F479197

General Info

Members Datasets Scaffolds Average Seq Length
753 413 720 364

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100018167|Ga0068852_1000181675
Length 428
Sequence MADPVIGAHRPSLGTIRGPPARTLRGGFCSFFLPQDTCRGPSWSWGGPTLFHWEIPGIMSDLSITLEALERTRSQLSVNAYFDEDLFRREMELIYQHGPRYLGHELSVPEVGDYHALLQEGEGRALVRTPTGIELISNVCRHRQAVMLRGRGNTRSNIVCPLHRWTYDLKGELLGAPHFAEDPCLNLNRYKTRTWNGMVFEDNGRDIAADLASLGPRADLDFSGYVLDKVQAHECNYNWKTFIEVYLEDYHVGPFHPGLGQFVTCDDLRWEFAPNFSVQTVGANNALAKAGSDIYRKWHDAVLAFRGGEPPKQGAIWLTYYPNIMVEWXXXXLVVSTLHPKGPQKTINVVEFYYPEEIAAFEPEFMQAQQAAYWETCEEDDEIALRMDAGRKALMERGDDEAGPYQSPMEDGMQQFHEWYRKVMKPRG

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
3 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
4 2547132512 Azospira oryzae 6a3 Isolate Unclassified
5 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
6 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
7 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
8 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
9 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
10 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
11 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
12 2643221585 Pelomonas sp. Root662 Isolate Unclassified
13 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
14 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
15 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
16 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
17 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
18 2643221656 Pelomonas sp. Root405 Isolate Unclassified
19 2738541337 Pelomonas sp. BT06 Isolate Unclassified
20 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
21 2831864461 Roseateles noduli HZ7 Isolate Nodule
22 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
23 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
24 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
25 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
26 2885266251 Ralstonia sp. SET104 Isolate Nodule
27 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
28 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
29 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
30 2928058823 Ralstonia sp. 1138 Isolate Unclassified
31 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
32 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
33 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
34 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
35 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
36 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
37 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
38 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
39 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
40 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
41 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
42 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
43 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
44 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
45 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
46 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
47 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
48 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
49 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
50 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
51 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
52 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
53 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
56 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
57 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
58 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
59 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
62 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
63 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
64 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
65 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
66 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
67 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
68 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
69 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
70 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
71 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
72 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
73 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
74 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
75 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
76 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
77 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
78 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
79 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
80 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
81 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
82 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
83 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
84 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
85 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
86 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
87 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
88 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
89 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
90 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
91 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
92 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
93 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
94 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
95 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
96 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
97 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
98 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
99 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
100 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
101 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
102 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
103 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
104 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
105 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
106 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
107 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
108 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
109 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
110 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
111 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
112 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
113 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
114 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
115 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
116 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
117 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
118 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
119 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
120 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
124 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
125 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
126 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
127 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
128 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
129 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
131 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
139 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
145 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
146 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
147 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
148 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
149 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
154 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
155 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
161 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
164 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
171 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
173 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
174 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
177 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
178 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
186 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
233 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
241 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
245 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
246 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
247 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
248 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
249 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
250 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
251 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
252 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
253 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
254 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
255 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
256 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
257 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
258 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
259 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
260 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
261 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
262 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
263 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
264 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
265 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
266 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
267 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
268 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
269 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
270 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
271 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
272 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
273 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
274 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
275 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
276 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
277 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
279 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
280 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
281 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
282 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
283 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
284 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
285 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
286 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
287 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
288 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
289 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
290 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
291 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
292 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
293 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
294 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
295 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
296 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
297 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
298 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
299 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
300 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
301 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
302 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
303 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
304 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
305 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
306 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
307 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
308 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
309 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
310 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
311 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
312 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
313 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
314 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
315 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
316 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
317 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
318 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
319 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
320 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
321 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
322 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
323 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
324 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
325 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
326 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
327 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
328 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
329 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
330 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
331 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
332 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
333 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
334 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
335 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
336 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
337 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
338 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
339 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
340 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
341 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
342 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
343 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
344 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
345 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
346 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
347 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
348 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
351 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
352 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
353 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
354 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
355 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
356 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
357 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
358 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
359 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
360 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
361 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
362 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
363 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
364 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
365 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
374 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
375 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
376 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
379 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
380 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
383 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
384 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
385 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
386 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
388 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
389 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
390 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
391 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
392 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
393 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
394 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
395 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
396 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
397 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
398 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
399 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
400 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
401 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
402 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
403 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
404 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
405 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
406 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
407 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
408 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
409 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
412 639633007 Azoarcus olearius BH72 Isolate Unclassified
413 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.82
Metatranscriptomes 0.8
Isolates 4.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17
Nodule 0.93
Rhizoplane 1.2
Rhizosphere 73.04
Stem 0
Stem Tuber 0
Unclassified 7.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000340 3300001979 Bacteria 19873
2 JGI24740J21852_10020003 3300001979 Bacteria 2347
3 JGI24743J22301_10006182 3300001991 Bacteria 2030
4 JGI25156J39149_1000220 3300002705 Bacteria 39809
5 JGI25156J39149_1006463 3300002705 Bacteria 3199
6 JGI25156J39149_1013422 3300002705 Bacteria 1738
7 JGI25154J39366_1000669 3300002738 Bacteria 15992
8 JGI25154J39366_1001211 3300002738 Bacteria 9778
9 JGI25157J39369_1000135 3300002741 Bacteria 61510
10 JGI25152J39213_1003301 3300002773 Bacteria 5572
11 JGI25150J39212_1007478 3300002774 Bacteria 2190
12 JGI25151J46595_10000728 3300003187 Bacteria 27382
13 JGI25151J46595_10003136 3300003187 Bacteria 9294
14 JGI25151J46595_10004206 3300003187 Bacteria 7665
15 JGI25151J46595_10018212 3300003187 Bacteria 3025
16 rootH2_10005083 3300003320 Bacteria 8026
17 Ga0055538_1000084 3300003751 Bacteria 81835
18 Ga0055538_1005996 3300003751 Bacteria 1211
19 Ga0055538_1005999 3300003751 Bacteria 1211
20 Ga0055539_1000068 3300003752 Bacteria 134912
21 Ga0055539_1000125 3300003752 Bacteria 81835
22 Ga0055533_1000132 3300003756 Bacteria 81835
23 Ga0055533_1000172 3300003756 Bacteria 58634
24 Ga0055533_1000361 3300003756 Bacteria 19156
25 Ga0055533_1004790 3300003756 Bacteria 2336
26 Ga0055532_1000028 3300003758 Bacteria 234512
27 Ga0055525_1000171 3300003759 Bacteria 81835
28 Ga0055525_1000598 3300003759 Bacteria 15433
29 Ga0055525_1000665 3300003759 Bacteria 13242
30 Ga0055527_1003277 3300003760 Bacteria 2453
31 Ga0055535_1000022 3300003761 Bacteria 234512
32 Ga0055535_1000641 3300003761 Bacteria 27812
33 Ga0055542_1001981 3300003762 Bacteria 7929
34 Ga0055529_1000063 3300003763 Bacteria 181573
35 Ga0055529_1000145 3300003763 Bacteria 101255
36 Ga0055529_1000602 3300003763 Bacteria 27804
37 Ga0055526_1001897 3300003771 Bacteria 14503
38 Ga0055526_1011980 3300003771 Bacteria 3836
39 Ga0055526_1019952 3300003771 Bacteria 2413
40 Ga0055526_1033905 3300003771 Bacteria 1406
41 Ga0055524_1000125 3300003775 Bacteria 90042
42 Ga0055524_1000290 3300003775 Bacteria 48740
43 Ga0055524_1009546 3300003775 Bacteria 3934
44 Ga0055536_1000074 3300003781 Bacteria 84660
45 Ga0055534_1002013 3300003784 Bacteria 7393
46 Ga0055534_1003067 3300003784 Bacteria 5455
47 Ga0055530_10006753 3300003791 Bacteria 5012
48 Ga0055540_1000011 3300003792 Bacteria 282927
49 Ga0055540_1009175 3300003792 Bacteria 3456
50 Ga0055541_1000083 3300003841 Bacteria 81835
51 Ga0055541_1002647 3300003841 Bacteria 3512
52 Ga0055543_1002628 3300004625 Bacteria 5792
53 Ga0065165_1000153 3300005262 Bacteria 120209
54 Ga0065165_1000569 3300005262 Bacteria 54781
55 Ga0065165_1000967 3300005262 Bacteria 36011
56 Ga0065712_10024488 3300005290 Bacteria 1476
57 Ga0065712_10078545 3300005290 Bacteria 3332
58 Ga0070658_10006078 3300005327 Bacteria 9790
59 Ga0070658_10014263 3300005327 Bacteria 6376
60 Ga0070658_10051266 3300005327 Bacteria 3344
61 Ga0070676_10001034 3300005328 Bacteria 13850
62 Ga0070676_10059807 3300005328 Bacteria 2261
63 Ga0070690_100027241 3300005330 Bacteria 3532
64 Ga0070690_100047414 3300005330 Bacteria 2734
65 Ga0070690_100050076 3300005330 Bacteria 2665
66 Ga0070670_100012213 3300005331 Bacteria 7346
67 Ga0068869_100005217 3300005334 Bacteria 8157
68 Ga0070666_10076811 3300005335 Bacteria 2279
69 Ga0070680_100181391 3300005336 Bacteria 1773
70 Ga0068868_100262068 3300005338 Bacteria 1458
71 Ga0070660_100055514 3300005339 Bacteria 3061
72 Ga0070660_100067859 3300005339 Bacteria 2779
73 Ga0070689_100115781 3300005340 Bacteria 2137
74 Ga0070689_100177005 3300005340 Bacteria 1731
75 Ga0070661_100000127 3300005344 Bacteria 63148
76 Ga0070661_100001108 3300005344 Bacteria 18946
77 Ga0070661_100016464 3300005344 Bacteria 5227
78 Ga0070661_100150359 3300005344 Bacteria 1760
79 Ga0070692_10147313 3300005345 Bacteria 1338
80 Ga0070669_100002753 3300005353 Bacteria 12687
81 Ga0070669_100163053 3300005353 Bacteria 1734
82 Ga0070669_100267501 3300005353 Bacteria 1366
83 Ga0070675_100011301 3300005354 Bacteria 6987
84 Ga0070675_100193237 3300005354 Bacteria 1764
85 Ga0070675_100206976 3300005354 Bacteria 1704
86 Ga0070675_100428258 3300005354 Bacteria 1184
87 Ga0070671_100005776 3300005355 Bacteria 9855
88 Ga0070671_100006504 3300005355 Bacteria 9343
89 Ga0070671_100049616 3300005355 Bacteria 3492
90 Ga0070671_100123151 3300005355 Bacteria 2183
91 Ga0070674_100037117 3300005356 Bacteria 3275
92 Ga0070674_100118645 3300005356 Bacteria 1955
93 Ga0070674_100121168 3300005356 Bacteria 1937
94 Ga0070673_100011122 3300005364 Bacteria 6135
95 Ga0070673_100103091 3300005364 Bacteria 2353
96 Ga0070688_100075300 3300005365 Bacteria 2169
97 Ga0070659_100001014 3300005366 Bacteria 20566
98 Ga0070659_100066418 3300005366 Bacteria 2858
99 Ga0070667_100222985 3300005367 Bacteria 1679
100 Ga0070714_100050194 3300005435 Bacteria 3553
101 Ga0070713_100087771 3300005436 Bacteria 2668
102 Ga0070701_10033350 3300005438 Bacteria 2572
103 Ga0070705_100037898 3300005440 Bacteria 2723
104 Ga0070705_100195030 3300005440 Bacteria 1384
105 Ga0070700_100092176 3300005441 Bacteria 1979
106 Ga0070694_100066092 3300005444 Bacteria 2480
107 Ga0070663_100000005 3300005455 Bacteria 251758
108 Ga0070663_100001510 3300005455 Bacteria 12793
109 Ga0070678_100062876 3300005456 Bacteria 2743
110 Ga0070662_100004421 3300005457 Bacteria 8886
111 Ga0070681_10006660 3300005458 Bacteria 11245
112 Ga0068867_100000249 3300005459 Bacteria 35572
113 Ga0068867_100005126 3300005459 Bacteria 9258
114 Ga0068867_100028944 3300005459 Bacteria 3989
115 Ga0070685_10038814 3300005466 Bacteria 2702
116 Ga0070698_100024331 3300005471 Bacteria 6319
117 Ga0070698_100301761 3300005471 Bacteria 1532
118 Ga0070679_100010085 3300005530 Bacteria 8952
119 Ga0070679_100015526 3300005530 Bacteria 7317
120 Ga0070684_100027216 3300005535 Bacteria 4824
121 Ga0068853_100074850 3300005539 Bacteria 2955
122 Ga0070672_100000520 3300005543 Bacteria 22520
123 Ga0070672_100026519 3300005543 Bacteria 4313
124 Ga0070672_100028153 3300005543 Bacteria 4199
125 Ga0070696_100033303 3300005546 Bacteria 3539
126 Ga0070693_100110608 3300005547 Bacteria 1689
127 Ga0070704_100010535 3300005549 Bacteria 5628
128 Ga0068855_100002213 3300005563 Bacteria 24061
129 Ga0068855_100017466 3300005563 Bacteria 8629
130 Ga0068855_100030309 3300005563 Bacteria 6471
131 Ga0068855_100043110 3300005563 Bacteria 5346
132 Ga0068855_100048452 3300005563 Bacteria 5014
133 Ga0068855_100165615 3300005563 Bacteria 2506
134 Ga0070664_100000001 3300005564 Bacteria 551832
135 Ga0070664_100006317 3300005564 Bacteria 9561
136 Ga0070664_100058075 3300005564 Bacteria 3290
137 Ga0068857_100019209 3300005577 Bacteria 5999
138 Ga0068854_100000360 3300005578 Bacteria 29154
139 Ga0068854_100050767 3300005578 Bacteria 2969
140 Ga0068854_100128870 3300005578 Bacteria 1930
141 Ga0068856_100000008 3300005614 Bacteria 190886
142 Ga0068856_100017028 3300005614 Bacteria 7044
143 Ga0068856_100026163 3300005614 Bacteria 5690
144 Ga0068852_100001134 3300005616 Bacteria 17618
145 Ga0068852_100018167 3300005616 Bacteria 5536
146 Ga0068852_100019290 3300005616 Bacteria 5394
147 Ga0068852_100030609 3300005616 Bacteria 4433
148 Ga0068852_100065922 3300005616 Bacteria 3161
149 Ga0068852_100224064 3300005616 Bacteria 1789
150 Ga0068859_100033628 3300005617 Bacteria 5149
151 Ga0068859_100043018 3300005617 Bacteria 4539
152 Ga0068859_100321316 3300005617 Bacteria 1642
153 Ga0068859_100335794 3300005617 Bacteria 1605
154 Ga0068864_100017643 3300005618 Bacteria 5951
155 Ga0068864_100039034 3300005618 Bacteria 4057
156 Ga0068861_100067562 3300005719 Bacteria 2759
157 Ga0068861_100155522 3300005719 Bacteria 1880
158 Ga0068851_10003401 3300005834 Bacteria 7083
159 Ga0068863_100007733 3300005841 Bacteria 10512
160 Ga0068863_100058519 3300005841 Bacteria 3646
161 Ga0068863_100087822 3300005841 Bacteria 2946
162 Ga0068863_100250424 3300005841 Bacteria 1711
163 Ga0068858_100056576 3300005842 Bacteria 3624
164 Ga0068858_100083388 3300005842 Bacteria 2972
165 Ga0068858_100129462 3300005842 Bacteria 2365
166 Ga0068860_100006790 3300005843 Bacteria 11470
167 Ga0068860_100062070 3300005843 Bacteria 3551
168 Ga0068862_100045535 3300005844 Bacteria 3744
169 Ga0068862_100084626 3300005844 Bacteria 2755
170 Ga0075364_10067106 3300006051 Bacteria 2358
171 Ga0075432_10025280 3300006058 Bacteria 2037
172 Ga0075362_10005489 3300006177 Bacteria 4646
173 Ga0075367_10006872 3300006178 Bacteria 5789
174 Ga0075369_10006951 3300006186 Bacteria 4297
175 Ga0075366_10007379 3300006195 Bacteria 6069
176 Ga0075366_10061476 3300006195 Bacteria 2232
177 Ga0075366_10071927 3300006195 Bacteria 2061
178 Ga0075366_10102119 3300006195 Bacteria 1721
179 Ga0097621_100051122 3300006237 Bacteria 3362
180 Ga0075370_10004055 3300006353 Bacteria 7042
181 Ga0075370_10005449 3300006353 Bacteria 6331
182 Ga0075370_10137032 3300006353 Bacteria 1430
183 Ga0068871_100009363 3300006358 Bacteria 7092
184 Ga0068871_100015078 3300006358 Bacteria 5776
185 Ga0068871_100183974 3300006358 Bacteria 1797
186 Ga0075428_100045170 3300006844 Bacteria 4841
187 Ga0075431_100052358 3300006847 Bacteria 4209
188 Ga0075433_10186500 3300006852 Bacteria 1845
189 Ga0075433_10266638 3300006852 Bacteria 1518
190 Ga0075429_100000146 3300006880 Bacteria 43486
191 Ga0075429_100047747 3300006880 Bacteria 3724
192 Ga0068865_100029750 3300006881 Bacteria 3628
193 Ga0068865_100054946 3300006881 Bacteria 2770
194 Ga0075436_100072343 3300006914 Bacteria 2386
195 Ga0097620_100033628 3300006931 Bacteria 5149
196 Ga0097620_100043018 3300006931 Bacteria 4539
197 Ga0097620_100321360 3300006931 Bacteria 1642
198 Ga0097620_100335794 3300006931 Bacteria 1605
199 Ga0099826_10000015 3300006948 Bacteria 254837
200 Ga0075435_100307001 3300007076 Bacteria 1357
201 Ga0105240_10006302 3300009093 Bacteria 17457
202 Ga0105240_10103453 3300009093 Bacteria 3460
203 Ga0105240_10142898 3300009093 Bacteria 2859
204 Ga0111539_10001478 3300009094 Bacteria 31398
205 Ga0111539_10077596 3300009094 Bacteria 3909
206 Ga0105245_10101426 3300009098 Bacteria 2664
207 Ga0105245_10181528 3300009098 Bacteria 2011
208 Ga0114129_10011675 3300009147 Bacteria 12502
209 Ga0114129_10025565 3300009147 Bacteria 8366
210 Ga0114129_10597416 3300009147 Bacteria 1430
211 Ga0105243_10002157 3300009148 Bacteria 16630
212 Ga0105241_10008816 3300009174 Bacteria 7411
213 Ga0105241_10097593 3300009174 Bacteria 2330
214 Ga0105241_10267668 3300009174 Bacteria 1455
215 Ga0105242_10013549 3300009176 Bacteria 6308
216 Ga0105248_10001017 3300009177 Bacteria 30997
217 Ga0105248_10016620 3300009177 Bacteria 8101
218 Ga0105248_10048319 3300009177 Bacteria 4773
219 Ga0105248_10063274 3300009177 Bacteria 4153
220 Ga0105248_10116598 3300009177 Bacteria 3012
221 Ga0105237_10105532 3300009545 Bacteria 2809
222 Ga0105237_10208066 3300009545 Bacteria 1957
223 Ga0105238_10028556 3300009551 Bacteria 5683
224 Ga0105238_10037056 3300009551 Bacteria 4959
225 Ga0105238_10072034 3300009551 Bacteria 3453
226 Ga0105249_10053995 3300009553 Bacteria 3673
227 Ga0105239_10056778 3300010375 Bacteria 4294
228 Ga0157373_10000732 3300013100 Bacteria 25563
229 Ga0157373_10004520 3300013100 Bacteria 10460
230 Ga0157371_10000035 3300013102 Bacteria 223396
231 Ga0157370_10000021 3300013104 Bacteria 166168
232 Ga0157370_10001810 3300013104 Bacteria 26364
233 Ga0157370_10209105 3300013104 Bacteria 1809
234 Ga0157369_10008405 3300013105 Bacteria 11835
235 Ga0157374_10018896 3300013296 Bacteria 6093
236 Ga0157374_10076605 3300013296 Bacteria 3163
237 Ga0157378_10009642 3300013297 Bacteria 8406
238 Ga0157378_10017857 3300013297 Bacteria 6227
239 Ga0157378_10066292 3300013297 Bacteria 3234
240 Ga0157378_10087737 3300013297 Bacteria 2822
241 Ga0163162_10164616 3300013306 Bacteria 2341
242 Ga0163162_10256805 3300013306 Bacteria 1879
243 Ga0163162_10266275 3300013306 Bacteria 1845
244 Ga0157372_10000331 3300013307 Bacteria 51927
245 Ga0157372_10023625 3300013307 Bacteria 6669
246 Ga0157372_10032119 3300013307 Bacteria 5754
247 Ga0157372_10042431 3300013307 Bacteria 5032
248 Ga0157372_10341950 3300013307 Bacteria 1743
249 Ga0157375_10046145 3300013308 Bacteria 4246
250 Ga0157375_10166888 3300013308 Bacteria 2347
251 Ga0157375_10278942 3300013308 Bacteria 1834
252 Ga0163163_10186391 3300014325 Bacteria 2123
253 Ga0157380_10018320 3300014326 Bacteria 5196
254 Ga0157377_10000016 3300014745 Bacteria 190613
255 Ga0157377_10005227 3300014745 Bacteria 6078
256 Ga0157377_10098814 3300014745 Bacteria 1735
257 Ga0157379_10014692 3300014968 Bacteria 6868
258 Ga0157379_10205024 3300014968 Bacteria 1784
259 Ga0182006_1000956 3300015261 Bacteria 19183
260 Ga0163161_10008757 3300017792 Bacteria 6994
261 Ga0163161_10063937 3300017792 Bacteria 2683
262 Ga0163161_10069050 3300017792 Bacteria 2583
263 Ga0197907_10277493 3300020069 Bacteria 1351
264 Ga0206355_1056333 3300020076 Bacteria 1498
265 Ga0206351_10481241 3300020077 Bacteria 1552
266 Ga0154015_1042038 3300020610 Bacteria 50222
267 Ga0213872_10000049 3300021361 Bacteria 109094
268 Ga0213872_10001888 3300021361 Bacteria 12908
269 Ga0213872_10002133 3300021361 Bacteria 11880
270 Ga0213872_10002209 3300021361 Bacteria 11652
271 Ga0213872_10007035 3300021361 Bacteria 5574
272 Ga0213872_10012868 3300021361 Bacteria 3925
273 Ga0213872_10020466 3300021361 Bacteria 3050
274 Ga0213872_10030117 3300021361 Bacteria 2488
275 Ga0209784_100009 3300025224 Bacteria 688031
276 Ga0209784_100014 3300025224 Bacteria 496182
277 Ga0209784_100505 3300025224 Bacteria 15204
278 Ga0209566_100007 3300025225 Bacteria 688031
279 Ga0209566_100011 3300025225 Bacteria 496182
280 Ga0209566_100447 3300025225 Bacteria 30429
281 Ga0209674_100018 3300025226 Bacteria 688031
282 Ga0209674_100032 3300025226 Bacteria 426888
283 Ga0209674_100088 3300025226 Bacteria 181554
284 Ga0209674_100131 3300025226 Bacteria 118079
285 Ga0209672_100217 3300025228 Bacteria 44942
286 Ga0209147_100002 3300025229 Bacteria 2158988
287 Ga0209563_100020 3300025230 Bacteria 688031
288 Ga0209563_100029 3300025230 Bacteria 496182
289 Ga0209563_100160 3300025230 Bacteria 58893
290 Ga0207427_100296 3300025231 Bacteria 34920
291 Ga0209258_100002 3300025242 Bacteria 2158988
292 Ga0209258_100630 3300025242 Bacteria 27864
293 Ga0209258_100869 3300025242 Bacteria 16009
294 Ga0209646_1000058 3300025246 Bacteria 259999
295 Ga0209646_1000214 3300025246 Bacteria 64093
296 Ga0209026_1000059 3300025250 Bacteria 226652
297 Ga0209677_100010 3300025253 Bacteria 688031
298 Ga0209677_100042 3300025253 Bacteria 225037
299 Ga0209677_100162 3300025253 Bacteria 58923
300 Ga0209677_100226 3300025253 Bacteria 40136
301 Ga0209677_104848 3300025253 Bacteria 3708
302 Ga0209148_1000043 3300025254 Bacteria 461531
303 Ga0209148_1003153 3300025254 Bacteria 4761
304 Ga0209759_1000365 3300025256 Bacteria 56836
305 Ga0209759_1001265 3300025256 Bacteria 15220
306 Ga0209759_1002367 3300025256 Bacteria 8390
307 Ga0209759_1002799 3300025256 Bacteria 7368
308 Ga0209759_1009015 3300025256 Bacteria 3058
309 Ga0209129_1000027 3300025258 Bacteria 409587
310 Ga0209565_1000329 3300025263 Bacteria 42233
311 Ga0209565_1002450 3300025263 Bacteria 6683
312 Ga0209455_1000009 3300025272 Bacteria 1042273
313 Ga0209455_1000508 3300025272 Bacteria 27836
314 Ga0209673_1015229 3300025273 Bacteria 2933
315 Ga0209675_1000070 3300025291 Bacteria 169161
316 Ga0209675_1000644 3300025291 Bacteria 24798
317 Ga0209675_1017519 3300025291 Bacteria 2043
318 Ga0209676_1000012 3300025292 Bacteria 841431
319 Ga0209025_1001428 3300025294 Bacteria 31518
320 Ga0209025_1004660 3300025294 Bacteria 11725
321 Ga0209025_1006958 3300025294 Bacteria 8594
322 Ga0209564_1000139 3300025295 Bacteria 180328
323 Ga0209564_1000359 3300025295 Bacteria 84631
324 Ga0209564_1001697 3300025295 Bacteria 20841
325 Ga0209564_1002980 3300025295 Bacteria 12164
326 Ga0209758_1000052 3300025297 Bacteria 338962
327 Ga0209758_1000146 3300025297 Bacteria 169246
328 Ga0209050_1000532 3300025298 Bacteria 63063
329 Ga0209256_1000059 3300025299 Bacteria 272170
330 Ga0209256_1000113 3300025299 Bacteria 175296
331 Ga0209256_1000149 3300025299 Bacteria 146390
332 Ga0209256_1024458 3300025299 Bacteria 1778
333 Ga0209051_1000020 3300025303 Bacteria 508628
334 Ga0209051_1005529 3300025303 Bacteria 7365
335 Ga0209051_1006172 3300025303 Bacteria 6805
336 Ga0209051_1011536 3300025303 Bacteria 4355
337 Ga0209257_1000085 3300025304 Bacteria 291117
338 Ga0207697_10029588 3300025315 Bacteria 2241
339 Ga0207680_10033476 3300025903 Bacteria 2932
340 Ga0207645_10085798 3300025907 Bacteria 2022
341 Ga0207705_10002838 3300025909 Bacteria 13260
342 Ga0207705_10039414 3300025909 Bacteria 3386
343 Ga0207705_10047019 3300025909 Bacteria 3102
344 Ga0207654_10038347 3300025911 Bacteria 2688
345 Ga0207654_10191464 3300025911 Bacteria 1341
346 Ga0207707_10056099 3300025912 Bacteria 3426
347 Ga0207695_10002489 3300025913 Bacteria 27124
348 Ga0207695_10003096 3300025913 Bacteria 23815
349 Ga0207695_10008251 3300025913 Bacteria 13072
350 Ga0207695_10223213 3300025913 Bacteria 1791
351 Ga0207671_10212660 3300025914 Bacteria 1513
352 Ga0207663_10031320 3300025916 Bacteria 3147
353 Ga0207662_10044662 3300025918 Bacteria 2616
354 Ga0207662_10078268 3300025918 Bacteria 2012
355 Ga0207662_10257904 3300025918 Bacteria 1147
356 Ga0207657_10038876 3300025919 Bacteria 4231
357 Ga0207657_10055107 3300025919 Bacteria 3436
358 Ga0207649_10000169 3300025920 Bacteria 53440
359 Ga0207649_10000951 3300025920 Bacteria 18067
360 Ga0207652_10003246 3300025921 Bacteria 13489
361 Ga0207652_10033593 3300025921 Bacteria 4320
362 Ga0207652_10277405 3300025921 Bacteria 1512
363 Ga0207681_10008325 3300025923 Bacteria 6342
364 Ga0207681_10045573 3300025923 Bacteria 2945
365 Ga0207694_10012151 3300025924 Bacteria 6493
366 Ga0207694_10050348 3300025924 Bacteria 3225
367 Ga0207650_10000265 3300025925 Bacteria 55786
368 Ga0207650_10008031 3300025925 Bacteria 7192
369 Ga0207659_10000148 3300025926 Bacteria 41151
370 Ga0207659_10202800 3300025926 Bacteria 1585
371 Ga0207644_10003662 3300025931 Bacteria 9961
372 Ga0207644_10012407 3300025931 Bacteria 5659
373 Ga0207644_10268193 3300025931 Bacteria 1367
374 Ga0207690_10000658 3300025932 Bacteria 22107
375 Ga0207706_10013431 3300025933 Bacteria 7443
376 Ga0207709_10013052 3300025935 Bacteria 4579
377 Ga0207709_10098384 3300025935 Bacteria 1929
378 Ga0207709_10182975 3300025935 Bacteria 1481
379 Ga0207670_10088353 3300025936 Bacteria 2186
380 Ga0207670_10261185 3300025936 Bacteria 1342
381 Ga0207669_10004257 3300025937 Bacteria 6282
382 Ga0207669_10024521 3300025937 Bacteria 3243
383 Ga0207691_10002036 3300025940 Bacteria 19776
384 Ga0207691_10012845 3300025940 Bacteria 8017
385 Ga0207711_10061995 3300025941 Bacteria 3225
386 Ga0207711_10064015 3300025941 Bacteria 3175
387 Ga0207711_10219893 3300025941 Bacteria 1737
388 Ga0207711_10325107 3300025941 Bacteria 1422
389 Ga0207689_10055607 3300025942 Bacteria 3257
390 Ga0207679_10000003 3300025945 Bacteria 597553
391 Ga0207679_10003109 3300025945 Bacteria 10278
392 Ga0207679_10094573 3300025945 Bacteria 2321
393 Ga0207667_10004383 3300025949 Bacteria 17283
394 Ga0207667_10017027 3300025949 Bacteria 8198
395 Ga0207667_10036128 3300025949 Bacteria 5297
396 Ga0207667_10078403 3300025949 Bacteria 3424
397 Ga0207667_10110627 3300025949 Bacteria 2834
398 Ga0207667_10133821 3300025949 Bacteria 2553
399 Ga0207651_10006277 3300025960 Bacteria 6199
400 Ga0207640_10001688 3300025981 Bacteria 11829
401 Ga0207640_10011737 3300025981 Bacteria 4968
402 Ga0207658_10084677 3300025986 Bacteria 2440
403 Ga0207677_10015406 3300026023 Bacteria 4496
404 Ga0207703_10061761 3300026035 Bacteria 3068
405 Ga0207678_10000002 3300026067 Bacteria 371723
406 Ga0207678_10008084 3300026067 Bacteria 9275
407 Ga0207702_10001439 3300026078 Bacteria 23650
408 Ga0207702_10001983 3300026078 Bacteria 19881
409 Ga0207702_10066788 3300026078 Bacteria 3084
410 Ga0207702_10082959 3300026078 Bacteria 2788
411 Ga0207641_10025181 3300026088 Bacteria 4906
412 Ga0207648_10000515 3300026089 Bacteria 43207
413 Ga0207648_10034719 3300026089 Bacteria 4444
414 Ga0207648_10038130 3300026089 Bacteria 4230
415 Ga0207648_10056500 3300026089 Bacteria 3425
416 Ga0207648_10064100 3300026089 Bacteria 3203
417 Ga0207648_10072375 3300026089 Bacteria 3004
418 Ga0207676_10015363 3300026095 Bacteria 5520
419 Ga0207674_10004769 3300026116 Bacteria 16262
420 Ga0207675_100021444 3300026118 Bacteria 6017
421 Ga0207675_100054825 3300026118 Bacteria 3719
422 Ga0207675_100072379 3300026118 Bacteria 3224
423 Ga0207683_10013304 3300026121 Bacteria 7015
424 Ga0207683_10014592 3300026121 Bacteria 6690
425 Ga0207683_10286663 3300026121 Bacteria 1505
426 Ga0207698_10018160 3300026142 Bacteria 4787
427 Ga0207698_10028487 3300026142 Bacteria 3983
428 Ga0207698_10042141 3300026142 Bacteria 3408
429 Ga0207698_10069043 3300026142 Bacteria 2793
430 Ga0207698_10250139 3300026142 Bacteria 1621
431 Ga0209281_1000195 3300027111 Bacteria 139144
432 Ga0209969_1002573 3300027360 Bacteria 2511
433 Ga0209981_1002023 3300027378 Bacteria 2591
434 Ga0210000_1001879 3300027462 Bacteria 2969
435 Ga0209995_1000468 3300027471 Bacteria 6158
436 Ga0209968_1005613 3300027526 Bacteria 1885
437 Ga0209999_1007712 3300027543 Bacteria 1936
438 Ga0209982_1007932 3300027552 Bacteria 1553
439 Ga0209282_1000031 3300027666 Bacteria 150666
440 Ga0209974_10016343 3300027876 Bacteria 2464
441 Ga0268265_10178538 3300028380 Bacteria 1822
442 Ga0268264_10025766 3300028381 Bacteria 4803
443 Ga0268264_10357704 3300028381 Bacteria 1391
444 Ga0265336_10000325 3300028666 Bacteria 31959
445 Ga0307517_10061963 3300028786 Bacteria 3528
446 Ga0307515_10000090 3300028794 Bacteria 215043
447 Ga0307515_10014346 3300028794 Bacteria 14704
448 Ga0307515_10020693 3300028794 Bacteria 11719
449 Ga0307515_10087834 3300028794 Bacteria 3939
450 Ga0265324_10001988 3300029957 Bacteria 10920
451 Ga0268256_1007226 3300030500 Bacteria 3995
452 Ga0307511_10136090 3300030521 Bacteria 1462
453 Ga0307512_10016010 3300030522 Bacteria 6930
454 Ga0307512_10099387 3300030522 Bacteria 1980
455 Ga0265332_10000004 3300031238 Bacteria 426592
456 Ga0265332_10001479 3300031238 Bacteria 13111
457 Ga0265325_10007114 3300031241 Bacteria 6735
458 Ga0265325_10016943 3300031241 Bacteria 4062
459 Ga0265340_10053273 3300031247 Bacteria 1954
460 Ga0265339_10114760 3300031249 Bacteria 1390
461 Ga0265331_10000748 3300031250 Bacteria 27195
462 Ga0265327_10013764 3300031251 Bacteria 5346
463 Ga0265316_10034622 3300031344 Bacteria 4101
464 Ga0265316_10080048 3300031344 Bacteria 2506
465 Ga0265316_10242163 3300031344 Bacteria 1326
466 Ga0307513_10000004 3300031456 Bacteria 558931
467 Ga0307513_10017668 3300031456 Bacteria 8546
468 Ga0307509_10000072 3300031507 Bacteria 140566
469 Ga0307509_10000234 3300031507 Bacteria 89398
470 Ga0307509_10202198 3300031507 Bacteria 1821
471 Ga0307408_100067111 3300031548 Bacteria 2637
472 Ga0307508_10000007 3300031616 Bacteria 268359
473 Ga0307514_10001152 3300031649 Bacteria 36151
474 Ga0307514_10011693 3300031649 Bacteria 7300
475 Ga0265314_10036837 3300031711 Bacteria 3550
476 Ga0307516_10000398 3300031730 Bacteria 56825
477 Ga0307516_10000984 3300031730 Bacteria 39418
478 Ga0307516_10003708 3300031730 Bacteria 19431
479 Ga0307516_10003842 3300031730 Bacteria 19022
480 Ga0307516_10016231 3300031730 Bacteria 7796
481 Ga0307405_10000483 3300031731 Bacteria 14957
482 Ga0307406_10016088 3300031901 Bacteria 4339
483 Ga0307412_10081950 3300031911 Bacteria 2232
484 Ga0307412_10134738 3300031911 Bacteria 1800
485 Ga0307416_100021143 3300032002 Bacteria 4664
486 Ga0307414_10021391 3300032004 Bacteria 4058
487 Ga0307414_10169678 3300032004 Bacteria 1743
488 Ga0307411_10000973 3300032005 Bacteria 10988
489 Ga0307507_10031222 3300033179 Bacteria 5597
490 Ga0307510_10022775 3300033180 Bacteria 7267
491 Ga0373936_0043991 3300035113 Bacteria 1796
492 Ga0373955_0042399 3300035172 Bacteria 2443
493 Ga0373931_0022679 3300035691 Bacteria 3161
494 Ga0373935_0099188 3300035692 Bacteria 1918
495 Ga0373937_0087421 3300036401 Bacteria 2885
496 Ga0373937_0103189 3300036401 Bacteria 2648
497 Ga0373937_0249749 3300036401 Bacteria 1672
498 Ga0373925_0027214 3300037068 Bacteria 4187
499 Ga0395899_0047536 3300037312 Bacteria 3195
500 Ga0395900_0019530 3300037418 Bacteria 6909
501 Ga0395900_0140487 3300037418 Bacteria 2473
502 Ga0395898_0063380 3300037466 Bacteria 3587
503 Ga0395905_0004070 3300037471 Bacteria 15324
504 Ga0395905_0005002 3300037471 Bacteria 13656
505 Ga0395905_0068289 3300037471 Bacteria 3329
506 Ga0395905_0077996 3300037471 Bacteria 3104
507 Ga0395901_0045670 3300038443 Bacteria 4547
508 Ga0395901_0143147 3300038443 Bacteria 2513
509 Ga0436361_0082864 3300039447 Bacteria 107951
510 Ga0436361_0224027 3300039447 Bacteria 5992
511 Ga0436361_0240585 3300039447 Bacteria 3666
512 Ga0436361_0313546 3300039447 Bacteria 35556
513 Ga0436361_0347526 3300039447 Bacteria 75643
514 Ga0436361_0409948 3300039447 Bacteria 13635
515 Ga0436361_0431442 3300039447 Bacteria 4517
516 Ga0436361_0500164 3300039447 Bacteria 28968
517 Ga0436361_0664726 3300039447 Bacteria 17402
518 Ga0439439_0025003 3300041406 Bacteria 1501
519 Ga0451802_0554797 3300041460 Bacteria 2110
520 Ga0439449_0002349 3300042007 Bacteria 7421
521 Ga0439462_0017713 3300042015 Bacteria 1845
522 Ga0439446_0023098 3300042156 Bacteria 1767
523 Ga0439446_0024276 3300042156 Bacteria 1729
524 Ga0439446_0057215 3300042156 Bacteria 1173
525 Ga0450918_000036 3300042531 Bacteria 26790
526 Ga0451577_0000519 3300042876 Bacteria 64350
527 Ga0451577_0006947 3300042876 Bacteria 11183
528 Ga0451577_0024692 3300042876 Bacteria 5464
529 Ga0451577_0029185 3300042876 Bacteria 4985
530 Ga0451577_0058754 3300042876 Bacteria 3428
531 Ga0451577_0081617 3300042876 Bacteria 2884
532 Ga0451577_0093774 3300042876 Bacteria 2681
533 Ga0451577_0104771 3300042876 Bacteria 2527
534 Ga0451577_0130423 3300042876 Bacteria 2255
535 Ga0451577_0313424 3300042876 Bacteria 1422
536 Ga0466969_0000056 3300044656 Bacteria 59381
537 Ga0466969_0002248 3300044656 Bacteria 10325
538 Ga0466969_0004296 3300044656 Bacteria 7581
539 Ga0466969_0027148 3300044656 Bacteria 2932
540 Ga0466969_0030894 3300044656 Bacteria 2727
541 Ga0466972_0000390 3300044658 Bacteria 23451
542 Ga0466972_0003819 3300044658 Bacteria 7493
543 Ga0466965_0006239 3300044683 Bacteria 5394
544 Ga0466965_0015556 3300044683 Bacteria 3614
545 Ga0466966_0003784 3300044684 Bacteria 9979
546 Ga0466966_0004701 3300044684 Bacteria 8985
547 Ga0466966_0020706 3300044684 Bacteria 4322
548 Ga0466961_0000465 3300044693 Bacteria 25650
549 Ga0466961_0050237 3300044693 Bacteria 2663
550 Ga0466963_0002329 3300044694 Bacteria 10589
551 Ga0466964_0005251 3300044706 Bacteria 4800
552 Ga0466964_0006854 3300044706 Bacteria 4251
553 Ga0453684_0000005 3300044712 Bacteria 1431632
554 Ga0453684_0000114 3300044712 Bacteria 356610
555 Ga0453684_0000296 3300044712 Bacteria 211075
556 Ga0453684_0000419 3300044712 Bacteria 173463
557 Ga0453684_0011178 3300044712 Bacteria 15114
558 Ga0453684_0018530 3300044712 Bacteria 10675
559 Ga0453684_0059341 3300044712 Bacteria 4933
560 Ga0453684_0187373 3300044712 Bacteria 2423
561 Ga0453684_0411093 3300044712 Bacteria 1513
562 Ga0466971_0010748 3300044719 Bacteria 4005
563 Ga0466971_0023104 3300044719 Bacteria 2771
564 Ga0466968_0028155 3300044735 Bacteria 2316
565 Ga0466970_0040863 3300044765 Bacteria 2463
566 Ga0466957_0022668 3300044842 Bacteria 3706
567 Ga0466957_0047980 3300044842 Bacteria 2595
568 Ga0466960_0083871 3300044901 Bacteria 1611
569 Ga0466959_0000664 3300045049 Bacteria 20079
570 Ga0466959_0000680 3300045049 Bacteria 19879
571 Ga0466959_0001826 3300045049 Bacteria 13354
572 Ga0466959_0032449 3300045049 Bacteria 3865
573 Ga0466959_0067606 3300045049 Bacteria 2590
574 Ga0451576_0000166 3300045051 Bacteria 166647
575 Ga0451576_0003772 3300045051 Bacteria 20437
576 Ga0451576_0005878 3300045051 Bacteria 15242
577 Ga0451576_0007439 3300045051 Bacteria 13087
578 Ga0451576_0007667 3300045051 Bacteria 12830
579 Ga0451576_0011665 3300045051 Bacteria 9956
580 Ga0451576_0019755 3300045051 Bacteria 7353
581 Ga0451576_0023472 3300045051 Bacteria 6678
582 Ga0451576_0023534 3300045051 Bacteria 6669
583 Ga0451576_0024433 3300045051 Bacteria 6527
584 Ga0451576_0028815 3300045051 Bacteria 5946
585 Ga0451576_0029921 3300045051 Bacteria 5825
586 Ga0451576_0090837 3300045051 Bacteria 3177
587 Ga0466958_0016990 3300045836 Bacteria 4197
588 Ga0466967_0016110 3300045976 Bacteria 5883
589 Ga0466967_0041245 3300045976 Bacteria 3978
590 Ga0466967_0079232 3300045976 Bacteria 2961
591 Ga0495592_0000291 3300046454 Bacteria 42990
592 Ga0495592_0010885 3300046454 Bacteria 6864
593 Ga0495592_0034937 3300046454 Bacteria 3788
594 Ga0495591_000607 3300046458 Bacteria 27108
595 Ga0495629_0004690 3300046459 Bacteria 10240
596 Ga0495651_0096470 3300046462 Bacteria 2209
597 Ga0495650_0002299 3300046471 Bacteria 15858
598 Ga0495650_0005641 3300046471 Bacteria 8048
599 Ga0495650_0005687 3300046471 Bacteria 7993
600 Ga0495580_0014357 3300046472 Bacteria 6007
601 Ga0495639_0105127 3300046475 Bacteria 1336
602 Ga0495664_0034823 3300046477 Bacteria 2963
603 Ga0495584_0027192 3300046491 Bacteria 2899
604 Ga0495585_0008002 3300046492 Bacteria 6426
605 Ga0495596_0002606 3300046500 Bacteria 9583
606 Ga0495583_0000866 3300046506 Bacteria 36795
607 Ga0495606_0000127 3300046507 Bacteria 129676
608 Ga0495606_0005178 3300046507 Bacteria 12612
609 Ga0495608_0002232 3300046511 Bacteria 13984
610 Ga0495628_0312254 3300046516 Bacteria 1161
611 Ga0495630_0005459 3300046517 Bacteria 8981
612 Ga0495643_0043504 3300046522 Bacteria 2444
613 Ga0495666_0003508 3300046526 Bacteria 7914
614 Ga0495652_0023647 3300046529 Bacteria 5445
615 Ga0495652_0121013 3300046529 Bacteria 2088
616 Ga0495654_0002047 3300046530 Bacteria 13234
617 Ga0495665_0031536 3300046531 Bacteria 2836
618 Ga0495640_0010264 3300046533 Bacteria 7247
619 Ga0495587_0004383 3300046536 Bacteria 9310
620 Ga0495587_0084225 3300046536 Bacteria 1841
621 Ga0495621_0009589 3300046539 Bacteria 2945
622 Ga0495621_0021471 3300046539 Bacteria 2128
623 Ga0495645_0057531 3300046543 Bacteria 2821
624 Ga0495634_0015664 3300046642 Bacteria 5439
625 Ga0495634_0241023 3300046642 Bacteria 1109
626 Ga0495625_0003235 3300046660 Bacteria 16485
627 Ga0495625_0011371 3300046660 Bacteria 7263
628 Ga0495625_0025801 3300046660 Bacteria 4450
629 Ga0495635_0001381 3300046663 Bacteria 16190
630 Ga0495661_0023528 3300046665 Bacteria 3998
631 Ga0495588_0007649 3300046674 Bacteria 4931
632 Ga0495588_0013517 3300046674 Bacteria 3891
633 Ga0495599_0001603 3300046678 Bacteria 13048
634 Ga0495599_0092489 3300046678 Bacteria 1887
635 Ga0495646_0034513 3300046680 Bacteria 3141
636 Ga0495658_0015312 3300046683 Bacteria 3933
637 Ga0495613_0002519 3300046689 Bacteria 13804
638 Ga0495649_0004080 3300046694 Bacteria 9608
639 Ga0495589_0000923 3300046794 Bacteria 18039
640 Ga0495600_0073499 3300046809 Bacteria 2233
641 Ga0495581_0060891 3300047315 Bacteria 2181
642 Ga0495680_0083663 3300047322 Bacteria 2405
643 Ga0495683_0002247 3300047323 Bacteria 11796
644 Ga0495675_0047979 3300047444 Bacteria 2716
645 Ga0495593_0003496 3300047673 Bacteria 9400
646 Ga0495602_0052137 3300048088 Bacteria 3636
647 Ga0495614_0003100 3300048089 Bacteria 7401
648 Ga0496104_0012365 3300048907 Bacteria 7672
649 Ga0496105_0079238 3300048908 Bacteria 2713
650 Ga0496106_0048548 3300048909 Bacteria 3196
651 Ga0496109_0146014 3300048912 Bacteria 2213
652 Ga0496112_0001089 3300048915 Bacteria 20089
653 Ga0496114_0018736 3300048917 Bacteria 5602
654 Ga0496114_0122128 3300048917 Bacteria 2241
655 Ga0496116_0005538 3300048919 Bacteria 11652
656 Ga0496118_0005614 3300048921 Bacteria 14166
657 Ga0496123_0004424 3300048926 Bacteria 14783
658 Ga0496124_0000786 3300048927 Bacteria 51804
659 Ga0496125_0013748 3300048928 Bacteria 7935
660 Ga0501300_003548 3300049523 Bacteria 2323
661 Ga0501034_0000188 3300049571 Bacteria 115935
662 Ga0501039_0198151 3300049575 Bacteria 1579
663 Ga0501043_0000149 3300049579 Bacteria 65122
664 Ga0501046_0000092 3300049580 Bacteria 97456
665 Ga0501047_0000028 3300049581 Bacteria 220279
666 Ga0501048_0009579 3300049582 Bacteria 7271
667 Ga0501048_0089301 3300049582 Bacteria 2174
668 Ga0501069_0154301 3300049585 Bacteria 1320
669 Ga0501070_0007594 3300049586 Bacteria 9210
670 Ga0501071_0003792 3300049587 Bacteria 9499
671 Ga0501072_0035564 3300049588 Bacteria 3902
672 Ga0501073_0005474 3300049589 Bacteria 9515
673 Ga0501074_0014295 3300049590 Bacteria 5774
674 Ga0501076_0290920 3300049592 Bacteria 1338
675 Ga0501198_000025 3300049649 Bacteria 66985
676 Ga0501222_000033 3300049662 Bacteria 55105
677 Ga0501079_0048511 3300049741 Bacteria 3276
678 Ga0501079_0068513 3300049741 Bacteria 2739
679 Ga0501080_0003503 3300049742 Bacteria 13821
680 Ga0501080_0016126 3300049742 Bacteria 6897
681 Ga0501083_0000223 3300049744 Bacteria 36614
682 Ga0501273_004131 3300049770 Bacteria 1581
683 Ga0501280_000120 3300049776 Bacteria 20478
684 Ga0501281_00899 3300049777 Bacteria 2500
685 Ga0501035_0192155 3300049822 Bacteria 1755
686 Ga0501045_0000170 3300049824 Bacteria 35617
687 nmdc:mga03683_78057_c1 3300050489 Bacteria 1425
688 nmdc:mga00v17_248424_c1 3300050491 Bacteria 1153
689 nmdc:mga0k408_39694_c1 3300050493 Bacteria 2706
690 nmdc:mga0k408_44627_c1 3300050493 Bacteria 2557
691 nmdc:mga0k408_59676_c1 3300050493 Bacteria 2217
692 nmdc:mga07m45_169856_c1 3300050496 Bacteria 1267
693 nmdc:mga07m45_2314_c1 3300050496 Bacteria 8922
694 nmdc:mga07m45_31586_c1 3300050496 Bacteria 2935
695 nmdc:mga05p37_588_c1 3300050507 Bacteria 40012
696 nmdc:mga09592_116_c1 3300050508 Bacteria 50381
697 nmdc:mga09592_123169_c1 3300050508 Bacteria 2228
698 nmdc:mga06r32_57165_c1 3300050510 Bacteria 3747
699 nmdc:mga08y16_16326_c1 3300050511 Bacteria 7806
700 nmdc:mga0rr50_73361_c1 3300050513 Bacteria 2616
701 nmdc:mga08x19_35743_c1 3300050514 Bacteria 3145
702 nmdc:mga08x19_70054_c1 3300050514 Bacteria 2284
703 nmdc:mga0a205_196811_c1 3300050515 Bacteria 1906
704 Ga0500635_0000055 3300053080 Bacteria 74107
705 Ga0500578_0015088 3300053086 Bacteria 4966
706 Ga0500641_0046324 3300053096 Bacteria 1774
707 Ga0500593_001155 3300053117 Bacteria 9527
708 Ga0500658_0032919 3300053134 Bacteria 2035
709 Ga0500619_000325 3300053154 Bacteria 9276
710 Ga0500636_0000064 3300053177 Bacteria 51986
711 Ga0500636_0014675 3300053177 Bacteria 4608
712 Ga0500645_004966 3300053730 Bacteria 4990
713 Ga0501084_0033974 3300054114 Bacteria 4265
714 Ga0501084_0049927 3300054114 Bacteria 3502
715 Ga0590071_006216 3300059421 Bacteria 2845
716 Ga0587072_000424 3300059643 Bacteria 4193
717 Ga0587079_017963 3300059647 Bacteria 1234
718 Ga0466962_0002201 3300061719 Bacteria 9220
719 Ga0466962_0006139 3300061719 Bacteria 5774
720 Ga0466962_0024685 3300061719 Bacteria 2886

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0029921 Ga0451576_0029921_4896_5810 285
2 3300005354 Ga0070675_100428258 Ga0070675_1004282581 303
3 3300049592 Ga0501076_0290920 Ga0501076_0290920_32_985 303
4 3300042156 Ga0439446_0024276 Ga0439446_0024276_16_987 304
5 3300006058 Ga0075432_10025280 Ga0075432_100252802 317
6 3300041406 Ga0439439_0025003 Ga0439439_0025003_240_1385 323
7 3300042007 Ga0439449_0002349 Ga0439449_0002349_1911_3056 323
8 3300042015 Ga0439462_0017713 Ga0439462_0017713_536_1681 323
9 3300046530 Ga0495654_0002047 Ga0495654_0002047_5895_7070 323
10 3300003775 Ga0055524_1000125 Ga0055524_100012524 324
11 3300003791 Ga0055530_10006753 Ga0055530_100067536 324
12 3300003792 Ga0055540_1000011 Ga0055540_100001157 324
13 3300004625 Ga0055543_1002628 Ga0055543_10026281 324
14 3300005262 Ga0065165_1000153 Ga0065165_100015385 324
15 3300005616 Ga0068852_100065922 Ga0068852_1000659224 324
16 3300006051 Ga0075364_10067106 Ga0075364_100671062 324
17 3300006177 Ga0075362_10005489 Ga0075362_100054894 324
18 3300006178 Ga0075367_10006872 Ga0075367_100068724 324
19 3300025291 Ga0209675_1017519 Ga0209675_10175192 324
20 3300025297 Ga0209758_1000146 Ga0209758_100014616 324
21 3300025298 Ga0209050_1000532 Ga0209050_10005324 324
22 3300025299 Ga0209256_1000113 Ga0209256_100011374 324
23 3300025303 Ga0209051_1000020 Ga0209051_100002056 324
24 3300025304 Ga0209257_1000085 Ga0209257_100008556 324
25 3300025949 Ga0207667_10078403 Ga0207667_100784032 324
26 3300026142 Ga0207698_10028487 Ga0207698_100284874 324
27 3300027111 Ga0209281_1000195 Ga0209281_100019548 324
28 3300028794 Ga0307515_10020693 Ga0307515_100206936 324
29 3300031238 Ga0265332_10001479 Ga0265332_1000147910 324
30 3300031241 Ga0265325_10016943 Ga0265325_100169431 324
31 3300031249 Ga0265339_10114760 Ga0265339_101147601 324
32 3300031250 Ga0265331_10000748 Ga0265331_100007483 324
33 3300031251 Ga0265327_10013764 Ga0265327_100137643 324
34 3300031344 Ga0265316_10034622 Ga0265316_100346222 324
35 3300031456 Ga0307513_10017668 Ga0307513_100176686 324
36 3300046471 Ga0495650_0002299 Ga0495650_0002299_5126_6250 324
37 3300046522 Ga0495643_0043504 Ga0495643_0043504_181_1293 324
38 3300046660 Ga0495625_0003235 Ga0495625_0003235_15117_16229 324
39 3300048917 Ga0496114_0018736 Ga0496114_0018736_3735_4847 324
40 3300053117 Ga0500593_001155 Ga0500593_001155_6987_8096 324
41 3300053134 Ga0500658_0032919 Ga0500658_0032919_318_1430 324
42 3300002773 JGI25152J39213_1003301 JGI25152J39213_10033014 325
43 3300002774 JGI25150J39212_1007478 JGI25150J39212_10074782 325
44 3300003771 Ga0055526_1001897 Ga0055526_10018977 325
45 3300005262 Ga0065165_1000967 Ga0065165_100096719 325
46 3300025258 Ga0209129_1000027 Ga0209129_100002739 325
47 3300025295 Ga0209564_1000139 Ga0209564_100013930 325
48 3300025297 Ga0209758_1000052 Ga0209758_100005281 325
49 3300025299 Ga0209256_1024458 Ga0209256_10244582 325
50 3300026089 Ga0207648_10038130 Ga0207648_100381305 325
51 3300030522 Ga0307512_10099387 Ga0307512_100993872 325
52 3300031507 Ga0307509_10202198 Ga0307509_102021982 325
53 3300031616 Ga0307508_10000007 Ga0307508_1000000717 325
54 3300031649 Ga0307514_10011693 Ga0307514_100116934 325
55 3300031911 Ga0307412_10134738 Ga0307412_101347382 325
56 3300033179 Ga0307507_10031222 Ga0307507_100312226 325
57 3300046539 Ga0495621_0021471 Ga0495621_0021471_44_1078 325
58 3300030500 Ga0268256_1007226 Ga0268256_10072263 326
59 3300042156 Ga0439446_0023098 Ga0439446_0023098_342_1544 326
60 3300042531 Ga0450918_000036 Ga0450918_000036_23185_24297 326
61 3300044658 Ga0466972_0003819 Ga0466972_0003819_2111_3241 326
62 3300049579 Ga0501043_0000149 Ga0501043_0000149_50107_51237 326
63 3300049580 Ga0501046_0000092 Ga0501046_0000092_14022_15152 326
64 3300049581 Ga0501047_0000028 Ga0501047_0000028_169217_170347 326
65 3300049582 Ga0501048_0009579 Ga0501048_0009579_4463_5593 326
66 3300049824 Ga0501045_0000170 Ga0501045_0000170_7338_8468 326
67 3300025931 Ga0207644_10268193 Ga0207644_102681931 327
68 3300044656 Ga0466969_0027148 Ga0466969_0027148_697_1827 327
69 3300044656 Ga0466969_0030894 Ga0466969_0030894_209_1339 327
70 3300044684 Ga0466966_0004701 Ga0466966_0004701_6289_7419 327
71 3300044693 Ga0466961_0050237 Ga0466961_0050237_1448_2578 327
72 3300044694 Ga0466963_0002329 Ga0466963_0002329_4631_5761 327
73 3300044706 Ga0466964_0006854 Ga0466964_0006854_2889_4019 327
74 3300044719 Ga0466971_0010748 Ga0466971_0010748_1100_2230 327
75 3300044719 Ga0466971_0023104 Ga0466971_0023104_146_1276 327
76 3300045049 Ga0466959_0001826 Ga0466959_0001826_5252_6382 327
77 3300045049 Ga0466959_0067606 Ga0466959_0067606_976_2088 327
78 3300045976 Ga0466967_0041245 Ga0466967_0041245_1564_2694 327
79 3300061719 Ga0466962_0002201 Ga0466962_0002201_8040_9170 327
80 3300061719 Ga0466962_0024685 Ga0466962_0024685_1566_2696 327
81 3300009147 Ga0114129_10597416 Ga0114129_105974162 328
82 3300044656 Ga0466969_0000056 Ga0466969_0000056_45714_46844 329
83 3300044684 Ga0466966_0020706 Ga0466966_0020706_1989_3119 329
84 3300045049 Ga0466959_0032449 Ga0466959_0032449_360_1490 329
85 3300044712 Ga0453684_0187373 Ga0453684_0187373_295_1428 330
86 3300045051 Ga0451576_0003772 Ga0451576_0003772_7204_8337 330
87 3300050493 nmdc:mga0k408_39694_c1 nmdc:mga0k408_39694_c1_126_1262 330
88 3300053154 Ga0500619_000325 Ga0500619_000325_209_1354 331
89 3300003792 Ga0055540_1009175 Ga0055540_10091751 332
90 3300005616 Ga0068852_100224064 Ga0068852_1002240642 332
91 3300006353 Ga0075370_10004055 Ga0075370_100040553 332
92 3300025303 Ga0209051_1006172 Ga0209051_10061724 332
93 3300026118 Ga0207675_100021444 Ga0207675_1000214446 332
94 3300046492 Ga0495585_0008002 Ga0495585_0008002_992_2122 332
95 3300050496 nmdc:mga07m45_31586_c1 nmdc:mga07m45_31586_c1_283_1407 332
96 3300005330 Ga0070690_100027241 Ga0070690_1000272412 333
97 3300005340 Ga0070689_100177005 Ga0070689_1001770051 333
98 3300005355 Ga0070671_100049616 Ga0070671_1000496161 333
99 3300009177 Ga0105248_10001017 Ga0105248_1000101733 333
100 3300013296 Ga0157374_10076605 Ga0157374_100766053 333
101 3300013297 Ga0157378_10087737 Ga0157378_100877371 333
102 3300014745 Ga0157377_10098814 Ga0157377_100988142 333
103 3300025941 Ga0207711_10061995 Ga0207711_100619953 333
104 3300025942 Ga0207689_10055607 Ga0207689_100556075 333
105 3300033180 Ga0307510_10022775 Ga0307510_100227756 333
106 3300048915 Ga0496112_0001089 Ga0496112_0001089_16911_18041 333
107 3300003187 JGI25151J46595_10004206 JGI25151J46595_100042062 334
108 3300037471 Ga0395905_0004070 Ga0395905_0004070_4688_5818 334
109 3300036401 Ga0373937_0087421 Ga0373937_0087421_196_1257 335
110 3300046642 Ga0495634_0241023 Ga0495634_0241023_25_1092 335
111 3300005457 Ga0070662_100004421 Ga0070662_1000044213 336
112 3300021361 Ga0213872_10002133 Ga0213872_100021334 336
113 3300025933 Ga0207706_10013431 Ga0207706_100134316 336
114 3300039447 Ga0436361_0347526 Ga0436361_0347526_3755_4864 336
115 3300005344 Ga0070661_100150359 Ga0070661_1001503592 337
116 3300026142 Ga0207698_10069043 Ga0207698_100690433 337
117 3300044658 Ga0466972_0000390 Ga0466972_0000390_12956_14086 337
118 3300041460 Ga0451802_0554797 Ga0451802_0554797_975_2099 338
119 3300005262 Ga0065165_1000569 Ga0065165_100056949 340
120 3300005290 Ga0065712_10024488 Ga0065712_100244882 340
121 3300005331 Ga0070670_100012213 Ga0070670_1000122138 340
122 3300005353 Ga0070669_100002753 Ga0070669_1000027537 340
123 3300005354 Ga0070675_100011301 Ga0070675_1000113016 340
124 3300005355 Ga0070671_100006504 Ga0070671_1000065046 340
125 3300005356 Ga0070674_100037117 Ga0070674_1000371172 340
126 3300005364 Ga0070673_100011122 Ga0070673_1000111226 340
127 3300005367 Ga0070667_100222985 Ga0070667_1002229851 340
128 3300005459 Ga0068867_100005126 Ga0068867_10000512610 340
129 3300005543 Ga0070672_100000520 Ga0070672_10000052015 340
130 3300005564 Ga0070664_100058075 Ga0070664_1000580753 340
131 3300005618 Ga0068864_100039034 Ga0068864_1000390344 340
132 3300005719 Ga0068861_100155522 Ga0068861_1001555222 340
133 3300006881 Ga0068865_100054946 Ga0068865_1000549463 340
134 3300013308 Ga0157375_10046145 Ga0157375_100461453 340
135 3300017792 Ga0163161_10063937 Ga0163161_100639371 340
136 3300021361 Ga0213872_10012868 Ga0213872_100128684 340
137 3300025315 Ga0207697_10029588 Ga0207697_100295882 340
138 3300025923 Ga0207681_10008325 Ga0207681_100083255 340
139 3300025925 Ga0207650_10000265 Ga0207650_1000026520 340
140 3300025926 Ga0207659_10000148 Ga0207659_100001489 340
141 3300025931 Ga0207644_10003662 Ga0207644_100036623 340
142 3300025937 Ga0207669_10004257 Ga0207669_100042575 340
143 3300025937 Ga0207669_10024521 Ga0207669_100245212 340
144 3300025940 Ga0207691_10012845 Ga0207691_100128454 340
145 3300025945 Ga0207679_10094573 Ga0207679_100945733 340
146 3300025960 Ga0207651_10006277 Ga0207651_100062776 340
147 3300025986 Ga0207658_10084677 Ga0207658_100846771 340
148 3300026089 Ga0207648_10034719 Ga0207648_100347191 340
149 3300026089 Ga0207648_10064100 Ga0207648_100641001 340
150 3300026118 Ga0207675_100072379 Ga0207675_1000723792 340
151 3300026121 Ga0207683_10013304 Ga0207683_100133046 340
152 3300028794 Ga0307515_10087834 Ga0307515_100878343 340
153 3300039447 Ga0436361_0409948 Ga0436361_0409948_9440_10555 340
154 3300046454 Ga0495592_0000291 Ga0495592_0000291_35892_37004 340
155 3300035691 Ga0373931_0022679 Ga0373931_0022679_652_1782 341
156 3300042876 Ga0451577_0006947 Ga0451577_0006947_1262_2404 342
157 iso_pu_bacteria 2511231002 2511243894 342
158 iso_pu_bacteria 2904479285 2904482177 343
159 iso_pu_bacteria 2547132103 2547371073 344
160 iso_pu_bacteria 2843690924 2843694116 344
161 iso_pu_bacteria 2846033681 2846037192 344
162 iso_pu_bacteria 2846037992 2846038958 344
163 iso_pu_bacteria 2998344455 2998346700 344
164 3300021361 Ga0213872_10020466 Ga0213872_100204662 346
165 3300031456 Ga0307513_10000004 Ga0307513_10000004288 346
166 3300031730 Ga0307516_10016231 Ga0307516_100162314 346
167 3300039447 Ga0436361_0224027 Ga0436361_0224027_693_1823 346
168 iso_pu_bacteria 2547132512 2548849319 346
169 iso_pu_bacteria 2574179768 2574431962 346
170 iso_pu_bacteria 2585428058 2587736732 346
171 iso_pu_bacteria 2585428062 2587755612 346
172 iso_pu_bacteria 2588253510 2588295342 346
173 iso_pu_bacteria 2643221625 2644142388 346
174 iso_pu_bacteria 2643221644 2644246993 346
175 iso_pu_bacteria 2643221648 2644275146 346
176 iso_pu_bacteria 2891633521 2891636055 346
177 iso_pu_bacteria 639633007 639786334 346
178 iso_pu_bacteria 2513237151 2513962793 347
179 iso_pu_bacteria 2551306416 2553006210 347
180 iso_pu_bacteria 2599185178 2599443732 347
181 iso_pu_bacteria 2643221544 2643742838 347
182 iso_pu_bacteria 2643221585 2643933322 347
183 iso_pu_bacteria 2643221639 2644217530 347
184 iso_pu_bacteria 2643221646 2644258734 347
185 iso_pu_bacteria 2643221656 2644314571 347
186 iso_pu_bacteria 2738541337 2739056568 347
187 iso_pu_bacteria 2765235838 2765571011 347
188 iso_pu_bacteria 2831864461 2831865508 347
189 iso_pu_bacteria 2834641062 2834644810 347
190 iso_pu_bacteria 2885266251 2885267376 347
191 iso_pu_bacteria 2900577576 2900582956 347
192 iso_pu_bacteria 2928058823 2928061994 347
193 3300005336 Ga0070680_100181391 Ga0070680_1001813912 348
194 3300005339 Ga0070660_100055514 Ga0070660_1000555143 348
195 3300005563 Ga0068855_100030309 Ga0068855_1000303094 348
196 3300021361 Ga0213872_10030117 Ga0213872_100301173 348
197 3300025919 Ga0207657_10038876 Ga0207657_100388764 348
198 3300025921 Ga0207652_10277405 Ga0207652_102774051 348
199 3300026121 Ga0207683_10286663 Ga0207683_102866631 348
200 3300039447 Ga0436361_0240585 Ga0436361_0240585_719_1828 348
201 3300044656 Ga0466969_0002248 Ga0466969_0002248_3983_5092 348
202 3300044683 Ga0466965_0006239 Ga0466965_0006239_675_1784 348
203 3300044693 Ga0466961_0000465 Ga0466961_0000465_4715_5824 348
204 3300045049 Ga0466959_0000680 Ga0466959_0000680_4668_5777 348
205 3300003761 Ga0055535_1000641 Ga0055535_10006416 349
206 3300003763 Ga0055529_1000602 Ga0055529_100060222 349
207 3300005353 Ga0070669_100267501 Ga0070669_1002675011 349
208 3300005471 Ga0070698_100301761 Ga0070698_1003017611 349
209 3300005841 Ga0068863_100250424 Ga0068863_1002504242 349
210 3300006914 Ga0075436_100072343 Ga0075436_1000723433 349
211 3300025242 Ga0209258_100630 Ga0209258_1006307 349
212 3300025256 Ga0209759_1009015 Ga0209759_10090152 349
213 3300025272 Ga0209455_1000508 Ga0209455_10005087 349
214 3300035113 Ga0373936_0043991 Ga0373936_0043991_249_1355 349
215 3300035172 Ga0373955_0042399 Ga0373955_0042399_356_1462 349
216 3300036401 Ga0373937_0249749 Ga0373937_0249749_528_1634 349
217 3300039447 Ga0436361_0431442 Ga0436361_0431442_101_1228 349
218 3300042876 Ga0451577_0024692 Ga0451577_0024692_2078_3184 349
219 3300044712 Ga0453684_0000114 Ga0453684_0000114_183914_185020 349
220 3300044712 Ga0453684_0059341 Ga0453684_0059341_614_1720 349
221 3300045051 Ga0451576_0007439 Ga0451576_0007439_10668_11774 349
222 3300045051 Ga0451576_0023472 Ga0451576_0023472_2962_4068 349
223 3300045051 Ga0451576_0024433 Ga0451576_0024433_1509_2615 349
224 3300045051 Ga0451576_0028815 Ga0451576_0028815_1493_2599 349
225 3300046683 Ga0495658_0015312 Ga0495658_0015312_166_1272 349
226 3300049582 Ga0501048_0089301 Ga0501048_0089301_586_1677 349
227 3300049587 Ga0501071_0003792 Ga0501071_0003792_4485_5576 349
228 3300049588 Ga0501072_0035564 Ga0501072_0035564_2449_3540 349
229 3300049741 Ga0501079_0068513 Ga0501079_0068513_320_1411 349
230 3300049822 Ga0501035_0192155 Ga0501035_0192155_352_1443 349
231 3300050514 nmdc:mga08x19_70054_c1 nmdc:mga08x19_70054_c1_158_1264 349
232 3300001979 JGI24740J21852_10020003 JGI24740J21852_100200033 350
233 3300001991 JGI24743J22301_10006182 JGI24743J22301_100061822 350
234 3300005328 Ga0070676_10001034 Ga0070676_100010348 350
235 3300005328 Ga0070676_10059807 Ga0070676_100598071 350
236 3300005330 Ga0070690_100050076 Ga0070690_1000500761 350
237 3300005334 Ga0068869_100005217 Ga0068869_1000052172 350
238 3300005335 Ga0070666_10076811 Ga0070666_100768111 350
239 3300005338 Ga0068868_100262068 Ga0068868_1002620682 350
240 3300005339 Ga0070660_100067859 Ga0070660_1000678592 350
241 3300005344 Ga0070661_100001108 Ga0070661_10000110818 350
242 3300005344 Ga0070661_100016464 Ga0070661_1000164645 350
243 3300005353 Ga0070669_100163053 Ga0070669_1001630532 350
244 3300005354 Ga0070675_100193237 Ga0070675_1001932372 350
245 3300005355 Ga0070671_100005776 Ga0070671_1000057761 350
246 3300005355 Ga0070671_100123151 Ga0070671_1001231511 350
247 3300005356 Ga0070674_100118645 Ga0070674_1001186452 350
248 3300005366 Ga0070659_100001014 Ga0070659_1000010147 350
249 3300005366 Ga0070659_100066418 Ga0070659_1000664183 350
250 3300005441 Ga0070700_100092176 Ga0070700_1000921762 350
251 3300005444 Ga0070694_100066092 Ga0070694_1000660923 350
252 3300005456 Ga0070678_100062876 Ga0070678_1000628763 350
253 3300005459 Ga0068867_100028944 Ga0068867_1000289443 350
254 3300005543 Ga0070672_100026519 Ga0070672_1000265193 350
255 3300005563 Ga0068855_100043110 Ga0068855_1000431105 350
256 3300005563 Ga0068855_100048452 Ga0068855_1000484525 350
257 3300005564 Ga0070664_100006317 Ga0070664_1000063173 350
258 3300005616 Ga0068852_100018167 Ga0068852_1000181675 350
259 3300005617 Ga0068859_100033628 Ga0068859_1000336285 350
260 3300005618 Ga0068864_100017643 Ga0068864_1000176433 350
261 3300005719 Ga0068861_100067562 Ga0068861_1000675623 350
262 3300005841 Ga0068863_100007733 Ga0068863_1000077336 350
263 3300005841 Ga0068863_100058519 Ga0068863_1000585194 350
264 3300005841 Ga0068863_100087822 Ga0068863_1000878223 350
265 3300005842 Ga0068858_100129462 Ga0068858_1001294622 350
266 3300005843 Ga0068860_100006790 Ga0068860_1000067908 350
267 3300005843 Ga0068860_100062070 Ga0068860_1000620703 350
268 3300005844 Ga0068862_100045535 Ga0068862_1000455354 350
269 3300005844 Ga0068862_100084626 Ga0068862_1000846262 350
270 3300006353 Ga0075370_10137032 Ga0075370_101370321 350
271 3300006358 Ga0068871_100015078 Ga0068871_1000150783 350
272 3300006931 Ga0097620_100033628 Ga0097620_1000336285 350
273 3300009147 Ga0114129_10011675 Ga0114129_100116754 350
274 3300009176 Ga0105242_10013549 Ga0105242_100135493 350
275 3300009177 Ga0105248_10116598 Ga0105248_101165983 350
276 3300009545 Ga0105237_10208066 Ga0105237_102080662 350
277 3300009553 Ga0105249_10053995 Ga0105249_100539953 350
278 3300013100 Ga0157373_10004520 Ga0157373_1000452010 350
279 3300013104 Ga0157370_10209105 Ga0157370_102091051 350
280 3300013297 Ga0157378_10009642 Ga0157378_100096422 350
281 3300013297 Ga0157378_10017857 Ga0157378_100178577 350
282 3300013306 Ga0163162_10266275 Ga0163162_102662751 350
283 3300013307 Ga0157372_10032119 Ga0157372_100321193 350
284 3300013308 Ga0157375_10278942 Ga0157375_102789421 350
285 3300014325 Ga0163163_10186391 Ga0163163_101863912 350
286 3300014326 Ga0157380_10018320 Ga0157380_100183203 350
287 3300014968 Ga0157379_10205024 Ga0157379_102050242 350
288 3300017792 Ga0163161_10008757 Ga0163161_100087573 350
289 3300021361 Ga0213872_10001888 Ga0213872_100018887 350
290 3300021361 Ga0213872_10002209 Ga0213872_100022093 350
291 3300025903 Ga0207680_10033476 Ga0207680_100334764 350
292 3300025914 Ga0207671_10212660 Ga0207671_102126602 350
293 3300025920 Ga0207649_10000951 Ga0207649_100009518 350
294 3300025923 Ga0207681_10045573 Ga0207681_100455731 350
295 3300025925 Ga0207650_10008031 Ga0207650_100080316 350
296 3300025926 Ga0207659_10202800 Ga0207659_102028002 350
297 3300025931 Ga0207644_10012407 Ga0207644_100124075 350
298 3300025932 Ga0207690_10000658 Ga0207690_100006587 350
299 3300025940 Ga0207691_10002036 Ga0207691_100020367 350
300 3300025941 Ga0207711_10219893 Ga0207711_102198932 350
301 3300025945 Ga0207679_10003109 Ga0207679_100031092 350
302 3300025949 Ga0207667_10017027 Ga0207667_100170279 350
303 3300026023 Ga0207677_10015406 Ga0207677_100154062 350
304 3300026035 Ga0207703_10061761 Ga0207703_100617612 350
305 3300026078 Ga0207702_10066788 Ga0207702_100667884 350
306 3300026088 Ga0207641_10025181 Ga0207641_100251813 350
307 3300026089 Ga0207648_10056500 Ga0207648_100565002 350
308 3300026095 Ga0207676_10015363 Ga0207676_100153634 350
309 3300026118 Ga0207675_100054825 Ga0207675_1000548254 350
310 3300026121 Ga0207683_10014592 Ga0207683_100145923 350
311 3300026142 Ga0207698_10042141 Ga0207698_100421413 350
312 3300028380 Ga0268265_10178538 Ga0268265_101785382 350
313 3300028381 Ga0268264_10025766 Ga0268264_100257663 350
314 3300028381 Ga0268264_10357704 Ga0268264_103577041 350
315 3300028794 Ga0307515_10000090 Ga0307515_10000090134 350
316 3300031238 Ga0265332_10000004 Ga0265332_10000004235 350
317 3300031241 Ga0265325_10007114 Ga0265325_100071143 350
318 3300031344 Ga0265316_10080048 Ga0265316_100800481 350
319 3300031344 Ga0265316_10242163 Ga0265316_102421631 350
320 3300031507 Ga0307509_10000072 Ga0307509_1000007292 350
321 3300031730 Ga0307516_10003842 Ga0307516_1000384223 350
322 3300032004 Ga0307414_10169678 Ga0307414_101696781 350
323 3300035692 Ga0373935_0099188 Ga0373935_0099188_99_1208 350
324 3300039447 Ga0436361_0313546 Ga0436361_0313546_10380_11504 350
325 3300039447 Ga0436361_0500164 Ga0436361_0500164_20107_21231 350
326 3300042876 Ga0451577_0000519 Ga0451577_0000519_12490_13608 350
327 3300042876 Ga0451577_0029185 Ga0451577_0029185_2113_3213 350
328 3300042876 Ga0451577_0081617 Ga0451577_0081617_1749_2867 350
329 3300042876 Ga0451577_0104771 Ga0451577_0104771_230_1330 350
330 3300042876 Ga0451577_0130423 Ga0451577_0130423_297_1406 350
331 3300042876 Ga0451577_0313424 Ga0451577_0313424_52_1161 350
332 3300044712 Ga0453684_0000005 Ga0453684_0000005_1417997_1419115 350
333 3300044712 Ga0453684_0000296 Ga0453684_0000296_12050_13168 350
334 3300044712 Ga0453684_0000419 Ga0453684_0000419_13454_14563 350
335 3300044712 Ga0453684_0011178 Ga0453684_0011178_2137_3255 350
336 3300044712 Ga0453684_0018530 Ga0453684_0018530_1959_3062 350
337 3300045051 Ga0451576_0000166 Ga0451576_0000166_122369_123469 350
338 3300045051 Ga0451576_0005878 Ga0451576_0005878_11860_12978 350
339 3300045051 Ga0451576_0007667 Ga0451576_0007667_11551_12666 350
340 3300045051 Ga0451576_0011665 Ga0451576_0011665_4388_5488 350
341 3300045051 Ga0451576_0023534 Ga0451576_0023534_2787_3890 350
342 3300045051 Ga0451576_0090837 Ga0451576_0090837_986_2095 350
343 3300048908 Ga0496105_0079238 Ga0496105_0079238_1393_2502 350
344 3300049649 Ga0501198_000025 Ga0501198_000025_38515_39648 350
345 3300049662 Ga0501222_000033 Ga0501222_000033_26636_27769 350
346 3300049742 Ga0501080_0016126 Ga0501080_0016126_2318_3427 350
347 3300050496 nmdc:mga07m45_169856_c1 nmdc:mga07m45_169856_c1_126_1229 350
348 3300053177 Ga0500636_0000064 Ga0500636_0000064_35670_36770 350
349 3300054114 Ga0501084_0033974 Ga0501084_0033974_2399_3508 350
350 3300001979 JGI24740J21852_10000340 JGI24740J21852_1000034011 351
351 3300002705 JGI25156J39149_1000220 JGI25156J39149_10002207 351
352 3300002705 JGI25156J39149_1006463 JGI25156J39149_10064631 351
353 3300002705 JGI25156J39149_1013422 JGI25156J39149_10134221 351
354 3300002738 JGI25154J39366_1000669 JGI25154J39366_10006693 351
355 3300002738 JGI25154J39366_1001211 JGI25154J39366_10012112 351
356 3300002741 JGI25157J39369_1000135 JGI25157J39369_100013551 351
357 3300003187 JGI25151J46595_10000728 JGI25151J46595_1000072823 351
358 3300003187 JGI25151J46595_10003136 JGI25151J46595_100031364 351
359 3300003187 JGI25151J46595_10018212 JGI25151J46595_100182124 351
360 3300003320 rootH2_10005083 rootH2_100050835 351
361 3300003751 Ga0055538_1000084 Ga0055538_100008426 351
362 3300003751 Ga0055538_1005996 Ga0055538_10059961 351
363 3300003751 Ga0055538_1005999 Ga0055538_10059991 351
364 3300003752 Ga0055539_1000068 Ga0055539_1000068111 351
365 3300003752 Ga0055539_1000125 Ga0055539_100012526 351
366 3300003756 Ga0055533_1000132 Ga0055533_100013226 351
367 3300003756 Ga0055533_1000172 Ga0055533_100017248 351
368 3300003756 Ga0055533_1000361 Ga0055533_10003617 351
369 3300003756 Ga0055533_1004790 Ga0055533_10047901 351
370 3300003758 Ga0055532_1000028 Ga0055532_100002878 351
371 3300003759 Ga0055525_1000171 Ga0055525_100017126 351
372 3300003759 Ga0055525_1000598 Ga0055525_10005983 351
373 3300003759 Ga0055525_1000665 Ga0055525_10006659 351
374 3300003760 Ga0055527_1003277 Ga0055527_10032773 351
375 3300003761 Ga0055535_1000022 Ga0055535_100002278 351
376 3300003762 Ga0055542_1001981 Ga0055542_10019814 351
377 3300003763 Ga0055529_1000063 Ga0055529_100006333 351
378 3300003763 Ga0055529_1000145 Ga0055529_100014510 351
379 3300003771 Ga0055526_1011980 Ga0055526_10119803 351
380 3300003771 Ga0055526_1019952 Ga0055526_10199522 351
381 3300003771 Ga0055526_1033905 Ga0055526_10339051 351
382 3300003775 Ga0055524_1000290 Ga0055524_100029030 351
383 3300003775 Ga0055524_1009546 Ga0055524_10095464 351
384 3300003781 Ga0055536_1000074 Ga0055536_100007445 351
385 3300003784 Ga0055534_1002013 Ga0055534_10020134 351
386 3300003784 Ga0055534_1003067 Ga0055534_10030674 351
387 3300003841 Ga0055541_1000083 Ga0055541_100008352 351
388 3300003841 Ga0055541_1002647 Ga0055541_10026473 351
389 3300005290 Ga0065712_10078545 Ga0065712_100785452 351
390 3300005327 Ga0070658_10006078 Ga0070658_100060788 351
391 3300005327 Ga0070658_10014263 Ga0070658_100142636 351
392 3300005327 Ga0070658_10051266 Ga0070658_100512663 351
393 3300005330 Ga0070690_100047414 Ga0070690_1000474141 351
394 3300005340 Ga0070689_100115781 Ga0070689_1001157812 351
395 3300005344 Ga0070661_100000127 Ga0070661_10000012743 351
396 3300005345 Ga0070692_10147313 Ga0070692_101473131 351
397 3300005354 Ga0070675_100206976 Ga0070675_1002069761 351
398 3300005356 Ga0070674_100121168 Ga0070674_1001211683 351
399 3300005364 Ga0070673_100103091 Ga0070673_1001030913 351
400 3300005365 Ga0070688_100075300 Ga0070688_1000753004 351
401 3300005435 Ga0070714_100050194 Ga0070714_1000501941 351
402 3300005436 Ga0070713_100087771 Ga0070713_1000877713 351
403 3300005438 Ga0070701_10033350 Ga0070701_100333502 351
404 3300005440 Ga0070705_100037898 Ga0070705_1000378982 351
405 3300005440 Ga0070705_100195030 Ga0070705_1001950301 351
406 3300005455 Ga0070663_100000005 Ga0070663_100000005123 351
407 3300005455 Ga0070663_100001510 Ga0070663_1000015102 351
408 3300005458 Ga0070681_10006660 Ga0070681_100066608 351
409 3300005459 Ga0068867_100000249 Ga0068867_10000024914 351
410 3300005466 Ga0070685_10038814 Ga0070685_100388143 351
411 3300005471 Ga0070698_100024331 Ga0070698_1000243314 351
412 3300005530 Ga0070679_100010085 Ga0070679_1000100852 351
413 3300005530 Ga0070679_100015526 Ga0070679_1000155264 351
414 3300005535 Ga0070684_100027216 Ga0070684_1000272166 351
415 3300005539 Ga0068853_100074850 Ga0068853_1000748504 351
416 3300005543 Ga0070672_100028153 Ga0070672_1000281534 351
417 3300005546 Ga0070696_100033303 Ga0070696_1000333033 351
418 3300005547 Ga0070693_100110608 Ga0070693_1001106081 351
419 3300005549 Ga0070704_100010535 Ga0070704_1000105354 351
420 3300005563 Ga0068855_100002213 Ga0068855_10000221310 351
421 3300005563 Ga0068855_100017466 Ga0068855_1000174664 351
422 3300005563 Ga0068855_100165615 Ga0068855_1001656151 351
423 3300005564 Ga0070664_100000001 Ga0070664_10000000181 351
424 3300005577 Ga0068857_100019209 Ga0068857_1000192096 351
425 3300005578 Ga0068854_100000360 Ga0068854_10000036019 351
426 3300005578 Ga0068854_100050767 Ga0068854_1000507672 351
427 3300005578 Ga0068854_100128870 Ga0068854_1001288702 351
428 3300005614 Ga0068856_100000008 Ga0068856_1000000086 351
429 3300005614 Ga0068856_100017028 Ga0068856_1000170284 351
430 3300005614 Ga0068856_100026163 Ga0068856_1000261632 351
431 3300005616 Ga0068852_100001134 Ga0068852_1000011345 351
432 3300005616 Ga0068852_100019290 Ga0068852_1000192905 351
433 3300005616 Ga0068852_100030609 Ga0068852_1000306094 351
434 3300005617 Ga0068859_100043018 Ga0068859_1000430185 351
435 3300005617 Ga0068859_100321316 Ga0068859_1003213162 351
436 3300005617 Ga0068859_100335794 Ga0068859_1003357942 351
437 3300005834 Ga0068851_10003401 Ga0068851_100034017 351
438 3300005842 Ga0068858_100056576 Ga0068858_1000565763 351
439 3300005842 Ga0068858_100083388 Ga0068858_1000833883 351
440 3300006186 Ga0075369_10006951 Ga0075369_100069514 351
441 3300006195 Ga0075366_10007379 Ga0075366_100073796 351
442 3300006195 Ga0075366_10061476 Ga0075366_100614763 351
443 3300006195 Ga0075366_10071927 Ga0075366_100719272 351
444 3300006195 Ga0075366_10102119 Ga0075366_101021192 351
445 3300006237 Ga0097621_100051122 Ga0097621_1000511224 351
446 3300006353 Ga0075370_10005449 Ga0075370_100054496 351
447 3300006358 Ga0068871_100009363 Ga0068871_1000093638 351
448 3300006358 Ga0068871_100183974 Ga0068871_1001839741 351
449 3300006844 Ga0075428_100045170 Ga0075428_1000451704 351
450 3300006847 Ga0075431_100052358 Ga0075431_1000523584 351
451 3300006852 Ga0075433_10186500 Ga0075433_101865003 351
452 3300006852 Ga0075433_10266638 Ga0075433_102666382 351
453 3300006880 Ga0075429_100000146 Ga0075429_10000014626 351
454 3300006880 Ga0075429_100047747 Ga0075429_1000477472 351
455 3300006881 Ga0068865_100029750 Ga0068865_1000297503 351
456 3300006931 Ga0097620_100043018 Ga0097620_1000430185 351
457 3300006931 Ga0097620_100321360 Ga0097620_1003213601 351
458 3300006931 Ga0097620_100335794 Ga0097620_1003357942 351
459 3300006948 Ga0099826_10000015 Ga0099826_1000001550 351
460 3300007076 Ga0075435_100307001 Ga0075435_1003070011 351
461 3300009093 Ga0105240_10006302 Ga0105240_1000630214 351
462 3300009093 Ga0105240_10103453 Ga0105240_101034534 351
463 3300009093 Ga0105240_10142898 Ga0105240_101428981 351
464 3300009094 Ga0111539_10001478 Ga0111539_1000147824 351
465 3300009094 Ga0111539_10077596 Ga0111539_100775963 351
466 3300009098 Ga0105245_10101426 Ga0105245_101014263 351
467 3300009098 Ga0105245_10181528 Ga0105245_101815282 351
468 3300009147 Ga0114129_10025565 Ga0114129_1002556510 351
469 3300009148 Ga0105243_10002157 Ga0105243_100021574 351
470 3300009174 Ga0105241_10008816 Ga0105241_100088166 351
471 3300009174 Ga0105241_10097593 Ga0105241_100975933 351
472 3300009174 Ga0105241_10267668 Ga0105241_102676682 351
473 3300009177 Ga0105248_10016620 Ga0105248_100166206 351
474 3300009177 Ga0105248_10048319 Ga0105248_100483194 351
475 3300009177 Ga0105248_10063274 Ga0105248_100632744 351
476 3300009545 Ga0105237_10105532 Ga0105237_101055322 351
477 3300009551 Ga0105238_10028556 Ga0105238_100285562 351
478 3300009551 Ga0105238_10037056 Ga0105238_100370564 351
479 3300009551 Ga0105238_10072034 Ga0105238_100720342 351
480 3300010375 Ga0105239_10056778 Ga0105239_100567783 351
481 3300013100 Ga0157373_10000732 Ga0157373_1000073218 351
482 3300013102 Ga0157371_10000035 Ga0157371_1000003512 351
483 3300013104 Ga0157370_10000021 Ga0157370_10000021102 351
484 3300013104 Ga0157370_10001810 Ga0157370_1000181019 351
485 3300013105 Ga0157369_10008405 Ga0157369_100084059 351
486 3300013296 Ga0157374_10018896 Ga0157374_100188963 351
487 3300013297 Ga0157378_10066292 Ga0157378_100662923 351
488 3300013306 Ga0163162_10164616 Ga0163162_101646162 351
489 3300013306 Ga0163162_10256805 Ga0163162_102568052 351
490 3300013307 Ga0157372_10000331 Ga0157372_1000033138 351
491 3300013307 Ga0157372_10023625 Ga0157372_100236256 351
492 3300013307 Ga0157372_10042431 Ga0157372_100424314 351
493 3300013307 Ga0157372_10341950 Ga0157372_103419501 351
494 3300013308 Ga0157375_10166888 Ga0157375_101668882 351
495 3300014745 Ga0157377_10000016 Ga0157377_10000016171 351
496 3300014745 Ga0157377_10005227 Ga0157377_100052272 351
497 3300014968 Ga0157379_10014692 Ga0157379_100146924 351
498 3300015261 Ga0182006_1000956 Ga0182006_10009564 351
499 3300017792 Ga0163161_10069050 Ga0163161_100690501 351
500 3300020069 Ga0197907_10277493 Ga0197907_102774931 351
501 3300020076 Ga0206355_1056333 Ga0206355_10563331 351
502 3300020077 Ga0206351_10481241 Ga0206351_104812411 351
503 3300020610 Ga0154015_1042038 Ga0154015_104203828 351
504 3300021361 Ga0213872_10000049 Ga0213872_1000004948 351
505 3300021361 Ga0213872_10007035 Ga0213872_100070354 351
506 3300025224 Ga0209784_100009 Ga0209784_100009588 351
507 3300025224 Ga0209784_100014 Ga0209784_100014355 351
508 3300025224 Ga0209784_100505 Ga0209784_1005051 351
509 3300025225 Ga0209566_100007 Ga0209566_100007588 351
510 3300025225 Ga0209566_100011 Ga0209566_100011355 351
511 3300025225 Ga0209566_100447 Ga0209566_10044710 351
512 3300025226 Ga0209674_100018 Ga0209674_100018588 351
513 3300025226 Ga0209674_100032 Ga0209674_100032130 351
514 3300025226 Ga0209674_100088 Ga0209674_1000886 351
515 3300025226 Ga0209674_100131 Ga0209674_10013110 351
516 3300025228 Ga0209672_100217 Ga0209672_10021740 351
517 3300025229 Ga0209147_100002 Ga0209147_100002631 351
518 3300025230 Ga0209563_100020 Ga0209563_100020588 351
519 3300025230 Ga0209563_100029 Ga0209563_100029130 351
520 3300025230 Ga0209563_100160 Ga0209563_1001606 351
521 3300025231 Ga0207427_100296 Ga0207427_1002966 351
522 3300025242 Ga0209258_100002 Ga0209258_100002631 351
523 3300025242 Ga0209258_100869 Ga0209258_10086911 351
524 3300025246 Ga0209646_1000058 Ga0209646_1000058150 351
525 3300025246 Ga0209646_1000214 Ga0209646_10002147 351
526 3300025250 Ga0209026_1000059 Ga0209026_1000059198 351
527 3300025253 Ga0209677_100010 Ga0209677_100010588 351
528 3300025253 Ga0209677_100042 Ga0209677_10004282 351
529 3300025253 Ga0209677_100162 Ga0209677_1001626 351
530 3300025253 Ga0209677_100226 Ga0209677_10022630 351
531 3300025253 Ga0209677_104848 Ga0209677_1048481 351
532 3300025254 Ga0209148_1000043 Ga0209148_1000043346 351
533 3300025254 Ga0209148_1003153 Ga0209148_10031534 351
534 3300025256 Ga0209759_1000365 Ga0209759_10003657 351
535 3300025256 Ga0209759_1001265 Ga0209759_10012657 351
536 3300025256 Ga0209759_1002367 Ga0209759_10023676 351
537 3300025256 Ga0209759_1002799 Ga0209759_10027996 351
538 3300025263 Ga0209565_1000329 Ga0209565_100032912 351
539 3300025263 Ga0209565_1002450 Ga0209565_10024505 351
540 3300025272 Ga0209455_1000009 Ga0209455_1000009512 351
541 3300025273 Ga0209673_1015229 Ga0209673_10152292 351
542 3300025291 Ga0209675_1000070 Ga0209675_1000070161 351
543 3300025291 Ga0209675_1000644 Ga0209675_10006444 351
544 3300025292 Ga0209676_1000012 Ga0209676_1000012462 351
545 3300025294 Ga0209025_1001428 Ga0209025_100142814 351
546 3300025294 Ga0209025_1004660 Ga0209025_10046607 351
547 3300025294 Ga0209025_1006958 Ga0209025_10069586 351
548 3300025295 Ga0209564_1000359 Ga0209564_100035977 351
549 3300025295 Ga0209564_1001697 Ga0209564_10016974 351
550 3300025295 Ga0209564_1002980 Ga0209564_10029804 351
551 3300025299 Ga0209256_1000059 Ga0209256_100005960 351
552 3300025299 Ga0209256_1000149 Ga0209256_1000149119 351
553 3300025303 Ga0209051_1005529 Ga0209051_10055294 351
554 3300025303 Ga0209051_1011536 Ga0209051_10115361 351
555 3300025907 Ga0207645_10085798 Ga0207645_100857982 351
556 3300025909 Ga0207705_10002838 Ga0207705_1000283811 351
557 3300025909 Ga0207705_10039414 Ga0207705_100394144 351
558 3300025909 Ga0207705_10047019 Ga0207705_100470193 351
559 3300025911 Ga0207654_10038347 Ga0207654_100383472 351
560 3300025911 Ga0207654_10191464 Ga0207654_101914641 351
561 3300025912 Ga0207707_10056099 Ga0207707_100560992 351
562 3300025913 Ga0207695_10002489 Ga0207695_1000248920 351
563 3300025913 Ga0207695_10003096 Ga0207695_1000309624 351
564 3300025913 Ga0207695_10008251 Ga0207695_100082517 351
565 3300025913 Ga0207695_10223213 Ga0207695_102232132 351
566 3300025916 Ga0207663_10031320 Ga0207663_100313204 351
567 3300025918 Ga0207662_10044662 Ga0207662_100446623 351
568 3300025918 Ga0207662_10078268 Ga0207662_100782682 351
569 3300025918 Ga0207662_10257904 Ga0207662_102579041 351
570 3300025919 Ga0207657_10055107 Ga0207657_100551074 351
571 3300025920 Ga0207649_10000169 Ga0207649_1000016948 351
572 3300025921 Ga0207652_10003246 Ga0207652_100032468 351
573 3300025921 Ga0207652_10033593 Ga0207652_100335932 351
574 3300025924 Ga0207694_10012151 Ga0207694_100121518 351
575 3300025924 Ga0207694_10050348 Ga0207694_100503483 351
576 3300025935 Ga0207709_10013052 Ga0207709_100130523 351
577 3300025935 Ga0207709_10098384 Ga0207709_100983842 351
578 3300025935 Ga0207709_10182975 Ga0207709_101829752 351
579 3300025936 Ga0207670_10088353 Ga0207670_100883533 351
580 3300025936 Ga0207670_10261185 Ga0207670_102611852 351
581 3300025941 Ga0207711_10064015 Ga0207711_100640153 351
582 3300025941 Ga0207711_10325107 Ga0207711_103251071 351
583 3300025945 Ga0207679_10000003 Ga0207679_10000003442 351
584 3300025949 Ga0207667_10004383 Ga0207667_1000438313 351
585 3300025949 Ga0207667_10036128 Ga0207667_100361283 351
586 3300025949 Ga0207667_10110627 Ga0207667_101106273 351
587 3300025949 Ga0207667_10133821 Ga0207667_101338213 351
588 3300025981 Ga0207640_10001688 Ga0207640_100016887 351
589 3300025981 Ga0207640_10011737 Ga0207640_100117372 351
590 3300026067 Ga0207678_10000002 Ga0207678_10000002310 351
591 3300026067 Ga0207678_10008084 Ga0207678_100080847 351
592 3300026078 Ga0207702_10001439 Ga0207702_1000143919 351
593 3300026078 Ga0207702_10001983 Ga0207702_1000198313 351
594 3300026078 Ga0207702_10082959 Ga0207702_100829592 351
595 3300026089 Ga0207648_10000515 Ga0207648_1000051534 351
596 3300026089 Ga0207648_10072375 Ga0207648_100723752 351
597 3300026116 Ga0207674_10004769 Ga0207674_100047693 351
598 3300026142 Ga0207698_10018160 Ga0207698_100181602 351
599 3300026142 Ga0207698_10250139 Ga0207698_102501392 351
600 3300027360 Ga0209969_1002573 Ga0209969_10025732 351
601 3300027378 Ga0209981_1002023 Ga0209981_10020232 351
602 3300027462 Ga0210000_1001879 Ga0210000_10018793 351
603 3300027471 Ga0209995_1000468 Ga0209995_10004686 351
604 3300027526 Ga0209968_1005613 Ga0209968_10056132 351
605 3300027543 Ga0209999_1007712 Ga0209999_10077122 351
606 3300027552 Ga0209982_1007932 Ga0209982_10079322 351
607 3300027666 Ga0209282_1000031 Ga0209282_100003194 351
608 3300027876 Ga0209974_10016343 Ga0209974_100163432 351
609 3300028666 Ga0265336_10000325 Ga0265336_1000032517 351
610 3300028786 Ga0307517_10061963 Ga0307517_100619632 351
611 3300028794 Ga0307515_10014346 Ga0307515_1001434614 351
612 3300029957 Ga0265324_10001988 Ga0265324_100019886 351
613 3300030521 Ga0307511_10136090 Ga0307511_101360902 351
614 3300030522 Ga0307512_10016010 Ga0307512_100160103 351
615 3300031247 Ga0265340_10053273 Ga0265340_100532732 351
616 3300031507 Ga0307509_10000234 Ga0307509_1000023430 351
617 3300031548 Ga0307408_100067111 Ga0307408_1000671112 351
618 3300031649 Ga0307514_10001152 Ga0307514_100011528 351
619 3300031711 Ga0265314_10036837 Ga0265314_100368372 351
620 3300031730 Ga0307516_10000398 Ga0307516_100003981 351
621 3300031730 Ga0307516_10000984 Ga0307516_100009845 351
622 3300031730 Ga0307516_10003708 Ga0307516_1000370817 351
623 3300031731 Ga0307405_10000483 Ga0307405_100004831 351
624 3300031901 Ga0307406_10016088 Ga0307406_100160881 351
625 3300031911 Ga0307412_10081950 Ga0307412_100819501 351
626 3300032002 Ga0307416_100021143 Ga0307416_1000211434 351
627 3300032004 Ga0307414_10021391 Ga0307414_100213914 351
628 3300032005 Ga0307411_10000973 Ga0307411_1000097310 351
629 3300036401 Ga0373937_0103189 Ga0373937_0103189_823_1938 351
630 3300037068 Ga0373925_0027214 Ga0373925_0027214_2618_3730 351
631 3300037312 Ga0395899_0047536 Ga0395899_0047536_1930_3042 351
632 3300037418 Ga0395900_0019530 Ga0395900_0019530_1370_2482 351
633 3300037418 Ga0395900_0140487 Ga0395900_0140487_1321_2421 351
634 3300037466 Ga0395898_0063380 Ga0395898_0063380_323_1423 351
635 3300037471 Ga0395905_0005002 Ga0395905_0005002_3936_5048 351
636 3300037471 Ga0395905_0068289 Ga0395905_0068289_1740_2885 351
637 3300037471 Ga0395905_0077996 Ga0395905_0077996_1926_3056 351
638 3300038443 Ga0395901_0045670 Ga0395901_0045670_1491_2606 351
639 3300038443 Ga0395901_0143147 Ga0395901_0143147_1253_2365 351
640 3300039447 Ga0436361_0082864 Ga0436361_0082864_52795_53913 351
641 3300039447 Ga0436361_0664726 Ga0436361_0664726_9956_11077 351
642 3300042156 Ga0439446_0057215 Ga0439446_0057215_24_1148 351
643 3300042876 Ga0451577_0058754 Ga0451577_0058754_1332_2450 351
644 3300042876 Ga0451577_0093774 Ga0451577_0093774_905_2017 351
645 3300044656 Ga0466969_0004296 Ga0466969_0004296_825_1961 351
646 3300044683 Ga0466965_0015556 Ga0466965_0015556_2050_3168 351
647 3300044684 Ga0466966_0003784 Ga0466966_0003784_3368_4504 351
648 3300044706 Ga0466964_0005251 Ga0466964_0005251_2267_3403 351
649 3300044712 Ga0453684_0411093 Ga0453684_0411093_183_1319 351
650 3300044735 Ga0466968_0028155 Ga0466968_0028155_871_1989 351
651 3300044765 Ga0466970_0040863 Ga0466970_0040863_446_1582 351
652 3300044842 Ga0466957_0022668 Ga0466957_0022668_498_1610 351
653 3300044842 Ga0466957_0047980 Ga0466957_0047980_898_2034 351
654 3300044901 Ga0466960_0083871 Ga0466960_0083871_251_1381 351
655 3300045049 Ga0466959_0000664 Ga0466959_0000664_16378_17496 351
656 3300045051 Ga0451576_0019755 Ga0451576_0019755_4154_5251 351
657 3300045836 Ga0466958_0016990 Ga0466958_0016990_2078_3196 351
658 3300045976 Ga0466967_0016110 Ga0466967_0016110_4273_5409 351
659 3300045976 Ga0466967_0079232 Ga0466967_0079232_287_1405 351
660 3300046454 Ga0495592_0010885 Ga0495592_0010885_1004_2119 351
661 3300046454 Ga0495592_0034937 Ga0495592_0034937_999_2105 351
662 3300046458 Ga0495591_000607 Ga0495591_000607_3809_4915 351
663 3300046459 Ga0495629_0004690 Ga0495629_0004690_8978_10084 351
664 3300046462 Ga0495651_0096470 Ga0495651_0096470_611_1726 351
665 3300046471 Ga0495650_0005641 Ga0495650_0005641_1305_2420 351
666 3300046471 Ga0495650_0005687 Ga0495650_0005687_729_1835 351
667 3300046472 Ga0495580_0014357 Ga0495580_0014357_1636_2742 351
668 3300046475 Ga0495639_0105127 Ga0495639_0105127_165_1280 351
669 3300046477 Ga0495664_0034823 Ga0495664_0034823_1297_2403 351
670 3300046491 Ga0495584_0027192 Ga0495584_0027192_1666_2766 351
671 3300046500 Ga0495596_0002606 Ga0495596_0002606_2055_3161 351
672 3300046506 Ga0495583_0000866 Ga0495583_0000866_4999_6114 351
673 3300046507 Ga0495606_0000127 Ga0495606_0000127_10630_11730 351
674 3300046507 Ga0495606_0005178 Ga0495606_0005178_5576_6691 351
675 3300046511 Ga0495608_0002232 Ga0495608_0002232_5759_6865 351
676 3300046516 Ga0495628_0312254 Ga0495628_0312254_29_1135 351
677 3300046517 Ga0495630_0005459 Ga0495630_0005459_1634_2740 351
678 3300046526 Ga0495666_0003508 Ga0495666_0003508_5080_6186 351
679 3300046529 Ga0495652_0023647 Ga0495652_0023647_29_1135 351
680 3300046529 Ga0495652_0121013 Ga0495652_0121013_236_1351 351
681 3300046531 Ga0495665_0031536 Ga0495665_0031536_1250_2356 351
682 3300046533 Ga0495640_0010264 Ga0495640_0010264_145_1251 351
683 3300046536 Ga0495587_0004383 Ga0495587_0004383_6247_7353 351
684 3300046536 Ga0495587_0084225 Ga0495587_0084225_126_1241 351
685 3300046539 Ga0495621_0009589 Ga0495621_0009589_1797_2909 351
686 3300046543 Ga0495645_0057531 Ga0495645_0057531_1618_2733 351
687 3300046642 Ga0495634_0015664 Ga0495634_0015664_157_1263 351
688 3300046660 Ga0495625_0011371 Ga0495625_0011371_5034_6149 351
689 3300046660 Ga0495625_0025801 Ga0495625_0025801_1519_2622 351
690 3300046663 Ga0495635_0001381 Ga0495635_0001381_6372_7478 351
691 3300046665 Ga0495661_0023528 Ga0495661_0023528_1264_2370 351
692 3300046674 Ga0495588_0007649 Ga0495588_0007649_2243_3343 351
693 3300046674 Ga0495588_0013517 Ga0495588_0013517_1014_2114 351
694 3300046678 Ga0495599_0001603 Ga0495599_0001603_752_1867 351
695 3300046678 Ga0495599_0092489 Ga0495599_0092489_623_1729 351
696 3300046680 Ga0495646_0034513 Ga0495646_0034513_1986_3092 351
697 3300046689 Ga0495613_0002519 Ga0495613_0002519_1258_2364 351
698 3300046694 Ga0495649_0004080 Ga0495649_0004080_3455_4570 351
699 3300046794 Ga0495589_0000923 Ga0495589_0000923_15239_16345 351
700 3300046809 Ga0495600_0073499 Ga0495600_0073499_627_1742 351
701 3300047315 Ga0495581_0060891 Ga0495581_0060891_1021_2127 351
702 3300047322 Ga0495680_0083663 Ga0495680_0083663_1233_2339 351
703 3300047323 Ga0495683_0002247 Ga0495683_0002247_4308_5414 351
704 3300047444 Ga0495675_0047979 Ga0495675_0047979_1569_2675 351
705 3300047673 Ga0495593_0003496 Ga0495593_0003496_1729_2835 351
706 3300048088 Ga0495602_0052137 Ga0495602_0052137_1636_2742 351
707 3300048089 Ga0495614_0003100 Ga0495614_0003100_4919_6025 351
708 3300048907 Ga0496104_0012365 Ga0496104_0012365_2133_3245 351
709 3300048909 Ga0496106_0048548 Ga0496106_0048548_620_1732 351
710 3300048912 Ga0496109_0146014 Ga0496109_0146014_421_1554 351
711 3300048917 Ga0496114_0122128 Ga0496114_0122128_591_1715 351
712 3300048919 Ga0496116_0005538 Ga0496116_0005538_8898_10001 351
713 3300048921 Ga0496118_0005614 Ga0496118_0005614_6678_7784 351
714 3300048926 Ga0496123_0004424 Ga0496123_0004424_8686_9789 351
715 3300048927 Ga0496124_0000786 Ga0496124_0000786_47312_48421 351
716 3300048928 Ga0496125_0013748 Ga0496125_0013748_4601_5710 351
717 3300049523 Ga0501300_003548 Ga0501300_003548_266_1369 351
718 3300049571 Ga0501034_0000188 Ga0501034_0000188_51422_52525 351
719 3300049575 Ga0501039_0198151 Ga0501039_0198151_230_1342 351
720 3300049585 Ga0501069_0154301 Ga0501069_0154301_96_1211 351
721 3300049586 Ga0501070_0007594 Ga0501070_0007594_4044_5156 351
722 3300049589 Ga0501073_0005474 Ga0501073_0005474_5232_6344 351
723 3300049590 Ga0501074_0014295 Ga0501074_0014295_4392_5507 351
724 3300049741 Ga0501079_0048511 Ga0501079_0048511_244_1356 351
725 3300049742 Ga0501080_0003503 Ga0501080_0003503_11490_12602 351
726 3300049744 Ga0501083_0000223 Ga0501083_0000223_32788_33900 351
727 3300049770 Ga0501273_004131 Ga0501273_004131_36_1259 351
728 3300049776 Ga0501280_000120 Ga0501280_000120_7084_8187 351
729 3300049777 Ga0501281_00899 Ga0501281_00899_1008_2231 351
730 3300050489 nmdc:mga03683_78057_c1 nmdc:mga03683_78057_c1_50_1213 351
731 3300050491 nmdc:mga00v17_248424_c1 nmdc:mga00v17_248424_c1_13_1140 351
732 3300050493 nmdc:mga0k408_44627_c1 nmdc:mga0k408_44627_c1_1198_2310 351
733 3300050493 nmdc:mga0k408_59676_c1 nmdc:mga0k408_59676_c1_1050_2159 351
734 3300050496 nmdc:mga07m45_2314_c1 nmdc:mga07m45_2314_c1_2674_3789 351
735 3300050507 nmdc:mga05p37_588_c1 nmdc:mga05p37_588_c1_16140_17237 351
736 3300050508 nmdc:mga09592_116_c1 nmdc:mga09592_116_c1_18204_19301 351
737 3300050508 nmdc:mga09592_123169_c1 nmdc:mga09592_123169_c1_61_1173 351
738 3300050510 nmdc:mga06r32_57165_c1 nmdc:mga06r32_57165_c1_263_1360 351
739 3300050511 nmdc:mga08y16_16326_c1 nmdc:mga08y16_16326_c1_1557_2669 351
740 3300050513 nmdc:mga0rr50_73361_c1 nmdc:mga0rr50_73361_c1_1088_2200 351
741 3300050514 nmdc:mga08x19_35743_c1 nmdc:mga08x19_35743_c1_1280_2392 351
742 3300050515 nmdc:mga0a205_196811_c1 nmdc:mga0a205_196811_c1_617_1732 351
743 3300053080 Ga0500635_0000055 Ga0500635_0000055_67870_68985 351
744 3300053086 Ga0500578_0015088 Ga0500578_0015088_3054_4166 351
745 3300053096 Ga0500641_0046324 Ga0500641_0046324_155_1270 351
746 3300053177 Ga0500636_0014675 Ga0500636_0014675_1504_2619 351
747 3300053730 Ga0500645_004966 Ga0500645_004966_729_1841 351
748 3300054114 Ga0501084_0049927 Ga0501084_0049927_2220_3332 351
749 3300059421 Ga0590071_006216 Ga0590071_006216_843_2156 351
750 3300059643 Ga0587072_000424 Ga0587072_000424_453_1550 351
751 3300059647 Ga0587079_017963 Ga0587079_017963_70_1170 351
752 3300061719 Ga0466962_0006139 Ga0466962_0006139_3258_4376 351
753 iso_pu_bacteria 644736347 644748554 351

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00848

Ring_hydroxyl_A

Ring hydroxylating alpha subunit (catalytic domain)

222

426

0.92

PF00355

Rieske

Rieske [2Fe-2S] domain

100

192

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qup-assembly1.cif.gz_A crystal structure of stachydrine demethylase with n-methyl proline from low x-ray dose composite datasets 0.7719 15 350
3bcc-assembly1.cif.gz_E-2 stigmatellin and antimycin bound cytochrome bc1 complex from chicken 0.7687 71 142
3h1i-assembly1.cif.gz_E stigmatellin and antimycin bound cytochrome bc1 complex from chicken 0.7646 71 142
2a06-assembly1.cif.gz_R bovine cytochrome bc1 complex with stigmatellin bound 0.7578 73 142
6zgp-assembly1.cif.gz_C crystal structure of the quaternary ammonium rieske monooxygenase cnta in complex with inhibitor mmv12 (mmv020670) 0.7562 15 351
ID Description Score Start End Superfamily
af_B9FEC3_96_233_2.90.10.10 Mainly Beta;Orthogonal Prism;Agglutinin, subunit A;Bulb-type lectin domain 0.87 64 78 2.90.10.10
af_P0ABR7_49_169_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8373 43 150 2.102.10.10
3n0qA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8344 41 145 2.102.10.10
af_A0A1D8PL08_48_170_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8306 42 145 2.102.10.10
2xrxU02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8092 41 147 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A840RCB1-F1-model_v4 Choline monooxygenase (EC 1.14.15.7) 0.9898 16 351 GO:0004497
GO:0005506
GO:0051537
AF-A0A7Y7LMA7-F1-model_v4 Choline monooxygenase (EC 1.14.15.7) 0.9877 33 351 GO:0005506
GO:0019133
GO:0051537
AF-A0A554WU25-F1-model_v4 2-aminobenzenesulfonate 2,3-dioxygenase subunit alpha (EC 1.14.12.14) 0.9861 16 351 GO:0005506
GO:0018627
GO:0051537
AF-A0A353YAI2-F1-model_v4 Rieske (2Fe-2S) protein 0.9844 15 351 GO:0005506
GO:0016491
GO:0051537
AF-I3CRD7-F1-model_v4 Dioxygenase subunit alpha oxidoreductase 0.9842 48 350 GO:0005506
GO:0051213
GO:0051537

Feature Viewer

pLDDT pTM Quality
91.9 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map