F479197
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 753 | 413 | 720 | 364 |
Family's Representative Sequence
| Representative Sequence | 3300005616|Ga0068852_100018167|Ga0068852_1000181675 |
| Length | 428 |
| Sequence | MADPVIGAHRPSLGTIRGPPARTLRGGFCSFFLPQDTCRGPSWSWGGPTLFHWEIPGIMSDLSITLEALERTRSQLSVNAYFDEDLFRREMELIYQHGPRYLGHELSVPEVGDYHALLQEGEGRALVRTPTGIELISNVCRHRQAVMLRGRGNTRSNIVCPLHRWTYDLKGELLGAPHFAEDPCLNLNRYKTRTWNGMVFEDNGRDIAADLASLGPRADLDFSGYVLDKVQAHECNYNWKTFIEVYLEDYHVGPFHPGLGQFVTCDDLRWEFAPNFSVQTVGANNALAKAGSDIYRKWHDAVLAFRGGEPPKQGAIWLTYYPNIMVEWXXXXLVVSTLHPKGPQKTINVVEFYYPEEIAAFEPEFMQAQQAAYWETCEEDDEIALRMDAGRKALMERGDDEAGPYQSPMEDGMQQFHEWYRKVMKPRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 3 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 4 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 5 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 6 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 7 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 8 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 9 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 10 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 11 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 12 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 13 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 14 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 15 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 16 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 17 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 18 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 19 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 20 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 21 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 22 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 23 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 24 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 25 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 26 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 27 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 28 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 29 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 30 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 31 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 32 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 33 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 34 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 35 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 36 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 37 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 38 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 39 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 40 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 41 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 42 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 45 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 48 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 49 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 50 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 53 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 54 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 55 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 59 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 60 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 65 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 68 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 70 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 78 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 91 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 94 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 96 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 101 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 103 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 104 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 105 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 106 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 107 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 108 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 109 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 110 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 111 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 112 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 113 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 114 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 115 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 116 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 117 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 118 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 119 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 120 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 122 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 123 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 124 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 125 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 126 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 127 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 128 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 129 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 131 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 132 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 158 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 161 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 164 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 177 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 233 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 241 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 246 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 247 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 248 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 249 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 250 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 251 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 253 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 254 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 255 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 256 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 257 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 258 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 259 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 260 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 261 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 262 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 263 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 264 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 265 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 266 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 267 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 268 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 269 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 270 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 271 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 272 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 273 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 274 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 276 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 277 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 280 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 281 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 282 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 283 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 284 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 285 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 286 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 287 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 288 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 289 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 290 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 291 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 292 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 293 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 294 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 295 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 296 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 297 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 298 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 299 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 300 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 301 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 302 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 303 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 304 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 305 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 306 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 307 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 308 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 309 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 354 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 355 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 356 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 358 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 359 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 360 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 361 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 362 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 363 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 364 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 365 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 379 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 380 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 384 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 385 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 386 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 389 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 390 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 391 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 392 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 400 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 401 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 402 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 403 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 405 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 407 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 409 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 412 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 413 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.82 |
| Metatranscriptomes | 0.8 |
| Isolates | 4.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17 |
| Nodule | 0.93 |
| Rhizoplane | 1.2 |
| Rhizosphere | 73.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000340 | 3300001979 | Bacteria | 19873 |
| 2 | JGI24740J21852_10020003 | 3300001979 | Bacteria | 2347 |
| 3 | JGI24743J22301_10006182 | 3300001991 | Bacteria | 2030 |
| 4 | JGI25156J39149_1000220 | 3300002705 | Bacteria | 39809 |
| 5 | JGI25156J39149_1006463 | 3300002705 | Bacteria | 3199 |
| 6 | JGI25156J39149_1013422 | 3300002705 | Bacteria | 1738 |
| 7 | JGI25154J39366_1000669 | 3300002738 | Bacteria | 15992 |
| 8 | JGI25154J39366_1001211 | 3300002738 | Bacteria | 9778 |
| 9 | JGI25157J39369_1000135 | 3300002741 | Bacteria | 61510 |
| 10 | JGI25152J39213_1003301 | 3300002773 | Bacteria | 5572 |
| 11 | JGI25150J39212_1007478 | 3300002774 | Bacteria | 2190 |
| 12 | JGI25151J46595_10000728 | 3300003187 | Bacteria | 27382 |
| 13 | JGI25151J46595_10003136 | 3300003187 | Bacteria | 9294 |
| 14 | JGI25151J46595_10004206 | 3300003187 | Bacteria | 7665 |
| 15 | JGI25151J46595_10018212 | 3300003187 | Bacteria | 3025 |
| 16 | rootH2_10005083 | 3300003320 | Bacteria | 8026 |
| 17 | Ga0055538_1000084 | 3300003751 | Bacteria | 81835 |
| 18 | Ga0055538_1005996 | 3300003751 | Bacteria | 1211 |
| 19 | Ga0055538_1005999 | 3300003751 | Bacteria | 1211 |
| 20 | Ga0055539_1000068 | 3300003752 | Bacteria | 134912 |
| 21 | Ga0055539_1000125 | 3300003752 | Bacteria | 81835 |
| 22 | Ga0055533_1000132 | 3300003756 | Bacteria | 81835 |
| 23 | Ga0055533_1000172 | 3300003756 | Bacteria | 58634 |
| 24 | Ga0055533_1000361 | 3300003756 | Bacteria | 19156 |
| 25 | Ga0055533_1004790 | 3300003756 | Bacteria | 2336 |
| 26 | Ga0055532_1000028 | 3300003758 | Bacteria | 234512 |
| 27 | Ga0055525_1000171 | 3300003759 | Bacteria | 81835 |
| 28 | Ga0055525_1000598 | 3300003759 | Bacteria | 15433 |
| 29 | Ga0055525_1000665 | 3300003759 | Bacteria | 13242 |
| 30 | Ga0055527_1003277 | 3300003760 | Bacteria | 2453 |
| 31 | Ga0055535_1000022 | 3300003761 | Bacteria | 234512 |
| 32 | Ga0055535_1000641 | 3300003761 | Bacteria | 27812 |
| 33 | Ga0055542_1001981 | 3300003762 | Bacteria | 7929 |
| 34 | Ga0055529_1000063 | 3300003763 | Bacteria | 181573 |
| 35 | Ga0055529_1000145 | 3300003763 | Bacteria | 101255 |
| 36 | Ga0055529_1000602 | 3300003763 | Bacteria | 27804 |
| 37 | Ga0055526_1001897 | 3300003771 | Bacteria | 14503 |
| 38 | Ga0055526_1011980 | 3300003771 | Bacteria | 3836 |
| 39 | Ga0055526_1019952 | 3300003771 | Bacteria | 2413 |
| 40 | Ga0055526_1033905 | 3300003771 | Bacteria | 1406 |
| 41 | Ga0055524_1000125 | 3300003775 | Bacteria | 90042 |
| 42 | Ga0055524_1000290 | 3300003775 | Bacteria | 48740 |
| 43 | Ga0055524_1009546 | 3300003775 | Bacteria | 3934 |
| 44 | Ga0055536_1000074 | 3300003781 | Bacteria | 84660 |
| 45 | Ga0055534_1002013 | 3300003784 | Bacteria | 7393 |
| 46 | Ga0055534_1003067 | 3300003784 | Bacteria | 5455 |
| 47 | Ga0055530_10006753 | 3300003791 | Bacteria | 5012 |
| 48 | Ga0055540_1000011 | 3300003792 | Bacteria | 282927 |
| 49 | Ga0055540_1009175 | 3300003792 | Bacteria | 3456 |
| 50 | Ga0055541_1000083 | 3300003841 | Bacteria | 81835 |
| 51 | Ga0055541_1002647 | 3300003841 | Bacteria | 3512 |
| 52 | Ga0055543_1002628 | 3300004625 | Bacteria | 5792 |
| 53 | Ga0065165_1000153 | 3300005262 | Bacteria | 120209 |
| 54 | Ga0065165_1000569 | 3300005262 | Bacteria | 54781 |
| 55 | Ga0065165_1000967 | 3300005262 | Bacteria | 36011 |
| 56 | Ga0065712_10024488 | 3300005290 | Bacteria | 1476 |
| 57 | Ga0065712_10078545 | 3300005290 | Bacteria | 3332 |
| 58 | Ga0070658_10006078 | 3300005327 | Bacteria | 9790 |
| 59 | Ga0070658_10014263 | 3300005327 | Bacteria | 6376 |
| 60 | Ga0070658_10051266 | 3300005327 | Bacteria | 3344 |
| 61 | Ga0070676_10001034 | 3300005328 | Bacteria | 13850 |
| 62 | Ga0070676_10059807 | 3300005328 | Bacteria | 2261 |
| 63 | Ga0070690_100027241 | 3300005330 | Bacteria | 3532 |
| 64 | Ga0070690_100047414 | 3300005330 | Bacteria | 2734 |
| 65 | Ga0070690_100050076 | 3300005330 | Bacteria | 2665 |
| 66 | Ga0070670_100012213 | 3300005331 | Bacteria | 7346 |
| 67 | Ga0068869_100005217 | 3300005334 | Bacteria | 8157 |
| 68 | Ga0070666_10076811 | 3300005335 | Bacteria | 2279 |
| 69 | Ga0070680_100181391 | 3300005336 | Bacteria | 1773 |
| 70 | Ga0068868_100262068 | 3300005338 | Bacteria | 1458 |
| 71 | Ga0070660_100055514 | 3300005339 | Bacteria | 3061 |
| 72 | Ga0070660_100067859 | 3300005339 | Bacteria | 2779 |
| 73 | Ga0070689_100115781 | 3300005340 | Bacteria | 2137 |
| 74 | Ga0070689_100177005 | 3300005340 | Bacteria | 1731 |
| 75 | Ga0070661_100000127 | 3300005344 | Bacteria | 63148 |
| 76 | Ga0070661_100001108 | 3300005344 | Bacteria | 18946 |
| 77 | Ga0070661_100016464 | 3300005344 | Bacteria | 5227 |
| 78 | Ga0070661_100150359 | 3300005344 | Bacteria | 1760 |
| 79 | Ga0070692_10147313 | 3300005345 | Bacteria | 1338 |
| 80 | Ga0070669_100002753 | 3300005353 | Bacteria | 12687 |
| 81 | Ga0070669_100163053 | 3300005353 | Bacteria | 1734 |
| 82 | Ga0070669_100267501 | 3300005353 | Bacteria | 1366 |
| 83 | Ga0070675_100011301 | 3300005354 | Bacteria | 6987 |
| 84 | Ga0070675_100193237 | 3300005354 | Bacteria | 1764 |
| 85 | Ga0070675_100206976 | 3300005354 | Bacteria | 1704 |
| 86 | Ga0070675_100428258 | 3300005354 | Bacteria | 1184 |
| 87 | Ga0070671_100005776 | 3300005355 | Bacteria | 9855 |
| 88 | Ga0070671_100006504 | 3300005355 | Bacteria | 9343 |
| 89 | Ga0070671_100049616 | 3300005355 | Bacteria | 3492 |
| 90 | Ga0070671_100123151 | 3300005355 | Bacteria | 2183 |
| 91 | Ga0070674_100037117 | 3300005356 | Bacteria | 3275 |
| 92 | Ga0070674_100118645 | 3300005356 | Bacteria | 1955 |
| 93 | Ga0070674_100121168 | 3300005356 | Bacteria | 1937 |
| 94 | Ga0070673_100011122 | 3300005364 | Bacteria | 6135 |
| 95 | Ga0070673_100103091 | 3300005364 | Bacteria | 2353 |
| 96 | Ga0070688_100075300 | 3300005365 | Bacteria | 2169 |
| 97 | Ga0070659_100001014 | 3300005366 | Bacteria | 20566 |
| 98 | Ga0070659_100066418 | 3300005366 | Bacteria | 2858 |
| 99 | Ga0070667_100222985 | 3300005367 | Bacteria | 1679 |
| 100 | Ga0070714_100050194 | 3300005435 | Bacteria | 3553 |
| 101 | Ga0070713_100087771 | 3300005436 | Bacteria | 2668 |
| 102 | Ga0070701_10033350 | 3300005438 | Bacteria | 2572 |
| 103 | Ga0070705_100037898 | 3300005440 | Bacteria | 2723 |
| 104 | Ga0070705_100195030 | 3300005440 | Bacteria | 1384 |
| 105 | Ga0070700_100092176 | 3300005441 | Bacteria | 1979 |
| 106 | Ga0070694_100066092 | 3300005444 | Bacteria | 2480 |
| 107 | Ga0070663_100000005 | 3300005455 | Bacteria | 251758 |
| 108 | Ga0070663_100001510 | 3300005455 | Bacteria | 12793 |
| 109 | Ga0070678_100062876 | 3300005456 | Bacteria | 2743 |
| 110 | Ga0070662_100004421 | 3300005457 | Bacteria | 8886 |
| 111 | Ga0070681_10006660 | 3300005458 | Bacteria | 11245 |
| 112 | Ga0068867_100000249 | 3300005459 | Bacteria | 35572 |
| 113 | Ga0068867_100005126 | 3300005459 | Bacteria | 9258 |
| 114 | Ga0068867_100028944 | 3300005459 | Bacteria | 3989 |
| 115 | Ga0070685_10038814 | 3300005466 | Bacteria | 2702 |
| 116 | Ga0070698_100024331 | 3300005471 | Bacteria | 6319 |
| 117 | Ga0070698_100301761 | 3300005471 | Bacteria | 1532 |
| 118 | Ga0070679_100010085 | 3300005530 | Bacteria | 8952 |
| 119 | Ga0070679_100015526 | 3300005530 | Bacteria | 7317 |
| 120 | Ga0070684_100027216 | 3300005535 | Bacteria | 4824 |
| 121 | Ga0068853_100074850 | 3300005539 | Bacteria | 2955 |
| 122 | Ga0070672_100000520 | 3300005543 | Bacteria | 22520 |
| 123 | Ga0070672_100026519 | 3300005543 | Bacteria | 4313 |
| 124 | Ga0070672_100028153 | 3300005543 | Bacteria | 4199 |
| 125 | Ga0070696_100033303 | 3300005546 | Bacteria | 3539 |
| 126 | Ga0070693_100110608 | 3300005547 | Bacteria | 1689 |
| 127 | Ga0070704_100010535 | 3300005549 | Bacteria | 5628 |
| 128 | Ga0068855_100002213 | 3300005563 | Bacteria | 24061 |
| 129 | Ga0068855_100017466 | 3300005563 | Bacteria | 8629 |
| 130 | Ga0068855_100030309 | 3300005563 | Bacteria | 6471 |
| 131 | Ga0068855_100043110 | 3300005563 | Bacteria | 5346 |
| 132 | Ga0068855_100048452 | 3300005563 | Bacteria | 5014 |
| 133 | Ga0068855_100165615 | 3300005563 | Bacteria | 2506 |
| 134 | Ga0070664_100000001 | 3300005564 | Bacteria | 551832 |
| 135 | Ga0070664_100006317 | 3300005564 | Bacteria | 9561 |
| 136 | Ga0070664_100058075 | 3300005564 | Bacteria | 3290 |
| 137 | Ga0068857_100019209 | 3300005577 | Bacteria | 5999 |
| 138 | Ga0068854_100000360 | 3300005578 | Bacteria | 29154 |
| 139 | Ga0068854_100050767 | 3300005578 | Bacteria | 2969 |
| 140 | Ga0068854_100128870 | 3300005578 | Bacteria | 1930 |
| 141 | Ga0068856_100000008 | 3300005614 | Bacteria | 190886 |
| 142 | Ga0068856_100017028 | 3300005614 | Bacteria | 7044 |
| 143 | Ga0068856_100026163 | 3300005614 | Bacteria | 5690 |
| 144 | Ga0068852_100001134 | 3300005616 | Bacteria | 17618 |
| 145 | Ga0068852_100018167 | 3300005616 | Bacteria | 5536 |
| 146 | Ga0068852_100019290 | 3300005616 | Bacteria | 5394 |
| 147 | Ga0068852_100030609 | 3300005616 | Bacteria | 4433 |
| 148 | Ga0068852_100065922 | 3300005616 | Bacteria | 3161 |
| 149 | Ga0068852_100224064 | 3300005616 | Bacteria | 1789 |
| 150 | Ga0068859_100033628 | 3300005617 | Bacteria | 5149 |
| 151 | Ga0068859_100043018 | 3300005617 | Bacteria | 4539 |
| 152 | Ga0068859_100321316 | 3300005617 | Bacteria | 1642 |
| 153 | Ga0068859_100335794 | 3300005617 | Bacteria | 1605 |
| 154 | Ga0068864_100017643 | 3300005618 | Bacteria | 5951 |
| 155 | Ga0068864_100039034 | 3300005618 | Bacteria | 4057 |
| 156 | Ga0068861_100067562 | 3300005719 | Bacteria | 2759 |
| 157 | Ga0068861_100155522 | 3300005719 | Bacteria | 1880 |
| 158 | Ga0068851_10003401 | 3300005834 | Bacteria | 7083 |
| 159 | Ga0068863_100007733 | 3300005841 | Bacteria | 10512 |
| 160 | Ga0068863_100058519 | 3300005841 | Bacteria | 3646 |
| 161 | Ga0068863_100087822 | 3300005841 | Bacteria | 2946 |
| 162 | Ga0068863_100250424 | 3300005841 | Bacteria | 1711 |
| 163 | Ga0068858_100056576 | 3300005842 | Bacteria | 3624 |
| 164 | Ga0068858_100083388 | 3300005842 | Bacteria | 2972 |
| 165 | Ga0068858_100129462 | 3300005842 | Bacteria | 2365 |
| 166 | Ga0068860_100006790 | 3300005843 | Bacteria | 11470 |
| 167 | Ga0068860_100062070 | 3300005843 | Bacteria | 3551 |
| 168 | Ga0068862_100045535 | 3300005844 | Bacteria | 3744 |
| 169 | Ga0068862_100084626 | 3300005844 | Bacteria | 2755 |
| 170 | Ga0075364_10067106 | 3300006051 | Bacteria | 2358 |
| 171 | Ga0075432_10025280 | 3300006058 | Bacteria | 2037 |
| 172 | Ga0075362_10005489 | 3300006177 | Bacteria | 4646 |
| 173 | Ga0075367_10006872 | 3300006178 | Bacteria | 5789 |
| 174 | Ga0075369_10006951 | 3300006186 | Bacteria | 4297 |
| 175 | Ga0075366_10007379 | 3300006195 | Bacteria | 6069 |
| 176 | Ga0075366_10061476 | 3300006195 | Bacteria | 2232 |
| 177 | Ga0075366_10071927 | 3300006195 | Bacteria | 2061 |
| 178 | Ga0075366_10102119 | 3300006195 | Bacteria | 1721 |
| 179 | Ga0097621_100051122 | 3300006237 | Bacteria | 3362 |
| 180 | Ga0075370_10004055 | 3300006353 | Bacteria | 7042 |
| 181 | Ga0075370_10005449 | 3300006353 | Bacteria | 6331 |
| 182 | Ga0075370_10137032 | 3300006353 | Bacteria | 1430 |
| 183 | Ga0068871_100009363 | 3300006358 | Bacteria | 7092 |
| 184 | Ga0068871_100015078 | 3300006358 | Bacteria | 5776 |
| 185 | Ga0068871_100183974 | 3300006358 | Bacteria | 1797 |
| 186 | Ga0075428_100045170 | 3300006844 | Bacteria | 4841 |
| 187 | Ga0075431_100052358 | 3300006847 | Bacteria | 4209 |
| 188 | Ga0075433_10186500 | 3300006852 | Bacteria | 1845 |
| 189 | Ga0075433_10266638 | 3300006852 | Bacteria | 1518 |
| 190 | Ga0075429_100000146 | 3300006880 | Bacteria | 43486 |
| 191 | Ga0075429_100047747 | 3300006880 | Bacteria | 3724 |
| 192 | Ga0068865_100029750 | 3300006881 | Bacteria | 3628 |
| 193 | Ga0068865_100054946 | 3300006881 | Bacteria | 2770 |
| 194 | Ga0075436_100072343 | 3300006914 | Bacteria | 2386 |
| 195 | Ga0097620_100033628 | 3300006931 | Bacteria | 5149 |
| 196 | Ga0097620_100043018 | 3300006931 | Bacteria | 4539 |
| 197 | Ga0097620_100321360 | 3300006931 | Bacteria | 1642 |
| 198 | Ga0097620_100335794 | 3300006931 | Bacteria | 1605 |
| 199 | Ga0099826_10000015 | 3300006948 | Bacteria | 254837 |
| 200 | Ga0075435_100307001 | 3300007076 | Bacteria | 1357 |
| 201 | Ga0105240_10006302 | 3300009093 | Bacteria | 17457 |
| 202 | Ga0105240_10103453 | 3300009093 | Bacteria | 3460 |
| 203 | Ga0105240_10142898 | 3300009093 | Bacteria | 2859 |
| 204 | Ga0111539_10001478 | 3300009094 | Bacteria | 31398 |
| 205 | Ga0111539_10077596 | 3300009094 | Bacteria | 3909 |
| 206 | Ga0105245_10101426 | 3300009098 | Bacteria | 2664 |
| 207 | Ga0105245_10181528 | 3300009098 | Bacteria | 2011 |
| 208 | Ga0114129_10011675 | 3300009147 | Bacteria | 12502 |
| 209 | Ga0114129_10025565 | 3300009147 | Bacteria | 8366 |
| 210 | Ga0114129_10597416 | 3300009147 | Bacteria | 1430 |
| 211 | Ga0105243_10002157 | 3300009148 | Bacteria | 16630 |
| 212 | Ga0105241_10008816 | 3300009174 | Bacteria | 7411 |
| 213 | Ga0105241_10097593 | 3300009174 | Bacteria | 2330 |
| 214 | Ga0105241_10267668 | 3300009174 | Bacteria | 1455 |
| 215 | Ga0105242_10013549 | 3300009176 | Bacteria | 6308 |
| 216 | Ga0105248_10001017 | 3300009177 | Bacteria | 30997 |
| 217 | Ga0105248_10016620 | 3300009177 | Bacteria | 8101 |
| 218 | Ga0105248_10048319 | 3300009177 | Bacteria | 4773 |
| 219 | Ga0105248_10063274 | 3300009177 | Bacteria | 4153 |
| 220 | Ga0105248_10116598 | 3300009177 | Bacteria | 3012 |
| 221 | Ga0105237_10105532 | 3300009545 | Bacteria | 2809 |
| 222 | Ga0105237_10208066 | 3300009545 | Bacteria | 1957 |
| 223 | Ga0105238_10028556 | 3300009551 | Bacteria | 5683 |
| 224 | Ga0105238_10037056 | 3300009551 | Bacteria | 4959 |
| 225 | Ga0105238_10072034 | 3300009551 | Bacteria | 3453 |
| 226 | Ga0105249_10053995 | 3300009553 | Bacteria | 3673 |
| 227 | Ga0105239_10056778 | 3300010375 | Bacteria | 4294 |
| 228 | Ga0157373_10000732 | 3300013100 | Bacteria | 25563 |
| 229 | Ga0157373_10004520 | 3300013100 | Bacteria | 10460 |
| 230 | Ga0157371_10000035 | 3300013102 | Bacteria | 223396 |
| 231 | Ga0157370_10000021 | 3300013104 | Bacteria | 166168 |
| 232 | Ga0157370_10001810 | 3300013104 | Bacteria | 26364 |
| 233 | Ga0157370_10209105 | 3300013104 | Bacteria | 1809 |
| 234 | Ga0157369_10008405 | 3300013105 | Bacteria | 11835 |
| 235 | Ga0157374_10018896 | 3300013296 | Bacteria | 6093 |
| 236 | Ga0157374_10076605 | 3300013296 | Bacteria | 3163 |
| 237 | Ga0157378_10009642 | 3300013297 | Bacteria | 8406 |
| 238 | Ga0157378_10017857 | 3300013297 | Bacteria | 6227 |
| 239 | Ga0157378_10066292 | 3300013297 | Bacteria | 3234 |
| 240 | Ga0157378_10087737 | 3300013297 | Bacteria | 2822 |
| 241 | Ga0163162_10164616 | 3300013306 | Bacteria | 2341 |
| 242 | Ga0163162_10256805 | 3300013306 | Bacteria | 1879 |
| 243 | Ga0163162_10266275 | 3300013306 | Bacteria | 1845 |
| 244 | Ga0157372_10000331 | 3300013307 | Bacteria | 51927 |
| 245 | Ga0157372_10023625 | 3300013307 | Bacteria | 6669 |
| 246 | Ga0157372_10032119 | 3300013307 | Bacteria | 5754 |
| 247 | Ga0157372_10042431 | 3300013307 | Bacteria | 5032 |
| 248 | Ga0157372_10341950 | 3300013307 | Bacteria | 1743 |
| 249 | Ga0157375_10046145 | 3300013308 | Bacteria | 4246 |
| 250 | Ga0157375_10166888 | 3300013308 | Bacteria | 2347 |
| 251 | Ga0157375_10278942 | 3300013308 | Bacteria | 1834 |
| 252 | Ga0163163_10186391 | 3300014325 | Bacteria | 2123 |
| 253 | Ga0157380_10018320 | 3300014326 | Bacteria | 5196 |
| 254 | Ga0157377_10000016 | 3300014745 | Bacteria | 190613 |
| 255 | Ga0157377_10005227 | 3300014745 | Bacteria | 6078 |
| 256 | Ga0157377_10098814 | 3300014745 | Bacteria | 1735 |
| 257 | Ga0157379_10014692 | 3300014968 | Bacteria | 6868 |
| 258 | Ga0157379_10205024 | 3300014968 | Bacteria | 1784 |
| 259 | Ga0182006_1000956 | 3300015261 | Bacteria | 19183 |
| 260 | Ga0163161_10008757 | 3300017792 | Bacteria | 6994 |
| 261 | Ga0163161_10063937 | 3300017792 | Bacteria | 2683 |
| 262 | Ga0163161_10069050 | 3300017792 | Bacteria | 2583 |
| 263 | Ga0197907_10277493 | 3300020069 | Bacteria | 1351 |
| 264 | Ga0206355_1056333 | 3300020076 | Bacteria | 1498 |
| 265 | Ga0206351_10481241 | 3300020077 | Bacteria | 1552 |
| 266 | Ga0154015_1042038 | 3300020610 | Bacteria | 50222 |
| 267 | Ga0213872_10000049 | 3300021361 | Bacteria | 109094 |
| 268 | Ga0213872_10001888 | 3300021361 | Bacteria | 12908 |
| 269 | Ga0213872_10002133 | 3300021361 | Bacteria | 11880 |
| 270 | Ga0213872_10002209 | 3300021361 | Bacteria | 11652 |
| 271 | Ga0213872_10007035 | 3300021361 | Bacteria | 5574 |
| 272 | Ga0213872_10012868 | 3300021361 | Bacteria | 3925 |
| 273 | Ga0213872_10020466 | 3300021361 | Bacteria | 3050 |
| 274 | Ga0213872_10030117 | 3300021361 | Bacteria | 2488 |
| 275 | Ga0209784_100009 | 3300025224 | Bacteria | 688031 |
| 276 | Ga0209784_100014 | 3300025224 | Bacteria | 496182 |
| 277 | Ga0209784_100505 | 3300025224 | Bacteria | 15204 |
| 278 | Ga0209566_100007 | 3300025225 | Bacteria | 688031 |
| 279 | Ga0209566_100011 | 3300025225 | Bacteria | 496182 |
| 280 | Ga0209566_100447 | 3300025225 | Bacteria | 30429 |
| 281 | Ga0209674_100018 | 3300025226 | Bacteria | 688031 |
| 282 | Ga0209674_100032 | 3300025226 | Bacteria | 426888 |
| 283 | Ga0209674_100088 | 3300025226 | Bacteria | 181554 |
| 284 | Ga0209674_100131 | 3300025226 | Bacteria | 118079 |
| 285 | Ga0209672_100217 | 3300025228 | Bacteria | 44942 |
| 286 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 287 | Ga0209563_100020 | 3300025230 | Bacteria | 688031 |
| 288 | Ga0209563_100029 | 3300025230 | Bacteria | 496182 |
| 289 | Ga0209563_100160 | 3300025230 | Bacteria | 58893 |
| 290 | Ga0207427_100296 | 3300025231 | Bacteria | 34920 |
| 291 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 292 | Ga0209258_100630 | 3300025242 | Bacteria | 27864 |
| 293 | Ga0209258_100869 | 3300025242 | Bacteria | 16009 |
| 294 | Ga0209646_1000058 | 3300025246 | Bacteria | 259999 |
| 295 | Ga0209646_1000214 | 3300025246 | Bacteria | 64093 |
| 296 | Ga0209026_1000059 | 3300025250 | Bacteria | 226652 |
| 297 | Ga0209677_100010 | 3300025253 | Bacteria | 688031 |
| 298 | Ga0209677_100042 | 3300025253 | Bacteria | 225037 |
| 299 | Ga0209677_100162 | 3300025253 | Bacteria | 58923 |
| 300 | Ga0209677_100226 | 3300025253 | Bacteria | 40136 |
| 301 | Ga0209677_104848 | 3300025253 | Bacteria | 3708 |
| 302 | Ga0209148_1000043 | 3300025254 | Bacteria | 461531 |
| 303 | Ga0209148_1003153 | 3300025254 | Bacteria | 4761 |
| 304 | Ga0209759_1000365 | 3300025256 | Bacteria | 56836 |
| 305 | Ga0209759_1001265 | 3300025256 | Bacteria | 15220 |
| 306 | Ga0209759_1002367 | 3300025256 | Bacteria | 8390 |
| 307 | Ga0209759_1002799 | 3300025256 | Bacteria | 7368 |
| 308 | Ga0209759_1009015 | 3300025256 | Bacteria | 3058 |
| 309 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 310 | Ga0209565_1000329 | 3300025263 | Bacteria | 42233 |
| 311 | Ga0209565_1002450 | 3300025263 | Bacteria | 6683 |
| 312 | Ga0209455_1000009 | 3300025272 | Bacteria | 1042273 |
| 313 | Ga0209455_1000508 | 3300025272 | Bacteria | 27836 |
| 314 | Ga0209673_1015229 | 3300025273 | Bacteria | 2933 |
| 315 | Ga0209675_1000070 | 3300025291 | Bacteria | 169161 |
| 316 | Ga0209675_1000644 | 3300025291 | Bacteria | 24798 |
| 317 | Ga0209675_1017519 | 3300025291 | Bacteria | 2043 |
| 318 | Ga0209676_1000012 | 3300025292 | Bacteria | 841431 |
| 319 | Ga0209025_1001428 | 3300025294 | Bacteria | 31518 |
| 320 | Ga0209025_1004660 | 3300025294 | Bacteria | 11725 |
| 321 | Ga0209025_1006958 | 3300025294 | Bacteria | 8594 |
| 322 | Ga0209564_1000139 | 3300025295 | Bacteria | 180328 |
| 323 | Ga0209564_1000359 | 3300025295 | Bacteria | 84631 |
| 324 | Ga0209564_1001697 | 3300025295 | Bacteria | 20841 |
| 325 | Ga0209564_1002980 | 3300025295 | Bacteria | 12164 |
| 326 | Ga0209758_1000052 | 3300025297 | Bacteria | 338962 |
| 327 | Ga0209758_1000146 | 3300025297 | Bacteria | 169246 |
| 328 | Ga0209050_1000532 | 3300025298 | Bacteria | 63063 |
| 329 | Ga0209256_1000059 | 3300025299 | Bacteria | 272170 |
| 330 | Ga0209256_1000113 | 3300025299 | Bacteria | 175296 |
| 331 | Ga0209256_1000149 | 3300025299 | Bacteria | 146390 |
| 332 | Ga0209256_1024458 | 3300025299 | Bacteria | 1778 |
| 333 | Ga0209051_1000020 | 3300025303 | Bacteria | 508628 |
| 334 | Ga0209051_1005529 | 3300025303 | Bacteria | 7365 |
| 335 | Ga0209051_1006172 | 3300025303 | Bacteria | 6805 |
| 336 | Ga0209051_1011536 | 3300025303 | Bacteria | 4355 |
| 337 | Ga0209257_1000085 | 3300025304 | Bacteria | 291117 |
| 338 | Ga0207697_10029588 | 3300025315 | Bacteria | 2241 |
| 339 | Ga0207680_10033476 | 3300025903 | Bacteria | 2932 |
| 340 | Ga0207645_10085798 | 3300025907 | Bacteria | 2022 |
| 341 | Ga0207705_10002838 | 3300025909 | Bacteria | 13260 |
| 342 | Ga0207705_10039414 | 3300025909 | Bacteria | 3386 |
| 343 | Ga0207705_10047019 | 3300025909 | Bacteria | 3102 |
| 344 | Ga0207654_10038347 | 3300025911 | Bacteria | 2688 |
| 345 | Ga0207654_10191464 | 3300025911 | Bacteria | 1341 |
| 346 | Ga0207707_10056099 | 3300025912 | Bacteria | 3426 |
| 347 | Ga0207695_10002489 | 3300025913 | Bacteria | 27124 |
| 348 | Ga0207695_10003096 | 3300025913 | Bacteria | 23815 |
| 349 | Ga0207695_10008251 | 3300025913 | Bacteria | 13072 |
| 350 | Ga0207695_10223213 | 3300025913 | Bacteria | 1791 |
| 351 | Ga0207671_10212660 | 3300025914 | Bacteria | 1513 |
| 352 | Ga0207663_10031320 | 3300025916 | Bacteria | 3147 |
| 353 | Ga0207662_10044662 | 3300025918 | Bacteria | 2616 |
| 354 | Ga0207662_10078268 | 3300025918 | Bacteria | 2012 |
| 355 | Ga0207662_10257904 | 3300025918 | Bacteria | 1147 |
| 356 | Ga0207657_10038876 | 3300025919 | Bacteria | 4231 |
| 357 | Ga0207657_10055107 | 3300025919 | Bacteria | 3436 |
| 358 | Ga0207649_10000169 | 3300025920 | Bacteria | 53440 |
| 359 | Ga0207649_10000951 | 3300025920 | Bacteria | 18067 |
| 360 | Ga0207652_10003246 | 3300025921 | Bacteria | 13489 |
| 361 | Ga0207652_10033593 | 3300025921 | Bacteria | 4320 |
| 362 | Ga0207652_10277405 | 3300025921 | Bacteria | 1512 |
| 363 | Ga0207681_10008325 | 3300025923 | Bacteria | 6342 |
| 364 | Ga0207681_10045573 | 3300025923 | Bacteria | 2945 |
| 365 | Ga0207694_10012151 | 3300025924 | Bacteria | 6493 |
| 366 | Ga0207694_10050348 | 3300025924 | Bacteria | 3225 |
| 367 | Ga0207650_10000265 | 3300025925 | Bacteria | 55786 |
| 368 | Ga0207650_10008031 | 3300025925 | Bacteria | 7192 |
| 369 | Ga0207659_10000148 | 3300025926 | Bacteria | 41151 |
| 370 | Ga0207659_10202800 | 3300025926 | Bacteria | 1585 |
| 371 | Ga0207644_10003662 | 3300025931 | Bacteria | 9961 |
| 372 | Ga0207644_10012407 | 3300025931 | Bacteria | 5659 |
| 373 | Ga0207644_10268193 | 3300025931 | Bacteria | 1367 |
| 374 | Ga0207690_10000658 | 3300025932 | Bacteria | 22107 |
| 375 | Ga0207706_10013431 | 3300025933 | Bacteria | 7443 |
| 376 | Ga0207709_10013052 | 3300025935 | Bacteria | 4579 |
| 377 | Ga0207709_10098384 | 3300025935 | Bacteria | 1929 |
| 378 | Ga0207709_10182975 | 3300025935 | Bacteria | 1481 |
| 379 | Ga0207670_10088353 | 3300025936 | Bacteria | 2186 |
| 380 | Ga0207670_10261185 | 3300025936 | Bacteria | 1342 |
| 381 | Ga0207669_10004257 | 3300025937 | Bacteria | 6282 |
| 382 | Ga0207669_10024521 | 3300025937 | Bacteria | 3243 |
| 383 | Ga0207691_10002036 | 3300025940 | Bacteria | 19776 |
| 384 | Ga0207691_10012845 | 3300025940 | Bacteria | 8017 |
| 385 | Ga0207711_10061995 | 3300025941 | Bacteria | 3225 |
| 386 | Ga0207711_10064015 | 3300025941 | Bacteria | 3175 |
| 387 | Ga0207711_10219893 | 3300025941 | Bacteria | 1737 |
| 388 | Ga0207711_10325107 | 3300025941 | Bacteria | 1422 |
| 389 | Ga0207689_10055607 | 3300025942 | Bacteria | 3257 |
| 390 | Ga0207679_10000003 | 3300025945 | Bacteria | 597553 |
| 391 | Ga0207679_10003109 | 3300025945 | Bacteria | 10278 |
| 392 | Ga0207679_10094573 | 3300025945 | Bacteria | 2321 |
| 393 | Ga0207667_10004383 | 3300025949 | Bacteria | 17283 |
| 394 | Ga0207667_10017027 | 3300025949 | Bacteria | 8198 |
| 395 | Ga0207667_10036128 | 3300025949 | Bacteria | 5297 |
| 396 | Ga0207667_10078403 | 3300025949 | Bacteria | 3424 |
| 397 | Ga0207667_10110627 | 3300025949 | Bacteria | 2834 |
| 398 | Ga0207667_10133821 | 3300025949 | Bacteria | 2553 |
| 399 | Ga0207651_10006277 | 3300025960 | Bacteria | 6199 |
| 400 | Ga0207640_10001688 | 3300025981 | Bacteria | 11829 |
| 401 | Ga0207640_10011737 | 3300025981 | Bacteria | 4968 |
| 402 | Ga0207658_10084677 | 3300025986 | Bacteria | 2440 |
| 403 | Ga0207677_10015406 | 3300026023 | Bacteria | 4496 |
| 404 | Ga0207703_10061761 | 3300026035 | Bacteria | 3068 |
| 405 | Ga0207678_10000002 | 3300026067 | Bacteria | 371723 |
| 406 | Ga0207678_10008084 | 3300026067 | Bacteria | 9275 |
| 407 | Ga0207702_10001439 | 3300026078 | Bacteria | 23650 |
| 408 | Ga0207702_10001983 | 3300026078 | Bacteria | 19881 |
| 409 | Ga0207702_10066788 | 3300026078 | Bacteria | 3084 |
| 410 | Ga0207702_10082959 | 3300026078 | Bacteria | 2788 |
| 411 | Ga0207641_10025181 | 3300026088 | Bacteria | 4906 |
| 412 | Ga0207648_10000515 | 3300026089 | Bacteria | 43207 |
| 413 | Ga0207648_10034719 | 3300026089 | Bacteria | 4444 |
| 414 | Ga0207648_10038130 | 3300026089 | Bacteria | 4230 |
| 415 | Ga0207648_10056500 | 3300026089 | Bacteria | 3425 |
| 416 | Ga0207648_10064100 | 3300026089 | Bacteria | 3203 |
| 417 | Ga0207648_10072375 | 3300026089 | Bacteria | 3004 |
| 418 | Ga0207676_10015363 | 3300026095 | Bacteria | 5520 |
| 419 | Ga0207674_10004769 | 3300026116 | Bacteria | 16262 |
| 420 | Ga0207675_100021444 | 3300026118 | Bacteria | 6017 |
| 421 | Ga0207675_100054825 | 3300026118 | Bacteria | 3719 |
| 422 | Ga0207675_100072379 | 3300026118 | Bacteria | 3224 |
| 423 | Ga0207683_10013304 | 3300026121 | Bacteria | 7015 |
| 424 | Ga0207683_10014592 | 3300026121 | Bacteria | 6690 |
| 425 | Ga0207683_10286663 | 3300026121 | Bacteria | 1505 |
| 426 | Ga0207698_10018160 | 3300026142 | Bacteria | 4787 |
| 427 | Ga0207698_10028487 | 3300026142 | Bacteria | 3983 |
| 428 | Ga0207698_10042141 | 3300026142 | Bacteria | 3408 |
| 429 | Ga0207698_10069043 | 3300026142 | Bacteria | 2793 |
| 430 | Ga0207698_10250139 | 3300026142 | Bacteria | 1621 |
| 431 | Ga0209281_1000195 | 3300027111 | Bacteria | 139144 |
| 432 | Ga0209969_1002573 | 3300027360 | Bacteria | 2511 |
| 433 | Ga0209981_1002023 | 3300027378 | Bacteria | 2591 |
| 434 | Ga0210000_1001879 | 3300027462 | Bacteria | 2969 |
| 435 | Ga0209995_1000468 | 3300027471 | Bacteria | 6158 |
| 436 | Ga0209968_1005613 | 3300027526 | Bacteria | 1885 |
| 437 | Ga0209999_1007712 | 3300027543 | Bacteria | 1936 |
| 438 | Ga0209982_1007932 | 3300027552 | Bacteria | 1553 |
| 439 | Ga0209282_1000031 | 3300027666 | Bacteria | 150666 |
| 440 | Ga0209974_10016343 | 3300027876 | Bacteria | 2464 |
| 441 | Ga0268265_10178538 | 3300028380 | Bacteria | 1822 |
| 442 | Ga0268264_10025766 | 3300028381 | Bacteria | 4803 |
| 443 | Ga0268264_10357704 | 3300028381 | Bacteria | 1391 |
| 444 | Ga0265336_10000325 | 3300028666 | Bacteria | 31959 |
| 445 | Ga0307517_10061963 | 3300028786 | Bacteria | 3528 |
| 446 | Ga0307515_10000090 | 3300028794 | Bacteria | 215043 |
| 447 | Ga0307515_10014346 | 3300028794 | Bacteria | 14704 |
| 448 | Ga0307515_10020693 | 3300028794 | Bacteria | 11719 |
| 449 | Ga0307515_10087834 | 3300028794 | Bacteria | 3939 |
| 450 | Ga0265324_10001988 | 3300029957 | Bacteria | 10920 |
| 451 | Ga0268256_1007226 | 3300030500 | Bacteria | 3995 |
| 452 | Ga0307511_10136090 | 3300030521 | Bacteria | 1462 |
| 453 | Ga0307512_10016010 | 3300030522 | Bacteria | 6930 |
| 454 | Ga0307512_10099387 | 3300030522 | Bacteria | 1980 |
| 455 | Ga0265332_10000004 | 3300031238 | Bacteria | 426592 |
| 456 | Ga0265332_10001479 | 3300031238 | Bacteria | 13111 |
| 457 | Ga0265325_10007114 | 3300031241 | Bacteria | 6735 |
| 458 | Ga0265325_10016943 | 3300031241 | Bacteria | 4062 |
| 459 | Ga0265340_10053273 | 3300031247 | Bacteria | 1954 |
| 460 | Ga0265339_10114760 | 3300031249 | Bacteria | 1390 |
| 461 | Ga0265331_10000748 | 3300031250 | Bacteria | 27195 |
| 462 | Ga0265327_10013764 | 3300031251 | Bacteria | 5346 |
| 463 | Ga0265316_10034622 | 3300031344 | Bacteria | 4101 |
| 464 | Ga0265316_10080048 | 3300031344 | Bacteria | 2506 |
| 465 | Ga0265316_10242163 | 3300031344 | Bacteria | 1326 |
| 466 | Ga0307513_10000004 | 3300031456 | Bacteria | 558931 |
| 467 | Ga0307513_10017668 | 3300031456 | Bacteria | 8546 |
| 468 | Ga0307509_10000072 | 3300031507 | Bacteria | 140566 |
| 469 | Ga0307509_10000234 | 3300031507 | Bacteria | 89398 |
| 470 | Ga0307509_10202198 | 3300031507 | Bacteria | 1821 |
| 471 | Ga0307408_100067111 | 3300031548 | Bacteria | 2637 |
| 472 | Ga0307508_10000007 | 3300031616 | Bacteria | 268359 |
| 473 | Ga0307514_10001152 | 3300031649 | Bacteria | 36151 |
| 474 | Ga0307514_10011693 | 3300031649 | Bacteria | 7300 |
| 475 | Ga0265314_10036837 | 3300031711 | Bacteria | 3550 |
| 476 | Ga0307516_10000398 | 3300031730 | Bacteria | 56825 |
| 477 | Ga0307516_10000984 | 3300031730 | Bacteria | 39418 |
| 478 | Ga0307516_10003708 | 3300031730 | Bacteria | 19431 |
| 479 | Ga0307516_10003842 | 3300031730 | Bacteria | 19022 |
| 480 | Ga0307516_10016231 | 3300031730 | Bacteria | 7796 |
| 481 | Ga0307405_10000483 | 3300031731 | Bacteria | 14957 |
| 482 | Ga0307406_10016088 | 3300031901 | Bacteria | 4339 |
| 483 | Ga0307412_10081950 | 3300031911 | Bacteria | 2232 |
| 484 | Ga0307412_10134738 | 3300031911 | Bacteria | 1800 |
| 485 | Ga0307416_100021143 | 3300032002 | Bacteria | 4664 |
| 486 | Ga0307414_10021391 | 3300032004 | Bacteria | 4058 |
| 487 | Ga0307414_10169678 | 3300032004 | Bacteria | 1743 |
| 488 | Ga0307411_10000973 | 3300032005 | Bacteria | 10988 |
| 489 | Ga0307507_10031222 | 3300033179 | Bacteria | 5597 |
| 490 | Ga0307510_10022775 | 3300033180 | Bacteria | 7267 |
| 491 | Ga0373936_0043991 | 3300035113 | Bacteria | 1796 |
| 492 | Ga0373955_0042399 | 3300035172 | Bacteria | 2443 |
| 493 | Ga0373931_0022679 | 3300035691 | Bacteria | 3161 |
| 494 | Ga0373935_0099188 | 3300035692 | Bacteria | 1918 |
| 495 | Ga0373937_0087421 | 3300036401 | Bacteria | 2885 |
| 496 | Ga0373937_0103189 | 3300036401 | Bacteria | 2648 |
| 497 | Ga0373937_0249749 | 3300036401 | Bacteria | 1672 |
| 498 | Ga0373925_0027214 | 3300037068 | Bacteria | 4187 |
| 499 | Ga0395899_0047536 | 3300037312 | Bacteria | 3195 |
| 500 | Ga0395900_0019530 | 3300037418 | Bacteria | 6909 |
| 501 | Ga0395900_0140487 | 3300037418 | Bacteria | 2473 |
| 502 | Ga0395898_0063380 | 3300037466 | Bacteria | 3587 |
| 503 | Ga0395905_0004070 | 3300037471 | Bacteria | 15324 |
| 504 | Ga0395905_0005002 | 3300037471 | Bacteria | 13656 |
| 505 | Ga0395905_0068289 | 3300037471 | Bacteria | 3329 |
| 506 | Ga0395905_0077996 | 3300037471 | Bacteria | 3104 |
| 507 | Ga0395901_0045670 | 3300038443 | Bacteria | 4547 |
| 508 | Ga0395901_0143147 | 3300038443 | Bacteria | 2513 |
| 509 | Ga0436361_0082864 | 3300039447 | Bacteria | 107951 |
| 510 | Ga0436361_0224027 | 3300039447 | Bacteria | 5992 |
| 511 | Ga0436361_0240585 | 3300039447 | Bacteria | 3666 |
| 512 | Ga0436361_0313546 | 3300039447 | Bacteria | 35556 |
| 513 | Ga0436361_0347526 | 3300039447 | Bacteria | 75643 |
| 514 | Ga0436361_0409948 | 3300039447 | Bacteria | 13635 |
| 515 | Ga0436361_0431442 | 3300039447 | Bacteria | 4517 |
| 516 | Ga0436361_0500164 | 3300039447 | Bacteria | 28968 |
| 517 | Ga0436361_0664726 | 3300039447 | Bacteria | 17402 |
| 518 | Ga0439439_0025003 | 3300041406 | Bacteria | 1501 |
| 519 | Ga0451802_0554797 | 3300041460 | Bacteria | 2110 |
| 520 | Ga0439449_0002349 | 3300042007 | Bacteria | 7421 |
| 521 | Ga0439462_0017713 | 3300042015 | Bacteria | 1845 |
| 522 | Ga0439446_0023098 | 3300042156 | Bacteria | 1767 |
| 523 | Ga0439446_0024276 | 3300042156 | Bacteria | 1729 |
| 524 | Ga0439446_0057215 | 3300042156 | Bacteria | 1173 |
| 525 | Ga0450918_000036 | 3300042531 | Bacteria | 26790 |
| 526 | Ga0451577_0000519 | 3300042876 | Bacteria | 64350 |
| 527 | Ga0451577_0006947 | 3300042876 | Bacteria | 11183 |
| 528 | Ga0451577_0024692 | 3300042876 | Bacteria | 5464 |
| 529 | Ga0451577_0029185 | 3300042876 | Bacteria | 4985 |
| 530 | Ga0451577_0058754 | 3300042876 | Bacteria | 3428 |
| 531 | Ga0451577_0081617 | 3300042876 | Bacteria | 2884 |
| 532 | Ga0451577_0093774 | 3300042876 | Bacteria | 2681 |
| 533 | Ga0451577_0104771 | 3300042876 | Bacteria | 2527 |
| 534 | Ga0451577_0130423 | 3300042876 | Bacteria | 2255 |
| 535 | Ga0451577_0313424 | 3300042876 | Bacteria | 1422 |
| 536 | Ga0466969_0000056 | 3300044656 | Bacteria | 59381 |
| 537 | Ga0466969_0002248 | 3300044656 | Bacteria | 10325 |
| 538 | Ga0466969_0004296 | 3300044656 | Bacteria | 7581 |
| 539 | Ga0466969_0027148 | 3300044656 | Bacteria | 2932 |
| 540 | Ga0466969_0030894 | 3300044656 | Bacteria | 2727 |
| 541 | Ga0466972_0000390 | 3300044658 | Bacteria | 23451 |
| 542 | Ga0466972_0003819 | 3300044658 | Bacteria | 7493 |
| 543 | Ga0466965_0006239 | 3300044683 | Bacteria | 5394 |
| 544 | Ga0466965_0015556 | 3300044683 | Bacteria | 3614 |
| 545 | Ga0466966_0003784 | 3300044684 | Bacteria | 9979 |
| 546 | Ga0466966_0004701 | 3300044684 | Bacteria | 8985 |
| 547 | Ga0466966_0020706 | 3300044684 | Bacteria | 4322 |
| 548 | Ga0466961_0000465 | 3300044693 | Bacteria | 25650 |
| 549 | Ga0466961_0050237 | 3300044693 | Bacteria | 2663 |
| 550 | Ga0466963_0002329 | 3300044694 | Bacteria | 10589 |
| 551 | Ga0466964_0005251 | 3300044706 | Bacteria | 4800 |
| 552 | Ga0466964_0006854 | 3300044706 | Bacteria | 4251 |
| 553 | Ga0453684_0000005 | 3300044712 | Bacteria | 1431632 |
| 554 | Ga0453684_0000114 | 3300044712 | Bacteria | 356610 |
| 555 | Ga0453684_0000296 | 3300044712 | Bacteria | 211075 |
| 556 | Ga0453684_0000419 | 3300044712 | Bacteria | 173463 |
| 557 | Ga0453684_0011178 | 3300044712 | Bacteria | 15114 |
| 558 | Ga0453684_0018530 | 3300044712 | Bacteria | 10675 |
| 559 | Ga0453684_0059341 | 3300044712 | Bacteria | 4933 |
| 560 | Ga0453684_0187373 | 3300044712 | Bacteria | 2423 |
| 561 | Ga0453684_0411093 | 3300044712 | Bacteria | 1513 |
| 562 | Ga0466971_0010748 | 3300044719 | Bacteria | 4005 |
| 563 | Ga0466971_0023104 | 3300044719 | Bacteria | 2771 |
| 564 | Ga0466968_0028155 | 3300044735 | Bacteria | 2316 |
| 565 | Ga0466970_0040863 | 3300044765 | Bacteria | 2463 |
| 566 | Ga0466957_0022668 | 3300044842 | Bacteria | 3706 |
| 567 | Ga0466957_0047980 | 3300044842 | Bacteria | 2595 |
| 568 | Ga0466960_0083871 | 3300044901 | Bacteria | 1611 |
| 569 | Ga0466959_0000664 | 3300045049 | Bacteria | 20079 |
| 570 | Ga0466959_0000680 | 3300045049 | Bacteria | 19879 |
| 571 | Ga0466959_0001826 | 3300045049 | Bacteria | 13354 |
| 572 | Ga0466959_0032449 | 3300045049 | Bacteria | 3865 |
| 573 | Ga0466959_0067606 | 3300045049 | Bacteria | 2590 |
| 574 | Ga0451576_0000166 | 3300045051 | Bacteria | 166647 |
| 575 | Ga0451576_0003772 | 3300045051 | Bacteria | 20437 |
| 576 | Ga0451576_0005878 | 3300045051 | Bacteria | 15242 |
| 577 | Ga0451576_0007439 | 3300045051 | Bacteria | 13087 |
| 578 | Ga0451576_0007667 | 3300045051 | Bacteria | 12830 |
| 579 | Ga0451576_0011665 | 3300045051 | Bacteria | 9956 |
| 580 | Ga0451576_0019755 | 3300045051 | Bacteria | 7353 |
| 581 | Ga0451576_0023472 | 3300045051 | Bacteria | 6678 |
| 582 | Ga0451576_0023534 | 3300045051 | Bacteria | 6669 |
| 583 | Ga0451576_0024433 | 3300045051 | Bacteria | 6527 |
| 584 | Ga0451576_0028815 | 3300045051 | Bacteria | 5946 |
| 585 | Ga0451576_0029921 | 3300045051 | Bacteria | 5825 |
| 586 | Ga0451576_0090837 | 3300045051 | Bacteria | 3177 |
| 587 | Ga0466958_0016990 | 3300045836 | Bacteria | 4197 |
| 588 | Ga0466967_0016110 | 3300045976 | Bacteria | 5883 |
| 589 | Ga0466967_0041245 | 3300045976 | Bacteria | 3978 |
| 590 | Ga0466967_0079232 | 3300045976 | Bacteria | 2961 |
| 591 | Ga0495592_0000291 | 3300046454 | Bacteria | 42990 |
| 592 | Ga0495592_0010885 | 3300046454 | Bacteria | 6864 |
| 593 | Ga0495592_0034937 | 3300046454 | Bacteria | 3788 |
| 594 | Ga0495591_000607 | 3300046458 | Bacteria | 27108 |
| 595 | Ga0495629_0004690 | 3300046459 | Bacteria | 10240 |
| 596 | Ga0495651_0096470 | 3300046462 | Bacteria | 2209 |
| 597 | Ga0495650_0002299 | 3300046471 | Bacteria | 15858 |
| 598 | Ga0495650_0005641 | 3300046471 | Bacteria | 8048 |
| 599 | Ga0495650_0005687 | 3300046471 | Bacteria | 7993 |
| 600 | Ga0495580_0014357 | 3300046472 | Bacteria | 6007 |
| 601 | Ga0495639_0105127 | 3300046475 | Bacteria | 1336 |
| 602 | Ga0495664_0034823 | 3300046477 | Bacteria | 2963 |
| 603 | Ga0495584_0027192 | 3300046491 | Bacteria | 2899 |
| 604 | Ga0495585_0008002 | 3300046492 | Bacteria | 6426 |
| 605 | Ga0495596_0002606 | 3300046500 | Bacteria | 9583 |
| 606 | Ga0495583_0000866 | 3300046506 | Bacteria | 36795 |
| 607 | Ga0495606_0000127 | 3300046507 | Bacteria | 129676 |
| 608 | Ga0495606_0005178 | 3300046507 | Bacteria | 12612 |
| 609 | Ga0495608_0002232 | 3300046511 | Bacteria | 13984 |
| 610 | Ga0495628_0312254 | 3300046516 | Bacteria | 1161 |
| 611 | Ga0495630_0005459 | 3300046517 | Bacteria | 8981 |
| 612 | Ga0495643_0043504 | 3300046522 | Bacteria | 2444 |
| 613 | Ga0495666_0003508 | 3300046526 | Bacteria | 7914 |
| 614 | Ga0495652_0023647 | 3300046529 | Bacteria | 5445 |
| 615 | Ga0495652_0121013 | 3300046529 | Bacteria | 2088 |
| 616 | Ga0495654_0002047 | 3300046530 | Bacteria | 13234 |
| 617 | Ga0495665_0031536 | 3300046531 | Bacteria | 2836 |
| 618 | Ga0495640_0010264 | 3300046533 | Bacteria | 7247 |
| 619 | Ga0495587_0004383 | 3300046536 | Bacteria | 9310 |
| 620 | Ga0495587_0084225 | 3300046536 | Bacteria | 1841 |
| 621 | Ga0495621_0009589 | 3300046539 | Bacteria | 2945 |
| 622 | Ga0495621_0021471 | 3300046539 | Bacteria | 2128 |
| 623 | Ga0495645_0057531 | 3300046543 | Bacteria | 2821 |
| 624 | Ga0495634_0015664 | 3300046642 | Bacteria | 5439 |
| 625 | Ga0495634_0241023 | 3300046642 | Bacteria | 1109 |
| 626 | Ga0495625_0003235 | 3300046660 | Bacteria | 16485 |
| 627 | Ga0495625_0011371 | 3300046660 | Bacteria | 7263 |
| 628 | Ga0495625_0025801 | 3300046660 | Bacteria | 4450 |
| 629 | Ga0495635_0001381 | 3300046663 | Bacteria | 16190 |
| 630 | Ga0495661_0023528 | 3300046665 | Bacteria | 3998 |
| 631 | Ga0495588_0007649 | 3300046674 | Bacteria | 4931 |
| 632 | Ga0495588_0013517 | 3300046674 | Bacteria | 3891 |
| 633 | Ga0495599_0001603 | 3300046678 | Bacteria | 13048 |
| 634 | Ga0495599_0092489 | 3300046678 | Bacteria | 1887 |
| 635 | Ga0495646_0034513 | 3300046680 | Bacteria | 3141 |
| 636 | Ga0495658_0015312 | 3300046683 | Bacteria | 3933 |
| 637 | Ga0495613_0002519 | 3300046689 | Bacteria | 13804 |
| 638 | Ga0495649_0004080 | 3300046694 | Bacteria | 9608 |
| 639 | Ga0495589_0000923 | 3300046794 | Bacteria | 18039 |
| 640 | Ga0495600_0073499 | 3300046809 | Bacteria | 2233 |
| 641 | Ga0495581_0060891 | 3300047315 | Bacteria | 2181 |
| 642 | Ga0495680_0083663 | 3300047322 | Bacteria | 2405 |
| 643 | Ga0495683_0002247 | 3300047323 | Bacteria | 11796 |
| 644 | Ga0495675_0047979 | 3300047444 | Bacteria | 2716 |
| 645 | Ga0495593_0003496 | 3300047673 | Bacteria | 9400 |
| 646 | Ga0495602_0052137 | 3300048088 | Bacteria | 3636 |
| 647 | Ga0495614_0003100 | 3300048089 | Bacteria | 7401 |
| 648 | Ga0496104_0012365 | 3300048907 | Bacteria | 7672 |
| 649 | Ga0496105_0079238 | 3300048908 | Bacteria | 2713 |
| 650 | Ga0496106_0048548 | 3300048909 | Bacteria | 3196 |
| 651 | Ga0496109_0146014 | 3300048912 | Bacteria | 2213 |
| 652 | Ga0496112_0001089 | 3300048915 | Bacteria | 20089 |
| 653 | Ga0496114_0018736 | 3300048917 | Bacteria | 5602 |
| 654 | Ga0496114_0122128 | 3300048917 | Bacteria | 2241 |
| 655 | Ga0496116_0005538 | 3300048919 | Bacteria | 11652 |
| 656 | Ga0496118_0005614 | 3300048921 | Bacteria | 14166 |
| 657 | Ga0496123_0004424 | 3300048926 | Bacteria | 14783 |
| 658 | Ga0496124_0000786 | 3300048927 | Bacteria | 51804 |
| 659 | Ga0496125_0013748 | 3300048928 | Bacteria | 7935 |
| 660 | Ga0501300_003548 | 3300049523 | Bacteria | 2323 |
| 661 | Ga0501034_0000188 | 3300049571 | Bacteria | 115935 |
| 662 | Ga0501039_0198151 | 3300049575 | Bacteria | 1579 |
| 663 | Ga0501043_0000149 | 3300049579 | Bacteria | 65122 |
| 664 | Ga0501046_0000092 | 3300049580 | Bacteria | 97456 |
| 665 | Ga0501047_0000028 | 3300049581 | Bacteria | 220279 |
| 666 | Ga0501048_0009579 | 3300049582 | Bacteria | 7271 |
| 667 | Ga0501048_0089301 | 3300049582 | Bacteria | 2174 |
| 668 | Ga0501069_0154301 | 3300049585 | Bacteria | 1320 |
| 669 | Ga0501070_0007594 | 3300049586 | Bacteria | 9210 |
| 670 | Ga0501071_0003792 | 3300049587 | Bacteria | 9499 |
| 671 | Ga0501072_0035564 | 3300049588 | Bacteria | 3902 |
| 672 | Ga0501073_0005474 | 3300049589 | Bacteria | 9515 |
| 673 | Ga0501074_0014295 | 3300049590 | Bacteria | 5774 |
| 674 | Ga0501076_0290920 | 3300049592 | Bacteria | 1338 |
| 675 | Ga0501198_000025 | 3300049649 | Bacteria | 66985 |
| 676 | Ga0501222_000033 | 3300049662 | Bacteria | 55105 |
| 677 | Ga0501079_0048511 | 3300049741 | Bacteria | 3276 |
| 678 | Ga0501079_0068513 | 3300049741 | Bacteria | 2739 |
| 679 | Ga0501080_0003503 | 3300049742 | Bacteria | 13821 |
| 680 | Ga0501080_0016126 | 3300049742 | Bacteria | 6897 |
| 681 | Ga0501083_0000223 | 3300049744 | Bacteria | 36614 |
| 682 | Ga0501273_004131 | 3300049770 | Bacteria | 1581 |
| 683 | Ga0501280_000120 | 3300049776 | Bacteria | 20478 |
| 684 | Ga0501281_00899 | 3300049777 | Bacteria | 2500 |
| 685 | Ga0501035_0192155 | 3300049822 | Bacteria | 1755 |
| 686 | Ga0501045_0000170 | 3300049824 | Bacteria | 35617 |
| 687 | nmdc:mga03683_78057_c1 | 3300050489 | Bacteria | 1425 |
| 688 | nmdc:mga00v17_248424_c1 | 3300050491 | Bacteria | 1153 |
| 689 | nmdc:mga0k408_39694_c1 | 3300050493 | Bacteria | 2706 |
| 690 | nmdc:mga0k408_44627_c1 | 3300050493 | Bacteria | 2557 |
| 691 | nmdc:mga0k408_59676_c1 | 3300050493 | Bacteria | 2217 |
| 692 | nmdc:mga07m45_169856_c1 | 3300050496 | Bacteria | 1267 |
| 693 | nmdc:mga07m45_2314_c1 | 3300050496 | Bacteria | 8922 |
| 694 | nmdc:mga07m45_31586_c1 | 3300050496 | Bacteria | 2935 |
| 695 | nmdc:mga05p37_588_c1 | 3300050507 | Bacteria | 40012 |
| 696 | nmdc:mga09592_116_c1 | 3300050508 | Bacteria | 50381 |
| 697 | nmdc:mga09592_123169_c1 | 3300050508 | Bacteria | 2228 |
| 698 | nmdc:mga06r32_57165_c1 | 3300050510 | Bacteria | 3747 |
| 699 | nmdc:mga08y16_16326_c1 | 3300050511 | Bacteria | 7806 |
| 700 | nmdc:mga0rr50_73361_c1 | 3300050513 | Bacteria | 2616 |
| 701 | nmdc:mga08x19_35743_c1 | 3300050514 | Bacteria | 3145 |
| 702 | nmdc:mga08x19_70054_c1 | 3300050514 | Bacteria | 2284 |
| 703 | nmdc:mga0a205_196811_c1 | 3300050515 | Bacteria | 1906 |
| 704 | Ga0500635_0000055 | 3300053080 | Bacteria | 74107 |
| 705 | Ga0500578_0015088 | 3300053086 | Bacteria | 4966 |
| 706 | Ga0500641_0046324 | 3300053096 | Bacteria | 1774 |
| 707 | Ga0500593_001155 | 3300053117 | Bacteria | 9527 |
| 708 | Ga0500658_0032919 | 3300053134 | Bacteria | 2035 |
| 709 | Ga0500619_000325 | 3300053154 | Bacteria | 9276 |
| 710 | Ga0500636_0000064 | 3300053177 | Bacteria | 51986 |
| 711 | Ga0500636_0014675 | 3300053177 | Bacteria | 4608 |
| 712 | Ga0500645_004966 | 3300053730 | Bacteria | 4990 |
| 713 | Ga0501084_0033974 | 3300054114 | Bacteria | 4265 |
| 714 | Ga0501084_0049927 | 3300054114 | Bacteria | 3502 |
| 715 | Ga0590071_006216 | 3300059421 | Bacteria | 2845 |
| 716 | Ga0587072_000424 | 3300059643 | Bacteria | 4193 |
| 717 | Ga0587079_017963 | 3300059647 | Bacteria | 1234 |
| 718 | Ga0466962_0002201 | 3300061719 | Bacteria | 9220 |
| 719 | Ga0466962_0006139 | 3300061719 | Bacteria | 5774 |
| 720 | Ga0466962_0024685 | 3300061719 | Bacteria | 2886 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045051 | Ga0451576_0029921 | Ga0451576_0029921_4896_5810 | 285 |
| 2 | 3300005354 | Ga0070675_100428258 | Ga0070675_1004282581 | 303 |
| 3 | 3300049592 | Ga0501076_0290920 | Ga0501076_0290920_32_985 | 303 |
| 4 | 3300042156 | Ga0439446_0024276 | Ga0439446_0024276_16_987 | 304 |
| 5 | 3300006058 | Ga0075432_10025280 | Ga0075432_100252802 | 317 |
| 6 | 3300041406 | Ga0439439_0025003 | Ga0439439_0025003_240_1385 | 323 |
| 7 | 3300042007 | Ga0439449_0002349 | Ga0439449_0002349_1911_3056 | 323 |
| 8 | 3300042015 | Ga0439462_0017713 | Ga0439462_0017713_536_1681 | 323 |
| 9 | 3300046530 | Ga0495654_0002047 | Ga0495654_0002047_5895_7070 | 323 |
| 10 | 3300003775 | Ga0055524_1000125 | Ga0055524_100012524 | 324 |
| 11 | 3300003791 | Ga0055530_10006753 | Ga0055530_100067536 | 324 |
| 12 | 3300003792 | Ga0055540_1000011 | Ga0055540_100001157 | 324 |
| 13 | 3300004625 | Ga0055543_1002628 | Ga0055543_10026281 | 324 |
| 14 | 3300005262 | Ga0065165_1000153 | Ga0065165_100015385 | 324 |
| 15 | 3300005616 | Ga0068852_100065922 | Ga0068852_1000659224 | 324 |
| 16 | 3300006051 | Ga0075364_10067106 | Ga0075364_100671062 | 324 |
| 17 | 3300006177 | Ga0075362_10005489 | Ga0075362_100054894 | 324 |
| 18 | 3300006178 | Ga0075367_10006872 | Ga0075367_100068724 | 324 |
| 19 | 3300025291 | Ga0209675_1017519 | Ga0209675_10175192 | 324 |
| 20 | 3300025297 | Ga0209758_1000146 | Ga0209758_100014616 | 324 |
| 21 | 3300025298 | Ga0209050_1000532 | Ga0209050_10005324 | 324 |
| 22 | 3300025299 | Ga0209256_1000113 | Ga0209256_100011374 | 324 |
| 23 | 3300025303 | Ga0209051_1000020 | Ga0209051_100002056 | 324 |
| 24 | 3300025304 | Ga0209257_1000085 | Ga0209257_100008556 | 324 |
| 25 | 3300025949 | Ga0207667_10078403 | Ga0207667_100784032 | 324 |
| 26 | 3300026142 | Ga0207698_10028487 | Ga0207698_100284874 | 324 |
| 27 | 3300027111 | Ga0209281_1000195 | Ga0209281_100019548 | 324 |
| 28 | 3300028794 | Ga0307515_10020693 | Ga0307515_100206936 | 324 |
| 29 | 3300031238 | Ga0265332_10001479 | Ga0265332_1000147910 | 324 |
| 30 | 3300031241 | Ga0265325_10016943 | Ga0265325_100169431 | 324 |
| 31 | 3300031249 | Ga0265339_10114760 | Ga0265339_101147601 | 324 |
| 32 | 3300031250 | Ga0265331_10000748 | Ga0265331_100007483 | 324 |
| 33 | 3300031251 | Ga0265327_10013764 | Ga0265327_100137643 | 324 |
| 34 | 3300031344 | Ga0265316_10034622 | Ga0265316_100346222 | 324 |
| 35 | 3300031456 | Ga0307513_10017668 | Ga0307513_100176686 | 324 |
| 36 | 3300046471 | Ga0495650_0002299 | Ga0495650_0002299_5126_6250 | 324 |
| 37 | 3300046522 | Ga0495643_0043504 | Ga0495643_0043504_181_1293 | 324 |
| 38 | 3300046660 | Ga0495625_0003235 | Ga0495625_0003235_15117_16229 | 324 |
| 39 | 3300048917 | Ga0496114_0018736 | Ga0496114_0018736_3735_4847 | 324 |
| 40 | 3300053117 | Ga0500593_001155 | Ga0500593_001155_6987_8096 | 324 |
| 41 | 3300053134 | Ga0500658_0032919 | Ga0500658_0032919_318_1430 | 324 |
| 42 | 3300002773 | JGI25152J39213_1003301 | JGI25152J39213_10033014 | 325 |
| 43 | 3300002774 | JGI25150J39212_1007478 | JGI25150J39212_10074782 | 325 |
| 44 | 3300003771 | Ga0055526_1001897 | Ga0055526_10018977 | 325 |
| 45 | 3300005262 | Ga0065165_1000967 | Ga0065165_100096719 | 325 |
| 46 | 3300025258 | Ga0209129_1000027 | Ga0209129_100002739 | 325 |
| 47 | 3300025295 | Ga0209564_1000139 | Ga0209564_100013930 | 325 |
| 48 | 3300025297 | Ga0209758_1000052 | Ga0209758_100005281 | 325 |
| 49 | 3300025299 | Ga0209256_1024458 | Ga0209256_10244582 | 325 |
| 50 | 3300026089 | Ga0207648_10038130 | Ga0207648_100381305 | 325 |
| 51 | 3300030522 | Ga0307512_10099387 | Ga0307512_100993872 | 325 |
| 52 | 3300031507 | Ga0307509_10202198 | Ga0307509_102021982 | 325 |
| 53 | 3300031616 | Ga0307508_10000007 | Ga0307508_1000000717 | 325 |
| 54 | 3300031649 | Ga0307514_10011693 | Ga0307514_100116934 | 325 |
| 55 | 3300031911 | Ga0307412_10134738 | Ga0307412_101347382 | 325 |
| 56 | 3300033179 | Ga0307507_10031222 | Ga0307507_100312226 | 325 |
| 57 | 3300046539 | Ga0495621_0021471 | Ga0495621_0021471_44_1078 | 325 |
| 58 | 3300030500 | Ga0268256_1007226 | Ga0268256_10072263 | 326 |
| 59 | 3300042156 | Ga0439446_0023098 | Ga0439446_0023098_342_1544 | 326 |
| 60 | 3300042531 | Ga0450918_000036 | Ga0450918_000036_23185_24297 | 326 |
| 61 | 3300044658 | Ga0466972_0003819 | Ga0466972_0003819_2111_3241 | 326 |
| 62 | 3300049579 | Ga0501043_0000149 | Ga0501043_0000149_50107_51237 | 326 |
| 63 | 3300049580 | Ga0501046_0000092 | Ga0501046_0000092_14022_15152 | 326 |
| 64 | 3300049581 | Ga0501047_0000028 | Ga0501047_0000028_169217_170347 | 326 |
| 65 | 3300049582 | Ga0501048_0009579 | Ga0501048_0009579_4463_5593 | 326 |
| 66 | 3300049824 | Ga0501045_0000170 | Ga0501045_0000170_7338_8468 | 326 |
| 67 | 3300025931 | Ga0207644_10268193 | Ga0207644_102681931 | 327 |
| 68 | 3300044656 | Ga0466969_0027148 | Ga0466969_0027148_697_1827 | 327 |
| 69 | 3300044656 | Ga0466969_0030894 | Ga0466969_0030894_209_1339 | 327 |
| 70 | 3300044684 | Ga0466966_0004701 | Ga0466966_0004701_6289_7419 | 327 |
| 71 | 3300044693 | Ga0466961_0050237 | Ga0466961_0050237_1448_2578 | 327 |
| 72 | 3300044694 | Ga0466963_0002329 | Ga0466963_0002329_4631_5761 | 327 |
| 73 | 3300044706 | Ga0466964_0006854 | Ga0466964_0006854_2889_4019 | 327 |
| 74 | 3300044719 | Ga0466971_0010748 | Ga0466971_0010748_1100_2230 | 327 |
| 75 | 3300044719 | Ga0466971_0023104 | Ga0466971_0023104_146_1276 | 327 |
| 76 | 3300045049 | Ga0466959_0001826 | Ga0466959_0001826_5252_6382 | 327 |
| 77 | 3300045049 | Ga0466959_0067606 | Ga0466959_0067606_976_2088 | 327 |
| 78 | 3300045976 | Ga0466967_0041245 | Ga0466967_0041245_1564_2694 | 327 |
| 79 | 3300061719 | Ga0466962_0002201 | Ga0466962_0002201_8040_9170 | 327 |
| 80 | 3300061719 | Ga0466962_0024685 | Ga0466962_0024685_1566_2696 | 327 |
| 81 | 3300009147 | Ga0114129_10597416 | Ga0114129_105974162 | 328 |
| 82 | 3300044656 | Ga0466969_0000056 | Ga0466969_0000056_45714_46844 | 329 |
| 83 | 3300044684 | Ga0466966_0020706 | Ga0466966_0020706_1989_3119 | 329 |
| 84 | 3300045049 | Ga0466959_0032449 | Ga0466959_0032449_360_1490 | 329 |
| 85 | 3300044712 | Ga0453684_0187373 | Ga0453684_0187373_295_1428 | 330 |
| 86 | 3300045051 | Ga0451576_0003772 | Ga0451576_0003772_7204_8337 | 330 |
| 87 | 3300050493 | nmdc:mga0k408_39694_c1 | nmdc:mga0k408_39694_c1_126_1262 | 330 |
| 88 | 3300053154 | Ga0500619_000325 | Ga0500619_000325_209_1354 | 331 |
| 89 | 3300003792 | Ga0055540_1009175 | Ga0055540_10091751 | 332 |
| 90 | 3300005616 | Ga0068852_100224064 | Ga0068852_1002240642 | 332 |
| 91 | 3300006353 | Ga0075370_10004055 | Ga0075370_100040553 | 332 |
| 92 | 3300025303 | Ga0209051_1006172 | Ga0209051_10061724 | 332 |
| 93 | 3300026118 | Ga0207675_100021444 | Ga0207675_1000214446 | 332 |
| 94 | 3300046492 | Ga0495585_0008002 | Ga0495585_0008002_992_2122 | 332 |
| 95 | 3300050496 | nmdc:mga07m45_31586_c1 | nmdc:mga07m45_31586_c1_283_1407 | 332 |
| 96 | 3300005330 | Ga0070690_100027241 | Ga0070690_1000272412 | 333 |
| 97 | 3300005340 | Ga0070689_100177005 | Ga0070689_1001770051 | 333 |
| 98 | 3300005355 | Ga0070671_100049616 | Ga0070671_1000496161 | 333 |
| 99 | 3300009177 | Ga0105248_10001017 | Ga0105248_1000101733 | 333 |
| 100 | 3300013296 | Ga0157374_10076605 | Ga0157374_100766053 | 333 |
| 101 | 3300013297 | Ga0157378_10087737 | Ga0157378_100877371 | 333 |
| 102 | 3300014745 | Ga0157377_10098814 | Ga0157377_100988142 | 333 |
| 103 | 3300025941 | Ga0207711_10061995 | Ga0207711_100619953 | 333 |
| 104 | 3300025942 | Ga0207689_10055607 | Ga0207689_100556075 | 333 |
| 105 | 3300033180 | Ga0307510_10022775 | Ga0307510_100227756 | 333 |
| 106 | 3300048915 | Ga0496112_0001089 | Ga0496112_0001089_16911_18041 | 333 |
| 107 | 3300003187 | JGI25151J46595_10004206 | JGI25151J46595_100042062 | 334 |
| 108 | 3300037471 | Ga0395905_0004070 | Ga0395905_0004070_4688_5818 | 334 |
| 109 | 3300036401 | Ga0373937_0087421 | Ga0373937_0087421_196_1257 | 335 |
| 110 | 3300046642 | Ga0495634_0241023 | Ga0495634_0241023_25_1092 | 335 |
| 111 | 3300005457 | Ga0070662_100004421 | Ga0070662_1000044213 | 336 |
| 112 | 3300021361 | Ga0213872_10002133 | Ga0213872_100021334 | 336 |
| 113 | 3300025933 | Ga0207706_10013431 | Ga0207706_100134316 | 336 |
| 114 | 3300039447 | Ga0436361_0347526 | Ga0436361_0347526_3755_4864 | 336 |
| 115 | 3300005344 | Ga0070661_100150359 | Ga0070661_1001503592 | 337 |
| 116 | 3300026142 | Ga0207698_10069043 | Ga0207698_100690433 | 337 |
| 117 | 3300044658 | Ga0466972_0000390 | Ga0466972_0000390_12956_14086 | 337 |
| 118 | 3300041460 | Ga0451802_0554797 | Ga0451802_0554797_975_2099 | 338 |
| 119 | 3300005262 | Ga0065165_1000569 | Ga0065165_100056949 | 340 |
| 120 | 3300005290 | Ga0065712_10024488 | Ga0065712_100244882 | 340 |
| 121 | 3300005331 | Ga0070670_100012213 | Ga0070670_1000122138 | 340 |
| 122 | 3300005353 | Ga0070669_100002753 | Ga0070669_1000027537 | 340 |
| 123 | 3300005354 | Ga0070675_100011301 | Ga0070675_1000113016 | 340 |
| 124 | 3300005355 | Ga0070671_100006504 | Ga0070671_1000065046 | 340 |
| 125 | 3300005356 | Ga0070674_100037117 | Ga0070674_1000371172 | 340 |
| 126 | 3300005364 | Ga0070673_100011122 | Ga0070673_1000111226 | 340 |
| 127 | 3300005367 | Ga0070667_100222985 | Ga0070667_1002229851 | 340 |
| 128 | 3300005459 | Ga0068867_100005126 | Ga0068867_10000512610 | 340 |
| 129 | 3300005543 | Ga0070672_100000520 | Ga0070672_10000052015 | 340 |
| 130 | 3300005564 | Ga0070664_100058075 | Ga0070664_1000580753 | 340 |
| 131 | 3300005618 | Ga0068864_100039034 | Ga0068864_1000390344 | 340 |
| 132 | 3300005719 | Ga0068861_100155522 | Ga0068861_1001555222 | 340 |
| 133 | 3300006881 | Ga0068865_100054946 | Ga0068865_1000549463 | 340 |
| 134 | 3300013308 | Ga0157375_10046145 | Ga0157375_100461453 | 340 |
| 135 | 3300017792 | Ga0163161_10063937 | Ga0163161_100639371 | 340 |
| 136 | 3300021361 | Ga0213872_10012868 | Ga0213872_100128684 | 340 |
| 137 | 3300025315 | Ga0207697_10029588 | Ga0207697_100295882 | 340 |
| 138 | 3300025923 | Ga0207681_10008325 | Ga0207681_100083255 | 340 |
| 139 | 3300025925 | Ga0207650_10000265 | Ga0207650_1000026520 | 340 |
| 140 | 3300025926 | Ga0207659_10000148 | Ga0207659_100001489 | 340 |
| 141 | 3300025931 | Ga0207644_10003662 | Ga0207644_100036623 | 340 |
| 142 | 3300025937 | Ga0207669_10004257 | Ga0207669_100042575 | 340 |
| 143 | 3300025937 | Ga0207669_10024521 | Ga0207669_100245212 | 340 |
| 144 | 3300025940 | Ga0207691_10012845 | Ga0207691_100128454 | 340 |
| 145 | 3300025945 | Ga0207679_10094573 | Ga0207679_100945733 | 340 |
| 146 | 3300025960 | Ga0207651_10006277 | Ga0207651_100062776 | 340 |
| 147 | 3300025986 | Ga0207658_10084677 | Ga0207658_100846771 | 340 |
| 148 | 3300026089 | Ga0207648_10034719 | Ga0207648_100347191 | 340 |
| 149 | 3300026089 | Ga0207648_10064100 | Ga0207648_100641001 | 340 |
| 150 | 3300026118 | Ga0207675_100072379 | Ga0207675_1000723792 | 340 |
| 151 | 3300026121 | Ga0207683_10013304 | Ga0207683_100133046 | 340 |
| 152 | 3300028794 | Ga0307515_10087834 | Ga0307515_100878343 | 340 |
| 153 | 3300039447 | Ga0436361_0409948 | Ga0436361_0409948_9440_10555 | 340 |
| 154 | 3300046454 | Ga0495592_0000291 | Ga0495592_0000291_35892_37004 | 340 |
| 155 | 3300035691 | Ga0373931_0022679 | Ga0373931_0022679_652_1782 | 341 |
| 156 | 3300042876 | Ga0451577_0006947 | Ga0451577_0006947_1262_2404 | 342 |
| 157 | iso_pu_bacteria | 2511231002 | 2511243894 | 342 |
| 158 | iso_pu_bacteria | 2904479285 | 2904482177 | 343 |
| 159 | iso_pu_bacteria | 2547132103 | 2547371073 | 344 |
| 160 | iso_pu_bacteria | 2843690924 | 2843694116 | 344 |
| 161 | iso_pu_bacteria | 2846033681 | 2846037192 | 344 |
| 162 | iso_pu_bacteria | 2846037992 | 2846038958 | 344 |
| 163 | iso_pu_bacteria | 2998344455 | 2998346700 | 344 |
| 164 | 3300021361 | Ga0213872_10020466 | Ga0213872_100204662 | 346 |
| 165 | 3300031456 | Ga0307513_10000004 | Ga0307513_10000004288 | 346 |
| 166 | 3300031730 | Ga0307516_10016231 | Ga0307516_100162314 | 346 |
| 167 | 3300039447 | Ga0436361_0224027 | Ga0436361_0224027_693_1823 | 346 |
| 168 | iso_pu_bacteria | 2547132512 | 2548849319 | 346 |
| 169 | iso_pu_bacteria | 2574179768 | 2574431962 | 346 |
| 170 | iso_pu_bacteria | 2585428058 | 2587736732 | 346 |
| 171 | iso_pu_bacteria | 2585428062 | 2587755612 | 346 |
| 172 | iso_pu_bacteria | 2588253510 | 2588295342 | 346 |
| 173 | iso_pu_bacteria | 2643221625 | 2644142388 | 346 |
| 174 | iso_pu_bacteria | 2643221644 | 2644246993 | 346 |
| 175 | iso_pu_bacteria | 2643221648 | 2644275146 | 346 |
| 176 | iso_pu_bacteria | 2891633521 | 2891636055 | 346 |
| 177 | iso_pu_bacteria | 639633007 | 639786334 | 346 |
| 178 | iso_pu_bacteria | 2513237151 | 2513962793 | 347 |
| 179 | iso_pu_bacteria | 2551306416 | 2553006210 | 347 |
| 180 | iso_pu_bacteria | 2599185178 | 2599443732 | 347 |
| 181 | iso_pu_bacteria | 2643221544 | 2643742838 | 347 |
| 182 | iso_pu_bacteria | 2643221585 | 2643933322 | 347 |
| 183 | iso_pu_bacteria | 2643221639 | 2644217530 | 347 |
| 184 | iso_pu_bacteria | 2643221646 | 2644258734 | 347 |
| 185 | iso_pu_bacteria | 2643221656 | 2644314571 | 347 |
| 186 | iso_pu_bacteria | 2738541337 | 2739056568 | 347 |
| 187 | iso_pu_bacteria | 2765235838 | 2765571011 | 347 |
| 188 | iso_pu_bacteria | 2831864461 | 2831865508 | 347 |
| 189 | iso_pu_bacteria | 2834641062 | 2834644810 | 347 |
| 190 | iso_pu_bacteria | 2885266251 | 2885267376 | 347 |
| 191 | iso_pu_bacteria | 2900577576 | 2900582956 | 347 |
| 192 | iso_pu_bacteria | 2928058823 | 2928061994 | 347 |
| 193 | 3300005336 | Ga0070680_100181391 | Ga0070680_1001813912 | 348 |
| 194 | 3300005339 | Ga0070660_100055514 | Ga0070660_1000555143 | 348 |
| 195 | 3300005563 | Ga0068855_100030309 | Ga0068855_1000303094 | 348 |
| 196 | 3300021361 | Ga0213872_10030117 | Ga0213872_100301173 | 348 |
| 197 | 3300025919 | Ga0207657_10038876 | Ga0207657_100388764 | 348 |
| 198 | 3300025921 | Ga0207652_10277405 | Ga0207652_102774051 | 348 |
| 199 | 3300026121 | Ga0207683_10286663 | Ga0207683_102866631 | 348 |
| 200 | 3300039447 | Ga0436361_0240585 | Ga0436361_0240585_719_1828 | 348 |
| 201 | 3300044656 | Ga0466969_0002248 | Ga0466969_0002248_3983_5092 | 348 |
| 202 | 3300044683 | Ga0466965_0006239 | Ga0466965_0006239_675_1784 | 348 |
| 203 | 3300044693 | Ga0466961_0000465 | Ga0466961_0000465_4715_5824 | 348 |
| 204 | 3300045049 | Ga0466959_0000680 | Ga0466959_0000680_4668_5777 | 348 |
| 205 | 3300003761 | Ga0055535_1000641 | Ga0055535_10006416 | 349 |
| 206 | 3300003763 | Ga0055529_1000602 | Ga0055529_100060222 | 349 |
| 207 | 3300005353 | Ga0070669_100267501 | Ga0070669_1002675011 | 349 |
| 208 | 3300005471 | Ga0070698_100301761 | Ga0070698_1003017611 | 349 |
| 209 | 3300005841 | Ga0068863_100250424 | Ga0068863_1002504242 | 349 |
| 210 | 3300006914 | Ga0075436_100072343 | Ga0075436_1000723433 | 349 |
| 211 | 3300025242 | Ga0209258_100630 | Ga0209258_1006307 | 349 |
| 212 | 3300025256 | Ga0209759_1009015 | Ga0209759_10090152 | 349 |
| 213 | 3300025272 | Ga0209455_1000508 | Ga0209455_10005087 | 349 |
| 214 | 3300035113 | Ga0373936_0043991 | Ga0373936_0043991_249_1355 | 349 |
| 215 | 3300035172 | Ga0373955_0042399 | Ga0373955_0042399_356_1462 | 349 |
| 216 | 3300036401 | Ga0373937_0249749 | Ga0373937_0249749_528_1634 | 349 |
| 217 | 3300039447 | Ga0436361_0431442 | Ga0436361_0431442_101_1228 | 349 |
| 218 | 3300042876 | Ga0451577_0024692 | Ga0451577_0024692_2078_3184 | 349 |
| 219 | 3300044712 | Ga0453684_0000114 | Ga0453684_0000114_183914_185020 | 349 |
| 220 | 3300044712 | Ga0453684_0059341 | Ga0453684_0059341_614_1720 | 349 |
| 221 | 3300045051 | Ga0451576_0007439 | Ga0451576_0007439_10668_11774 | 349 |
| 222 | 3300045051 | Ga0451576_0023472 | Ga0451576_0023472_2962_4068 | 349 |
| 223 | 3300045051 | Ga0451576_0024433 | Ga0451576_0024433_1509_2615 | 349 |
| 224 | 3300045051 | Ga0451576_0028815 | Ga0451576_0028815_1493_2599 | 349 |
| 225 | 3300046683 | Ga0495658_0015312 | Ga0495658_0015312_166_1272 | 349 |
| 226 | 3300049582 | Ga0501048_0089301 | Ga0501048_0089301_586_1677 | 349 |
| 227 | 3300049587 | Ga0501071_0003792 | Ga0501071_0003792_4485_5576 | 349 |
| 228 | 3300049588 | Ga0501072_0035564 | Ga0501072_0035564_2449_3540 | 349 |
| 229 | 3300049741 | Ga0501079_0068513 | Ga0501079_0068513_320_1411 | 349 |
| 230 | 3300049822 | Ga0501035_0192155 | Ga0501035_0192155_352_1443 | 349 |
| 231 | 3300050514 | nmdc:mga08x19_70054_c1 | nmdc:mga08x19_70054_c1_158_1264 | 349 |
| 232 | 3300001979 | JGI24740J21852_10020003 | JGI24740J21852_100200033 | 350 |
| 233 | 3300001991 | JGI24743J22301_10006182 | JGI24743J22301_100061822 | 350 |
| 234 | 3300005328 | Ga0070676_10001034 | Ga0070676_100010348 | 350 |
| 235 | 3300005328 | Ga0070676_10059807 | Ga0070676_100598071 | 350 |
| 236 | 3300005330 | Ga0070690_100050076 | Ga0070690_1000500761 | 350 |
| 237 | 3300005334 | Ga0068869_100005217 | Ga0068869_1000052172 | 350 |
| 238 | 3300005335 | Ga0070666_10076811 | Ga0070666_100768111 | 350 |
| 239 | 3300005338 | Ga0068868_100262068 | Ga0068868_1002620682 | 350 |
| 240 | 3300005339 | Ga0070660_100067859 | Ga0070660_1000678592 | 350 |
| 241 | 3300005344 | Ga0070661_100001108 | Ga0070661_10000110818 | 350 |
| 242 | 3300005344 | Ga0070661_100016464 | Ga0070661_1000164645 | 350 |
| 243 | 3300005353 | Ga0070669_100163053 | Ga0070669_1001630532 | 350 |
| 244 | 3300005354 | Ga0070675_100193237 | Ga0070675_1001932372 | 350 |
| 245 | 3300005355 | Ga0070671_100005776 | Ga0070671_1000057761 | 350 |
| 246 | 3300005355 | Ga0070671_100123151 | Ga0070671_1001231511 | 350 |
| 247 | 3300005356 | Ga0070674_100118645 | Ga0070674_1001186452 | 350 |
| 248 | 3300005366 | Ga0070659_100001014 | Ga0070659_1000010147 | 350 |
| 249 | 3300005366 | Ga0070659_100066418 | Ga0070659_1000664183 | 350 |
| 250 | 3300005441 | Ga0070700_100092176 | Ga0070700_1000921762 | 350 |
| 251 | 3300005444 | Ga0070694_100066092 | Ga0070694_1000660923 | 350 |
| 252 | 3300005456 | Ga0070678_100062876 | Ga0070678_1000628763 | 350 |
| 253 | 3300005459 | Ga0068867_100028944 | Ga0068867_1000289443 | 350 |
| 254 | 3300005543 | Ga0070672_100026519 | Ga0070672_1000265193 | 350 |
| 255 | 3300005563 | Ga0068855_100043110 | Ga0068855_1000431105 | 350 |
| 256 | 3300005563 | Ga0068855_100048452 | Ga0068855_1000484525 | 350 |
| 257 | 3300005564 | Ga0070664_100006317 | Ga0070664_1000063173 | 350 |
| 258 | 3300005616 | Ga0068852_100018167 | Ga0068852_1000181675 | 350 |
| 259 | 3300005617 | Ga0068859_100033628 | Ga0068859_1000336285 | 350 |
| 260 | 3300005618 | Ga0068864_100017643 | Ga0068864_1000176433 | 350 |
| 261 | 3300005719 | Ga0068861_100067562 | Ga0068861_1000675623 | 350 |
| 262 | 3300005841 | Ga0068863_100007733 | Ga0068863_1000077336 | 350 |
| 263 | 3300005841 | Ga0068863_100058519 | Ga0068863_1000585194 | 350 |
| 264 | 3300005841 | Ga0068863_100087822 | Ga0068863_1000878223 | 350 |
| 265 | 3300005842 | Ga0068858_100129462 | Ga0068858_1001294622 | 350 |
| 266 | 3300005843 | Ga0068860_100006790 | Ga0068860_1000067908 | 350 |
| 267 | 3300005843 | Ga0068860_100062070 | Ga0068860_1000620703 | 350 |
| 268 | 3300005844 | Ga0068862_100045535 | Ga0068862_1000455354 | 350 |
| 269 | 3300005844 | Ga0068862_100084626 | Ga0068862_1000846262 | 350 |
| 270 | 3300006353 | Ga0075370_10137032 | Ga0075370_101370321 | 350 |
| 271 | 3300006358 | Ga0068871_100015078 | Ga0068871_1000150783 | 350 |
| 272 | 3300006931 | Ga0097620_100033628 | Ga0097620_1000336285 | 350 |
| 273 | 3300009147 | Ga0114129_10011675 | Ga0114129_100116754 | 350 |
| 274 | 3300009176 | Ga0105242_10013549 | Ga0105242_100135493 | 350 |
| 275 | 3300009177 | Ga0105248_10116598 | Ga0105248_101165983 | 350 |
| 276 | 3300009545 | Ga0105237_10208066 | Ga0105237_102080662 | 350 |
| 277 | 3300009553 | Ga0105249_10053995 | Ga0105249_100539953 | 350 |
| 278 | 3300013100 | Ga0157373_10004520 | Ga0157373_1000452010 | 350 |
| 279 | 3300013104 | Ga0157370_10209105 | Ga0157370_102091051 | 350 |
| 280 | 3300013297 | Ga0157378_10009642 | Ga0157378_100096422 | 350 |
| 281 | 3300013297 | Ga0157378_10017857 | Ga0157378_100178577 | 350 |
| 282 | 3300013306 | Ga0163162_10266275 | Ga0163162_102662751 | 350 |
| 283 | 3300013307 | Ga0157372_10032119 | Ga0157372_100321193 | 350 |
| 284 | 3300013308 | Ga0157375_10278942 | Ga0157375_102789421 | 350 |
| 285 | 3300014325 | Ga0163163_10186391 | Ga0163163_101863912 | 350 |
| 286 | 3300014326 | Ga0157380_10018320 | Ga0157380_100183203 | 350 |
| 287 | 3300014968 | Ga0157379_10205024 | Ga0157379_102050242 | 350 |
| 288 | 3300017792 | Ga0163161_10008757 | Ga0163161_100087573 | 350 |
| 289 | 3300021361 | Ga0213872_10001888 | Ga0213872_100018887 | 350 |
| 290 | 3300021361 | Ga0213872_10002209 | Ga0213872_100022093 | 350 |
| 291 | 3300025903 | Ga0207680_10033476 | Ga0207680_100334764 | 350 |
| 292 | 3300025914 | Ga0207671_10212660 | Ga0207671_102126602 | 350 |
| 293 | 3300025920 | Ga0207649_10000951 | Ga0207649_100009518 | 350 |
| 294 | 3300025923 | Ga0207681_10045573 | Ga0207681_100455731 | 350 |
| 295 | 3300025925 | Ga0207650_10008031 | Ga0207650_100080316 | 350 |
| 296 | 3300025926 | Ga0207659_10202800 | Ga0207659_102028002 | 350 |
| 297 | 3300025931 | Ga0207644_10012407 | Ga0207644_100124075 | 350 |
| 298 | 3300025932 | Ga0207690_10000658 | Ga0207690_100006587 | 350 |
| 299 | 3300025940 | Ga0207691_10002036 | Ga0207691_100020367 | 350 |
| 300 | 3300025941 | Ga0207711_10219893 | Ga0207711_102198932 | 350 |
| 301 | 3300025945 | Ga0207679_10003109 | Ga0207679_100031092 | 350 |
| 302 | 3300025949 | Ga0207667_10017027 | Ga0207667_100170279 | 350 |
| 303 | 3300026023 | Ga0207677_10015406 | Ga0207677_100154062 | 350 |
| 304 | 3300026035 | Ga0207703_10061761 | Ga0207703_100617612 | 350 |
| 305 | 3300026078 | Ga0207702_10066788 | Ga0207702_100667884 | 350 |
| 306 | 3300026088 | Ga0207641_10025181 | Ga0207641_100251813 | 350 |
| 307 | 3300026089 | Ga0207648_10056500 | Ga0207648_100565002 | 350 |
| 308 | 3300026095 | Ga0207676_10015363 | Ga0207676_100153634 | 350 |
| 309 | 3300026118 | Ga0207675_100054825 | Ga0207675_1000548254 | 350 |
| 310 | 3300026121 | Ga0207683_10014592 | Ga0207683_100145923 | 350 |
| 311 | 3300026142 | Ga0207698_10042141 | Ga0207698_100421413 | 350 |
| 312 | 3300028380 | Ga0268265_10178538 | Ga0268265_101785382 | 350 |
| 313 | 3300028381 | Ga0268264_10025766 | Ga0268264_100257663 | 350 |
| 314 | 3300028381 | Ga0268264_10357704 | Ga0268264_103577041 | 350 |
| 315 | 3300028794 | Ga0307515_10000090 | Ga0307515_10000090134 | 350 |
| 316 | 3300031238 | Ga0265332_10000004 | Ga0265332_10000004235 | 350 |
| 317 | 3300031241 | Ga0265325_10007114 | Ga0265325_100071143 | 350 |
| 318 | 3300031344 | Ga0265316_10080048 | Ga0265316_100800481 | 350 |
| 319 | 3300031344 | Ga0265316_10242163 | Ga0265316_102421631 | 350 |
| 320 | 3300031507 | Ga0307509_10000072 | Ga0307509_1000007292 | 350 |
| 321 | 3300031730 | Ga0307516_10003842 | Ga0307516_1000384223 | 350 |
| 322 | 3300032004 | Ga0307414_10169678 | Ga0307414_101696781 | 350 |
| 323 | 3300035692 | Ga0373935_0099188 | Ga0373935_0099188_99_1208 | 350 |
| 324 | 3300039447 | Ga0436361_0313546 | Ga0436361_0313546_10380_11504 | 350 |
| 325 | 3300039447 | Ga0436361_0500164 | Ga0436361_0500164_20107_21231 | 350 |
| 326 | 3300042876 | Ga0451577_0000519 | Ga0451577_0000519_12490_13608 | 350 |
| 327 | 3300042876 | Ga0451577_0029185 | Ga0451577_0029185_2113_3213 | 350 |
| 328 | 3300042876 | Ga0451577_0081617 | Ga0451577_0081617_1749_2867 | 350 |
| 329 | 3300042876 | Ga0451577_0104771 | Ga0451577_0104771_230_1330 | 350 |
| 330 | 3300042876 | Ga0451577_0130423 | Ga0451577_0130423_297_1406 | 350 |
| 331 | 3300042876 | Ga0451577_0313424 | Ga0451577_0313424_52_1161 | 350 |
| 332 | 3300044712 | Ga0453684_0000005 | Ga0453684_0000005_1417997_1419115 | 350 |
| 333 | 3300044712 | Ga0453684_0000296 | Ga0453684_0000296_12050_13168 | 350 |
| 334 | 3300044712 | Ga0453684_0000419 | Ga0453684_0000419_13454_14563 | 350 |
| 335 | 3300044712 | Ga0453684_0011178 | Ga0453684_0011178_2137_3255 | 350 |
| 336 | 3300044712 | Ga0453684_0018530 | Ga0453684_0018530_1959_3062 | 350 |
| 337 | 3300045051 | Ga0451576_0000166 | Ga0451576_0000166_122369_123469 | 350 |
| 338 | 3300045051 | Ga0451576_0005878 | Ga0451576_0005878_11860_12978 | 350 |
| 339 | 3300045051 | Ga0451576_0007667 | Ga0451576_0007667_11551_12666 | 350 |
| 340 | 3300045051 | Ga0451576_0011665 | Ga0451576_0011665_4388_5488 | 350 |
| 341 | 3300045051 | Ga0451576_0023534 | Ga0451576_0023534_2787_3890 | 350 |
| 342 | 3300045051 | Ga0451576_0090837 | Ga0451576_0090837_986_2095 | 350 |
| 343 | 3300048908 | Ga0496105_0079238 | Ga0496105_0079238_1393_2502 | 350 |
| 344 | 3300049649 | Ga0501198_000025 | Ga0501198_000025_38515_39648 | 350 |
| 345 | 3300049662 | Ga0501222_000033 | Ga0501222_000033_26636_27769 | 350 |
| 346 | 3300049742 | Ga0501080_0016126 | Ga0501080_0016126_2318_3427 | 350 |
| 347 | 3300050496 | nmdc:mga07m45_169856_c1 | nmdc:mga07m45_169856_c1_126_1229 | 350 |
| 348 | 3300053177 | Ga0500636_0000064 | Ga0500636_0000064_35670_36770 | 350 |
| 349 | 3300054114 | Ga0501084_0033974 | Ga0501084_0033974_2399_3508 | 350 |
| 350 | 3300001979 | JGI24740J21852_10000340 | JGI24740J21852_1000034011 | 351 |
| 351 | 3300002705 | JGI25156J39149_1000220 | JGI25156J39149_10002207 | 351 |
| 352 | 3300002705 | JGI25156J39149_1006463 | JGI25156J39149_10064631 | 351 |
| 353 | 3300002705 | JGI25156J39149_1013422 | JGI25156J39149_10134221 | 351 |
| 354 | 3300002738 | JGI25154J39366_1000669 | JGI25154J39366_10006693 | 351 |
| 355 | 3300002738 | JGI25154J39366_1001211 | JGI25154J39366_10012112 | 351 |
| 356 | 3300002741 | JGI25157J39369_1000135 | JGI25157J39369_100013551 | 351 |
| 357 | 3300003187 | JGI25151J46595_10000728 | JGI25151J46595_1000072823 | 351 |
| 358 | 3300003187 | JGI25151J46595_10003136 | JGI25151J46595_100031364 | 351 |
| 359 | 3300003187 | JGI25151J46595_10018212 | JGI25151J46595_100182124 | 351 |
| 360 | 3300003320 | rootH2_10005083 | rootH2_100050835 | 351 |
| 361 | 3300003751 | Ga0055538_1000084 | Ga0055538_100008426 | 351 |
| 362 | 3300003751 | Ga0055538_1005996 | Ga0055538_10059961 | 351 |
| 363 | 3300003751 | Ga0055538_1005999 | Ga0055538_10059991 | 351 |
| 364 | 3300003752 | Ga0055539_1000068 | Ga0055539_1000068111 | 351 |
| 365 | 3300003752 | Ga0055539_1000125 | Ga0055539_100012526 | 351 |
| 366 | 3300003756 | Ga0055533_1000132 | Ga0055533_100013226 | 351 |
| 367 | 3300003756 | Ga0055533_1000172 | Ga0055533_100017248 | 351 |
| 368 | 3300003756 | Ga0055533_1000361 | Ga0055533_10003617 | 351 |
| 369 | 3300003756 | Ga0055533_1004790 | Ga0055533_10047901 | 351 |
| 370 | 3300003758 | Ga0055532_1000028 | Ga0055532_100002878 | 351 |
| 371 | 3300003759 | Ga0055525_1000171 | Ga0055525_100017126 | 351 |
| 372 | 3300003759 | Ga0055525_1000598 | Ga0055525_10005983 | 351 |
| 373 | 3300003759 | Ga0055525_1000665 | Ga0055525_10006659 | 351 |
| 374 | 3300003760 | Ga0055527_1003277 | Ga0055527_10032773 | 351 |
| 375 | 3300003761 | Ga0055535_1000022 | Ga0055535_100002278 | 351 |
| 376 | 3300003762 | Ga0055542_1001981 | Ga0055542_10019814 | 351 |
| 377 | 3300003763 | Ga0055529_1000063 | Ga0055529_100006333 | 351 |
| 378 | 3300003763 | Ga0055529_1000145 | Ga0055529_100014510 | 351 |
| 379 | 3300003771 | Ga0055526_1011980 | Ga0055526_10119803 | 351 |
| 380 | 3300003771 | Ga0055526_1019952 | Ga0055526_10199522 | 351 |
| 381 | 3300003771 | Ga0055526_1033905 | Ga0055526_10339051 | 351 |
| 382 | 3300003775 | Ga0055524_1000290 | Ga0055524_100029030 | 351 |
| 383 | 3300003775 | Ga0055524_1009546 | Ga0055524_10095464 | 351 |
| 384 | 3300003781 | Ga0055536_1000074 | Ga0055536_100007445 | 351 |
| 385 | 3300003784 | Ga0055534_1002013 | Ga0055534_10020134 | 351 |
| 386 | 3300003784 | Ga0055534_1003067 | Ga0055534_10030674 | 351 |
| 387 | 3300003841 | Ga0055541_1000083 | Ga0055541_100008352 | 351 |
| 388 | 3300003841 | Ga0055541_1002647 | Ga0055541_10026473 | 351 |
| 389 | 3300005290 | Ga0065712_10078545 | Ga0065712_100785452 | 351 |
| 390 | 3300005327 | Ga0070658_10006078 | Ga0070658_100060788 | 351 |
| 391 | 3300005327 | Ga0070658_10014263 | Ga0070658_100142636 | 351 |
| 392 | 3300005327 | Ga0070658_10051266 | Ga0070658_100512663 | 351 |
| 393 | 3300005330 | Ga0070690_100047414 | Ga0070690_1000474141 | 351 |
| 394 | 3300005340 | Ga0070689_100115781 | Ga0070689_1001157812 | 351 |
| 395 | 3300005344 | Ga0070661_100000127 | Ga0070661_10000012743 | 351 |
| 396 | 3300005345 | Ga0070692_10147313 | Ga0070692_101473131 | 351 |
| 397 | 3300005354 | Ga0070675_100206976 | Ga0070675_1002069761 | 351 |
| 398 | 3300005356 | Ga0070674_100121168 | Ga0070674_1001211683 | 351 |
| 399 | 3300005364 | Ga0070673_100103091 | Ga0070673_1001030913 | 351 |
| 400 | 3300005365 | Ga0070688_100075300 | Ga0070688_1000753004 | 351 |
| 401 | 3300005435 | Ga0070714_100050194 | Ga0070714_1000501941 | 351 |
| 402 | 3300005436 | Ga0070713_100087771 | Ga0070713_1000877713 | 351 |
| 403 | 3300005438 | Ga0070701_10033350 | Ga0070701_100333502 | 351 |
| 404 | 3300005440 | Ga0070705_100037898 | Ga0070705_1000378982 | 351 |
| 405 | 3300005440 | Ga0070705_100195030 | Ga0070705_1001950301 | 351 |
| 406 | 3300005455 | Ga0070663_100000005 | Ga0070663_100000005123 | 351 |
| 407 | 3300005455 | Ga0070663_100001510 | Ga0070663_1000015102 | 351 |
| 408 | 3300005458 | Ga0070681_10006660 | Ga0070681_100066608 | 351 |
| 409 | 3300005459 | Ga0068867_100000249 | Ga0068867_10000024914 | 351 |
| 410 | 3300005466 | Ga0070685_10038814 | Ga0070685_100388143 | 351 |
| 411 | 3300005471 | Ga0070698_100024331 | Ga0070698_1000243314 | 351 |
| 412 | 3300005530 | Ga0070679_100010085 | Ga0070679_1000100852 | 351 |
| 413 | 3300005530 | Ga0070679_100015526 | Ga0070679_1000155264 | 351 |
| 414 | 3300005535 | Ga0070684_100027216 | Ga0070684_1000272166 | 351 |
| 415 | 3300005539 | Ga0068853_100074850 | Ga0068853_1000748504 | 351 |
| 416 | 3300005543 | Ga0070672_100028153 | Ga0070672_1000281534 | 351 |
| 417 | 3300005546 | Ga0070696_100033303 | Ga0070696_1000333033 | 351 |
| 418 | 3300005547 | Ga0070693_100110608 | Ga0070693_1001106081 | 351 |
| 419 | 3300005549 | Ga0070704_100010535 | Ga0070704_1000105354 | 351 |
| 420 | 3300005563 | Ga0068855_100002213 | Ga0068855_10000221310 | 351 |
| 421 | 3300005563 | Ga0068855_100017466 | Ga0068855_1000174664 | 351 |
| 422 | 3300005563 | Ga0068855_100165615 | Ga0068855_1001656151 | 351 |
| 423 | 3300005564 | Ga0070664_100000001 | Ga0070664_10000000181 | 351 |
| 424 | 3300005577 | Ga0068857_100019209 | Ga0068857_1000192096 | 351 |
| 425 | 3300005578 | Ga0068854_100000360 | Ga0068854_10000036019 | 351 |
| 426 | 3300005578 | Ga0068854_100050767 | Ga0068854_1000507672 | 351 |
| 427 | 3300005578 | Ga0068854_100128870 | Ga0068854_1001288702 | 351 |
| 428 | 3300005614 | Ga0068856_100000008 | Ga0068856_1000000086 | 351 |
| 429 | 3300005614 | Ga0068856_100017028 | Ga0068856_1000170284 | 351 |
| 430 | 3300005614 | Ga0068856_100026163 | Ga0068856_1000261632 | 351 |
| 431 | 3300005616 | Ga0068852_100001134 | Ga0068852_1000011345 | 351 |
| 432 | 3300005616 | Ga0068852_100019290 | Ga0068852_1000192905 | 351 |
| 433 | 3300005616 | Ga0068852_100030609 | Ga0068852_1000306094 | 351 |
| 434 | 3300005617 | Ga0068859_100043018 | Ga0068859_1000430185 | 351 |
| 435 | 3300005617 | Ga0068859_100321316 | Ga0068859_1003213162 | 351 |
| 436 | 3300005617 | Ga0068859_100335794 | Ga0068859_1003357942 | 351 |
| 437 | 3300005834 | Ga0068851_10003401 | Ga0068851_100034017 | 351 |
| 438 | 3300005842 | Ga0068858_100056576 | Ga0068858_1000565763 | 351 |
| 439 | 3300005842 | Ga0068858_100083388 | Ga0068858_1000833883 | 351 |
| 440 | 3300006186 | Ga0075369_10006951 | Ga0075369_100069514 | 351 |
| 441 | 3300006195 | Ga0075366_10007379 | Ga0075366_100073796 | 351 |
| 442 | 3300006195 | Ga0075366_10061476 | Ga0075366_100614763 | 351 |
| 443 | 3300006195 | Ga0075366_10071927 | Ga0075366_100719272 | 351 |
| 444 | 3300006195 | Ga0075366_10102119 | Ga0075366_101021192 | 351 |
| 445 | 3300006237 | Ga0097621_100051122 | Ga0097621_1000511224 | 351 |
| 446 | 3300006353 | Ga0075370_10005449 | Ga0075370_100054496 | 351 |
| 447 | 3300006358 | Ga0068871_100009363 | Ga0068871_1000093638 | 351 |
| 448 | 3300006358 | Ga0068871_100183974 | Ga0068871_1001839741 | 351 |
| 449 | 3300006844 | Ga0075428_100045170 | Ga0075428_1000451704 | 351 |
| 450 | 3300006847 | Ga0075431_100052358 | Ga0075431_1000523584 | 351 |
| 451 | 3300006852 | Ga0075433_10186500 | Ga0075433_101865003 | 351 |
| 452 | 3300006852 | Ga0075433_10266638 | Ga0075433_102666382 | 351 |
| 453 | 3300006880 | Ga0075429_100000146 | Ga0075429_10000014626 | 351 |
| 454 | 3300006880 | Ga0075429_100047747 | Ga0075429_1000477472 | 351 |
| 455 | 3300006881 | Ga0068865_100029750 | Ga0068865_1000297503 | 351 |
| 456 | 3300006931 | Ga0097620_100043018 | Ga0097620_1000430185 | 351 |
| 457 | 3300006931 | Ga0097620_100321360 | Ga0097620_1003213601 | 351 |
| 458 | 3300006931 | Ga0097620_100335794 | Ga0097620_1003357942 | 351 |
| 459 | 3300006948 | Ga0099826_10000015 | Ga0099826_1000001550 | 351 |
| 460 | 3300007076 | Ga0075435_100307001 | Ga0075435_1003070011 | 351 |
| 461 | 3300009093 | Ga0105240_10006302 | Ga0105240_1000630214 | 351 |
| 462 | 3300009093 | Ga0105240_10103453 | Ga0105240_101034534 | 351 |
| 463 | 3300009093 | Ga0105240_10142898 | Ga0105240_101428981 | 351 |
| 464 | 3300009094 | Ga0111539_10001478 | Ga0111539_1000147824 | 351 |
| 465 | 3300009094 | Ga0111539_10077596 | Ga0111539_100775963 | 351 |
| 466 | 3300009098 | Ga0105245_10101426 | Ga0105245_101014263 | 351 |
| 467 | 3300009098 | Ga0105245_10181528 | Ga0105245_101815282 | 351 |
| 468 | 3300009147 | Ga0114129_10025565 | Ga0114129_1002556510 | 351 |
| 469 | 3300009148 | Ga0105243_10002157 | Ga0105243_100021574 | 351 |
| 470 | 3300009174 | Ga0105241_10008816 | Ga0105241_100088166 | 351 |
| 471 | 3300009174 | Ga0105241_10097593 | Ga0105241_100975933 | 351 |
| 472 | 3300009174 | Ga0105241_10267668 | Ga0105241_102676682 | 351 |
| 473 | 3300009177 | Ga0105248_10016620 | Ga0105248_100166206 | 351 |
| 474 | 3300009177 | Ga0105248_10048319 | Ga0105248_100483194 | 351 |
| 475 | 3300009177 | Ga0105248_10063274 | Ga0105248_100632744 | 351 |
| 476 | 3300009545 | Ga0105237_10105532 | Ga0105237_101055322 | 351 |
| 477 | 3300009551 | Ga0105238_10028556 | Ga0105238_100285562 | 351 |
| 478 | 3300009551 | Ga0105238_10037056 | Ga0105238_100370564 | 351 |
| 479 | 3300009551 | Ga0105238_10072034 | Ga0105238_100720342 | 351 |
| 480 | 3300010375 | Ga0105239_10056778 | Ga0105239_100567783 | 351 |
| 481 | 3300013100 | Ga0157373_10000732 | Ga0157373_1000073218 | 351 |
| 482 | 3300013102 | Ga0157371_10000035 | Ga0157371_1000003512 | 351 |
| 483 | 3300013104 | Ga0157370_10000021 | Ga0157370_10000021102 | 351 |
| 484 | 3300013104 | Ga0157370_10001810 | Ga0157370_1000181019 | 351 |
| 485 | 3300013105 | Ga0157369_10008405 | Ga0157369_100084059 | 351 |
| 486 | 3300013296 | Ga0157374_10018896 | Ga0157374_100188963 | 351 |
| 487 | 3300013297 | Ga0157378_10066292 | Ga0157378_100662923 | 351 |
| 488 | 3300013306 | Ga0163162_10164616 | Ga0163162_101646162 | 351 |
| 489 | 3300013306 | Ga0163162_10256805 | Ga0163162_102568052 | 351 |
| 490 | 3300013307 | Ga0157372_10000331 | Ga0157372_1000033138 | 351 |
| 491 | 3300013307 | Ga0157372_10023625 | Ga0157372_100236256 | 351 |
| 492 | 3300013307 | Ga0157372_10042431 | Ga0157372_100424314 | 351 |
| 493 | 3300013307 | Ga0157372_10341950 | Ga0157372_103419501 | 351 |
| 494 | 3300013308 | Ga0157375_10166888 | Ga0157375_101668882 | 351 |
| 495 | 3300014745 | Ga0157377_10000016 | Ga0157377_10000016171 | 351 |
| 496 | 3300014745 | Ga0157377_10005227 | Ga0157377_100052272 | 351 |
| 497 | 3300014968 | Ga0157379_10014692 | Ga0157379_100146924 | 351 |
| 498 | 3300015261 | Ga0182006_1000956 | Ga0182006_10009564 | 351 |
| 499 | 3300017792 | Ga0163161_10069050 | Ga0163161_100690501 | 351 |
| 500 | 3300020069 | Ga0197907_10277493 | Ga0197907_102774931 | 351 |
| 501 | 3300020076 | Ga0206355_1056333 | Ga0206355_10563331 | 351 |
| 502 | 3300020077 | Ga0206351_10481241 | Ga0206351_104812411 | 351 |
| 503 | 3300020610 | Ga0154015_1042038 | Ga0154015_104203828 | 351 |
| 504 | 3300021361 | Ga0213872_10000049 | Ga0213872_1000004948 | 351 |
| 505 | 3300021361 | Ga0213872_10007035 | Ga0213872_100070354 | 351 |
| 506 | 3300025224 | Ga0209784_100009 | Ga0209784_100009588 | 351 |
| 507 | 3300025224 | Ga0209784_100014 | Ga0209784_100014355 | 351 |
| 508 | 3300025224 | Ga0209784_100505 | Ga0209784_1005051 | 351 |
| 509 | 3300025225 | Ga0209566_100007 | Ga0209566_100007588 | 351 |
| 510 | 3300025225 | Ga0209566_100011 | Ga0209566_100011355 | 351 |
| 511 | 3300025225 | Ga0209566_100447 | Ga0209566_10044710 | 351 |
| 512 | 3300025226 | Ga0209674_100018 | Ga0209674_100018588 | 351 |
| 513 | 3300025226 | Ga0209674_100032 | Ga0209674_100032130 | 351 |
| 514 | 3300025226 | Ga0209674_100088 | Ga0209674_1000886 | 351 |
| 515 | 3300025226 | Ga0209674_100131 | Ga0209674_10013110 | 351 |
| 516 | 3300025228 | Ga0209672_100217 | Ga0209672_10021740 | 351 |
| 517 | 3300025229 | Ga0209147_100002 | Ga0209147_100002631 | 351 |
| 518 | 3300025230 | Ga0209563_100020 | Ga0209563_100020588 | 351 |
| 519 | 3300025230 | Ga0209563_100029 | Ga0209563_100029130 | 351 |
| 520 | 3300025230 | Ga0209563_100160 | Ga0209563_1001606 | 351 |
| 521 | 3300025231 | Ga0207427_100296 | Ga0207427_1002966 | 351 |
| 522 | 3300025242 | Ga0209258_100002 | Ga0209258_100002631 | 351 |
| 523 | 3300025242 | Ga0209258_100869 | Ga0209258_10086911 | 351 |
| 524 | 3300025246 | Ga0209646_1000058 | Ga0209646_1000058150 | 351 |
| 525 | 3300025246 | Ga0209646_1000214 | Ga0209646_10002147 | 351 |
| 526 | 3300025250 | Ga0209026_1000059 | Ga0209026_1000059198 | 351 |
| 527 | 3300025253 | Ga0209677_100010 | Ga0209677_100010588 | 351 |
| 528 | 3300025253 | Ga0209677_100042 | Ga0209677_10004282 | 351 |
| 529 | 3300025253 | Ga0209677_100162 | Ga0209677_1001626 | 351 |
| 530 | 3300025253 | Ga0209677_100226 | Ga0209677_10022630 | 351 |
| 531 | 3300025253 | Ga0209677_104848 | Ga0209677_1048481 | 351 |
| 532 | 3300025254 | Ga0209148_1000043 | Ga0209148_1000043346 | 351 |
| 533 | 3300025254 | Ga0209148_1003153 | Ga0209148_10031534 | 351 |
| 534 | 3300025256 | Ga0209759_1000365 | Ga0209759_10003657 | 351 |
| 535 | 3300025256 | Ga0209759_1001265 | Ga0209759_10012657 | 351 |
| 536 | 3300025256 | Ga0209759_1002367 | Ga0209759_10023676 | 351 |
| 537 | 3300025256 | Ga0209759_1002799 | Ga0209759_10027996 | 351 |
| 538 | 3300025263 | Ga0209565_1000329 | Ga0209565_100032912 | 351 |
| 539 | 3300025263 | Ga0209565_1002450 | Ga0209565_10024505 | 351 |
| 540 | 3300025272 | Ga0209455_1000009 | Ga0209455_1000009512 | 351 |
| 541 | 3300025273 | Ga0209673_1015229 | Ga0209673_10152292 | 351 |
| 542 | 3300025291 | Ga0209675_1000070 | Ga0209675_1000070161 | 351 |
| 543 | 3300025291 | Ga0209675_1000644 | Ga0209675_10006444 | 351 |
| 544 | 3300025292 | Ga0209676_1000012 | Ga0209676_1000012462 | 351 |
| 545 | 3300025294 | Ga0209025_1001428 | Ga0209025_100142814 | 351 |
| 546 | 3300025294 | Ga0209025_1004660 | Ga0209025_10046607 | 351 |
| 547 | 3300025294 | Ga0209025_1006958 | Ga0209025_10069586 | 351 |
| 548 | 3300025295 | Ga0209564_1000359 | Ga0209564_100035977 | 351 |
| 549 | 3300025295 | Ga0209564_1001697 | Ga0209564_10016974 | 351 |
| 550 | 3300025295 | Ga0209564_1002980 | Ga0209564_10029804 | 351 |
| 551 | 3300025299 | Ga0209256_1000059 | Ga0209256_100005960 | 351 |
| 552 | 3300025299 | Ga0209256_1000149 | Ga0209256_1000149119 | 351 |
| 553 | 3300025303 | Ga0209051_1005529 | Ga0209051_10055294 | 351 |
| 554 | 3300025303 | Ga0209051_1011536 | Ga0209051_10115361 | 351 |
| 555 | 3300025907 | Ga0207645_10085798 | Ga0207645_100857982 | 351 |
| 556 | 3300025909 | Ga0207705_10002838 | Ga0207705_1000283811 | 351 |
| 557 | 3300025909 | Ga0207705_10039414 | Ga0207705_100394144 | 351 |
| 558 | 3300025909 | Ga0207705_10047019 | Ga0207705_100470193 | 351 |
| 559 | 3300025911 | Ga0207654_10038347 | Ga0207654_100383472 | 351 |
| 560 | 3300025911 | Ga0207654_10191464 | Ga0207654_101914641 | 351 |
| 561 | 3300025912 | Ga0207707_10056099 | Ga0207707_100560992 | 351 |
| 562 | 3300025913 | Ga0207695_10002489 | Ga0207695_1000248920 | 351 |
| 563 | 3300025913 | Ga0207695_10003096 | Ga0207695_1000309624 | 351 |
| 564 | 3300025913 | Ga0207695_10008251 | Ga0207695_100082517 | 351 |
| 565 | 3300025913 | Ga0207695_10223213 | Ga0207695_102232132 | 351 |
| 566 | 3300025916 | Ga0207663_10031320 | Ga0207663_100313204 | 351 |
| 567 | 3300025918 | Ga0207662_10044662 | Ga0207662_100446623 | 351 |
| 568 | 3300025918 | Ga0207662_10078268 | Ga0207662_100782682 | 351 |
| 569 | 3300025918 | Ga0207662_10257904 | Ga0207662_102579041 | 351 |
| 570 | 3300025919 | Ga0207657_10055107 | Ga0207657_100551074 | 351 |
| 571 | 3300025920 | Ga0207649_10000169 | Ga0207649_1000016948 | 351 |
| 572 | 3300025921 | Ga0207652_10003246 | Ga0207652_100032468 | 351 |
| 573 | 3300025921 | Ga0207652_10033593 | Ga0207652_100335932 | 351 |
| 574 | 3300025924 | Ga0207694_10012151 | Ga0207694_100121518 | 351 |
| 575 | 3300025924 | Ga0207694_10050348 | Ga0207694_100503483 | 351 |
| 576 | 3300025935 | Ga0207709_10013052 | Ga0207709_100130523 | 351 |
| 577 | 3300025935 | Ga0207709_10098384 | Ga0207709_100983842 | 351 |
| 578 | 3300025935 | Ga0207709_10182975 | Ga0207709_101829752 | 351 |
| 579 | 3300025936 | Ga0207670_10088353 | Ga0207670_100883533 | 351 |
| 580 | 3300025936 | Ga0207670_10261185 | Ga0207670_102611852 | 351 |
| 581 | 3300025941 | Ga0207711_10064015 | Ga0207711_100640153 | 351 |
| 582 | 3300025941 | Ga0207711_10325107 | Ga0207711_103251071 | 351 |
| 583 | 3300025945 | Ga0207679_10000003 | Ga0207679_10000003442 | 351 |
| 584 | 3300025949 | Ga0207667_10004383 | Ga0207667_1000438313 | 351 |
| 585 | 3300025949 | Ga0207667_10036128 | Ga0207667_100361283 | 351 |
| 586 | 3300025949 | Ga0207667_10110627 | Ga0207667_101106273 | 351 |
| 587 | 3300025949 | Ga0207667_10133821 | Ga0207667_101338213 | 351 |
| 588 | 3300025981 | Ga0207640_10001688 | Ga0207640_100016887 | 351 |
| 589 | 3300025981 | Ga0207640_10011737 | Ga0207640_100117372 | 351 |
| 590 | 3300026067 | Ga0207678_10000002 | Ga0207678_10000002310 | 351 |
| 591 | 3300026067 | Ga0207678_10008084 | Ga0207678_100080847 | 351 |
| 592 | 3300026078 | Ga0207702_10001439 | Ga0207702_1000143919 | 351 |
| 593 | 3300026078 | Ga0207702_10001983 | Ga0207702_1000198313 | 351 |
| 594 | 3300026078 | Ga0207702_10082959 | Ga0207702_100829592 | 351 |
| 595 | 3300026089 | Ga0207648_10000515 | Ga0207648_1000051534 | 351 |
| 596 | 3300026089 | Ga0207648_10072375 | Ga0207648_100723752 | 351 |
| 597 | 3300026116 | Ga0207674_10004769 | Ga0207674_100047693 | 351 |
| 598 | 3300026142 | Ga0207698_10018160 | Ga0207698_100181602 | 351 |
| 599 | 3300026142 | Ga0207698_10250139 | Ga0207698_102501392 | 351 |
| 600 | 3300027360 | Ga0209969_1002573 | Ga0209969_10025732 | 351 |
| 601 | 3300027378 | Ga0209981_1002023 | Ga0209981_10020232 | 351 |
| 602 | 3300027462 | Ga0210000_1001879 | Ga0210000_10018793 | 351 |
| 603 | 3300027471 | Ga0209995_1000468 | Ga0209995_10004686 | 351 |
| 604 | 3300027526 | Ga0209968_1005613 | Ga0209968_10056132 | 351 |
| 605 | 3300027543 | Ga0209999_1007712 | Ga0209999_10077122 | 351 |
| 606 | 3300027552 | Ga0209982_1007932 | Ga0209982_10079322 | 351 |
| 607 | 3300027666 | Ga0209282_1000031 | Ga0209282_100003194 | 351 |
| 608 | 3300027876 | Ga0209974_10016343 | Ga0209974_100163432 | 351 |
| 609 | 3300028666 | Ga0265336_10000325 | Ga0265336_1000032517 | 351 |
| 610 | 3300028786 | Ga0307517_10061963 | Ga0307517_100619632 | 351 |
| 611 | 3300028794 | Ga0307515_10014346 | Ga0307515_1001434614 | 351 |
| 612 | 3300029957 | Ga0265324_10001988 | Ga0265324_100019886 | 351 |
| 613 | 3300030521 | Ga0307511_10136090 | Ga0307511_101360902 | 351 |
| 614 | 3300030522 | Ga0307512_10016010 | Ga0307512_100160103 | 351 |
| 615 | 3300031247 | Ga0265340_10053273 | Ga0265340_100532732 | 351 |
| 616 | 3300031507 | Ga0307509_10000234 | Ga0307509_1000023430 | 351 |
| 617 | 3300031548 | Ga0307408_100067111 | Ga0307408_1000671112 | 351 |
| 618 | 3300031649 | Ga0307514_10001152 | Ga0307514_100011528 | 351 |
| 619 | 3300031711 | Ga0265314_10036837 | Ga0265314_100368372 | 351 |
| 620 | 3300031730 | Ga0307516_10000398 | Ga0307516_100003981 | 351 |
| 621 | 3300031730 | Ga0307516_10000984 | Ga0307516_100009845 | 351 |
| 622 | 3300031730 | Ga0307516_10003708 | Ga0307516_1000370817 | 351 |
| 623 | 3300031731 | Ga0307405_10000483 | Ga0307405_100004831 | 351 |
| 624 | 3300031901 | Ga0307406_10016088 | Ga0307406_100160881 | 351 |
| 625 | 3300031911 | Ga0307412_10081950 | Ga0307412_100819501 | 351 |
| 626 | 3300032002 | Ga0307416_100021143 | Ga0307416_1000211434 | 351 |
| 627 | 3300032004 | Ga0307414_10021391 | Ga0307414_100213914 | 351 |
| 628 | 3300032005 | Ga0307411_10000973 | Ga0307411_1000097310 | 351 |
| 629 | 3300036401 | Ga0373937_0103189 | Ga0373937_0103189_823_1938 | 351 |
| 630 | 3300037068 | Ga0373925_0027214 | Ga0373925_0027214_2618_3730 | 351 |
| 631 | 3300037312 | Ga0395899_0047536 | Ga0395899_0047536_1930_3042 | 351 |
| 632 | 3300037418 | Ga0395900_0019530 | Ga0395900_0019530_1370_2482 | 351 |
| 633 | 3300037418 | Ga0395900_0140487 | Ga0395900_0140487_1321_2421 | 351 |
| 634 | 3300037466 | Ga0395898_0063380 | Ga0395898_0063380_323_1423 | 351 |
| 635 | 3300037471 | Ga0395905_0005002 | Ga0395905_0005002_3936_5048 | 351 |
| 636 | 3300037471 | Ga0395905_0068289 | Ga0395905_0068289_1740_2885 | 351 |
| 637 | 3300037471 | Ga0395905_0077996 | Ga0395905_0077996_1926_3056 | 351 |
| 638 | 3300038443 | Ga0395901_0045670 | Ga0395901_0045670_1491_2606 | 351 |
| 639 | 3300038443 | Ga0395901_0143147 | Ga0395901_0143147_1253_2365 | 351 |
| 640 | 3300039447 | Ga0436361_0082864 | Ga0436361_0082864_52795_53913 | 351 |
| 641 | 3300039447 | Ga0436361_0664726 | Ga0436361_0664726_9956_11077 | 351 |
| 642 | 3300042156 | Ga0439446_0057215 | Ga0439446_0057215_24_1148 | 351 |
| 643 | 3300042876 | Ga0451577_0058754 | Ga0451577_0058754_1332_2450 | 351 |
| 644 | 3300042876 | Ga0451577_0093774 | Ga0451577_0093774_905_2017 | 351 |
| 645 | 3300044656 | Ga0466969_0004296 | Ga0466969_0004296_825_1961 | 351 |
| 646 | 3300044683 | Ga0466965_0015556 | Ga0466965_0015556_2050_3168 | 351 |
| 647 | 3300044684 | Ga0466966_0003784 | Ga0466966_0003784_3368_4504 | 351 |
| 648 | 3300044706 | Ga0466964_0005251 | Ga0466964_0005251_2267_3403 | 351 |
| 649 | 3300044712 | Ga0453684_0411093 | Ga0453684_0411093_183_1319 | 351 |
| 650 | 3300044735 | Ga0466968_0028155 | Ga0466968_0028155_871_1989 | 351 |
| 651 | 3300044765 | Ga0466970_0040863 | Ga0466970_0040863_446_1582 | 351 |
| 652 | 3300044842 | Ga0466957_0022668 | Ga0466957_0022668_498_1610 | 351 |
| 653 | 3300044842 | Ga0466957_0047980 | Ga0466957_0047980_898_2034 | 351 |
| 654 | 3300044901 | Ga0466960_0083871 | Ga0466960_0083871_251_1381 | 351 |
| 655 | 3300045049 | Ga0466959_0000664 | Ga0466959_0000664_16378_17496 | 351 |
| 656 | 3300045051 | Ga0451576_0019755 | Ga0451576_0019755_4154_5251 | 351 |
| 657 | 3300045836 | Ga0466958_0016990 | Ga0466958_0016990_2078_3196 | 351 |
| 658 | 3300045976 | Ga0466967_0016110 | Ga0466967_0016110_4273_5409 | 351 |
| 659 | 3300045976 | Ga0466967_0079232 | Ga0466967_0079232_287_1405 | 351 |
| 660 | 3300046454 | Ga0495592_0010885 | Ga0495592_0010885_1004_2119 | 351 |
| 661 | 3300046454 | Ga0495592_0034937 | Ga0495592_0034937_999_2105 | 351 |
| 662 | 3300046458 | Ga0495591_000607 | Ga0495591_000607_3809_4915 | 351 |
| 663 | 3300046459 | Ga0495629_0004690 | Ga0495629_0004690_8978_10084 | 351 |
| 664 | 3300046462 | Ga0495651_0096470 | Ga0495651_0096470_611_1726 | 351 |
| 665 | 3300046471 | Ga0495650_0005641 | Ga0495650_0005641_1305_2420 | 351 |
| 666 | 3300046471 | Ga0495650_0005687 | Ga0495650_0005687_729_1835 | 351 |
| 667 | 3300046472 | Ga0495580_0014357 | Ga0495580_0014357_1636_2742 | 351 |
| 668 | 3300046475 | Ga0495639_0105127 | Ga0495639_0105127_165_1280 | 351 |
| 669 | 3300046477 | Ga0495664_0034823 | Ga0495664_0034823_1297_2403 | 351 |
| 670 | 3300046491 | Ga0495584_0027192 | Ga0495584_0027192_1666_2766 | 351 |
| 671 | 3300046500 | Ga0495596_0002606 | Ga0495596_0002606_2055_3161 | 351 |
| 672 | 3300046506 | Ga0495583_0000866 | Ga0495583_0000866_4999_6114 | 351 |
| 673 | 3300046507 | Ga0495606_0000127 | Ga0495606_0000127_10630_11730 | 351 |
| 674 | 3300046507 | Ga0495606_0005178 | Ga0495606_0005178_5576_6691 | 351 |
| 675 | 3300046511 | Ga0495608_0002232 | Ga0495608_0002232_5759_6865 | 351 |
| 676 | 3300046516 | Ga0495628_0312254 | Ga0495628_0312254_29_1135 | 351 |
| 677 | 3300046517 | Ga0495630_0005459 | Ga0495630_0005459_1634_2740 | 351 |
| 678 | 3300046526 | Ga0495666_0003508 | Ga0495666_0003508_5080_6186 | 351 |
| 679 | 3300046529 | Ga0495652_0023647 | Ga0495652_0023647_29_1135 | 351 |
| 680 | 3300046529 | Ga0495652_0121013 | Ga0495652_0121013_236_1351 | 351 |
| 681 | 3300046531 | Ga0495665_0031536 | Ga0495665_0031536_1250_2356 | 351 |
| 682 | 3300046533 | Ga0495640_0010264 | Ga0495640_0010264_145_1251 | 351 |
| 683 | 3300046536 | Ga0495587_0004383 | Ga0495587_0004383_6247_7353 | 351 |
| 684 | 3300046536 | Ga0495587_0084225 | Ga0495587_0084225_126_1241 | 351 |
| 685 | 3300046539 | Ga0495621_0009589 | Ga0495621_0009589_1797_2909 | 351 |
| 686 | 3300046543 | Ga0495645_0057531 | Ga0495645_0057531_1618_2733 | 351 |
| 687 | 3300046642 | Ga0495634_0015664 | Ga0495634_0015664_157_1263 | 351 |
| 688 | 3300046660 | Ga0495625_0011371 | Ga0495625_0011371_5034_6149 | 351 |
| 689 | 3300046660 | Ga0495625_0025801 | Ga0495625_0025801_1519_2622 | 351 |
| 690 | 3300046663 | Ga0495635_0001381 | Ga0495635_0001381_6372_7478 | 351 |
| 691 | 3300046665 | Ga0495661_0023528 | Ga0495661_0023528_1264_2370 | 351 |
| 692 | 3300046674 | Ga0495588_0007649 | Ga0495588_0007649_2243_3343 | 351 |
| 693 | 3300046674 | Ga0495588_0013517 | Ga0495588_0013517_1014_2114 | 351 |
| 694 | 3300046678 | Ga0495599_0001603 | Ga0495599_0001603_752_1867 | 351 |
| 695 | 3300046678 | Ga0495599_0092489 | Ga0495599_0092489_623_1729 | 351 |
| 696 | 3300046680 | Ga0495646_0034513 | Ga0495646_0034513_1986_3092 | 351 |
| 697 | 3300046689 | Ga0495613_0002519 | Ga0495613_0002519_1258_2364 | 351 |
| 698 | 3300046694 | Ga0495649_0004080 | Ga0495649_0004080_3455_4570 | 351 |
| 699 | 3300046794 | Ga0495589_0000923 | Ga0495589_0000923_15239_16345 | 351 |
| 700 | 3300046809 | Ga0495600_0073499 | Ga0495600_0073499_627_1742 | 351 |
| 701 | 3300047315 | Ga0495581_0060891 | Ga0495581_0060891_1021_2127 | 351 |
| 702 | 3300047322 | Ga0495680_0083663 | Ga0495680_0083663_1233_2339 | 351 |
| 703 | 3300047323 | Ga0495683_0002247 | Ga0495683_0002247_4308_5414 | 351 |
| 704 | 3300047444 | Ga0495675_0047979 | Ga0495675_0047979_1569_2675 | 351 |
| 705 | 3300047673 | Ga0495593_0003496 | Ga0495593_0003496_1729_2835 | 351 |
| 706 | 3300048088 | Ga0495602_0052137 | Ga0495602_0052137_1636_2742 | 351 |
| 707 | 3300048089 | Ga0495614_0003100 | Ga0495614_0003100_4919_6025 | 351 |
| 708 | 3300048907 | Ga0496104_0012365 | Ga0496104_0012365_2133_3245 | 351 |
| 709 | 3300048909 | Ga0496106_0048548 | Ga0496106_0048548_620_1732 | 351 |
| 710 | 3300048912 | Ga0496109_0146014 | Ga0496109_0146014_421_1554 | 351 |
| 711 | 3300048917 | Ga0496114_0122128 | Ga0496114_0122128_591_1715 | 351 |
| 712 | 3300048919 | Ga0496116_0005538 | Ga0496116_0005538_8898_10001 | 351 |
| 713 | 3300048921 | Ga0496118_0005614 | Ga0496118_0005614_6678_7784 | 351 |
| 714 | 3300048926 | Ga0496123_0004424 | Ga0496123_0004424_8686_9789 | 351 |
| 715 | 3300048927 | Ga0496124_0000786 | Ga0496124_0000786_47312_48421 | 351 |
| 716 | 3300048928 | Ga0496125_0013748 | Ga0496125_0013748_4601_5710 | 351 |
| 717 | 3300049523 | Ga0501300_003548 | Ga0501300_003548_266_1369 | 351 |
| 718 | 3300049571 | Ga0501034_0000188 | Ga0501034_0000188_51422_52525 | 351 |
| 719 | 3300049575 | Ga0501039_0198151 | Ga0501039_0198151_230_1342 | 351 |
| 720 | 3300049585 | Ga0501069_0154301 | Ga0501069_0154301_96_1211 | 351 |
| 721 | 3300049586 | Ga0501070_0007594 | Ga0501070_0007594_4044_5156 | 351 |
| 722 | 3300049589 | Ga0501073_0005474 | Ga0501073_0005474_5232_6344 | 351 |
| 723 | 3300049590 | Ga0501074_0014295 | Ga0501074_0014295_4392_5507 | 351 |
| 724 | 3300049741 | Ga0501079_0048511 | Ga0501079_0048511_244_1356 | 351 |
| 725 | 3300049742 | Ga0501080_0003503 | Ga0501080_0003503_11490_12602 | 351 |
| 726 | 3300049744 | Ga0501083_0000223 | Ga0501083_0000223_32788_33900 | 351 |
| 727 | 3300049770 | Ga0501273_004131 | Ga0501273_004131_36_1259 | 351 |
| 728 | 3300049776 | Ga0501280_000120 | Ga0501280_000120_7084_8187 | 351 |
| 729 | 3300049777 | Ga0501281_00899 | Ga0501281_00899_1008_2231 | 351 |
| 730 | 3300050489 | nmdc:mga03683_78057_c1 | nmdc:mga03683_78057_c1_50_1213 | 351 |
| 731 | 3300050491 | nmdc:mga00v17_248424_c1 | nmdc:mga00v17_248424_c1_13_1140 | 351 |
| 732 | 3300050493 | nmdc:mga0k408_44627_c1 | nmdc:mga0k408_44627_c1_1198_2310 | 351 |
| 733 | 3300050493 | nmdc:mga0k408_59676_c1 | nmdc:mga0k408_59676_c1_1050_2159 | 351 |
| 734 | 3300050496 | nmdc:mga07m45_2314_c1 | nmdc:mga07m45_2314_c1_2674_3789 | 351 |
| 735 | 3300050507 | nmdc:mga05p37_588_c1 | nmdc:mga05p37_588_c1_16140_17237 | 351 |
| 736 | 3300050508 | nmdc:mga09592_116_c1 | nmdc:mga09592_116_c1_18204_19301 | 351 |
| 737 | 3300050508 | nmdc:mga09592_123169_c1 | nmdc:mga09592_123169_c1_61_1173 | 351 |
| 738 | 3300050510 | nmdc:mga06r32_57165_c1 | nmdc:mga06r32_57165_c1_263_1360 | 351 |
| 739 | 3300050511 | nmdc:mga08y16_16326_c1 | nmdc:mga08y16_16326_c1_1557_2669 | 351 |
| 740 | 3300050513 | nmdc:mga0rr50_73361_c1 | nmdc:mga0rr50_73361_c1_1088_2200 | 351 |
| 741 | 3300050514 | nmdc:mga08x19_35743_c1 | nmdc:mga08x19_35743_c1_1280_2392 | 351 |
| 742 | 3300050515 | nmdc:mga0a205_196811_c1 | nmdc:mga0a205_196811_c1_617_1732 | 351 |
| 743 | 3300053080 | Ga0500635_0000055 | Ga0500635_0000055_67870_68985 | 351 |
| 744 | 3300053086 | Ga0500578_0015088 | Ga0500578_0015088_3054_4166 | 351 |
| 745 | 3300053096 | Ga0500641_0046324 | Ga0500641_0046324_155_1270 | 351 |
| 746 | 3300053177 | Ga0500636_0014675 | Ga0500636_0014675_1504_2619 | 351 |
| 747 | 3300053730 | Ga0500645_004966 | Ga0500645_004966_729_1841 | 351 |
| 748 | 3300054114 | Ga0501084_0049927 | Ga0501084_0049927_2220_3332 | 351 |
| 749 | 3300059421 | Ga0590071_006216 | Ga0590071_006216_843_2156 | 351 |
| 750 | 3300059643 | Ga0587072_000424 | Ga0587072_000424_453_1550 | 351 |
| 751 | 3300059647 | Ga0587079_017963 | Ga0587079_017963_70_1170 | 351 |
| 752 | 3300061719 | Ga0466962_0006139 | Ga0466962_0006139_3258_4376 | 351 |
| 753 | iso_pu_bacteria | 644736347 | 644748554 | 351 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qup-assembly1.cif.gz_A | crystal structure of stachydrine demethylase with n-methyl proline from low x-ray dose composite datasets | 0.7719 | 15 | 350 |
| 3bcc-assembly1.cif.gz_E-2 | stigmatellin and antimycin bound cytochrome bc1 complex from chicken | 0.7687 | 71 | 142 |
| 3h1i-assembly1.cif.gz_E | stigmatellin and antimycin bound cytochrome bc1 complex from chicken | 0.7646 | 71 | 142 |
| 2a06-assembly1.cif.gz_R | bovine cytochrome bc1 complex with stigmatellin bound | 0.7578 | 73 | 142 |
| 6zgp-assembly1.cif.gz_C | crystal structure of the quaternary ammonium rieske monooxygenase cnta in complex with inhibitor mmv12 (mmv020670) | 0.7562 | 15 | 351 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B9FEC3_96_233_2.90.10.10 | Mainly Beta;Orthogonal Prism;Agglutinin, subunit A;Bulb-type lectin domain | 0.87 | 64 | 78 | 2.90.10.10 |
| af_P0ABR7_49_169_2.102.10.10 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.8373 | 43 | 150 | 2.102.10.10 |
| 3n0qA02 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.8344 | 41 | 145 | 2.102.10.10 |
| af_A0A1D8PL08_48_170_2.102.10.10 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.8306 | 42 | 145 | 2.102.10.10 |
| 2xrxU02 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.8092 | 41 | 147 | 2.102.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A840RCB1-F1-model_v4 | Choline monooxygenase (EC 1.14.15.7) | 0.9898 | 16 | 351 |
GO:0004497
GO:0005506 GO:0051537 |
| AF-A0A7Y7LMA7-F1-model_v4 | Choline monooxygenase (EC 1.14.15.7) | 0.9877 | 33 | 351 |
GO:0005506
GO:0019133 GO:0051537 |
| AF-A0A554WU25-F1-model_v4 | 2-aminobenzenesulfonate 2,3-dioxygenase subunit alpha (EC 1.14.12.14) | 0.9861 | 16 | 351 |
GO:0005506
GO:0018627 GO:0051537 |
| AF-A0A353YAI2-F1-model_v4 | Rieske (2Fe-2S) protein | 0.9844 | 15 | 351 |
GO:0005506
GO:0016491 GO:0051537 |
| AF-I3CRD7-F1-model_v4 | Dioxygenase subunit alpha oxidoreductase | 0.9842 | 48 | 350 |
GO:0005506
GO:0051213 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar