga0439433_0014612 3300041999 Bacteria 1729
548 Ga0439433_0038600 3300041999 Bacteria 1108
549 Ga0439441_002190 3300042001 Bacteria 2714
550 Ga0439449_0008488 3300042007 Bacteria 3904
551 Ga0439457_001097 3300042014 Bacteria 8163
552 Ga0450922_001319 3300042124 Bacteria 2451
553 Ga0450923_013374 3300042125 Bacteria 1508
554 Ga0451577_0000120 3300042876 Bacteria 172425
555 Ga0451577_0001493 3300042876 Bacteria 30989
556 Ga0451577_0002301 3300042876 Bacteria 23092
557 Ga0451577_0010455 3300042876 Bacteria 8867
558 Ga0451577_0023348 3300042876 Bacteria 5641
559 Ga0466972_0000013 3300044658 Bacteria 229345
560 Ga0466972_0000020 3300044658 Bacteria 197336
561 Ga0466972_0003179 3300044658 Bacteria 8160
562 Ga0453683_0000241 3300044673 Bacteria 72899
563 Ga0453683_0001409 3300044673 Bacteria 20902
564 Ga0453683_0003448 3300044673 Bacteria 11652
565 Ga0453683_0156432 3300044673 Bacteria 1441
566 Ga0466965_0001828 3300044683 Bacteria 8849
567 Ga0466965_0084842 3300044683 Bacteria 1605
568 Ga0466966_0000045 3300044684 Bacteria 92504
569 Ga0453684_0000721 3300044712 Bacteria 116843
570 Ga0453684_0001358 3300044712 Bacteria 71434
571 Ga0453684_0004196 3300044712 Bacteria 30989
572 Ga0453684_0010057 3300044712 Bacteria 16264
573 Ga0453684_0010472 3300044712 Bacteria 15850
574 Ga0453684_0012355 3300044712 Bacteria 14113
575 Ga0453684_0025978 3300044712 Bacteria 8480
576 Ga0453684_0026693 3300044712 Bacteria 8325
577 Ga0453684_0039498 3300044712 Bacteria 6429
578 Ga0453684_0121903 3300044712 Bacteria 3146
579 Ga0453684_0160406 3300044712 Bacteria 2661
580 Ga0453684_0166014 3300044712 Bacteria 2606
581 Ga0453684_0222224 3300044712 Bacteria 2187
582 Ga0453684_0241468 3300044712 Bacteria 2079
583 Ga0453684_0423641 3300044712 Bacteria 1486
584 Ga0453684_0624768 3300044712 Bacteria 1178
585 Ga0466971_0000591 3300044719 Bacteria 14363
586 Ga0466971_0070216 3300044719 Bacteria 1590
587 Ga0466970_0000491 3300044765 Bacteria 19409
588 Ga0466970_0093345 3300044765 Bacteria 1635
589 Ga0466970_0104694 3300044765 Bacteria 1543
590 Ga0466957_0000544 3300044842 Bacteria 19041
591 Ga0466957_0003789 3300044842 Bacteria 8357
592 Ga0466957_0018826 3300044842 Bacteria 4059
593 Ga0466959_0000023 3300045049 Bacteria 124545
594 Ga0466959_0007926 3300045049 Bacteria 7481
595 Ga0451576_0002107 3300045051 Bacteria 30989
596 Ga0451576_0005360 3300045051 Bacteria 16125
597 Ga0451576_0020756 3300045051 Bacteria 7150
598 Ga0451576_0046622 3300045051 Bacteria 4563
599 Ga0466958_0044918 3300045836 Bacteria 2664
600 Ga0466967_0024602 3300045976 Bacteria 4954
601 Ga0495629_0037803 3300046459 Unclassified 3402
602 Ga0495638_0071059 3300046460 Bacteria 2130
603 Ga0495650_0076584 3300046471 Bacteria 1300
604 Ga0495580_0119283 3300046472 Unclassified 1832
605 Ga0495594_0077794 3300046499 Bacteria 1851
606 Ga0495606_0005542 3300046507 Bacteria 12040
607 Ga0495643_0000815 3300046522 Bacteria 34055
608 Ga0495648_0008867 3300046524 Bacteria 7865
609 Ga0495598_0009085 3300046537 Bacteria 2337
610 Ga0495633_0046732 3300046558 Bacteria 2047
611 Ga0495668_0002414 3300046616 Bacteria 15444
612 Ga0495668_0007203 3300046616 Bacteria 7146
613 Ga0495611_0000204 3300046648 Bacteria 41676
614 Ga0495611_0008341 3300046648 Bacteria 4387
615 Ga0495623_0113437 3300046679 Bacteria 1640
616 Ga0495670_0007145 3300046691 Bacteria 5497
617 Ga0495687_000001 3300047443 Bacteria 1215582
618 Ga0495686_0000004 3300047472 Bacteria 869019
619 Ga0495686_0004111 3300047472 Bacteria 12115
620 Ga0495686_0035343 3300047472 Bacteria 3213
621 Ga0495686_0038920 3300047472 Bacteria 3040
622 Ga0496109_0327402 3300048912 Bacteria 1446
623 Ga0496114_0238737 3300048917 Bacteria 1598
624 Ga0496115_0197709 3300048918 Bacteria 1661
625 Ga0496125_0000017 3300048928 Bacteria 508217
626 Ga0496126_0006314 3300048929 Bacteria 13234
627 Ga0501031_0001670 3300049568 Bacteria 13928
628 Ga0501031_0014692 3300049568 Bacteria 5089
629 Ga0501032_0000245 3300049569 Bacteria 45098
630 Ga0501032_0099433 3300049569 Bacteria 1927
631 Ga0501032_0106121 3300049569 Bacteria 1861
632 Ga0501033_0000002 3300049570 Bacteria 668574
633 Ga0501033_0000049 3300049570 Bacteria 114610
634 Ga0501033_0207150 3300049570 Unclassified 1399
635 Ga0501033_0216202 3300049570 Bacteria 1366
636 Ga0501034_0044922 3300049571 Bacteria 4465
637 Ga0501034_0059472 3300049571 Bacteria 3838
638 Ga0501034_0074425 3300049571 Bacteria 3404
639 Ga0501036_0132238 3300049572 Unclassified 2106
640 Ga0501037_0000459 3300049573 Bacteria 33122
641 Ga0501037_0243701 3300049573 Bacteria 1259
642 Ga0501038_0000020 3300049574 Bacteria 152738
643 Ga0501038_0024802 3300049574 Bacteria 5346
644 Ga0501038_0061904 3300049574 Unclassified 3200
645 Ga0501039_0007009 3300049575 Bacteria 8581
646 Ga0501043_0003640 3300049579 Bacteria 12650
647 Ga0501043_0010076 3300049579 Bacteria 7410
648 Ga0501043_0128090 3300049579 Bacteria 1990
649 Ga0501043_0311588 3300049579 Bacteria 1201
650 Ga0501046_0046898 3300049580 Bacteria 3428
651 Ga0501046_0242480 3300049580 Bacteria 1329
652 Ga0501047_0010102 3300049581 Bacteria 8922
653 Ga0501047_0031817 3300049581 Bacteria 5090
654 Ga0501047_0064834 3300049581 Bacteria 3523
655 Ga0501047_0247097 3300049581 Unclassified 1633
656 Ga0501047_0250731 3300049581 Bacteria 1619
657 Ga0501067_0110755 3300049583 Bacteria 1526
658 Ga0501068_0063276 3300049584 Bacteria 2251
659 Ga0501069_0196604 3300049585 Bacteria 1168
660 Ga0501070_0008406 3300049586 Bacteria 8717
661 Ga0501070_0044040 3300049586 Bacteria 3714
662 Ga0501073_0033415 3300049589 Bacteria 3663
663 Ga0501199_001464 3300049650 Bacteria 2143
664 Ga0501202_001117 3300049652 Bacteria 4186
665 Ga0501217_010862 3300049661 Bacteria 2004
666 Ga0501217_017971 3300049661 Bacteria 1636
667 Ga0501223_011844 3300049663 Bacteria 1749
668 Ga0501223_019433 3300049663 Bacteria 1335
669 Ga0501235_001439 3300049669 Bacteria 5077
670 Ga0501243_009183 3300049675 Bacteria 1534
671 Ga0501257_005896 3300049686 Bacteria 2711
672 Ga0501259_002355 3300049688 Bacteria 3085
673 Ga0501259_003203 3300049688 Bacteria 2616
674 Ga0501219_000038 3300049703 Bacteria 21298
675 Ga0501221_000867 3300049704 Bacteria 4936
676 Ga0501083_0030624 3300049744 Bacteria 3695
677 Ga0501241_000198 3300049758 Bacteria 13561
678 Ga0501241_002421 3300049758 Bacteria 3605
679 Ga0501272_004269 3300049769 Bacteria 1481
680 Ga0501279_009168 3300049775 Bacteria 1324
681 Ga0501035_0000001 3300049822 Bacteria 1037138
682 Ga0501035_0023072 3300049822 Bacteria 5711
683 Ga0501044_0007030 3300049823 Bacteria 12384
684 Ga0501044_0028431 3300049823 Bacteria 5902
685 Ga0501044_0028857 3300049823 Bacteria 5852
686 Ga0501044_0035810 3300049823 Bacteria 5195
687 Ga0501044_0100058 3300049823 Bacteria 2918
688 Ga0501284_00021 3300050005 Bacteria 89729
689 nmdc:mga0k408_134812_c1 3300050493 Bacteria 1467
690 nmdc:mga0k408_29824_c1 3300050493 Bacteria 3107
691 nmdc:mga05p37_3343_c1 3300050507 Bacteria 18701
692 nmdc:mga09592_29840_c1 3300050508 Bacteria 4536
693 nmdc:mga09592_400339_c1 3300050508 Bacteria 1187
694 nmdc:mga0qj67_17217_c1 3300050509 Bacteria 5492
695 nmdc:mga06r32_162916_c1 3300050510 Bacteria 2212
696 nmdc:mga08y16_137821_c1 3300050511 Bacteria 2537
697 nmdc:mga08y16_94339_c1 3300050511 Bacteria 3117
698 nmdc:mga08y16_99592_c1 3300050511 Bacteria 3026
699 Ga0500578_0000155 3300053086 Bacteria 80380
700 Ga0500646_0011376 3300053090 Bacteria 2289
701 Ga0500583_0000043 3300053092 Bacteria 81313
702 Ga0500583_0000675 3300053092 Bacteria 10019
703 Ga0500562_000007 3300053108 Bacteria 241755
704 Ga0500652_032439 3300053131 Bacteria 2058
705 Ga0500559_0025149 3300053136 Bacteria 2534
706 Ga0500568_0000702 3300053139 Bacteria 24042
707 Ga0500589_004209 3300053147 Bacteria 5366
708 Ga0500604_0000317 3300053151 Bacteria 13432
709 Ga0500622_0000052 3300053156 Bacteria 145201
710 Ga0500622_0000575 3300053156 Bacteria 33359
711 Ga0500622_0001876 3300053156 Bacteria 15870
712 Ga0500622_0013673 3300053156 Bacteria 4375
713 Ga0500627_0013003 3300053158 Bacteria 3139
714 Ga0500639_091952 3300053163 Bacteria 1509
715 Ga0500636_0004180 3300053177 Bacteria 8177
716 Ga0500611_000011 3300053727 Bacteria 141259
717 Ga0500611_001356 3300053727 Bacteria 2672
718 Ga0500645_011995 3300053730 Bacteria 2811
719 Ga0500661_006149 3300055283 Bacteria 2239
720 Ga0587090_011249 3300059510 Bacteria 1255
721 Ga0466962_0000091 3300061719 Bacteria 36637

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031727 Ga0316576_10071140 Ga0316576_100711402 339
2 3300036712 Ga0316584_0175901 Ga0316584_0175901_29_1105 339
3 3300044673 Ga0453683_0156432 Ga0453683_0156432_10_1035 341
4 3300045051 Ga0451576_0046622 Ga0451576_0046622_3053_4132 341
5 3300009094 Ga0111539_10028901 Ga0111539_100289014 343
6 3300050511 nmdc:mga08y16_94339_c1 nmdc:mga08y16_94339_c1_1911_2942 343
7 3300042124 Ga0450922_001319 Ga0450922_001319_518_1585 344
8 3300006844 Ga0075428_100041517 Ga0075428_1000415176 345
9 3300042876 Ga0451577_0000120 Ga0451577_0000120_17782_18846 345
10 3300036647 Ga0316582_0050110 Ga0316582_0050110_11_1054 347
11 iso_pu_bacteria 2884634485 2884634769 349
12 iso_pu_bacteria 2919692658 2919694602 349
13 iso_pu_bacteria 2884791551 2884792949 350
14 3300036647 Ga0316582_0235889 Ga0316582_0235889_183_1238 351
15 3300053151 Ga0500604_0000317 Ga0500604_0000317_2183_3244 351
16 3300053156 Ga0500622_0000052 Ga0500622_0000052_40394_41455 351
17 3300053158 Ga0500627_0013003 Ga0500627_0013003_710_1771 351
18 iso_pu_bacteria 2738541278 2738726340 351
19 iso_pu_bacteria 2818991442 2819576420 351
20 iso_pu_bacteria 2818991444 2819589661 351
21 iso_pu_bacteria 2818991460 2819678103 351
22 iso_pu_bacteria 2821136567 2821142621 351
23 iso_pu_bacteria 2883068021 2883068288 351
24 iso_pu_bacteria 2890804823 2890805887 351
25 iso_pu_bacteria 2896085136 2896089115 351
26 iso_pu_bacteria 2904467357 2904470211 351
27 iso_pu_bacteria 2914759650 2914760840 351
28 iso_pu_bacteria 2929154850 2929156214 351
29 iso_pu_bacteria 2929177148 2929181189 351
30 iso_pu_bacteria 2929239360 2929243252 351
31 iso_pu_bacteria 2929921140 2929925088 351
32 iso_pu_bacteria 2945977869 2945983593 351
33 iso_pu_bacteria 2946013367 2946017019 351
34 iso_pu_bacteria 2965320100 2965323728 351
35 iso_pu_bacteria 646564506 646812803 351
36 iso_pu_bacteria 8003151029 8003157335 351
37 iso_pu_bacteria 2523533629 2524006569 352
38 3300005327 Ga0070658_10231933 Ga0070658_102319332 353
39 3300005614 Ga0068856_100478334 Ga0068856_1004783341 353
40 3300025909 Ga0207705_10194595 Ga0207705_101945952 353
41 3300030744 Ga0316181_1156517 Ga0316181_11565171 353
42 3300031548 Ga0307408_100000139 Ga0307408_10000013925 353
43 3300032004 Ga0307414_10000072 Ga0307414_1000007290 353
44 3300032004 Ga0307414_10003862 Ga0307414_100038622 353
45 3300032168 Ga0316593_10020484 Ga0316593_100204842 353
46 3300033524 Ga0316592_1017350 Ga0316592_10173501 353
47 3300033529 Ga0316587_1004236 Ga0316587_10042362 353
48 3300033541 Ga0316596_1002416 Ga0316596_10024163 353
49 3300033541 Ga0316596_1016204 Ga0316596_10162041 353
50 3300036712 Ga0316584_0106334 Ga0316584_0106334_746_1816 353
51 3300037418 Ga0395900_0101169 Ga0395900_0101169_130_1197 353
52 3300037471 Ga0395905_0000007 Ga0395905_0000007_293081_294148 353
53 3300042876 Ga0451577_0002301 Ga0451577_0002301_3966_5027 353
54 3300044712 Ga0453684_0000721 Ga0453684_0000721_11723_12784 353
55 3300048918 Ga0496115_0197709 Ga0496115_0197709_128_1192 353
56 3300049579 Ga0501043_0128090 Ga0501043_0128090_11_1078 353
57 3300049758 Ga0501241_002421 Ga0501241_002421_1118_2185 353
58 iso_pu_bacteria 2648501241 2649121315 353
59 iso_pu_bacteria 2651869818 2652974568 353
60 iso_pu_bacteria 2786546548 2787509772 353
61 iso_pu_bacteria 2919493220 2919496828 353
62 iso_pu_bacteria 2919543075 2919546402 353
63 iso_pu_bacteria 2923525760 2923529953 353
64 iso_pu_bacteria 8001522603 8001525860 353
65 3300002459 JGI24751J29686_10008130 JGI24751J29686_100081302 354
66 3300003320 rootH2_10000149 rootH2_100001492 354
67 3300003320 rootH2_10030789 rootH2_1003078910 354
68 3300003320 rootH2_10033273 rootH2_100332733 354
69 3300003320 rootH2_10162427 rootH2_101624271 354
70 3300003322 rootL2_10090605 rootL2_100906053 354
71 3300003354 JGI25160J50197_1002187 JGI25160J50197_10021874 354
72 3300003791 Ga0055530_10000315 Ga0055530_100003155 354
73 3300005289 Ga0065704_10096676 Ga0065704_100966762 354
74 3300005290 Ga0065712_10014468 Ga0065712_100144684 354
75 3300005290 Ga0065712_10081375 Ga0065712_100813754 354
76 3300005327 Ga0070658_10000095 Ga0070658_1000009552 354
77 3300005327 Ga0070658_10267109 Ga0070658_102671091 354
78 3300005328 Ga0070676_10000252 Ga0070676_100002522 354
79 3300005328 Ga0070676_10009134 Ga0070676_100091345 354
80 3300005329 Ga0070683_100003259 Ga0070683_1000032595 354
81 3300005329 Ga0070683_100025140 Ga0070683_1000251404 354
82 3300005330 Ga0070690_100140451 Ga0070690_1001404511 354
83 3300005330 Ga0070690_100226063 Ga0070690_1002260631 354
84 3300005331 Ga0070670_100007971 Ga0070670_1000079716 354
85 3300005331 Ga0070670_100014145 Ga0070670_1000141452 354
86 3300005331 Ga0070670_100036514 Ga0070670_1000365143 354
87 3300005331 Ga0070670_100078424 Ga0070670_1000784241 354
88 3300005331 Ga0070670_100156232 Ga0070670_1001562322 354
89 3300005331 Ga0070670_100194295 Ga0070670_1001942951 354
90 3300005334 Ga0068869_100008995 Ga0068869_1000089955 354
91 3300005334 Ga0068869_100013406 Ga0068869_1000134064 354
92 3300005334 Ga0068869_100018447 Ga0068869_1000184472 354
93 3300005334 Ga0068869_100048072 Ga0068869_1000480724 354
94 3300005335 Ga0070666_10000616 Ga0070666_1000061610 354
95 3300005335 Ga0070666_10009653 Ga0070666_100096535 354
96 3300005335 Ga0070666_10130184 Ga0070666_101301841 354
97 3300005337 Ga0070682_100010522 Ga0070682_1000105222 354
98 3300005337 Ga0070682_100031550 Ga0070682_1000315503 354
99 3300005338 Ga0068868_100000091 Ga0068868_10000009116 354
100 3300005338 Ga0068868_100051846 Ga0068868_1000518461 354
101 3300005340 Ga0070689_100027356 Ga0070689_1000273562 354
102 3300005340 Ga0070689_100114899 Ga0070689_1001148992 354
103 3300005347 Ga0070668_100000043 Ga0070668_10000004351 354
104 3300005347 Ga0070668_100044375 Ga0070668_1000443754 354
105 3300005353 Ga0070669_100040844 Ga0070669_1000408444 354
106 3300005354 Ga0070675_100040358 Ga0070675_1000403581 354
107 3300005354 Ga0070675_100048827 Ga0070675_1000488273 354
108 3300005355 Ga0070671_100027742 Ga0070671_1000277422 354
109 3300005355 Ga0070671_100055549 Ga0070671_1000555493 354
110 3300005355 Ga0070671_100107623 Ga0070671_1001076232 354
111 3300005356 Ga0070674_100026685 Ga0070674_1000266854 354
112 3300005356 Ga0070674_100032734 Ga0070674_1000327343 354
113 3300005364 Ga0070673_100000283 Ga0070673_10000028317 354
114 3300005364 Ga0070673_100012211 Ga0070673_1000122117 354
115 3300005364 Ga0070673_100031990 Ga0070673_1000319902 354
116 3300005365 Ga0070688_100012566 Ga0070688_1000125664 354
117 3300005366 Ga0070659_100090583 Ga0070659_1000905832 354
118 3300005367 Ga0070667_100000254 Ga0070667_10000025444 354
119 3300005367 Ga0070667_100001284 Ga0070667_10000128419 354
120 3300005367 Ga0070667_100016664 Ga0070667_1000166645 354
121 3300005367 Ga0070667_100199438 Ga0070667_1001994381 354
122 3300005367 Ga0070667_100323849 Ga0070667_1003238491 354
123 3300005455 Ga0070663_100165609 Ga0070663_1001656092 354
124 3300005456 Ga0070678_100042090 Ga0070678_1000420902 354
125 3300005457 Ga0070662_100002778 Ga0070662_1000027788 354
126 3300005457 Ga0070662_100006706 Ga0070662_1000067062 354
127 3300005458 Ga0070681_10025679 Ga0070681_100256794 354
128 3300005458 Ga0070681_10081003 Ga0070681_100810033 354
129 3300005458 Ga0070681_10147131 Ga0070681_101471312 354
130 3300005459 Ga0068867_100005482 Ga0068867_1000054822 354
131 3300005459 Ga0068867_100016258 Ga0068867_1000162583 354
132 3300005459 Ga0068867_100157290 Ga0068867_1001572902 354
133 3300005459 Ga0068867_100225940 Ga0068867_1002259402 354
134 3300005466 Ga0070685_10028768 Ga0070685_100287682 354
135 3300005467 Ga0070706_100200107 Ga0070706_1002001072 354
136 3300005471 Ga0070698_100001232 Ga0070698_10000123217 354
137 3300005471 Ga0070698_100132976 Ga0070698_1001329763 354
138 3300005530 Ga0070679_100031738 Ga0070679_1000317384 354
139 3300005530 Ga0070679_100156060 Ga0070679_1001560604 354
140 3300005535 Ga0070684_100007323 Ga0070684_1000073234 354
141 3300005535 Ga0070684_100271675 Ga0070684_1002716752 354
142 3300005539 Ga0068853_100000675 Ga0068853_1000006753 354
143 3300005539 Ga0068853_100004921 Ga0068853_1000049214 354
144 3300005539 Ga0068853_100022678 Ga0068853_1000226782 354
145 3300005539 Ga0068853_100037199 Ga0068853_1000371992 354
146 3300005539 Ga0068853_100324852 Ga0068853_1003248522 354
147 3300005543 Ga0070672_100000160 Ga0070672_10000016011 354
148 3300005543 Ga0070672_100114886 Ga0070672_1001148862 354
149 3300005548 Ga0070665_100000001 Ga0070665_100000001657 354
150 3300005548 Ga0070665_100000350 Ga0070665_10000035019 354
151 3300005548 Ga0070665_100012508 Ga0070665_1000125086 354
152 3300005563 Ga0068855_100000089 Ga0068855_10000008946 354
153 3300005563 Ga0068855_100023787 Ga0068855_1000237875 354
154 3300005563 Ga0068855_100046257 Ga0068855_1000462572 354
155 3300005563 Ga0068855_100066665 Ga0068855_1000666655 354
156 3300005563 Ga0068855_100079334 Ga0068855_1000793343 354
157 3300005563 Ga0068855_100158975 Ga0068855_1001589753 354
158 3300005564 Ga0070664_100002175 Ga0070664_1000021753 354
159 3300005564 Ga0070664_100046003 Ga0070664_1000460032 354
160 3300005578 Ga0068854_100026248 Ga0068854_1000262483 354
161 3300005614 Ga0068856_100009691 Ga0068856_1000096914 354
162 3300005614 Ga0068856_100042851 Ga0068856_1000428515 354
163 3300005614 Ga0068856_100049149 Ga0068856_1000491492 354
164 3300005616 Ga0068852_100000655 Ga0068852_10000065510 354
165 3300005616 Ga0068852_100015276 Ga0068852_1000152763 354
166 3300005616 Ga0068852_100019201 Ga0068852_1000192012 354
167 3300005617 Ga0068859_100000100 Ga0068859_10000010047 354
168 3300005617 Ga0068859_100010659 Ga0068859_1000106592 354
169 3300005617 Ga0068859_100014583 Ga0068859_1000145835 354
170 3300005617 Ga0068859_100332443 Ga0068859_1003324432 354
171 3300005618 Ga0068864_100001658 Ga0068864_1000016583 354
172 3300005618 Ga0068864_100013342 Ga0068864_1000133421 354
173 3300005618 Ga0068864_100138887 Ga0068864_1001388871 354
174 3300005618 Ga0068864_100359796 Ga0068864_1003597962 354
175 3300005618 Ga0068864_100362130 Ga0068864_1003621302 354
176 3300005718 Ga0068866_10143259 Ga0068866_101432591 354
177 3300005719 Ga0068861_100003609 Ga0068861_1000036097 354
178 3300005719 Ga0068861_100006042 Ga0068861_1000060422 354
179 3300005719 Ga0068861_100013501 Ga0068861_1000135011 354
180 3300005834 Ga0068851_10004456 Ga0068851_100044562 354
181 3300005834 Ga0068851_10058388 Ga0068851_100583882 354
182 3300005841 Ga0068863_100018881 Ga0068863_1000188812 354
183 3300005841 Ga0068863_100022470 Ga0068863_1000224706 354
184 3300005841 Ga0068863_100038477 Ga0068863_1000384772 354
185 3300005841 Ga0068863_100039594 Ga0068863_1000395942 354
186 3300005841 Ga0068863_100079599 Ga0068863_1000795992 354
187 3300005841 Ga0068863_100310984 Ga0068863_1003109841 354
188 3300005842 Ga0068858_100000199 Ga0068858_10000019955 354
189 3300005842 Ga0068858_100001301 Ga0068858_1000013012 354
190 3300005842 Ga0068858_100340636 Ga0068858_1003406361 354
191 3300005843 Ga0068860_100000111 Ga0068860_10000011173 354
192 3300005843 Ga0068860_100000846 Ga0068860_1000008467 354
193 3300005843 Ga0068860_100001512 Ga0068860_10000151210 354
194 3300005843 Ga0068860_100003412 Ga0068860_1000034124 354
195 3300005843 Ga0068860_100005552 Ga0068860_1000055525 354
196 3300005843 Ga0068860_100042932 Ga0068860_1000429323 354
197 3300005843 Ga0068860_100139432 Ga0068860_1001394322 354
198 3300005844 Ga0068862_100058563 Ga0068862_1000585633 354
199 3300006195 Ga0075366_10018779 Ga0075366_100187793 354
200 3300006195 Ga0075366_10116478 Ga0075366_101164782 354
201 3300006237 Ga0097621_100002436 Ga0097621_1000024367 354
202 3300006237 Ga0097621_100002531 Ga0097621_1000025313 354
203 3300006237 Ga0097621_100003700 Ga0097621_1000037002 354
204 3300006237 Ga0097621_100020533 Ga0097621_1000205335 354
205 3300006237 Ga0097621_100051241 Ga0097621_1000512412 354
206 3300006358 Ga0068871_100004030 Ga0068871_10000403011 354
207 3300006358 Ga0068871_100010137 Ga0068871_1000101376 354
208 3300006358 Ga0068871_100027019 Ga0068871_1000270192 354
209 3300006358 Ga0068871_100031740 Ga0068871_1000317404 354
210 3300006358 Ga0068871_100039362 Ga0068871_1000393622 354
211 3300006358 Ga0068871_100044639 Ga0068871_1000446391 354
212 3300006358 Ga0068871_100062039 Ga0068871_1000620393 354
213 3300006358 Ga0068871_100198721 Ga0068871_1001987212 354
214 3300006844 Ga0075428_100013181 Ga0075428_1000131816 354
215 3300006844 Ga0075428_100015528 Ga0075428_1000155289 354
216 3300006844 Ga0075428_100251468 Ga0075428_1002514682 354
217 3300006846 Ga0075430_100051698 Ga0075430_1000516984 354
218 3300006847 Ga0075431_100140517 Ga0075431_1001405173 354
219 3300006880 Ga0075429_100003290 Ga0075429_1000032909 354
220 3300006880 Ga0075429_100222922 Ga0075429_1002229221 354
221 3300006881 Ga0068865_100005344 Ga0068865_1000053445 354
222 3300006881 Ga0068865_100007446 Ga0068865_1000074465 354
223 3300006931 Ga0097620_100000100 Ga0097620_10000010025 354
224 3300006931 Ga0097620_100010659 Ga0097620_1000106597 354
225 3300006931 Ga0097620_100014582 Ga0097620_1000145825 354
226 3300006931 Ga0097620_100332454 Ga0097620_1003324542 354
227 3300009093 Ga0105240_10000074 Ga0105240_1000007474 354
228 3300009093 Ga0105240_10000513 Ga0105240_100005135 354
229 3300009093 Ga0105240_10007118 Ga0105240_100071184 354
230 3300009093 Ga0105240_10008360 Ga0105240_100083604 354
231 3300009093 Ga0105240_10041056 Ga0105240_100410565 354
232 3300009093 Ga0105240_10111783 Ga0105240_101117833 354
233 3300009093 Ga0105240_10375346 Ga0105240_103753461 354
234 3300009094 Ga0111539_10218562 Ga0111539_102185622 354
235 3300009094 Ga0111539_10447995 Ga0111539_104479952 354
236 3300009101 Ga0105247_10005256 Ga0105247_100052564 354
237 3300009147 Ga0114129_10004929 Ga0114129_1000492914 354
238 3300009174 Ga0105241_10023976 Ga0105241_100239762 354
239 3300009176 Ga0105242_10035646 Ga0105242_100356462 354
240 3300009176 Ga0105242_10041681 Ga0105242_100416811 354
241 3300009176 Ga0105242_10101424 Ga0105242_101014241 354
242 3300009176 Ga0105242_10119202 Ga0105242_101192022 354
243 3300009176 Ga0105242_10147822 Ga0105242_101478221 354
244 3300009177 Ga0105248_10031375 Ga0105248_100313754 354
245 3300009177 Ga0105248_10190771 Ga0105248_101907712 354
246 3300009545 Ga0105237_10000528 Ga0105237_1000052822 354
247 3300009545 Ga0105237_10002821 Ga0105237_100028214 354
248 3300009545 Ga0105237_10005077 Ga0105237_100050775 354
249 3300009545 Ga0105237_10007087 Ga0105237_100070875 354
250 3300009545 Ga0105237_10026166 Ga0105237_100261663 354
251 3300009545 Ga0105237_10488158 Ga0105237_104881582 354
252 3300009551 Ga0105238_10001119 Ga0105238_1000111921 354
253 3300009551 Ga0105238_10107514 Ga0105238_101075142 354
254 3300009551 Ga0105238_10254852 Ga0105238_102548521 354
255 3300009553 Ga0105249_10000420 Ga0105249_1000042017 354
256 3300009553 Ga0105249_10004140 Ga0105249_100041409 354
257 3300009553 Ga0105249_10012201 Ga0105249_100122012 354
258 3300010375 Ga0105239_10000048 Ga0105239_1000004833 354
259 3300010375 Ga0105239_10000314 Ga0105239_1000031436 354
260 3300010375 Ga0105239_10000853 Ga0105239_1000085312 354
261 3300010375 Ga0105239_10033395 Ga0105239_100333952 354
262 3300010375 Ga0105239_10039449 Ga0105239_100394493 354
263 3300010375 Ga0105239_10237363 Ga0105239_102373632 354
264 3300010375 Ga0105239_10387523 Ga0105239_103875231 354
265 3300010375 Ga0105239_10532817 Ga0105239_105328171 354
266 3300011119 Ga0105246_10037365 Ga0105246_100373651 354
267 3300013100 Ga0157373_10034570 Ga0157373_100345702 354
268 3300013100 Ga0157373_10036183 Ga0157373_100361835 354
269 3300013102 Ga0157371_10019068 Ga0157371_100190681 354
270 3300013102 Ga0157371_10201521 Ga0157371_102015211 354
271 3300013104 Ga0157370_10007951 Ga0157370_100079516 354
272 3300013104 Ga0157370_10075884 Ga0157370_100758843 354
273 3300013104 Ga0157370_10195942 Ga0157370_101959422 354
274 3300013105 Ga0157369_10010273 Ga0157369_100102738 354
275 3300013105 Ga0157369_10067695 Ga0157369_100676951 354
276 3300013105 Ga0157369_10223780 Ga0157369_102237802 354
277 3300013296 Ga0157374_10000084 Ga0157374_1000008419 354
278 3300013296 Ga0157374_10012628 Ga0157374_100126284 354
279 3300013296 Ga0157374_10076666 Ga0157374_100766663 354
280 3300013296 Ga0157374_10265730 Ga0157374_102657301 354
281 3300013296 Ga0157374_10325660 Ga0157374_103256602 354
282 3300013297 Ga0157378_10001872 Ga0157378_1000187211 354
283 3300013297 Ga0157378_10027692 Ga0157378_100276922 354
284 3300013297 Ga0157378_10032561 Ga0157378_100325613 354
285 3300013297 Ga0157378_10098402 Ga0157378_100984023 354
286 3300013306 Ga0163162_10000101 Ga0163162_1000010134 354
287 3300013306 Ga0163162_10000113 Ga0163162_1000011347 354
288 3300013306 Ga0163162_10003148 Ga0163162_1000314811 354
289 3300013306 Ga0163162_10005141 Ga0163162_100051418 354
290 3300013306 Ga0163162_10024246 Ga0163162_100242462 354
291 3300013306 Ga0163162_10071459 Ga0163162_100714591 354
292 3300013306 Ga0163162_10097769 Ga0163162_100977691 354
293 3300013307 Ga0157372_10001128 Ga0157372_100011287 354
294 3300013307 Ga0157372_10005133 Ga0157372_100051337 354
295 3300013307 Ga0157372_10005538 Ga0157372_100055385 354
296 3300013307 Ga0157372_10030568 Ga0157372_100305684 354
297 3300013307 Ga0157372_10049581 Ga0157372_100495814 354
298 3300013307 Ga0157372_10069083 Ga0157372_100690833 354
299 3300013307 Ga0157372_10073750 Ga0157372_100737502 354
300 3300013307 Ga0157372_10152955 Ga0157372_101529552 354
301 3300013307 Ga0157372_10434416 Ga0157372_104344161 354
302 3300013307 Ga0157372_10479499 Ga0157372_104794991 354
303 3300013308 Ga0157375_10000565 Ga0157375_1000056514 354
304 3300013308 Ga0157375_10009092 Ga0157375_100090923 354
305 3300013308 Ga0157375_10070596 Ga0157375_100705963 354
306 3300013308 Ga0157375_10122613 Ga0157375_101226132 354
307 3300013308 Ga0157375_10162918 Ga0157375_101629182 354
308 3300014325 Ga0163163_10000306 Ga0163163_100003064 354
309 3300014325 Ga0163163_10025324 Ga0163163_100253243 354
310 3300014325 Ga0163163_10361098 Ga0163163_103610981 354
311 3300014326 Ga0157380_10034657 Ga0157380_100346572 354
312 3300014326 Ga0157380_10042141 Ga0157380_100421413 354
313 3300014326 Ga0157380_10118025 Ga0157380_101180253 354
314 3300014745 Ga0157377_10085237 Ga0157377_100852372 354
315 3300014968 Ga0157379_10000245 Ga0157379_1000024518 354
316 3300014969 Ga0157376_10002364 Ga0157376_100023649 354
317 3300014969 Ga0157376_10003646 Ga0157376_100036469 354
318 3300014969 Ga0157376_10004318 Ga0157376_100043185 354
319 3300014969 Ga0157376_10023777 Ga0157376_100237772 354
320 3300014969 Ga0157376_10089937 Ga0157376_100899372 354
321 3300014969 Ga0157376_10156558 Ga0157376_101565582 354
322 3300014969 Ga0157376_10190896 Ga0157376_101908962 354
323 3300014969 Ga0157376_10418779 Ga0157376_104187791 354
324 3300017792 Ga0163161_10037411 Ga0163161_100374112 354
325 3300017792 Ga0163161_10095390 Ga0163161_100953902 354
326 3300017792 Ga0163161_10126070 Ga0163161_101260702 354
327 3300025246 Ga0209646_1001404 Ga0209646_10014042 354
328 3300025302 Ga0207426_1000009 Ga0207426_1000009397 354
329 3300025304 Ga0209257_1000089 Ga0209257_1000089150 354
330 3300025315 Ga0207697_10047494 Ga0207697_100474941 354
331 3300025321 Ga0207656_10002387 Ga0207656_100023876 354
332 3300025900 Ga0207710_10011655 Ga0207710_100116552 354
333 3300025900 Ga0207710_10017547 Ga0207710_100175472 354
334 3300025901 Ga0207688_10029845 Ga0207688_100298452 354
335 3300025903 Ga0207680_10003112 Ga0207680_100031122 354
336 3300025903 Ga0207680_10013728 Ga0207680_100137284 354
337 3300025904 Ga0207647_10004545 Ga0207647_100045454 354
338 3300025904 Ga0207647_10026889 Ga0207647_100268892 354
339 3300025907 Ga0207645_10000378 Ga0207645_100003789 354
340 3300025907 Ga0207645_10001750 Ga0207645_100017504 354
341 3300025908 Ga0207643_10052782 Ga0207643_100527822 354
342 3300025909 Ga0207705_10146201 Ga0207705_101462012 354
343 3300025911 Ga0207654_10001221 Ga0207654_100012212 354
344 3300025911 Ga0207654_10001953 Ga0207654_100019535 354
345 3300025911 Ga0207654_10008832 Ga0207654_100088323 354
346 3300025912 Ga0207707_10002099 Ga0207707_100020993 354
347 3300025912 Ga0207707_10130640 Ga0207707_101306404 354
348 3300025913 Ga0207695_10000071 Ga0207695_10000071192 354
349 3300025913 Ga0207695_10000084 Ga0207695_10000084165 354
350 3300025913 Ga0207695_10000323 Ga0207695_1000032314 354
351 3300025913 Ga0207695_10001425 Ga0207695_1000142530 354
352 3300025913 Ga0207695_10007632 Ga0207695_100076322 354
353 3300025913 Ga0207695_10011249 Ga0207695_100112494 354
354 3300025913 Ga0207695_10071661 Ga0207695_100716612 354
355 3300025914 Ga0207671_10001584 Ga0207671_100015844 354
356 3300025914 Ga0207671_10001605 Ga0207671_100016057 354
357 3300025914 Ga0207671_10008236 Ga0207671_100082364 354
358 3300025914 Ga0207671_10010848 Ga0207671_100108485 354
359 3300025914 Ga0207671_10016277 Ga0207671_100162774 354
360 3300025914 Ga0207671_10021869 Ga0207671_100218693 354
361 3300025914 Ga0207671_10336752 Ga0207671_103367521 354
362 3300025917 Ga0207660_10001416 Ga0207660_100014163 354
363 3300025918 Ga0207662_10023264 Ga0207662_100232643 354
364 3300025919 Ga0207657_10151871 Ga0207657_101518711 354
365 3300025919 Ga0207657_10188794 Ga0207657_101887942 354
366 3300025921 Ga0207652_10000986 Ga0207652_1000098624 354
367 3300025921 Ga0207652_10131105 Ga0207652_101311054 354
368 3300025923 Ga0207681_10039294 Ga0207681_100392942 354
369 3300025924 Ga0207694_10069297 Ga0207694_100692972 354
370 3300025924 Ga0207694_10115743 Ga0207694_101157432 354
371 3300025925 Ga0207650_10011294 Ga0207650_100112944 354
372 3300025925 Ga0207650_10041445 Ga0207650_100414452 354
373 3300025925 Ga0207650_10071800 Ga0207650_100718003 354
374 3300025925 Ga0207650_10076405 Ga0207650_100764051 354
375 3300025925 Ga0207650_10090530 Ga0207650_100905302 354
376 3300025926 Ga0207659_10017041 Ga0207659_100170412 354
377 3300025926 Ga0207659_10105532 Ga0207659_101055321 354
378 3300025926 Ga0207659_10324805 Ga0207659_103248052 354
379 3300025927 Ga0207687_10027927 Ga0207687_100279274 354
380 3300025931 Ga0207644_10058787 Ga0207644_100587873 354
381 3300025931 Ga0207644_10088847 Ga0207644_100888472 354
382 3300025933 Ga0207706_10005553 Ga0207706_100055538 354
383 3300025933 Ga0207706_10014031 Ga0207706_100140315 354
384 3300025934 Ga0207686_10030128 Ga0207686_100301282 354
385 3300025934 Ga0207686_10041764 Ga0207686_100417643 354
386 3300025934 Ga0207686_10073887 Ga0207686_100738872 354
387 3300025934 Ga0207686_10081034 Ga0207686_100810341 354
388 3300025936 Ga0207670_10025122 Ga0207670_100251223 354
389 3300025937 Ga0207669_10045391 Ga0207669_100453913 354
390 3300025937 Ga0207669_10103394 Ga0207669_101033941 354
391 3300025938 Ga0207704_10001110 Ga0207704_100011107 354
392 3300025938 Ga0207704_10018773 Ga0207704_100187731 354
393 3300025940 Ga0207691_10000227 Ga0207691_1000022744 354
394 3300025940 Ga0207691_10184848 Ga0207691_101848482 354
395 3300025940 Ga0207691_10343081 Ga0207691_103430811 354
396 3300025942 Ga0207689_10008011 Ga0207689_100080116 354
397 3300025942 Ga0207689_10010699 Ga0207689_100106991 354
398 3300025942 Ga0207689_10035224 Ga0207689_100352242 354
399 3300025942 Ga0207689_10094949 Ga0207689_100949492 354
400 3300025942 Ga0207689_10126332 Ga0207689_101263322 354
401 3300025945 Ga0207679_10032303 Ga0207679_100323034 354
402 3300025945 Ga0207679_10094266 Ga0207679_100942663 354
403 3300025949 Ga0207667_10000135 Ga0207667_1000013548 354
404 3300025949 Ga0207667_10000177 Ga0207667_1000017761 354
405 3300025949 Ga0207667_10025965 Ga0207667_100259657 354
406 3300025949 Ga0207667_10060186 Ga0207667_100601862 354
407 3300025949 Ga0207667_10205788 Ga0207667_102057881 354
408 3300025960 Ga0207651_10001142 Ga0207651_100011425 354
409 3300025960 Ga0207651_10336240 Ga0207651_103362401 354
410 3300025961 Ga0207712_10001272 Ga0207712_1000127211 354
411 3300025961 Ga0207712_10004770 Ga0207712_100047701 354
412 3300025961 Ga0207712_10006837 Ga0207712_100068375 354
413 3300025961 Ga0207712_10025027 Ga0207712_100250272 354
414 3300025961 Ga0207712_10112040 Ga0207712_101120402 354
415 3300025961 Ga0207712_10183222 Ga0207712_101832221 354
416 3300025972 Ga0207668_10000821 Ga0207668_100008219 354
417 3300025972 Ga0207668_10028723 Ga0207668_100287233 354
418 3300025972 Ga0207668_10116285 Ga0207668_101162852 354
419 3300025981 Ga0207640_10174974 Ga0207640_101749742 354
420 3300025986 Ga0207658_10000176 Ga0207658_1000017651 354
421 3300025986 Ga0207658_10036237 Ga0207658_100362372 354
422 3300025986 Ga0207658_10043302 Ga0207658_100433022 354
423 3300025986 Ga0207658_10054994 Ga0207658_100549942 354
424 3300026023 Ga0207677_10002439 Ga0207677_100024399 354
425 3300026023 Ga0207677_10032982 Ga0207677_100329822 354
426 3300026035 Ga0207703_10034234 Ga0207703_100342342 354
427 3300026035 Ga0207703_10072524 Ga0207703_100725241 354
428 3300026035 Ga0207703_10172950 Ga0207703_101729502 354
429 3300026041 Ga0207639_10005083 Ga0207639_100050832 354
430 3300026041 Ga0207639_10010154 Ga0207639_100101543 354
431 3300026041 Ga0207639_10138096 Ga0207639_101380962 354
432 3300026041 Ga0207639_10138862 Ga0207639_101388621 354
433 3300026075 Ga0207708_10045746 Ga0207708_100457461 354
434 3300026078 Ga0207702_10067898 Ga0207702_100678982 354
435 3300026088 Ga0207641_10000038 Ga0207641_10000038157 354
436 3300026088 Ga0207641_10010883 Ga0207641_100108834 354
437 3300026088 Ga0207641_10013810 Ga0207641_100138102 354
438 3300026088 Ga0207641_10072010 Ga0207641_100720103 354
439 3300026088 Ga0207641_10119402 Ga0207641_101194021 354
440 3300026088 Ga0207641_10289755 Ga0207641_102897552 354
441 3300026089 Ga0207648_10002605 Ga0207648_100026052 354
442 3300026089 Ga0207648_10010813 Ga0207648_100108134 354
443 3300026089 Ga0207648_10020336 Ga0207648_100203362 354
444 3300026089 Ga0207648_10040329 Ga0207648_100403294 354
445 3300026089 Ga0207648_10052734 Ga0207648_100527342 354
446 3300026089 Ga0207648_10068486 Ga0207648_100684862 354
447 3300026089 Ga0207648_10104514 Ga0207648_101045142 354
448 3300026089 Ga0207648_10263920 Ga0207648_102639201 354
449 3300026095 Ga0207676_10002713 Ga0207676_100027133 354
450 3300026095 Ga0207676_10009517 Ga0207676_100095176 354
451 3300026095 Ga0207676_10037153 Ga0207676_100371531 354
452 3300026095 Ga0207676_10088603 Ga0207676_100886032 354
453 3300026095 Ga0207676_10236217 Ga0207676_102362172 354
454 3300026095 Ga0207676_10361174 Ga0207676_103611741 354
455 3300026116 Ga0207674_10054739 Ga0207674_100547395 354
456 3300026116 Ga0207674_10082423 Ga0207674_100824232 354
457 3300026116 Ga0207674_10269078 Ga0207674_102690781 354
458 3300026118 Ga0207675_100008753 Ga0207675_1000087533 354
459 3300026118 Ga0207675_100017817 Ga0207675_1000178172 354
460 3300026118 Ga0207675_100043196 Ga0207675_1000431962 354
461 3300026118 Ga0207675_100047989 Ga0207675_1000479894 354
462 3300026118 Ga0207675_100086517 Ga0207675_1000865172 354
463 3300026121 Ga0207683_10027744 Ga0207683_100277442 354
464 3300026142 Ga0207698_10005625 Ga0207698_100056258 354
465 3300027907 Ga0207428_10178649 Ga0207428_101786491 354
466 3300028379 Ga0268266_10000049 Ga0268266_1000004918 354
467 3300028379 Ga0268266_10010154 Ga0268266_100101542 354
468 3300028380 Ga0268265_10014355 Ga0268265_100143554 354
469 3300028381 Ga0268264_10000313 Ga0268264_1000031327 354
470 3300028381 Ga0268264_10010078 Ga0268264_100100786 354
471 3300028381 Ga0268264_10011115 Ga0268264_100111157 354
472 3300028381 Ga0268264_10012858 Ga0268264_100128585 354
473 3300028786 Ga0307517_10002780 Ga0307517_1000278018 354
474 3300028786 Ga0307517_10095134 Ga0307517_100951342 354
475 3300028794 Ga0307515_10000072 Ga0307515_1000007299 354
476 3300031251 Ga0265327_10000168 Ga0265327_1000016869 354
477 3300031251 Ga0265327_10000196 Ga0265327_1000019639 354
478 3300031251 Ga0265327_10026564 Ga0265327_100265643 354
479 3300031456 Ga0307513_10267995 Ga0307513_102679952 354
480 3300031507 Ga0307509_10068086 Ga0307509_100680862 354
481 3300031616 Ga0307508_10003548 Ga0307508_100035489 354
482 3300031616 Ga0307508_10273194 Ga0307508_102731942 354
483 3300031730 Ga0307516_10000646 Ga0307516_1000064625 354
484 3300031852 Ga0307410_10199947 Ga0307410_101999472 354
485 3300031911 Ga0307412_10207918 Ga0307412_102079182 354
486 3300032002 Ga0307416_100203674 Ga0307416_1002036741 354
487 3300032004 Ga0307414_10095708 Ga0307414_100957081 354
488 3300032005 Ga0307411_10238352 Ga0307411_102383521 354
489 3300035086 Ga0373934_0031995 Ga0373934_0031995_117_1184 354
490 3300037312 Ga0395899_0186443 Ga0395899_0186443_104_1171 354
491 3300037418 Ga0395900_0007723 Ga0395900_0007723_2547_3614 354
492 3300037471 Ga0395905_0000494 Ga0395905_0000494_34852_35919 354
493 3300037471 Ga0395905_0167138 Ga0395905_0167138_385_1452 354
494 3300037471 Ga0395905_0284453 Ga0395905_0284453_195_1262 354
495 3300038443 Ga0395901_0298399 Ga0395901_0298399_115_1182 354
496 3300039437 Ga0436365_1600972 Ga0436365_1600972_68_1135 354
497 3300041404 Ga0439436_0004744 Ga0439436_0004744_287_1354 354
498 3300041404 Ga0439436_0029713 Ga0439436_0029713_106_1173 354
499 3300041406 Ga0439439_0018409 Ga0439439_0018409_159_1226 354
500 3300041410 Ga0439461_0015025 Ga0439461_0015025_343_1410 354
501 3300041512 Ga0451853_1566562 Ga0451853_1566562_544_1611 354
502 3300041997 Ga0439431_0019848 Ga0439431_0019848_313_1380 354
503 3300041999 Ga0439433_0014612 Ga0439433_0014612_235_1302 354
504 3300041999 Ga0439433_0038600 Ga0439433_0038600_23_1090 354
505 3300042001 Ga0439441_002190 Ga0439441_002190_1089_2156 354
506 3300042007 Ga0439449_0008488 Ga0439449_0008488_71_1138 354
507 3300042014 Ga0439457_001097 Ga0439457_001097_1224_2291 354
508 3300042125 Ga0450923_013374 Ga0450923_013374_251_1318 354
509 3300044658 Ga0466972_0000013 Ga0466972_0000013_107761_108828 354
510 3300044658 Ga0466972_0000020 Ga0466972_0000020_129052_130119 354
511 3300044658 Ga0466972_0003179 Ga0466972_0003179_6821_7888 354
512 3300044683 Ga0466965_0084842 Ga0466965_0084842_298_1365 354
513 3300044712 Ga0453684_0624768 Ga0453684_0624768_79_1146 354
514 3300044719 Ga0466971_0070216 Ga0466971_0070216_171_1238 354
515 3300044765 Ga0466970_0000491 Ga0466970_0000491_17746_18813 354
516 3300044765 Ga0466970_0093345 Ga0466970_0093345_504_1571 354
517 3300044765 Ga0466970_0104694 Ga0466970_0104694_194_1261 354
518 3300044842 Ga0466957_0000544 Ga0466957_0000544_15679_16746 354
519 3300044842 Ga0466957_0018826 Ga0466957_0018826_165_1232 354
520 3300045049 Ga0466959_0007926 Ga0466959_0007926_5031_6098 354
521 3300045836 Ga0466958_0044918 Ga0466958_0044918_190_1257 354
522 3300046459 Ga0495629_0037803 Ga0495629_0037803_689_1756 354
523 3300046460 Ga0495638_0071059 Ga0495638_0071059_999_2066 354
524 3300046471 Ga0495650_0076584 Ga0495650_0076584_218_1285 354
525 3300046472 Ga0495580_0119283 Ga0495580_0119283_718_1785 354
526 3300046499 Ga0495594_0077794 Ga0495594_0077794_286_1353 354
527 3300046507 Ga0495606_0005542 Ga0495606_0005542_5803_6870 354
528 3300046524 Ga0495648_0008867 Ga0495648_0008867_5720_6787 354
529 3300046537 Ga0495598_0009085 Ga0495598_0009085_17_1081 354
530 3300046558 Ga0495633_0046732 Ga0495633_0046732_401_1468 354
531 3300046616 Ga0495668_0007203 Ga0495668_0007203_2766_3833 354
532 3300046648 Ga0495611_0000204 Ga0495611_0000204_38333_39400 354
533 3300046648 Ga0495611_0008341 Ga0495611_0008341_3051_4118 354
534 3300046679 Ga0495623_0113437 Ga0495623_0113437_438_1505 354
535 3300046691 Ga0495670_0007145 Ga0495670_0007145_3580_4647 354
536 3300047443 Ga0495687_000001 Ga0495687_000001_412103_413170 354
537 3300047472 Ga0495686_0000004 Ga0495686_0000004_365857_366924 354
538 3300047472 Ga0495686_0004111 Ga0495686_0004111_440_1507 354
539 3300047472 Ga0495686_0035343 Ga0495686_0035343_2033_3100 354
540 3300047472 Ga0495686_0038920 Ga0495686_0038920_132_1199 354
541 3300048912 Ga0496109_0327402 Ga0496109_0327402_302_1369 354
542 3300048917 Ga0496114_0238737 Ga0496114_0238737_36_1103 354
543 3300048929 Ga0496126_0006314 Ga0496126_0006314_3057_4124 354
544 3300049568 Ga0501031_0014692 Ga0501031_0014692_3958_5025 354
545 3300049569 Ga0501032_0106121 Ga0501032_0106121_505_1572 354
546 3300049570 Ga0501033_0207150 Ga0501033_0207150_236_1303 354
547 3300049570 Ga0501033_0216202 Ga0501033_0216202_40_1107 354
548 3300049571 Ga0501034_0044922 Ga0501034_0044922_890_1957 354
549 3300049571 Ga0501034_0059472 Ga0501034_0059472_1334_2401 354
550 3300049571 Ga0501034_0074425 Ga0501034_0074425_953_2020 354
551 3300049572 Ga0501036_0132238 Ga0501036_0132238_989_2056 354
552 3300049573 Ga0501037_0243701 Ga0501037_0243701_15_1082 354
553 3300049574 Ga0501038_0024802 Ga0501038_0024802_3851_4918 354
554 3300049574 Ga0501038_0061904 Ga0501038_0061904_1382_2449 354
555 3300049579 Ga0501043_0311588 Ga0501043_0311588_55_1122 354
556 3300049580 Ga0501046_0046898 Ga0501046_0046898_875_1942 354
557 3300049581 Ga0501047_0247097 Ga0501047_0247097_59_1126 354
558 3300049581 Ga0501047_0250731 Ga0501047_0250731_515_1582 354
559 3300049583 Ga0501067_0110755 Ga0501067_0110755_70_1137 354
560 3300049584 Ga0501068_0063276 Ga0501068_0063276_911_1978 354
561 3300049589 Ga0501073_0033415 Ga0501073_0033415_775_1842 354
562 3300049650 Ga0501199_001464 Ga0501199_001464_997_2064 354
563 3300049652 Ga0501202_001117 Ga0501202_001117_153_1220 354
564 3300049661 Ga0501217_010862 Ga0501217_010862_837_1904 354
565 3300049661 Ga0501217_017971 Ga0501217_017971_22_1089 354
566 3300049663 Ga0501223_011844 Ga0501223_011844_366_1433 354
567 3300049663 Ga0501223_019433 Ga0501223_019433_80_1147 354
568 3300049669 Ga0501235_001439 Ga0501235_001439_552_1619 354
569 3300049675 Ga0501243_009183 Ga0501243_009183_232_1299 354
570 3300049686 Ga0501257_005896 Ga0501257_005896_76_1143 354
571 3300049688 Ga0501259_002355 Ga0501259_002355_1310_2377 354
572 3300049688 Ga0501259_003203 Ga0501259_003203_779_1846 354
573 3300049703 Ga0501219_000038 Ga0501219_000038_413_1480 354
574 3300049704 Ga0501221_000867 Ga0501221_000867_312_1379 354
575 3300049744 Ga0501083_0030624 Ga0501083_0030624_1675_2742 354
576 3300049758 Ga0501241_000198 Ga0501241_000198_3901_4968 354
577 3300049769 Ga0501272_004269 Ga0501272_004269_370_1437 354
578 3300049775 Ga0501279_009168 Ga0501279_009168_160_1227 354
579 3300049823 Ga0501044_0028431 Ga0501044_0028431_535_1602 354
580 3300049823 Ga0501044_0028857 Ga0501044_0028857_1259_2326 354
581 3300049823 Ga0501044_0100058 Ga0501044_0100058_179_1246 354
582 3300050005 Ga0501284_00021 Ga0501284_00021_83154_84221 354
583 3300050493 nmdc:mga0k408_134812_c1 nmdc:mga0k408_134812_c1_339_1406 354
584 3300050493 nmdc:mga0k408_29824_c1 nmdc:mga0k408_29824_c1_627_1694 354
585 3300050507 nmdc:mga05p37_3343_c1 nmdc:mga05p37_3343_c1_2168_3235 354
586 3300050508 nmdc:mga09592_29840_c1 nmdc:mga09592_29840_c1_1705_2772 354
587 3300050508 nmdc:mga09592_400339_c1 nmdc:mga09592_400339_c1_56_1123 354
588 3300050509 nmdc:mga0qj67_17217_c1 nmdc:mga0qj67_17217_c1_175_1242 354
589 3300050510 nmdc:mga06r32_162916_c1 nmdc:mga06r32_162916_c1_865_1932 354
590 3300050511 nmdc:mga08y16_137821_c1 nmdc:mga08y16_137821_c1_1453_2520 354
591 3300050511 nmdc:mga08y16_99592_c1 nmdc:mga08y16_99592_c1_1752_2819 354
592 3300053086 Ga0500578_0000155 Ga0500578_0000155_2047_3114 354
593 3300053092 Ga0500583_0000675 Ga0500583_0000675_4904_5971 354
594 3300053108 Ga0500562_000007 Ga0500562_000007_220154_221221 354
595 3300053136 Ga0500559_0025149 Ga0500559_0025149_411_1478 354
596 3300053139 Ga0500568_0000702 Ga0500568_0000702_12562_13629 354
597 3300053156 Ga0500622_0000575 Ga0500622_0000575_18641_19708 354
598 3300053156 Ga0500622_0001876 Ga0500622_0001876_12593_13660 354
599 3300053156 Ga0500622_0013673 Ga0500622_0013673_79_1152 354
600 3300053177 Ga0500636_0004180 Ga0500636_0004180_2949_4016 354
601 3300053727 Ga0500611_000011 Ga0500611_000011_66188_67255 354
602 3300053730 Ga0500645_011995 Ga0500645_011995_1022_2089 354
603 3300055283 Ga0500661_006149 Ga0500661_006149_588_1655 354
604 iso_pu_bacteria 2522125168 2522548262 354
605 iso_pu_bacteria 2910245624 2910249789 354
606 iso_pu_bacteria 2911138879 2911140558 354
607 3300005341 Ga0070691_10016494 Ga0070691_100164943 355
608 3300010375 Ga0105239_10002727 Ga0105239_1000272710 355
609 3300025917 Ga0207660_10053726 Ga0207660_100537262 355
610 3300028800 Ga0265338_10012873 Ga0265338_100128736 355
611 3300031250 Ga0265331_10006131 Ga0265331_100061314 355
612 3300031711 Ga0265314_10038479 Ga0265314_100384791 355
613 3300031728 Ga0316578_10061165 Ga0316578_100611652 355
614 3300032168 Ga0316593_10011558 Ga0316593_100115582 355
615 3300035116 Ga0373945_0042753 Ga0373945_0042753_224_1345 355
616 3300036712 Ga0316584_0000096 Ga0316584_0000096_18175_19251 355
617 3300042876 Ga0451577_0001493 Ga0451577_0001493_24933_26009 355
618 3300044673 Ga0453683_0000241 Ga0453683_0000241_63694_64770 355
619 3300044673 Ga0453683_0003448 Ga0453683_0003448_4981_6057 355
620 3300044684 Ga0466966_0000045 Ga0466966_0000045_47602_48672 355
621 3300044712 Ga0453684_0001358 Ga0453684_0001358_35651_36727 355
622 3300044712 Ga0453684_0004196 Ga0453684_0004196_24933_26009 355
623 3300044712 Ga0453684_0010057 Ga0453684_0010057_5023_6099 355
624 3300044712 Ga0453684_0166014 Ga0453684_0166014_334_1410 355
625 3300045049 Ga0466959_0000023 Ga0466959_0000023_53777_54847 355
626 3300045051 Ga0451576_0002107 Ga0451576_0002107_24933_26009 355
627 3300045051 Ga0451576_0020756 Ga0451576_0020756_5937_7013 355
628 3300046616 Ga0495668_0002414 Ga0495668_0002414_12183_13298 355
629 3300049580 Ga0501046_0242480 Ga0501046_0242480_126_1196 355
630 3300049581 Ga0501047_0031817 Ga0501047_0031817_1523_2593 355
631 3300049581 Ga0501047_0064834 Ga0501047_0064834_2309_3379 355
632 3300049823 Ga0501044_0007030 Ga0501044_0007030_5386_6456 355
633 3300053090 Ga0500646_0011376 Ga0500646_0011376_1032_2102 355
634 3300053092 Ga0500583_0000043 Ga0500583_0000043_71422_72492 355
635 3300053131 Ga0500652_032439 Ga0500652_032439_750_1820 355
636 3300053147 Ga0500589_004209 Ga0500589_004209_3653_4723 355
637 3300053163 Ga0500639_091952 Ga0500639_091952_78_1148 355
638 3300053727 Ga0500611_001356 Ga0500611_001356_663_1733 355
639 3300005563 Ga0068855_100002600 Ga0068855_1000026002 356
640 3300013296 Ga0157374_10000026 Ga0157374_10000026164 356
641 3300014969 Ga0157376_10003682 Ga0157376_100036823 356
642 3300025949 Ga0207667_10009580 Ga0207667_1000958010 356
643 3300029957 Ga0265324_10002213 Ga0265324_100022133 356
644 3300031239 Ga0265328_10001168 Ga0265328_100011684 356
645 3300031242 Ga0265329_10001743 Ga0265329_100017437 356
646 3300031251 Ga0265327_10000866 Ga0265327_100008661 356
647 3300031251 Ga0265327_10004598 Ga0265327_1000459813 356
648 3300031344 Ga0265316_10000478 Ga0265316_100004784 356
649 3300031344 Ga0265316_10007268 Ga0265316_100072687 356
650 3300031344 Ga0265316_10128142 Ga0265316_101281422 356
651 3300031712 Ga0265342_10095345 Ga0265342_100953451 356
652 3300031727 Ga0316576_10067243 Ga0316576_100672432 356
653 3300031728 Ga0316578_10003667 Ga0316578_100036674 356
654 3300031728 Ga0316578_10006133 Ga0316578_100061335 356
655 3300032139 Ga0316580_10013097 Ga0316580_100130971 356
656 3300032168 Ga0316593_10002062 Ga0316593_100020624 356
657 3300036712 Ga0316584_0088813 Ga0316584_0088813_79_1158 356
658 3300039062 Ga0400483_069014 Ga0400483_069014_7423_8502 356
659 3300039062 Ga0400483_078471 Ga0400483_078471_98_1177 356
660 3300039062 Ga0400483_174753 Ga0400483_174753_18215_19294 356
661 3300042876 Ga0451577_0023348 Ga0451577_0023348_632_1711 356
662 3300044673 Ga0453683_0001409 Ga0453683_0001409_39_1118 356
663 3300044712 Ga0453684_0010472 Ga0453684_0010472_5723_6802 356
664 3300044712 Ga0453684_0012355 Ga0453684_0012355_6474_7553 356
665 3300044712 Ga0453684_0025978 Ga0453684_0025978_1684_2763 356
666 3300044712 Ga0453684_0026693 Ga0453684_0026693_3638_4717 356
667 3300044712 Ga0453684_0121903 Ga0453684_0121903_943_2022 356
668 3300044712 Ga0453684_0160406 Ga0453684_0160406_579_1658 356
669 3300044712 Ga0453684_0222224 Ga0453684_0222224_876_1955 356
670 3300044712 Ga0453684_0241468 Ga0453684_0241468_879_1958 356
671 3300044712 Ga0453684_0423641 Ga0453684_0423641_70_1143 356
672 3300045051 Ga0451576_0005360 Ga0451576_0005360_6808_7887 356
673 3300049822 Ga0501035_0023072 Ga0501035_0023072_1412_2548 356
674 3300001991 JGI24743J22301_10000005 JGI24743J22301_100000059 357
675 3300002155 JGI24033J26618_1000119 JGI24033J26618_10001193 357
676 3300003320 rootH2_10009508 rootH2_100095086 357
677 3300003323 rootH1_10064317 rootH1_100643178 357
678 3300005262 Ga0065165_1000060 Ga0065165_1000060104 357
679 3300005289 Ga0065704_10115828 Ga0065704_101158282 357
680 3300005327 Ga0070658_10008866 Ga0070658_100088662 357
681 3300005344 Ga0070661_100001232 Ga0070661_1000012329 357
682 3300005347 Ga0070668_100336312 Ga0070668_1003363121 357
683 3300005354 Ga0070675_100160301 Ga0070675_1001603012 357
684 3300005366 Ga0070659_100041296 Ga0070659_1000412965 357
685 3300005614 Ga0068856_100000313 Ga0068856_1000003136 357
686 3300005615 Ga0070702_100080937 Ga0070702_1000809372 357
687 3300005719 Ga0068861_100061933 Ga0068861_1000619332 357
688 3300005842 Ga0068858_100225034 Ga0068858_1002250342 357
689 3300009094 Ga0111539_10330721 Ga0111539_103307212 357
690 3300009098 Ga0105245_10025045 Ga0105245_100250455 357
691 3300009101 Ga0105247_10002103 Ga0105247_100021033 357
692 3300009148 Ga0105243_10177594 Ga0105243_101775942 357
693 3300009148 Ga0105243_10213245 Ga0105243_102132451 357
694 3300009174 Ga0105241_10011399 Ga0105241_100113992 357
695 3300009545 Ga0105237_10088422 Ga0105237_100884223 357
696 3300009553 Ga0105249_10020079 Ga0105249_100200795 357
697 3300010375 Ga0105239_10026069 Ga0105239_100260692 357
698 3300013102 Ga0157371_10063215 Ga0157371_100632152 357
699 3300013102 Ga0157371_10087974 Ga0157371_100879743 357
700 3300013104 Ga0157370_10018014 Ga0157370_100180143 357
701 3300013104 Ga0157370_10233657 Ga0157370_102336572 357
702 3300013296 Ga0157374_10005000 Ga0157374_100050004 357
703 3300013297 Ga0157378_10001185 Ga0157378_1000118516 357
704 3300013306 Ga0163162_10011934 Ga0163162_100119345 357
705 3300013308 Ga0157375_10067247 Ga0157375_100672472 357
706 3300013308 Ga0157375_10069207 Ga0157375_100692074 357
707 3300014968 Ga0157379_10016583 Ga0157379_100165831 357
708 3300025292 Ga0209676_1000351 Ga0209676_100035138 357
709 3300025909 Ga0207705_10014193 Ga0207705_100141932 357
710 3300025920 Ga0207649_10000935 Ga0207649_1000093511 357
711 3300025926 Ga0207659_10132703 Ga0207659_101327032 357
712 3300025932 Ga0207690_10113536 Ga0207690_101135362 357
713 3300026035 Ga0207703_10003978 Ga0207703_100039782 357
714 3300026078 Ga0207702_10001517 Ga0207702_100015176 357
715 3300026118 Ga0207675_100018829 Ga0207675_1000188293 357
716 3300031548 Ga0307408_100000005 Ga0307408_100000005262 357
717 3300031727 Ga0316576_10004148 Ga0316576_100041484 357
718 3300031733 Ga0316577_10013408 Ga0316577_100134083 357
719 3300031901 Ga0307406_10000214 Ga0307406_1000021412 357
720 3300032137 Ga0316585_10013447 Ga0316585_100134472 357
721 3300035398 Ga0316574_0005453 Ga0316574_0005453_4873_5952 357
722 3300036647 Ga0316582_0003920 Ga0316582_0003920_3141_4220 357
723 3300036712 Ga0316584_0000480 Ga0316584_0000480_19226_20305 357
724 3300036712 Ga0316584_0089844 Ga0316584_0089844_665_1741 357
725 3300036712 Ga0316584_0122322 Ga0316584_0122322_635_1714 357
726 3300037312 Ga0395899_0000022 Ga0395899_0000022_315541_316614 357
727 3300037466 Ga0395898_0000012 Ga0395898_0000012_262544_263617 357
728 3300038742 Ga0400486_17517 Ga0400486_17517_2003_3082 357
729 3300042876 Ga0451577_0010455 Ga0451577_0010455_6193_7269 357
730 3300044683 Ga0466965_0001828 Ga0466965_0001828_6661_7734 357
731 3300044712 Ga0453684_0039498 Ga0453684_0039498_3738_4814 357
732 3300044719 Ga0466971_0000591 Ga0466971_0000591_4137_5210 357
733 3300044842 Ga0466957_0003789 Ga0466957_0003789_3594_4667 357
734 3300045976 Ga0466967_0024602 Ga0466967_0024602_170_1243 357
735 3300046522 Ga0495643_0000815 Ga0495643_0000815_17952_19028 357
736 3300048928 Ga0496125_0000017 Ga0496125_0000017_367052_368128 357
737 3300049568 Ga0501031_0001670 Ga0501031_0001670_7199_8272 357
738 3300049569 Ga0501032_0000245 Ga0501032_0000245_26016_27089 357
739 3300049569 Ga0501032_0099433 Ga0501032_0099433_91_1164 357
740 3300049570 Ga0501033_0000002 Ga0501033_0000002_38715_39788 357
741 3300049570 Ga0501033_0000049 Ga0501033_0000049_57650_58723 357
742 3300049573 Ga0501037_0000459 Ga0501037_0000459_16291_17364 357
743 3300049574 Ga0501038_0000020 Ga0501038_0000020_107717_108793 357
744 3300049575 Ga0501039_0007009 Ga0501039_0007009_1339_2412 357
745 3300049579 Ga0501043_0003640 Ga0501043_0003640_5854_6927 357
746 3300049579 Ga0501043_0010076 Ga0501043_0010076_5358_6431 357
747 3300049581 Ga0501047_0010102 Ga0501047_0010102_4202_5275 357
748 3300049585 Ga0501069_0196604 Ga0501069_0196604_20_1093 357
749 3300049586 Ga0501070_0008406 Ga0501070_0008406_131_1204 357
750 3300049586 Ga0501070_0044040 Ga0501070_0044040_1179_2252 357
751 3300049822 Ga0501035_0000001 Ga0501035_0000001_217925_218998 357
752 3300049823 Ga0501044_0035810 Ga0501044_0035810_2054_3127 357
753 3300059510 Ga0587090_011249 Ga0587090_011249_63_1142 357
754 3300061719 Ga0466962_0000091 Ga0466962_0000091_3838_4911 357

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01116

F_bP_aldolase

Fructose-bisphosphate aldolase class-II

12

343

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gk7-assembly1.cif.gz_B structure of e.coli fructose 1,6-bisphosphate aldolase bound to tris 0.9747 5 357
5gk4-assembly1.cif.gz_A native structure of fructose 1,6-bisphosphate aldolase from escherichia coli at 2.0 angstrom resolution 0.9747 5 357
5gk4-assembly1.cif.gz_B native structure of fructose 1,6-bisphosphate aldolase from escherichia coli at 2.0 angstrom resolution 0.9737 7 357
5gk5-assembly2.cif.gz_D apo structure of fructose 1,6-bisphosphate aldolase from escherichia coli at 1.9 angstrom resolution 0.9734 7 357
5gk8-assembly1.cif.gz_A structure of e.coli fructose 1,6-bisphosphate aldolase, acetate bound form 0.9731 7 357
ID Description Score Start End Superfamily
af_P14540_5_359_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9622 5 353 3.20.20.70
af_P14540_5_359_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9436 5 353 3.20.20.70
1dosA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9321 7 357 3.20.20.70
4a22A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9186 14 356 3.20.20.70
1dosA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9142 7 357 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A182S9Y6-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9916 7 174 GO:0004332
GO:0005829
GO:0006094
GO:0006096
GO:0008270
AF-A0A7Y7CJ11-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) (Fructose-1,6-bisphosphate aldolase) 0.9892 5 122 GO:0004332
GO:0005829
GO:0006094
GO:0006096
GO:0008270
AF-A0A4V1ULU9-F1-model_v4 deleted 0.9872 5 179
AF-A0A7R9U1S8-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9864 7 163 GO:0004332
GO:0005829
GO:0006094
GO:0006096
GO:0008270
AF-A0A7S2XVF8-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9863 6 139 GO:0004332
GO:0005829
GO:0006094
GO:0006096
GO:0008270

Feature Viewer

pLDDT pTM Quality
90.3 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map