F479161
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 752 | 386 | 1504 | 332 |
Family's Representative Sequence
| Representative Sequence | 3300025292|Ga0209676_1000906|Ga0209676_100090629 |
| Length | 376 |
| Sequence | MDKLQAPNPEYGQVVCVLWDLPVPRGGDRGVIIAGMRVLGIESSCDETGVAVYDTDLAGSAALRAHAVYSQIALHAEYGGVVPELASRDHVRKLLPLVRQTLAEAGLGVGDIDGVAYTAGPGLVGALLVGAGVARSLAWALEVPAVGVHHMEGHLLAPLMEDDPPEAPFVALLVSGGHTQLVAVDAIGQYRLLGETLDDAAGEAFDKTAKMMGLPYPGGPQLARLAEQGTPGVYRFARPMTDRPGLDFSFSGLKTQVLMAWRDSDQSEQTRADIARGFEDAVVETLSIKCERALEAAGTNVIVVAGGVGANKRLRARLQQMAERLGGRACFPRPALCTDNGAMIAFAGALRLQAGQHNPPKVDVTPRWDMATLPAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 72 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 110 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 114 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 180 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 181 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 182 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 191 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 203 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 213 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 214 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 215 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 216 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 217 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 218 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 219 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 220 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 221 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 222 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 225 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 226 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 229 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 230 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 231 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 232 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 233 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 234 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 275 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 276 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 277 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 278 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 279 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 280 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 281 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 282 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 283 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 284 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 285 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 286 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 313 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 318 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 322 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 334 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 337 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 338 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 339 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 340 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 341 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 342 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 343 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 344 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 345 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 346 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 347 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 348 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 349 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 350 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 351 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 352 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 353 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 354 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 355 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 356 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 357 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 358 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 359 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 360 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 361 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 362 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 363 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 364 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 365 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 366 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 367 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 368 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 369 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 370 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 371 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 372 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 373 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 374 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 375 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 376 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 377 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 378 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 379 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 380 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 381 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 382 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 383 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 384 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 385 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 386 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.22 |
| Metatranscriptomes | 0.27 |
| Isolates | 6.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.13 |
| Bulb | 0 |
| Endosphere | 9.57 |
| Nodule | 0.13 |
| Rhizoplane | 4.52 |
| Rhizosphere | 76.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0209676_1000906 | 3300025292 | Bacteria | 37292 |
| 2 | SwRhRL2b_contig_24145 | 2162886007 | Bacteria | 4392 |
| 3 | JGI24739J22299_10004160 | 3300001989 | Bacteria | 5537 |
| 4 | JGI25152J39213_1000039 | 3300002773 | Bacteria | 89573 |
| 5 | JGI25150J39212_1000422 | 3300002774 | Bacteria | 19529 |
| 6 | JGI25151J46595_10000008 | 3300003187 | Bacteria | 334180 |
| 7 | JGI25151J46595_10000154 | 3300003187 | Bacteria | 89582 |
| 8 | JGI25151J46595_10047611 | 3300003187 | Bacteria | 1490 |
| 9 | JGI25153J46596_10000120 | 3300003215 | Bacteria | 89582 |
| 10 | rootH2_10050576 | 3300003320 | Bacteria | 5405 |
| 11 | JGI25160J50197_1006305 | 3300003354 | Bacteria | 4817 |
| 12 | JGI25407J50210_10045132 | 3300003373 | Bacteria | 1124 |
| 13 | Ga0055526_1000015 | 3300003771 | Bacteria | 226543 |
| 14 | Ga0055526_1011436 | 3300003771 | Bacteria | 3996 |
| 15 | Ga0055526_1011939 | 3300003771 | Bacteria | 3849 |
| 16 | Ga0055537_1000132 | 3300003773 | Bacteria | 56953 |
| 17 | Ga0055537_1000177 | 3300003773 | Bacteria | 47558 |
| 18 | Ga0055524_1000132 | 3300003775 | Bacteria | 87907 |
| 19 | Ga0055536_1000626 | 3300003781 | Bacteria | 24000 |
| 20 | Ga0055536_1002286 | 3300003781 | Bacteria | 10882 |
| 21 | Ga0055536_1007175 | 3300003781 | Bacteria | 5037 |
| 22 | Ga0055534_1000055 | 3300003784 | Bacteria | 88009 |
| 23 | Ga0055534_1000706 | 3300003784 | Bacteria | 16374 |
| 24 | Ga0055534_1000870 | 3300003784 | Bacteria | 13802 |
| 25 | Ga0055528_1000008 | 3300003790 | Bacteria | 226543 |
| 26 | Ga0055528_1000045 | 3300003790 | Bacteria | 101917 |
| 27 | Ga0055530_10002878 | 3300003791 | Bacteria | 10485 |
| 28 | Ga0055531_10005845 | 3300003794 | Bacteria | 7108 |
| 29 | Ga0055531_10011945 | 3300003794 | Bacteria | 4131 |
| 30 | Ga0055531_10014427 | 3300003794 | Bacteria | 3556 |
| 31 | Ga0058692_1000026 | 3300003856 | Bacteria | 203096 |
| 32 | Ga0065704_10072580 | 3300005289 | Bacteria | 8305 |
| 33 | Ga0070658_10069423 | 3300005327 | Bacteria | 2883 |
| 34 | Ga0070658_10145276 | 3300005327 | Bacteria | 1983 |
| 35 | Ga0070683_100060010 | 3300005329 | Bacteria | 3534 |
| 36 | Ga0070683_100092653 | 3300005329 | Bacteria | 2838 |
| 37 | Ga0070690_100036047 | 3300005330 | Bacteria | 3106 |
| 38 | Ga0070670_100231701 | 3300005331 | Bacteria | 1607 |
| 39 | Ga0070666_10257039 | 3300005335 | Bacteria | 1238 |
| 40 | Ga0070680_100003170 | 3300005336 | Bacteria | 12221 |
| 41 | Ga0070682_100011512 | 3300005337 | Bacteria | 5056 |
| 42 | Ga0070660_100010096 | 3300005339 | Bacteria | 6662 |
| 43 | Ga0070660_100170424 | 3300005339 | Bacteria | 1758 |
| 44 | Ga0070668_100016107 | 3300005347 | Bacteria | 5594 |
| 45 | Ga0070668_100019159 | 3300005347 | Bacteria | 5146 |
| 46 | Ga0070668_100031994 | 3300005347 | Bacteria | 4003 |
| 47 | Ga0070669_100049635 | 3300005353 | Bacteria | 3064 |
| 48 | Ga0070674_100174385 | 3300005356 | Bacteria | 1642 |
| 49 | Ga0070674_100254978 | 3300005356 | Bacteria | 1379 |
| 50 | Ga0070673_100110039 | 3300005364 | Bacteria | 2283 |
| 51 | Ga0070659_100001553 | 3300005366 | Bacteria | 16555 |
| 52 | Ga0070659_100068955 | 3300005366 | Bacteria | 2807 |
| 53 | Ga0070703_10000599 | 3300005406 | Bacteria | 12921 |
| 54 | Ga0070709_10021134 | 3300005434 | Bacteria | 3788 |
| 55 | Ga0070714_100062593 | 3300005435 | Bacteria | 3198 |
| 56 | Ga0070713_100030412 | 3300005436 | Bacteria | 4288 |
| 57 | Ga0070711_100248503 | 3300005439 | Bacteria | 1394 |
| 58 | Ga0070705_100030815 | 3300005440 | Bacteria | 2964 |
| 59 | Ga0070708_100002202 | 3300005445 | Bacteria | 15054 |
| 60 | Ga0070708_100022520 | 3300005445 | Bacteria | 5345 |
| 61 | Ga0070678_100038110 | 3300005456 | Bacteria | 3381 |
| 62 | Ga0070681_10223970 | 3300005458 | Bacteria | 1796 |
| 63 | Ga0068867_100193782 | 3300005459 | Bacteria | 1623 |
| 64 | Ga0070706_100000503 | 3300005467 | Bacteria | 45861 |
| 65 | Ga0070706_100208148 | 3300005467 | Bacteria | 1826 |
| 66 | Ga0070707_100144123 | 3300005468 | Bacteria | 2318 |
| 67 | Ga0070698_100022834 | 3300005471 | Bacteria | 6541 |
| 68 | Ga0070698_100053404 | 3300005471 | Bacteria | 4106 |
| 69 | Ga0070699_100132740 | 3300005518 | Bacteria | 2196 |
| 70 | Ga0070679_100014388 | 3300005530 | Bacteria | 7599 |
| 71 | Ga0070679_100098566 | 3300005530 | Bacteria | 2910 |
| 72 | Ga0070684_100165652 | 3300005535 | Bacteria | 2006 |
| 73 | Ga0070697_100000833 | 3300005536 | Bacteria | 23139 |
| 74 | Ga0070672_100006123 | 3300005543 | Bacteria | 8051 |
| 75 | Ga0070696_100045575 | 3300005546 | Bacteria | 3038 |
| 76 | Ga0070693_100069355 | 3300005547 | Bacteria | 2072 |
| 77 | Ga0070665_100394780 | 3300005548 | Bacteria | 1391 |
| 78 | Ga0070704_100008393 | 3300005549 | Bacteria | 6193 |
| 79 | Ga0068855_100002748 | 3300005563 | Bacteria | 21663 |
| 80 | Ga0068855_100008913 | 3300005563 | Bacteria | 12128 |
| 81 | Ga0068855_100163780 | 3300005563 | Bacteria | 2522 |
| 82 | Ga0068855_100361331 | 3300005563 | Bacteria | 1597 |
| 83 | Ga0070664_100170132 | 3300005564 | Bacteria | 1933 |
| 84 | Ga0068857_100000234 | 3300005577 | Bacteria | 37184 |
| 85 | Ga0068854_100011394 | 3300005578 | Bacteria | 5786 |
| 86 | Ga0068856_100200048 | 3300005614 | Bacteria | 2012 |
| 87 | Ga0068852_100002465 | 3300005616 | Bacteria | 12738 |
| 88 | Ga0068861_100402577 | 3300005719 | Bacteria | 1215 |
| 89 | Ga0068862_100001242 | 3300005844 | Bacteria | 24005 |
| 90 | Ga0068862_100185166 | 3300005844 | Bacteria | 1871 |
| 91 | Ga0081455_10005471 | 3300005937 | Bacteria | 13923 |
| 92 | Ga0081455_10009400 | 3300005937 | Bacteria | 10057 |
| 93 | Ga0081455_10055449 | 3300005937 | Bacteria | 3371 |
| 94 | Ga0081538_10000132 | 3300005981 | Bacteria | 77110 |
| 95 | Ga0081538_10000280 | 3300005981 | Bacteria | 58428 |
| 96 | Ga0081538_10003124 | 3300005981 | Bacteria | 15747 |
| 97 | Ga0081538_10004486 | 3300005981 | Bacteria | 12856 |
| 98 | Ga0081538_10008088 | 3300005981 | Bacteria | 8979 |
| 99 | Ga0081538_10015017 | 3300005981 | Bacteria | 6023 |
| 100 | Ga0081538_10027674 | 3300005981 | Bacteria | 3922 |
| 101 | Ga0081539_10002871 | 3300005985 | Bacteria | 22885 |
| 102 | Ga0070717_10438328 | 3300006028 | Bacteria | 1176 |
| 103 | Ga0075364_10000016 | 3300006051 | Bacteria | 57197 |
| 104 | Ga0075432_10007403 | 3300006058 | Bacteria | 3738 |
| 105 | Ga0075432_10019233 | 3300006058 | Bacteria | 2332 |
| 106 | Ga0070715_10049380 | 3300006163 | Bacteria | 1802 |
| 107 | Ga0075367_10156062 | 3300006178 | Bacteria | 1418 |
| 108 | Ga0075369_10065216 | 3300006186 | Bacteria | 1596 |
| 109 | Ga0097621_100024439 | 3300006237 | Bacteria | 4718 |
| 110 | Ga0075428_100069454 | 3300006844 | Bacteria | 3851 |
| 111 | Ga0075430_100045499 | 3300006846 | Bacteria | 3708 |
| 112 | Ga0075431_100103054 | 3300006847 | Bacteria | 2945 |
| 113 | Ga0075431_100103287 | 3300006847 | Bacteria | 2942 |
| 114 | Ga0075431_100200873 | 3300006847 | Bacteria | 2039 |
| 115 | Ga0075433_10051269 | 3300006852 | Bacteria | 3593 |
| 116 | Ga0075434_100000846 | 3300006871 | Bacteria | 24336 |
| 117 | Ga0075429_100040897 | 3300006880 | Bacteria | 4036 |
| 118 | Ga0075436_100010273 | 3300006914 | Bacteria | 6410 |
| 119 | Ga0099794_10009725 | 3300007265 | Bacteria | 4058 |
| 120 | Ga0105251_10000135 | 3300009011 | Bacteria | 74718 |
| 121 | Ga0105251_10004487 | 3300009011 | Bacteria | 9472 |
| 122 | Ga0105244_10024368 | 3300009036 | Bacteria | 3303 |
| 123 | Ga0105240_10009127 | 3300009093 | Bacteria | 14078 |
| 124 | Ga0105240_10051930 | 3300009093 | Bacteria | 5156 |
| 125 | Ga0111539_10028573 | 3300009094 | Bacteria | 6802 |
| 126 | Ga0111539_10057290 | 3300009094 | Bacteria | 4628 |
| 127 | Ga0111539_10113234 | 3300009094 | Bacteria | 3182 |
| 128 | Ga0111539_10349560 | 3300009094 | Bacteria | 1721 |
| 129 | Ga0105245_10003103 | 3300009098 | Bacteria | 14866 |
| 130 | Ga0105245_10173198 | 3300009098 | Bacteria | 2056 |
| 131 | Ga0114129_10013338 | 3300009147 | Bacteria | 11707 |
| 132 | Ga0114129_10042807 | 3300009147 | Bacteria | 6373 |
| 133 | Ga0114129_10108436 | 3300009147 | Bacteria | 3833 |
| 134 | Ga0114129_10239391 | 3300009147 | Bacteria | 2440 |
| 135 | Ga0114129_10493503 | 3300009147 | Bacteria | 1600 |
| 136 | Ga0105243_10022597 | 3300009148 | Bacteria | 4782 |
| 137 | Ga0105243_10051475 | 3300009148 | Bacteria | 3257 |
| 138 | Ga0105241_10162986 | 3300009174 | Bacteria | 1834 |
| 139 | Ga0105242_10131717 | 3300009176 | Bacteria | 2159 |
| 140 | Ga0105242_10355426 | 3300009176 | Bacteria | 1354 |
| 141 | Ga0105248_10353770 | 3300009177 | Bacteria | 1654 |
| 142 | Ga0105237_10029977 | 3300009545 | Bacteria | 5527 |
| 143 | Ga0105237_10053657 | 3300009545 | Bacteria | 4043 |
| 144 | Ga0105238_10259111 | 3300009551 | Bacteria | 1718 |
| 145 | Ga0105249_10022114 | 3300009553 | Bacteria | 5696 |
| 146 | Ga0105239_10045602 | 3300010375 | Bacteria | 4805 |
| 147 | Ga0105239_10124122 | 3300010375 | Bacteria | 2869 |
| 148 | Ga0157373_10152790 | 3300013100 | Bacteria | 1624 |
| 149 | Ga0157373_10172457 | 3300013100 | Bacteria | 1522 |
| 150 | Ga0157371_10001308 | 3300013102 | Bacteria | 26174 |
| 151 | Ga0157371_10076836 | 3300013102 | Bacteria | 2364 |
| 152 | Ga0157371_10084153 | 3300013102 | Bacteria | 2253 |
| 153 | Ga0157370_10004629 | 3300013104 | Bacteria | 15729 |
| 154 | Ga0157370_10022411 | 3300013104 | Bacteria | 6284 |
| 155 | Ga0157370_10054285 | 3300013104 | Bacteria | 3819 |
| 156 | Ga0157369_10014378 | 3300013105 | Bacteria | 8937 |
| 157 | Ga0157369_10031143 | 3300013105 | Bacteria | 5878 |
| 158 | Ga0157369_10037255 | 3300013105 | Bacteria | 5325 |
| 159 | Ga0157369_10037763 | 3300013105 | Bacteria | 5287 |
| 160 | Ga0157369_10103111 | 3300013105 | Bacteria | 3039 |
| 161 | Ga0157369_10302380 | 3300013105 | Bacteria | 1664 |
| 162 | Ga0157378_10027228 | 3300013297 | Bacteria | 5045 |
| 163 | Ga0157372_10007977 | 3300013307 | Bacteria | 11260 |
| 164 | Ga0157375_10247026 | 3300013308 | Bacteria | 1945 |
| 165 | Ga0157380_10049821 | 3300014326 | Bacteria | 3305 |
| 166 | Ga0157380_10074859 | 3300014326 | Bacteria | 2750 |
| 167 | Ga0182008_10014732 | 3300014497 | Bacteria | 4089 |
| 168 | Ga0157379_10186197 | 3300014968 | Bacteria | 1876 |
| 169 | Ga0182006_1015869 | 3300015261 | Bacteria | 3220 |
| 170 | Ga0182006_1058647 | 3300015261 | Bacteria | 1459 |
| 171 | Ga0182007_10000025 | 3300015262 | Bacteria | 172058 |
| 172 | Ga0182005_1000293 | 3300015265 | Bacteria | 31203 |
| 173 | Ga0183360_10003 | 3300015689 | Bacteria | 713221 |
| 174 | Ga0183361_10402 | 3300016635 | Bacteria | 1839 |
| 175 | Ga0163161_10024320 | 3300017792 | Bacteria | 4279 |
| 176 | Ga0206353_11046508 | 3300020082 | Bacteria | 7214 |
| 177 | Ga0206353_11888363 | 3300020082 | Bacteria | 2480 |
| 178 | Ga0213871_10000823 | 3300021441 | Bacteria | 4653 |
| 179 | Ga0207425_1000074 | 3300025245 | Bacteria | 108738 |
| 180 | Ga0207425_1005126 | 3300025245 | Bacteria | 3790 |
| 181 | Ga0209129_1000150 | 3300025258 | Bacteria | 113886 |
| 182 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 183 | Ga0209565_1000037 | 3300025263 | Bacteria | 289371 |
| 184 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 185 | Ga0209673_1000494 | 3300025273 | Bacteria | 65078 |
| 186 | Ga0209673_1007568 | 3300025273 | Bacteria | 4973 |
| 187 | Ga0209130_1004530 | 3300025284 | Bacteria | 5228 |
| 188 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 189 | Ga0209675_1000020 | 3300025291 | Bacteria | 335854 |
| 190 | Ga0209676_1000035 | 3300025292 | Bacteria | 459284 |
| 191 | Ga0209676_1000307 | 3300025292 | Bacteria | 96239 |
| 192 | Ga0209676_1001357 | 3300025292 | Bacteria | 24182 |
| 193 | Ga0209676_1002821 | 3300025292 | Bacteria | 11496 |
| 194 | Ga0209676_1024112 | 3300025292 | Bacteria | 1978 |
| 195 | Ga0209676_1027433 | 3300025292 | Bacteria | 1792 |
| 196 | Ga0209676_1034159 | 3300025292 | Bacteria | 1506 |
| 197 | Ga0209025_1000030 | 3300025294 | Bacteria | 441196 |
| 198 | Ga0209025_1000048 | 3300025294 | Bacteria | 335574 |
| 199 | Ga0209025_1001262 | 3300025294 | Bacteria | 34940 |
| 200 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 201 | Ga0209564_1000993 | 3300025295 | Bacteria | 35449 |
| 202 | Ga0209564_1007388 | 3300025295 | Bacteria | 5686 |
| 203 | Ga0209758_1000056 | 3300025297 | Bacteria | 335574 |
| 204 | Ga0209758_1006559 | 3300025297 | Bacteria | 8283 |
| 205 | Ga0209050_1000429 | 3300025298 | Bacteria | 77085 |
| 206 | Ga0209050_1000670 | 3300025298 | Bacteria | 51926 |
| 207 | Ga0209050_1000711 | 3300025298 | Bacteria | 49107 |
| 208 | Ga0209256_1000006 | 3300025299 | Bacteria | 1250310 |
| 209 | Ga0209256_1003920 | 3300025299 | Bacteria | 9816 |
| 210 | Ga0209256_1004659 | 3300025299 | Bacteria | 8438 |
| 211 | Ga0209256_1014385 | 3300025299 | Bacteria | 2851 |
| 212 | Ga0209256_1037534 | 3300025299 | Bacteria | 1261 |
| 213 | Ga0209051_1001115 | 3300025303 | Bacteria | 24576 |
| 214 | Ga0209051_1016812 | 3300025303 | Bacteria | 3289 |
| 215 | Ga0209257_1000091 | 3300025304 | Bacteria | 270637 |
| 216 | Ga0209257_1000587 | 3300025304 | Bacteria | 60909 |
| 217 | Ga0209257_1001339 | 3300025304 | Bacteria | 29896 |
| 218 | Ga0209257_1017145 | 3300025304 | Bacteria | 2874 |
| 219 | Ga0209257_1040972 | 3300025304 | Bacteria | 1377 |
| 220 | Ga0207655_1044618 | 3300025728 | Bacteria | 1861 |
| 221 | Ga0207713_1000417 | 3300025735 | Bacteria | 45375 |
| 222 | Ga0207713_1003755 | 3300025735 | Bacteria | 10197 |
| 223 | Ga0207653_10000045 | 3300025885 | Bacteria | 94691 |
| 224 | Ga0207680_10135023 | 3300025903 | Bacteria | 1630 |
| 225 | Ga0207699_10133374 | 3300025906 | Bacteria | 1623 |
| 226 | Ga0207705_10025354 | 3300025909 | Bacteria | 4234 |
| 227 | Ga0207705_10070623 | 3300025909 | Bacteria | 2531 |
| 228 | Ga0207705_10190849 | 3300025909 | Bacteria | 1549 |
| 229 | Ga0207684_10000158 | 3300025910 | Bacteria | 115693 |
| 230 | Ga0207684_10000652 | 3300025910 | Bacteria | 41078 |
| 231 | Ga0207695_10011130 | 3300025913 | Bacteria | 10919 |
| 232 | Ga0207695_10041208 | 3300025913 | Bacteria | 4943 |
| 233 | Ga0207671_10017913 | 3300025914 | Bacteria | 5448 |
| 234 | Ga0207693_10019987 | 3300025915 | Bacteria | 5327 |
| 235 | Ga0207693_10020013 | 3300025915 | Bacteria | 5324 |
| 236 | Ga0207693_10079116 | 3300025915 | Bacteria | 2572 |
| 237 | Ga0207693_10219745 | 3300025915 | Bacteria | 1493 |
| 238 | Ga0207657_10013269 | 3300025919 | Bacteria | 8084 |
| 239 | Ga0207652_10107030 | 3300025921 | Bacteria | 2476 |
| 240 | Ga0207652_10117953 | 3300025921 | Bacteria | 2358 |
| 241 | Ga0207652_10275951 | 3300025921 | Bacteria | 1516 |
| 242 | Ga0207646_10060964 | 3300025922 | Bacteria | 3368 |
| 243 | Ga0207681_10094276 | 3300025923 | Bacteria | 2145 |
| 244 | Ga0207694_10087539 | 3300025924 | Bacteria | 2454 |
| 245 | Ga0207650_10001342 | 3300025925 | Bacteria | 17794 |
| 246 | Ga0207650_10153484 | 3300025925 | Bacteria | 1819 |
| 247 | Ga0207659_10114138 | 3300025926 | Bacteria | 2059 |
| 248 | Ga0207700_10206251 | 3300025928 | Bacteria | 1659 |
| 249 | Ga0207664_10234313 | 3300025929 | Bacteria | 1597 |
| 250 | Ga0207664_10292684 | 3300025929 | Bacteria | 1431 |
| 251 | Ga0207644_10219136 | 3300025931 | Bacteria | 1507 |
| 252 | Ga0207706_10005511 | 3300025933 | Bacteria | 11800 |
| 253 | Ga0207709_10002055 | 3300025935 | Bacteria | 13012 |
| 254 | Ga0207709_10085344 | 3300025935 | Bacteria | 2047 |
| 255 | Ga0207669_10165172 | 3300025937 | Bacteria | 1569 |
| 256 | Ga0207665_10002293 | 3300025939 | Bacteria | 12916 |
| 257 | Ga0207665_10013449 | 3300025939 | Bacteria | 5381 |
| 258 | Ga0207691_10001588 | 3300025940 | Bacteria | 22555 |
| 259 | Ga0207661_10016758 | 3300025944 | Bacteria | 5410 |
| 260 | Ga0207679_10290791 | 3300025945 | Bacteria | 1405 |
| 261 | Ga0207667_10000151 | 3300025949 | Bacteria | 104054 |
| 262 | Ga0207667_10108167 | 3300025949 | Bacteria | 2869 |
| 263 | Ga0207651_10180060 | 3300025960 | Bacteria | 1676 |
| 264 | Ga0207712_10032133 | 3300025961 | Bacteria | 3541 |
| 265 | Ga0207668_10012526 | 3300025972 | Bacteria | 5194 |
| 266 | Ga0207668_10015590 | 3300025972 | Bacteria | 4724 |
| 267 | Ga0207668_10022768 | 3300025972 | Bacteria | 4016 |
| 268 | Ga0207640_10009438 | 3300025981 | Bacteria | 5465 |
| 269 | Ga0207640_10170193 | 3300025981 | Bacteria | 1622 |
| 270 | Ga0207677_10295046 | 3300026023 | Bacteria | 1337 |
| 271 | Ga0207639_10104928 | 3300026041 | Bacteria | 2292 |
| 272 | Ga0207708_10005607 | 3300026075 | Bacteria | 9263 |
| 273 | Ga0207708_10277985 | 3300026075 | Bacteria | 1356 |
| 274 | Ga0207648_10041415 | 3300026089 | Bacteria | 4044 |
| 275 | Ga0207648_10220889 | 3300026089 | Bacteria | 1684 |
| 276 | Ga0207648_10425133 | 3300026089 | Bacteria | 1207 |
| 277 | Ga0207674_10002882 | 3300026116 | Bacteria | 21375 |
| 278 | Ga0207683_10001345 | 3300026121 | Bacteria | 22193 |
| 279 | Ga0207683_10128202 | 3300026121 | Bacteria | 2281 |
| 280 | Ga0207698_10015099 | 3300026142 | Bacteria | 5162 |
| 281 | Ga0209371_1000028 | 3300027312 | Bacteria | 429688 |
| 282 | Ga0209983_1000837 | 3300027665 | Bacteria | 6741 |
| 283 | Ga0209588_1075766 | 3300027671 | Bacteria | 1087 |
| 284 | Ga0209971_1000564 | 3300027682 | Bacteria | 9701 |
| 285 | Ga0209974_10022179 | 3300027876 | Bacteria | 2103 |
| 286 | Ga0268266_10353744 | 3300028379 | Bacteria | 1381 |
| 287 | Ga0268265_10001651 | 3300028380 | Bacteria | 18273 |
| 288 | Ga0268265_10171494 | 3300028380 | Bacteria | 1855 |
| 289 | Ga0265337_1026456 | 3300028556 | Bacteria | 1758 |
| 290 | Ga0265319_1002310 | 3300028563 | Bacteria | 10520 |
| 291 | Ga0265318_10014419 | 3300028577 | Bacteria | 3317 |
| 292 | Ga0265322_10002939 | 3300028654 | Bacteria | 5192 |
| 293 | Ga0265322_10007118 | 3300028654 | Bacteria | 3277 |
| 294 | Ga0265338_10021437 | 3300028800 | Bacteria | 6737 |
| 295 | Ga0265338_10060021 | 3300028800 | Bacteria | 3346 |
| 296 | Ga0265338_10110644 | 3300028800 | Bacteria | 2213 |
| 297 | Ga0268256_1000030 | 3300030500 | Bacteria | 429688 |
| 298 | Ga0316177_1093440 | 3300030731 | Bacteria | 1334 |
| 299 | Ga0314311_1115363 | 3300030733 | Bacteria | 5402 |
| 300 | Ga0316178_1075419 | 3300030735 | Bacteria | 2059 |
| 301 | Ga0265329_10046532 | 3300031242 | Bacteria | 1386 |
| 302 | Ga0265331_10065095 | 3300031250 | Bacteria | 1715 |
| 303 | Ga0265327_10003143 | 3300031251 | Bacteria | 16217 |
| 304 | Ga0265327_10004332 | 3300031251 | Bacteria | 12650 |
| 305 | Ga0265316_10142866 | 3300031344 | Bacteria | 1797 |
| 306 | Ga0307513_10041457 | 3300031456 | Bacteria | 5080 |
| 307 | Ga0307513_10283085 | 3300031456 | Bacteria | 1434 |
| 308 | Ga0307408_100012782 | 3300031548 | Bacteria | 5567 |
| 309 | Ga0307408_100038495 | 3300031548 | Bacteria | 3375 |
| 310 | Ga0307408_100184660 | 3300031548 | Bacteria | 1675 |
| 311 | Ga0307408_100245857 | 3300031548 | Bacteria | 1473 |
| 312 | Ga0265314_10031649 | 3300031711 | Bacteria | 3901 |
| 313 | Ga0265342_10030763 | 3300031712 | Bacteria | 3323 |
| 314 | Ga0316576_10047922 | 3300031727 | Unclassified | 3097 |
| 315 | Ga0316578_10079129 | 3300031728 | Bacteria | 1954 |
| 316 | Ga0307405_10070963 | 3300031731 | Bacteria | 2240 |
| 317 | Ga0307405_10081198 | 3300031731 | Bacteria | 2119 |
| 318 | Ga0307413_10036531 | 3300031824 | Bacteria | 2829 |
| 319 | Ga0307410_10104257 | 3300031852 | Bacteria | 2039 |
| 320 | Ga0307406_10000482 | 3300031901 | Bacteria | 23030 |
| 321 | Ga0307406_10074932 | 3300031901 | Bacteria | 2231 |
| 322 | Ga0307406_10166811 | 3300031901 | Bacteria | 1589 |
| 323 | Ga0307406_10169090 | 3300031901 | Bacteria | 1580 |
| 324 | Ga0307412_10012010 | 3300031911 | Bacteria | 5032 |
| 325 | Ga0307412_10018570 | 3300031911 | Bacteria | 4188 |
| 326 | Ga0307409_100013950 | 3300031995 | Bacteria | 5200 |
| 327 | Ga0307409_100125863 | 3300031995 | Bacteria | 2179 |
| 328 | Ga0307409_100303559 | 3300031995 | Bacteria | 1486 |
| 329 | Ga0307409_100403657 | 3300031995 | Bacteria | 1306 |
| 330 | Ga0307416_100020402 | 3300032002 | Bacteria | 4727 |
| 331 | Ga0307416_100022144 | 3300032002 | Bacteria | 4580 |
| 332 | Ga0307416_100121837 | 3300032002 | Bacteria | 2326 |
| 333 | Ga0307416_100170465 | 3300032002 | Bacteria | 2025 |
| 334 | Ga0307416_100248631 | 3300032002 | Bacteria | 1729 |
| 335 | Ga0307416_100479298 | 3300032002 | Bacteria | 1304 |
| 336 | Ga0307414_10001446 | 3300032004 | Bacteria | 12337 |
| 337 | Ga0307414_10003915 | 3300032004 | Bacteria | 8024 |
| 338 | Ga0307414_10005234 | 3300032004 | Bacteria | 7127 |
| 339 | Ga0307414_10012489 | 3300032004 | Bacteria | 5023 |
| 340 | Ga0307414_10038057 | 3300032004 | Bacteria | 3226 |
| 341 | Ga0307414_10075701 | 3300032004 | Bacteria | 2443 |
| 342 | Ga0307414_10077994 | 3300032004 | Bacteria | 2413 |
| 343 | Ga0307414_10131703 | 3300032004 | Bacteria | 1942 |
| 344 | Ga0307414_10196488 | 3300032004 | Bacteria | 1637 |
| 345 | Ga0307411_10128860 | 3300032005 | Bacteria | 1845 |
| 346 | Ga0307415_100000143 | 3300032126 | Bacteria | 31696 |
| 347 | Ga0307415_100082595 | 3300032126 | Bacteria | 2299 |
| 348 | Ga0307415_100147242 | 3300032126 | Bacteria | 1807 |
| 349 | Ga0307415_100206173 | 3300032126 | Bacteria | 1564 |
| 350 | Ga0316580_10041578 | 3300032139 | Unclassified | 1419 |
| 351 | Ga0373932_0026421 | 3300035112 | Bacteria | 1579 |
| 352 | Ga0373932_0045064 | 3300035112 | Bacteria | 1289 |
| 353 | Ga0316574_0003146 | 3300035398 | Bacteria | 8446 |
| 354 | Ga0316574_0015419 | 3300035398 | Bacteria | 4434 |
| 355 | Ga0373933_0129523 | 3300035724 | Bacteria | 1586 |
| 356 | Ga0373947_0063442 | 3300035725 | Bacteria | 2251 |
| 357 | Ga0395899_0001867 | 3300037312 | Bacteria | 17398 |
| 358 | Ga0395899_0002198 | 3300037312 | Bacteria | 15987 |
| 359 | Ga0395899_0018330 | 3300037312 | Bacteria | 5321 |
| 360 | Ga0395899_0021868 | 3300037312 | Bacteria | 4852 |
| 361 | Ga0395899_0032819 | 3300037312 | Bacteria | 3901 |
| 362 | Ga0395899_0068649 | 3300037312 | Bacteria | 2598 |
| 363 | Ga0395899_0142568 | 3300037312 | Bacteria | 1704 |
| 364 | Ga0395899_0199916 | 3300037312 | Bacteria | 1394 |
| 365 | Ga0395900_0003030 | 3300037418 | Bacteria | 18287 |
| 366 | Ga0395900_0006843 | 3300037418 | Bacteria | 11828 |
| 367 | Ga0395900_0011100 | 3300037418 | Bacteria | 9207 |
| 368 | Ga0395900_0026078 | 3300037418 | Bacteria | 5984 |
| 369 | Ga0395900_0039484 | 3300037418 | Bacteria | 4864 |
| 370 | Ga0395900_0049493 | 3300037418 | Bacteria | 4330 |
| 371 | Ga0395900_0061093 | 3300037418 | Bacteria | 3875 |
| 372 | Ga0395900_0065349 | 3300037418 | Bacteria | 3737 |
| 373 | Ga0395900_0111714 | 3300037418 | Bacteria | 2806 |
| 374 | Ga0395900_0130907 | 3300037418 | Bacteria | 2571 |
| 375 | Ga0395900_0132679 | 3300037418 | Bacteria | 2552 |
| 376 | Ga0395900_0207023 | 3300037418 | Bacteria | 1982 |
| 377 | Ga0395898_0003844 | 3300037466 | Bacteria | 16633 |
| 378 | Ga0395898_0003922 | 3300037466 | Bacteria | 16418 |
| 379 | Ga0395898_0004765 | 3300037466 | Bacteria | 14766 |
| 380 | Ga0395898_0022255 | 3300037466 | Bacteria | 6423 |
| 381 | Ga0395898_0028222 | 3300037466 | Bacteria | 5627 |
| 382 | Ga0395898_0043602 | 3300037466 | Bacteria | 4419 |
| 383 | Ga0395898_0075351 | 3300037466 | Bacteria | 3259 |
| 384 | Ga0395898_0102688 | 3300037466 | Bacteria | 2744 |
| 385 | Ga0395898_0185109 | 3300037466 | Bacteria | 1990 |
| 386 | Ga0395898_0205849 | 3300037466 | Bacteria | 1877 |
| 387 | Ga0395898_0207901 | 3300037466 | Bacteria | 1868 |
| 388 | Ga0395898_0297896 | 3300037466 | Bacteria | 1538 |
| 389 | Ga0395905_0001678 | 3300037471 | Bacteria | 26104 |
| 390 | Ga0395905_0003679 | 3300037471 | Bacteria | 16247 |
| 391 | Ga0395905_0017681 | 3300037471 | Bacteria | 6768 |
| 392 | Ga0395905_0023137 | 3300037471 | Bacteria | 5874 |
| 393 | Ga0395905_0025798 | 3300037471 | Bacteria | 5540 |
| 394 | Ga0395905_0044914 | 3300037471 | Bacteria | 4144 |
| 395 | Ga0395905_0082461 | 3300037471 | Bacteria | 3013 |
| 396 | Ga0395905_0446934 | 3300037471 | Bacteria | 1190 |
| 397 | Ga0395901_0003395 | 3300038443 | Bacteria | 16041 |
| 398 | Ga0395901_0033804 | 3300038443 | Bacteria | 5279 |
| 399 | Ga0395901_0035303 | 3300038443 | Bacteria | 5165 |
| 400 | Ga0395901_0035657 | 3300038443 | Bacteria | 5140 |
| 401 | Ga0395901_0037863 | 3300038443 | Bacteria | 4987 |
| 402 | Ga0395901_0041723 | 3300038443 | Bacteria | 4756 |
| 403 | Ga0395901_0048492 | 3300038443 | Bacteria | 4411 |
| 404 | Ga0395901_0061909 | 3300038443 | Bacteria | 3894 |
| 405 | Ga0395901_0063486 | 3300038443 | Bacteria | 3844 |
| 406 | Ga0395901_0066493 | 3300038443 | Bacteria | 3754 |
| 407 | Ga0395901_0085674 | 3300038443 | Bacteria | 3294 |
| 408 | Ga0395901_0137904 | 3300038443 | Bacteria | 2564 |
| 409 | Ga0395901_0193881 | 3300038443 | Bacteria | 2130 |
| 410 | Ga0395901_0219499 | 3300038443 | Bacteria | 1987 |
| 411 | Ga0395901_0304758 | 3300038443 | Bacteria | 1651 |
| 412 | Ga0395901_0548847 | 3300038443 | Bacteria | 1171 |
| 413 | Ga0237819_00061 | 3300038705 | Bacteria | 38106 |
| 414 | Ga0400484_03784 | 3300038725 | Bacteria | 19256 |
| 415 | Ga0400489_65446 | 3300039093 | Bacteria | 1602 |
| 416 | Ga0237816_00232 | 3300039145 | Bacteria | 4657 |
| 417 | Ga0439436_0004143 | 3300041404 | Bacteria | 4446 |
| 418 | Ga0439436_0010636 | 3300041404 | Bacteria | 2804 |
| 419 | Ga0439436_0012266 | 3300041404 | Bacteria | 2601 |
| 420 | Ga0439447_002627 | 3300041407 | Bacteria | 6516 |
| 421 | Ga0439465_0000127 | 3300041413 | Bacteria | 18321 |
| 422 | Ga0439465_0001965 | 3300041413 | Bacteria | 6745 |
| 423 | Ga0439465_0005093 | 3300041413 | Bacteria | 4216 |
| 424 | Ga0451797_0221659 | 3300041453 | Bacteria | 1304 |
| 425 | Ga0439432_015932 | 3300042006 | Bacteria | 2532 |
| 426 | Ga0439449_0004920 | 3300042007 | Bacteria | 5144 |
| 427 | Ga0439449_0018047 | 3300042007 | Bacteria | 2649 |
| 428 | Ga0439449_0019299 | 3300042007 | Bacteria | 2555 |
| 429 | Ga0439449_0024803 | 3300042007 | Bacteria | 2241 |
| 430 | Ga0439449_0039458 | 3300042007 | Bacteria | 1755 |
| 431 | Ga0450911_001216 | 3300042115 | Bacteria | 6249 |
| 432 | Ga0451577_0029445 | 3300042876 | Bacteria | 4963 |
| 433 | Ga0466969_0014427 | 3300044656 | Bacteria | 4155 |
| 434 | Ga0466972_0011785 | 3300044658 | Bacteria | 4391 |
| 435 | Ga0453683_0190476 | 3300044673 | Bacteria | 1301 |
| 436 | Ga0466966_0028489 | 3300044684 | Bacteria | 3638 |
| 437 | Ga0466961_0004981 | 3300044693 | Bacteria | 8354 |
| 438 | Ga0466961_0008653 | 3300044693 | Bacteria | 6487 |
| 439 | Ga0466961_0037271 | 3300044693 | Bacteria | 3119 |
| 440 | Ga0466963_0004507 | 3300044694 | Bacteria | 8106 |
| 441 | Ga0466963_0017812 | 3300044694 | Bacteria | 4432 |
| 442 | Ga0466963_0020278 | 3300044694 | Bacteria | 4180 |
| 443 | Ga0466963_0030453 | 3300044694 | Bacteria | 3483 |
| 444 | Ga0466963_0058030 | 3300044694 | Bacteria | 2579 |
| 445 | Ga0466963_0136879 | 3300044694 | Bacteria | 1695 |
| 446 | Ga0466964_0098914 | 3300044706 | Bacteria | 1283 |
| 447 | Ga0453684_0036612 | 3300044712 | Bacteria | 6759 |
| 448 | Ga0466971_0008317 | 3300044719 | Bacteria | 4527 |
| 449 | Ga0466971_0025090 | 3300044719 | Bacteria | 2662 |
| 450 | Ga0466971_0030874 | 3300044719 | Bacteria | 2398 |
| 451 | Ga0466957_0005089 | 3300044842 | Bacteria | 7355 |
| 452 | Ga0466957_0115968 | 3300044842 | Bacteria | 1703 |
| 453 | Ga0466959_0050755 | 3300045049 | Bacteria | 3044 |
| 454 | Ga0466959_0105492 | 3300045049 | Unclassified | 2015 |
| 455 | Ga0451576_0012693 | 3300045051 | Bacteria | 9460 |
| 456 | Ga0466958_0037262 | 3300045836 | Bacteria | 2914 |
| 457 | Ga0466958_0063667 | 3300045836 | Unclassified | 2249 |
| 458 | Ga0466967_0053604 | 3300045976 | Bacteria | 3545 |
| 459 | Ga0466967_0100175 | 3300045976 | Bacteria | 2647 |
| 460 | Ga0466967_0305226 | 3300045976 | Bacteria | 1532 |
| 461 | Ga0495603_0041890 | 3300046455 | Bacteria | 2738 |
| 462 | Ga0495638_0014897 | 3300046460 | Bacteria | 5237 |
| 463 | Ga0495638_0067672 | 3300046460 | Bacteria | 2192 |
| 464 | Ga0495584_0113104 | 3300046491 | Bacteria | 1374 |
| 465 | Ga0495585_0148869 | 3300046492 | Bacteria | 1222 |
| 466 | Ga0495607_0020327 | 3300046501 | Bacteria | 4200 |
| 467 | Ga0495610_0014871 | 3300046512 | Bacteria | 4551 |
| 468 | Ga0495618_0028394 | 3300046514 | Bacteria | 3487 |
| 469 | Ga0495618_0034493 | 3300046514 | Bacteria | 3173 |
| 470 | Ga0495631_0003909 | 3300046518 | Bacteria | 8049 |
| 471 | Ga0495643_0001494 | 3300046522 | Bacteria | 21238 |
| 472 | Ga0495643_0072356 | 3300046522 | Bacteria | 1808 |
| 473 | Ga0495663_0000563 | 3300046525 | Bacteria | 13078 |
| 474 | Ga0495633_0008243 | 3300046558 | Bacteria | 5895 |
| 475 | Ga0495633_0051720 | 3300046558 | Bacteria | 1935 |
| 476 | Ga0495656_0010234 | 3300046615 | Bacteria | 3403 |
| 477 | Ga0495656_0038148 | 3300046615 | Bacteria | 1988 |
| 478 | Ga0495668_0003552 | 3300046616 | Bacteria | 11588 |
| 479 | Ga0495625_0098783 | 3300046660 | Bacteria | 2007 |
| 480 | Ga0495658_0211468 | 3300046683 | Bacteria | 1212 |
| 481 | Ga0495624_0081552 | 3300046690 | Bacteria | 2003 |
| 482 | Ga0495671_0007904 | 3300046692 | Bacteria | 6015 |
| 483 | Ga0495636_0054559 | 3300047318 | Bacteria | 1679 |
| 484 | Ga0495636_0078857 | 3300047318 | Bacteria | 1415 |
| 485 | Ga0495672_0000594 | 3300047320 | Bacteria | 40835 |
| 486 | Ga0495676_0102427 | 3300047321 | Bacteria | 2115 |
| 487 | Ga0495676_0209623 | 3300047321 | Bacteria | 1349 |
| 488 | Ga0495680_0153142 | 3300047322 | Bacteria | 1679 |
| 489 | Ga0495684_0136386 | 3300047471 | Bacteria | 1841 |
| 490 | Ga0495686_0022158 | 3300047472 | Bacteria | 4205 |
| 491 | Ga0496100_0033464 | 3300048903 | Bacteria | 3216 |
| 492 | Ga0496100_0113532 | 3300048903 | Bacteria | 1886 |
| 493 | Ga0496102_0007168 | 3300048905 | Bacteria | 9518 |
| 494 | Ga0496102_0007577 | 3300048905 | Bacteria | 9274 |
| 495 | Ga0496102_0416014 | 3300048905 | Bacteria | 1263 |
| 496 | Ga0496103_0008200 | 3300048906 | Bacteria | 6199 |
| 497 | Ga0496103_0093917 | 3300048906 | Bacteria | 1895 |
| 498 | Ga0496104_0087302 | 3300048907 | Bacteria | 2979 |
| 499 | Ga0496105_0052365 | 3300048908 | Bacteria | 3372 |
| 500 | Ga0496105_0056707 | 3300048908 | Bacteria | 3234 |
| 501 | Ga0496105_0220928 | 3300048908 | Bacteria | 1542 |
| 502 | Ga0496106_0003316 | 3300048909 | Bacteria | 11997 |
| 503 | Ga0496106_0103323 | 3300048909 | Bacteria | 2211 |
| 504 | Ga0496106_0201475 | 3300048909 | Bacteria | 1584 |
| 505 | Ga0496106_0417840 | 3300048909 | Bacteria | 1078 |
| 506 | Ga0496107_0004360 | 3300048910 | Bacteria | 9581 |
| 507 | Ga0496107_0014375 | 3300048910 | Bacteria | 5543 |
| 508 | Ga0496107_0027828 | 3300048910 | Bacteria | 4016 |
| 509 | Ga0496108_0005735 | 3300048911 | Bacteria | 10053 |
| 510 | Ga0496108_0063679 | 3300048911 | Bacteria | 3105 |
| 511 | Ga0496108_0114985 | 3300048911 | Bacteria | 2304 |
| 512 | Ga0496109_0015790 | 3300048912 | Bacteria | 6591 |
| 513 | Ga0496109_0102809 | 3300048912 | Bacteria | 2652 |
| 514 | Ga0496109_0218782 | 3300048912 | Bacteria | 1791 |
| 515 | Ga0496110_0079573 | 3300048913 | Bacteria | 2918 |
| 516 | Ga0496110_0101263 | 3300048913 | Bacteria | 2582 |
| 517 | Ga0496112_0001751 | 3300048915 | Bacteria | 17014 |
| 518 | Ga0496112_0013805 | 3300048915 | Bacteria | 7471 |
| 519 | Ga0496112_0047465 | 3300048915 | Bacteria | 4213 |
| 520 | Ga0496113_0076553 | 3300048916 | Bacteria | 2556 |
| 521 | Ga0496114_0001241 | 3300048917 | Bacteria | 19288 |
| 522 | Ga0496115_0005999 | 3300048918 | Bacteria | 8869 |
| 523 | Ga0496115_0097841 | 3300048918 | Bacteria | 2403 |
| 524 | Ga0496116_0026626 | 3300048919 | Bacteria | 4224 |
| 525 | Ga0496116_0063433 | 3300048919 | Bacteria | 2381 |
| 526 | Ga0496117_0005821 | 3300048920 | Bacteria | 12769 |
| 527 | Ga0496117_0030989 | 3300048920 | Bacteria | 4091 |
| 528 | Ga0496118_0001226 | 3300048921 | Bacteria | 39410 |
| 529 | Ga0496118_0007402 | 3300048921 | Bacteria | 11647 |
| 530 | Ga0496118_0073764 | 3300048921 | Bacteria | 2443 |
| 531 | Ga0496119_0000303 | 3300048922 | Bacteria | 68844 |
| 532 | Ga0496119_0001216 | 3300048922 | Bacteria | 32142 |
| 533 | Ga0496120_0000437 | 3300048923 | Bacteria | 66014 |
| 534 | Ga0496120_0000710 | 3300048923 | Bacteria | 48861 |
| 535 | Ga0496121_0004776 | 3300048924 | Bacteria | 17874 |
| 536 | Ga0496121_0026510 | 3300048924 | Bacteria | 5459 |
| 537 | Ga0496121_0063685 | 3300048924 | Bacteria | 3010 |
| 538 | Ga0496121_0191780 | 3300048924 | Bacteria | 1464 |
| 539 | Ga0496122_0000379 | 3300048925 | Bacteria | 95139 |
| 540 | Ga0496122_0000915 | 3300048925 | Bacteria | 54089 |
| 541 | Ga0496122_0025501 | 3300048925 | Bacteria | 5132 |
| 542 | Ga0496122_0048381 | 3300048925 | Bacteria | 3270 |
| 543 | Ga0496123_0000313 | 3300048926 | Bacteria | 93165 |
| 544 | Ga0496123_0000635 | 3300048926 | Bacteria | 58668 |
| 545 | Ga0496123_0032869 | 3300048926 | Bacteria | 3745 |
| 546 | Ga0496123_0051997 | 3300048926 | Bacteria | 2722 |
| 547 | Ga0496124_0000115 | 3300048927 | Bacteria | 164929 |
| 548 | Ga0496124_0000398 | 3300048927 | Bacteria | 79279 |
| 549 | Ga0496124_0015628 | 3300048927 | Bacteria | 7265 |
| 550 | Ga0496124_0030831 | 3300048927 | Bacteria | 4751 |
| 551 | Ga0496124_0033677 | 3300048927 | Bacteria | 4505 |
| 552 | Ga0496124_0113215 | 3300048927 | Bacteria | 2180 |
| 553 | Ga0496125_0018256 | 3300048928 | Bacteria | 6666 |
| 554 | Ga0496125_0039444 | 3300048928 | Bacteria | 4066 |
| 555 | Ga0496125_0052087 | 3300048928 | Bacteria | 3368 |
| 556 | Ga0496125_0065331 | 3300048928 | Bacteria | 2883 |
| 557 | Ga0496126_0002933 | 3300048929 | Bacteria | 22177 |
| 558 | Ga0496126_0078862 | 3300048929 | Bacteria | 2917 |
| 559 | Ga0501031_0008297 | 3300049568 | Bacteria | 6756 |
| 560 | Ga0501031_0009504 | 3300049568 | Bacteria | 6327 |
| 561 | Ga0501031_0037607 | 3300049568 | Bacteria | 3158 |
| 562 | Ga0501032_0004860 | 3300049569 | Bacteria | 10063 |
| 563 | Ga0501032_0006583 | 3300049569 | Bacteria | 8530 |
| 564 | Ga0501032_0023619 | 3300049569 | Bacteria | 4244 |
| 565 | Ga0501033_0000751 | 3300049570 | Bacteria | 29835 |
| 566 | Ga0501033_0032264 | 3300049570 | Bacteria | 3933 |
| 567 | Ga0501033_0184119 | 3300049570 | Bacteria | 1496 |
| 568 | Ga0501034_0000309 | 3300049571 | Bacteria | 86590 |
| 569 | Ga0501034_0000311 | 3300049571 | Bacteria | 86241 |
| 570 | Ga0501034_0007516 | 3300049571 | Bacteria | 11592 |
| 571 | Ga0501034_0034158 | 3300049571 | Bacteria | 5156 |
| 572 | Ga0501036_0004153 | 3300049572 | Bacteria | 11654 |
| 573 | Ga0501036_0078377 | 3300049572 | Bacteria | 2794 |
| 574 | Ga0501036_0422091 | 3300049572 | Bacteria | 1112 |
| 575 | Ga0501037_0001504 | 3300049573 | Bacteria | 17049 |
| 576 | Ga0501037_0032274 | 3300049573 | Bacteria | 3867 |
| 577 | Ga0501037_0083448 | 3300049573 | Bacteria | 2315 |
| 578 | Ga0501038_0000399 | 3300049574 | Bacteria | 37785 |
| 579 | Ga0501038_0003005 | 3300049574 | Bacteria | 15719 |
| 580 | Ga0501038_0027118 | 3300049574 | Bacteria | 5098 |
| 581 | Ga0501038_0193745 | 3300049574 | Bacteria | 1634 |
| 582 | Ga0501039_0015934 | 3300049575 | Bacteria | 5755 |
| 583 | Ga0501039_0020428 | 3300049575 | Bacteria | 5075 |
| 584 | Ga0501040_0000991 | 3300049576 | Bacteria | 17960 |
| 585 | Ga0501040_0006195 | 3300049576 | Bacteria | 7756 |
| 586 | Ga0501040_0060491 | 3300049576 | Bacteria | 2603 |
| 587 | Ga0501040_0103026 | 3300049576 | Bacteria | 1992 |
| 588 | Ga0501041_0000643 | 3300049577 | Bacteria | 18283 |
| 589 | Ga0501041_0025337 | 3300049577 | Bacteria | 3564 |
| 590 | Ga0501042_0008464 | 3300049578 | Bacteria | 6791 |
| 591 | Ga0501042_0014784 | 3300049578 | Bacteria | 5330 |
| 592 | Ga0501043_0018319 | 3300049579 | Bacteria | 5490 |
| 593 | Ga0501043_0028920 | 3300049579 | Bacteria | 4350 |
| 594 | Ga0501043_0039265 | 3300049579 | Bacteria | 3720 |
| 595 | Ga0501043_0039441 | 3300049579 | Bacteria | 3711 |
| 596 | Ga0501046_0005323 | 3300049580 | Bacteria | 11507 |
| 597 | Ga0501046_0015319 | 3300049580 | Bacteria | 6447 |
| 598 | Ga0501047_0001290 | 3300049581 | Bacteria | 24727 |
| 599 | Ga0501047_0053749 | 3300049581 | Bacteria | 3896 |
| 600 | Ga0501047_0089639 | 3300049581 | Bacteria | 2953 |
| 601 | Ga0501048_0000176 | 3300049582 | Bacteria | 40373 |
| 602 | Ga0501048_0000668 | 3300049582 | Bacteria | 24832 |
| 603 | Ga0501048_0017781 | 3300049582 | Bacteria | 5231 |
| 604 | Ga0501067_0017766 | 3300049583 | Bacteria | 3938 |
| 605 | Ga0501067_0065319 | 3300049583 | Bacteria | 2014 |
| 606 | Ga0501067_0068449 | 3300049583 | Bacteria | 1965 |
| 607 | Ga0501068_0000266 | 3300049584 | Bacteria | 25796 |
| 608 | Ga0501068_0063823 | 3300049584 | Bacteria | 2241 |
| 609 | Ga0501068_0093288 | 3300049584 | Bacteria | 1859 |
| 610 | Ga0501069_0004227 | 3300049585 | Bacteria | 7420 |
| 611 | Ga0501069_0005669 | 3300049585 | Bacteria | 6504 |
| 612 | Ga0501069_0006582 | 3300049585 | Bacteria | 6072 |
| 613 | Ga0501069_0086462 | 3300049585 | Bacteria | 1770 |
| 614 | Ga0501070_0002030 | 3300049586 | Bacteria | 17801 |
| 615 | Ga0501070_0008772 | 3300049586 | Bacteria | 8549 |
| 616 | Ga0501070_0042887 | 3300049586 | Bacteria | 3766 |
| 617 | Ga0501070_0050585 | 3300049586 | Bacteria | 3449 |
| 618 | Ga0501071_0015981 | 3300049587 | Bacteria | 5156 |
| 619 | Ga0501071_0024158 | 3300049587 | Bacteria | 4249 |
| 620 | Ga0501071_0297207 | 3300049587 | Bacteria | 1224 |
| 621 | Ga0501072_0000870 | 3300049588 | Bacteria | 22145 |
| 622 | Ga0501072_0015504 | 3300049588 | Bacteria | 5841 |
| 623 | Ga0501073_0001604 | 3300049589 | Bacteria | 16747 |
| 624 | Ga0501073_0001742 | 3300049589 | Bacteria | 16172 |
| 625 | Ga0501074_0004583 | 3300049590 | Bacteria | 9900 |
| 626 | Ga0501074_0008266 | 3300049590 | Bacteria | 7544 |
| 627 | Ga0501074_0029258 | 3300049590 | Bacteria | 3990 |
| 628 | Ga0501075_0000298 | 3300049591 | Bacteria | 27595 |
| 629 | Ga0501075_0113468 | 3300049591 | Bacteria | 2060 |
| 630 | Ga0501075_0171788 | 3300049591 | Bacteria | 1654 |
| 631 | Ga0501076_0013602 | 3300049592 | Bacteria | 6104 |
| 632 | Ga0501076_0102840 | 3300049592 | Bacteria | 2304 |
| 633 | Ga0501076_0143235 | 3300049592 | Bacteria | 1942 |
| 634 | Ga0501077_0000718 | 3300049593 | Bacteria | 20025 |
| 635 | Ga0501077_0024815 | 3300049593 | Bacteria | 3806 |
| 636 | Ga0501202_049155 | 3300049652 | Unclassified | 930 |
| 637 | Ga0501079_0009091 | 3300049741 | Bacteria | 7523 |
| 638 | Ga0501079_0062446 | 3300049741 | Bacteria | 2874 |
| 639 | Ga0501079_0062584 | 3300049741 | Bacteria | 2870 |
| 640 | Ga0501079_0126797 | 3300049741 | Bacteria | 1985 |
| 641 | Ga0501080_0000450 | 3300049742 | Bacteria | 31992 |
| 642 | Ga0501080_0007118 | 3300049742 | Bacteria | 10101 |
| 643 | Ga0501080_0065727 | 3300049742 | Bacteria | 3373 |
| 644 | Ga0501081_0000447 | 3300049743 | Bacteria | 22828 |
| 645 | Ga0501081_0009614 | 3300049743 | Bacteria | 6302 |
| 646 | Ga0501081_0052394 | 3300049743 | Bacteria | 2816 |
| 647 | Ga0501083_0001240 | 3300049744 | Bacteria | 17307 |
| 648 | Ga0501083_0008730 | 3300049744 | Bacteria | 7150 |
| 649 | Ga0501083_0009464 | 3300049744 | Bacteria | 6883 |
| 650 | Ga0501265_002107 | 3300049762 | Bacteria | 2269 |
| 651 | Ga0501035_0005550 | 3300049822 | Bacteria | 11917 |
| 652 | Ga0501035_0023125 | 3300049822 | Bacteria | 5703 |
| 653 | Ga0501044_0013823 | 3300049823 | Bacteria | 8723 |
| 654 | Ga0501044_0013996 | 3300049823 | Bacteria | 8666 |
| 655 | Ga0501044_0018071 | 3300049823 | Bacteria | 7562 |
| 656 | Ga0501044_0038281 | 3300049823 | Bacteria | 5009 |
| 657 | Ga0501044_0098980 | 3300049823 | Bacteria | 2935 |
| 658 | Ga0501044_0382898 | 3300049823 | Bacteria | 1321 |
| 659 | Ga0501045_0003128 | 3300049824 | Bacteria | 11316 |
| 660 | Ga0501045_0065941 | 3300049824 | Bacteria | 2658 |
| 661 | Ga0501045_0128325 | 3300049824 | Bacteria | 1885 |
| 662 | nmdc:mga00v17_20464_c1 | 3300050491 | Bacteria | 3791 |
| 663 | nmdc:mga05p37_244362_c1 | 3300050507 | Bacteria | 2156 |
| 664 | nmdc:mga05p37_383015_c1 | 3300050507 | Bacteria | 1647 |
| 665 | nmdc:mga05p37_50983_c1 | 3300050507 | Bacteria | 5089 |
| 666 | nmdc:mga05p37_65045_c1 | 3300050507 | Bacteria | 4487 |
| 667 | nmdc:mga05p37_85673_c1 | 3300050507 | Bacteria | 3883 |
| 668 | nmdc:mga09592_57037_c1 | 3300050508 | Bacteria | 3300 |
| 669 | nmdc:mga0qj67_17327_c1 | 3300050509 | Bacteria | 2741 |
| 670 | nmdc:mga0qj67_193164_c1 | 3300050509 | Bacteria | 1654 |
| 671 | nmdc:mga0qj67_270537_c1 | 3300050509 | Bacteria | 1378 |
| 672 | nmdc:mga06r32_160071_c1 | 3300050510 | Bacteria | 2233 |
| 673 | nmdc:mga06r32_237806_c1 | 3300050510 | Bacteria | 1809 |
| 674 | nmdc:mga06r32_592686_c1 | 3300050510 | Bacteria | 1080 |
| 675 | nmdc:mga08y16_140247_c1 | 3300050511 | Bacteria | 2513 |
| 676 | nmdc:mga08y16_177411_c1 | 3300050511 | Bacteria | 2212 |
| 677 | nmdc:mga08y16_379430_c1 | 3300050511 | Bacteria | 1449 |
| 678 | nmdc:mga08y16_39216_c1 | 3300050511 | Bacteria | 4970 |
| 679 | nmdc:mga08y16_86589_c1 | 3300050511 | Bacteria | 3265 |
| 680 | nmdc:mga0n895_37071_c1 | 3300050512 | Bacteria | 4714 |
| 681 | nmdc:mga0n895_481381_c1 | 3300050512 | Bacteria | 1252 |
| 682 | nmdc:mga0rr50_67012_c1 | 3300050513 | Bacteria | 2726 |
| 683 | nmdc:mga08x19_160219_c1 | 3300050514 | Bacteria | 1528 |
| 684 | Ga0495601_0003616 | 3300053077 | Bacteria | 8889 |
| 685 | Ga0495601_0148344 | 3300053077 | Bacteria | 1531 |
| 686 | Ga0495595_0028648 | 3300053084 | Bacteria | 2488 |
| 687 | Ga0495595_0248197 | 3300053084 | Bacteria | 891 |
| 688 | Ga0495619_0017923 | 3300053085 | Bacteria | 4489 |
| 689 | Ga0500634_0000369 | 3300053161 | Bacteria | 14334 |
| 690 | Ga0501084_0008367 | 3300054114 | Bacteria | 8541 |
| 691 | Ga0501084_0040628 | 3300054114 | Bacteria | 3891 |
| 692 | Ga0501084_0313190 | 3300054114 | Bacteria | 1325 |
| 693 | Ga0501082_0005344 | 3300060353 | Bacteria | 11152 |
| 694 | Ga0501082_0008847 | 3300060353 | Bacteria | 8685 |
| 695 | Ga0501082_0041383 | 3300060353 | Bacteria | 3973 |
| 696 | Ga0501082_0163686 | 3300060353 | Bacteria | 1933 |
| 697 | Ga0466962_0002540 | 3300061719 | Bacteria | 8660 |
| 698 | Ga0466962_0005481 | 3300061719 | Bacteria | 6100 |
| 699 | Ga0466962_0008807 | 3300061719 | Bacteria | 4836 |
| 700 | Ga0466962_0153510 | 3300061719 | Bacteria | 1117 |
| 701 | Ga0530510_0011891 | 3300061734 | Bacteria | 6107 |
| 702 | Ga0530510_0013136 | 3300061734 | Bacteria | 5824 |
| 703 | Ga0530510_0182838 | 3300061734 | Bacteria | 1555 |
| 704 | 2525556335 | 2524614729 | Bacteria | 3091755 |
| 705 | 2547499561 | 2547132130 | Bacteria | 4660562 |
| 706 | 2572256107 | 2571042365 | Bacteria | 3289345 |
| 707 | 2578459937 | 2576861471 | Bacteria | 4648976 |
| 708 | 2630649565 | 2627854209 | Bacteria | 3093011 |
| 709 | 2643881415 | 2643221573 | Bacteria | 4784121 |
| 710 | 2643907651 | 2643221579 | Bacteria | 4443405 |
| 711 | 2643914089 | 2643221581 | Bacteria | 3893603 |
| 712 | 2643977168 | 2643221593 | Bacteria | 6296053 |
| 713 | 2644530359 | 2643221695 | Bacteria | 3441323 |
| 714 | 2644662188 | 2643221720 | Bacteria | 4694283 |
| 715 | 2644700330 | 2643221728 | Bacteria | 4797149 |
| 716 | 2747950312 | 2747842428 | Bacteria | 4689383 |
| 717 | 2748017671 | 2747842501 | Bacteria | 5293829 |
| 718 | 2765577333 | 2765235840 | Bacteria | 4663337 |
| 719 | 2816519961 | 2816332141 | Bacteria | 4436036 |
| 720 | 2842395445 | 2842391507 | Bacteria | 4486072 |
| 721 | 2842761118 | 2842757796 | Bacteria | 3981385 |
| 722 | 2842782930 | 2842780639 | Bacteria | 4337790 |
| 723 | 2852653362 | 2852649853 | Bacteria | 4036942 |
| 724 | 2857445759 | 2857442823 | Bacteria | 4562550 |
| 725 | 2874224215 | 2874220319 | Bacteria | 4594709 |
| 726 | 2884792441 | 2884791551 | Bacteria | 8511252 |
| 727 | 2895502904 | 2895498888 | Bacteria | 5283788 |
| 728 | 2895512943 | 2895511927 | Bacteria | 6802080 |
| 729 | 2895522954 | 2895522137 | Bacteria | 3284416 |
| 730 | 2895525271 | 2895525241 | Bacteria | 3388457 |
| 731 | 2896089956 | 2896085136 | Bacteria | 6129793 |
| 732 | 2919092108 | 2919089067 | Bacteria | 4560942 |
| 733 | 2919135360 | 2919134579 | Bacteria | 4480386 |
| 734 | 2919514210 | 2919513703 | Bacteria | 3844312 |
| 735 | 2919676016 | 2919675420 | Bacteria | 3969095 |
| 736 | 2923516549 | 2923516293 | Bacteria | 3716336 |
| 737 | 2928498741 | 2928496128 | Bacteria | 4631123 |
| 738 | 2931382381 | 2931380184 | Bacteria | 4455911 |
| 739 | 2937612991 | 2937610967 | Bacteria | 4618818 |
| 740 | 2939592288 | 2939589442 | Bacteria | 4214238 |
| 741 | 2939625244 | 2939622612 | Bacteria | 4698046 |
| 742 | 2939629516 | 2939626828 | Bacteria | 4695272 |
| 743 | 2941477644 | 2941475908 | Bacteria | 4145589 |
| 744 | 2941494354 | 2941489479 | Bacteria | 6313767 |
| 745 | 2961050979 | 2961047084 | Bacteria | 4594415 |
| 746 | 2961065701 | 2961064222 | Bacteria | 4749990 |
| 747 | 2974310369 | 2974307012 | Bacteria | 4172388 |
| 748 | 2977251098 | 2977247770 | Bacteria | 4160543 |
| 749 | 2984514408 | 2984514374 | Bacteria | 4172479 |
| 750 | 2987609131 | 2987605356 | Bacteria | 4187822 |
| 751 | 2995953760 | 2995948881 | Bacteria | 6358104 |
| 752 | 8003017696 | 8003014200 | Bacteria | 4059994 |
| 753 | Ga0209676_1000906 | |||
| 754 | SwRhRL2b_contig_24145 | |||
| 755 | JGI24739J22299_10004160 | |||
| 756 | JGI25152J39213_1000039 | |||
| 757 | JGI25150J39212_1000422 | |||
| 758 | JGI25151J46595_10000008 | |||
| 759 | JGI25151J46595_10000154 | |||
| 760 | JGI25151J46595_10047611 | |||
| 761 | JGI25153J46596_10000120 | |||
| 762 | rootH2_10050576 | |||
| 763 | JGI25160J50197_1006305 | |||
| 764 | JGI25407J50210_10045132 | |||
| 765 | Ga0055526_1000015 | |||
| 766 | Ga0055526_1011436 | |||
| 767 | Ga0055526_1011939 | |||
| 768 | Ga0055537_1000132 | |||
| 769 | Ga0055537_1000177 | |||
| 770 | Ga0055524_1000132 | |||
| 771 | Ga0055536_1000626 | |||
| 772 | Ga0055536_1002286 | |||
| 773 | Ga0055536_1007175 | |||
| 774 | Ga0055534_1000055 | |||
| 775 | Ga0055534_1000706 | |||
| 776 | Ga0055534_1000870 | |||
| 777 | Ga0055528_1000008 | |||
| 778 | Ga0055528_1000045 | |||
| 779 | Ga0055530_10002878 | |||
| 780 | Ga0055531_10005845 | |||
| 781 | Ga0055531_10011945 | |||
| 782 | Ga0055531_10014427 | |||
| 783 | Ga0058692_1000026 | |||
| 784 | Ga0065704_10072580 | |||
| 785 | Ga0070658_10069423 | |||
| 786 | Ga0070658_10145276 | |||
| 787 | Ga0070683_100060010 | |||
| 788 | Ga0070683_100092653 | |||
| 789 | Ga0070690_100036047 | |||
| 790 | Ga0070670_100231701 | |||
| 791 | Ga0070666_10257039 | |||
| 792 | Ga0070680_100003170 | |||
| 793 | Ga0070682_100011512 | |||
| 794 | Ga0070660_100010096 | |||
| 795 | Ga0070660_100170424 | |||
| 796 | Ga0070668_100016107 | |||
| 797 | Ga0070668_100019159 | |||
| 798 | Ga0070668_100031994 | |||
| 799 | Ga0070669_100049635 | |||
| 800 | Ga0070674_100174385 | |||
| 801 | Ga0070674_100254978 | |||
| 802 | Ga0070673_100110039 | |||
| 803 | Ga0070659_100001553 | |||
| 804 | Ga0070659_100068955 | |||
| 805 | Ga0070703_10000599 | |||
| 806 | Ga0070709_10021134 | |||
| 807 | Ga0070714_100062593 | |||
| 808 | Ga0070713_100030412 | |||
| 809 | Ga0070711_100248503 | |||
| 810 | Ga0070705_100030815 | |||
| 811 | Ga0070708_100002202 | |||
| 812 | Ga0070708_100022520 | |||
| 813 | Ga0070678_100038110 | |||
| 814 | Ga0070681_10223970 | |||
| 815 | Ga0068867_100193782 | |||
| 816 | Ga0070706_100000503 | |||
| 817 | Ga0070706_100208148 | |||
| 818 | Ga0070707_100144123 | |||
| 819 | Ga0070698_100022834 | |||
| 820 | Ga0070698_100053404 | |||
| 821 | Ga0070699_100132740 | |||
| 822 | Ga0070679_100014388 | |||
| 823 | Ga0070679_100098566 | |||
| 824 | Ga0070684_100165652 | |||
| 825 | Ga0070697_100000833 | |||
| 826 | Ga0070672_100006123 | |||
| 827 | Ga0070696_100045575 | |||
| 828 | Ga0070693_100069355 | |||
| 829 | Ga0070665_100394780 | |||
| 830 | Ga0070704_100008393 | |||
| 831 | Ga0068855_100002748 | |||
| 832 | Ga0068855_100008913 | |||
| 833 | Ga0068855_100163780 | |||
| 834 | Ga0068855_100361331 | |||
| 835 | Ga0070664_100170132 | |||
| 836 | Ga0068857_100000234 | |||
| 837 | Ga0068854_100011394 | |||
| 838 | Ga0068856_100200048 | |||
| 839 | Ga0068852_100002465 | |||
| 840 | Ga0068861_100402577 | |||
| 841 | Ga0068862_100001242 | |||
| 842 | Ga0068862_100185166 | |||
| 843 | Ga0081455_10005471 | |||
| 844 | Ga0081455_10009400 | |||
| 845 | Ga0081455_10055449 | |||
| 846 | Ga0081538_10000132 | |||
| 847 | Ga0081538_10000280 | |||
| 848 | Ga0081538_10003124 | |||
| 849 | Ga0081538_10004486 | |||
| 850 | Ga0081538_10008088 | |||
| 851 | Ga0081538_10015017 | |||
| 852 | Ga0081538_10027674 | |||
| 853 | Ga0081539_10002871 | |||
| 854 | Ga0070717_10438328 | |||
| 855 | Ga0075364_10000016 | |||
| 856 | Ga0075432_10007403 | |||
| 857 | Ga0075432_10019233 | |||
| 858 | Ga0070715_10049380 | |||
| 859 | Ga0075367_10156062 | |||
| 860 | Ga0075369_10065216 | |||
| 861 | Ga0097621_100024439 | |||
| 862 | Ga0075428_100069454 | |||
| 863 | Ga0075430_100045499 | |||
| 864 | Ga0075431_100103054 | |||
| 865 | Ga0075431_100103287 | |||
| 866 | Ga0075431_100200873 | |||
| 867 | Ga0075433_10051269 | |||
| 868 | Ga0075434_100000846 | |||
| 869 | Ga0075429_100040897 | |||
| 870 | Ga0075436_100010273 | |||
| 871 | Ga0099794_10009725 | |||
| 872 | Ga0105251_10000135 | |||
| 873 | Ga0105251_10004487 | |||
| 874 | Ga0105244_10024368 | |||
| 875 | Ga0105240_10009127 | |||
| 876 | Ga0105240_10051930 | |||
| 877 | Ga0111539_10028573 | |||
| 878 | Ga0111539_10057290 | |||
| 879 | Ga0111539_10113234 | |||
| 880 | Ga0111539_10349560 | |||
| 881 | Ga0105245_10003103 | |||
| 882 | Ga0105245_10173198 | |||
| 883 | Ga0114129_10013338 | |||
| 884 | Ga0114129_10042807 | |||
| 885 | Ga0114129_10108436 | |||
| 886 | Ga0114129_10239391 | |||
| 887 | Ga0114129_10493503 | |||
| 888 | Ga0105243_10022597 | |||
| 889 | Ga0105243_10051475 | |||
| 890 | Ga0105241_10162986 | |||
| 891 | Ga0105242_10131717 | |||
| 892 | Ga0105242_10355426 | |||
| 893 | Ga0105248_10353770 | |||
| 894 | Ga0105237_10029977 | |||
| 895 | Ga0105237_10053657 | |||
| 896 | Ga0105238_10259111 | |||
| 897 | Ga0105249_10022114 | |||
| 898 | Ga0105239_10045602 | |||
| 899 | Ga0105239_10124122 | |||
| 900 | Ga0157373_10152790 | |||
| 901 | Ga0157373_10172457 | |||
| 902 | Ga0157371_10001308 | |||
| 903 | Ga0157371_10076836 | |||
| 904 | Ga0157371_10084153 | |||
| 905 | Ga0157370_10004629 | |||
| 906 | Ga0157370_10022411 | |||
| 907 | Ga0157370_10054285 | |||
| 908 | Ga0157369_10014378 | |||
| 909 | Ga0157369_10031143 | |||
| 910 | Ga0157369_10037255 | |||
| 911 | Ga0157369_10037763 | |||
| 912 | Ga0157369_10103111 | |||
| 913 | Ga0157369_10302380 | |||
| 914 | Ga0157378_10027228 | |||
| 915 | Ga0157372_10007977 | |||
| 916 | Ga0157375_10247026 | |||
| 917 | Ga0157380_10049821 | |||
| 918 | Ga0157380_10074859 | |||
| 919 | Ga0182008_10014732 | |||
| 920 | Ga0157379_10186197 | |||
| 921 | Ga0182006_1015869 | |||
| 922 | Ga0182006_1058647 | |||
| 923 | Ga0182007_10000025 | |||
| 924 | Ga0182005_1000293 | |||
| 925 | Ga0183360_10003 | |||
| 926 | Ga0183361_10402 | |||
| 927 | Ga0163161_10024320 | |||
| 928 | Ga0206353_11046508 | |||
| 929 | Ga0206353_11888363 | |||
| 930 | Ga0213871_10000823 | |||
| 931 | Ga0207425_1000074 | |||
| 932 | Ga0207425_1005126 | |||
| 933 | Ga0209129_1000150 | |||
| 934 | Ga0209565_1000001 | |||
| 935 | Ga0209565_1000037 | |||
| 936 | Ga0209673_1000001 | |||
| 937 | Ga0209673_1000494 | |||
| 938 | Ga0209673_1007568 | |||
| 939 | Ga0209130_1004530 | |||
| 940 | Ga0209675_1000001 | |||
| 941 | Ga0209675_1000020 | |||
| 942 | Ga0209676_1000035 | |||
| 943 | Ga0209676_1000307 | |||
| 944 | Ga0209676_1001357 | |||
| 945 | Ga0209676_1002821 | |||
| 946 | Ga0209676_1024112 | |||
| 947 | Ga0209676_1027433 | |||
| 948 | Ga0209676_1034159 | |||
| 949 | Ga0209025_1000030 | |||
| 950 | Ga0209025_1000048 | |||
| 951 | Ga0209025_1001262 | |||
| 952 | Ga0209564_1000001 | |||
| 953 | Ga0209564_1000993 | |||
| 954 | Ga0209564_1007388 | |||
| 955 | Ga0209758_1000056 | |||
| 956 | Ga0209758_1006559 | |||
| 957 | Ga0209050_1000429 | |||
| 958 | Ga0209050_1000670 | |||
| 959 | Ga0209050_1000711 | |||
| 960 | Ga0209256_1000006 | |||
| 961 | Ga0209256_1003920 | |||
| 962 | Ga0209256_1004659 | |||
| 963 | Ga0209256_1014385 | |||
| 964 | Ga0209256_1037534 | |||
| 965 | Ga0209051_1001115 | |||
| 966 | Ga0209051_1016812 | |||
| 967 | Ga0209257_1000091 | |||
| 968 | Ga0209257_1000587 | |||
| 969 | Ga0209257_1001339 | |||
| 970 | Ga0209257_1017145 | |||
| 971 | Ga0209257_1040972 | |||
| 972 | Ga0207655_1044618 | |||
| 973 | Ga0207713_1000417 | |||
| 974 | Ga0207713_1003755 | |||
| 975 | Ga0207653_10000045 | |||
| 976 | Ga0207680_10135023 | |||
| 977 | Ga0207699_10133374 | |||
| 978 | Ga0207705_10025354 | |||
| 979 | Ga0207705_10070623 | |||
| 980 | Ga0207705_10190849 | |||
| 981 | Ga0207684_10000158 | |||
| 982 | Ga0207684_10000652 | |||
| 983 | Ga0207695_10011130 | |||
| 984 | Ga0207695_10041208 | |||
| 985 | Ga0207671_10017913 | |||
| 986 | Ga0207693_10019987 | |||
| 987 | Ga0207693_10020013 | |||
| 988 | Ga0207693_10079116 | |||
| 989 | Ga0207693_10219745 | |||
| 990 | Ga0207657_10013269 | |||
| 991 | Ga0207652_10107030 | |||
| 992 | Ga0207652_10117953 | |||
| 993 | Ga0207652_10275951 | |||
| 994 | Ga0207646_10060964 | |||
| 995 | Ga0207681_10094276 | |||
| 996 | Ga0207694_10087539 | |||
| 997 | Ga0207650_10001342 | |||
| 998 | Ga0207650_10153484 | |||
| 999 | Ga0207659_10114138 | |||
| 1000 | Ga0207700_10206251 | |||
| 1001 | Ga0207664_10234313 | |||
| 1002 | Ga0207664_10292684 | |||
| 1003 | Ga0207644_10219136 | |||
| 1004 | Ga0207706_10005511 | |||
| 1005 | Ga0207709_10002055 | |||
| 1006 | Ga0207709_10085344 | |||
| 1007 | Ga0207669_10165172 | |||
| 1008 | Ga0207665_10002293 | |||
| 1009 | Ga0207665_10013449 | |||
| 1010 | Ga0207691_10001588 | |||
| 1011 | Ga0207661_10016758 | |||
| 1012 | Ga0207679_10290791 | |||
| 1013 | Ga0207667_10000151 | |||
| 1014 | Ga0207667_10108167 | |||
| 1015 | Ga0207651_10180060 | |||
| 1016 | Ga0207712_10032133 | |||
| 1017 | Ga0207668_10012526 | |||
| 1018 | Ga0207668_10015590 | |||
| 1019 | Ga0207668_10022768 | |||
| 1020 | Ga0207640_10009438 | |||
| 1021 | Ga0207640_10170193 | |||
| 1022 | Ga0207677_10295046 | |||
| 1023 | Ga0207639_10104928 | |||
| 1024 | Ga0207708_10005607 | |||
| 1025 | Ga0207708_10277985 | |||
| 1026 | Ga0207648_10041415 | |||
| 1027 | Ga0207648_10220889 | |||
| 1028 | Ga0207648_10425133 | |||
| 1029 | Ga0207674_10002882 | |||
| 1030 | Ga0207683_10001345 | |||
| 1031 | Ga0207683_10128202 | |||
| 1032 | Ga0207698_10015099 | |||
| 1033 | Ga0209371_1000028 | |||
| 1034 | Ga0209983_1000837 | |||
| 1035 | Ga0209588_1075766 | |||
| 1036 | Ga0209971_1000564 | |||
| 1037 | Ga0209974_10022179 | |||
| 1038 | Ga0268266_10353744 | |||
| 1039 | Ga0268265_10001651 | |||
| 1040 | Ga0268265_10171494 | |||
| 1041 | Ga0265337_1026456 | |||
| 1042 | Ga0265319_1002310 | |||
| 1043 | Ga0265318_10014419 | |||
| 1044 | Ga0265322_10002939 | |||
| 1045 | Ga0265322_10007118 | |||
| 1046 | Ga0265338_10021437 | |||
| 1047 | Ga0265338_10060021 | |||
| 1048 | Ga0265338_10110644 | |||
| 1049 | Ga0268256_1000030 | |||
| 1050 | Ga0316177_1093440 | |||
| 1051 | Ga0314311_1115363 | |||
| 1052 | Ga0316178_1075419 | |||
| 1053 | Ga0265329_10046532 | |||
| 1054 | Ga0265331_10065095 | |||
| 1055 | Ga0265327_10003143 | |||
| 1056 | Ga0265327_10004332 | |||
| 1057 | Ga0265316_10142866 | |||
| 1058 | Ga0307513_10041457 | |||
| 1059 | Ga0307513_10283085 | |||
| 1060 | Ga0307408_100012782 | |||
| 1061 | Ga0307408_100038495 | |||
| 1062 | Ga0307408_100184660 | |||
| 1063 | Ga0307408_100245857 | |||
| 1064 | Ga0265314_10031649 | |||
| 1065 | Ga0265342_10030763 | |||
| 1066 | Ga0316576_10047922 | |||
| 1067 | Ga0316578_10079129 | |||
| 1068 | Ga0307405_10070963 | |||
| 1069 | Ga0307405_10081198 | |||
| 1070 | Ga0307413_10036531 | |||
| 1071 | Ga0307410_10104257 | |||
| 1072 | Ga0307406_10000482 | |||
| 1073 | Ga0307406_10074932 | |||
| 1074 | Ga0307406_10166811 | |||
| 1075 | Ga0307406_10169090 | |||
| 1076 | Ga0307412_10012010 | |||
| 1077 | Ga0307412_10018570 | |||
| 1078 | Ga0307409_100013950 | |||
| 1079 | Ga0307409_100125863 | |||
| 1080 | Ga0307409_100303559 | |||
| 1081 | Ga0307409_100403657 | |||
| 1082 | Ga0307416_100020402 | |||
| 1083 | Ga0307416_100022144 | |||
| 1084 | Ga0307416_100121837 | |||
| 1085 | Ga0307416_100170465 | |||
| 1086 | Ga0307416_100248631 | |||
| 1087 | Ga0307416_100479298 | |||
| 1088 | Ga0307414_10001446 | |||
| 1089 | Ga0307414_10003915 | |||
| 1090 | Ga0307414_10005234 | |||
| 1091 | Ga0307414_10012489 | |||
| 1092 | Ga0307414_10038057 | |||
| 1093 | Ga0307414_10075701 | |||
| 1094 | Ga0307414_10077994 | |||
| 1095 | Ga0307414_10131703 | |||
| 1096 | Ga0307414_10196488 | |||
| 1097 | Ga0307411_10128860 | |||
| 1098 | Ga0307415_100000143 | |||
| 1099 | Ga0307415_100082595 | |||
| 1100 | Ga0307415_100147242 | |||
| 1101 | Ga0307415_100206173 | |||
| 1102 | Ga0316580_10041578 | |||
| 1103 | Ga0373932_0026421 | |||
| 1104 | Ga0373932_0045064 | |||
| 1105 | Ga0316574_0003146 | |||
| 1106 | Ga0316574_0015419 | |||
| 1107 | Ga0373933_0129523 | |||
| 1108 | Ga0373947_0063442 | |||
| 1109 | Ga0395899_0001867 | |||
| 1110 | Ga0395899_0002198 | |||
| 1111 | Ga0395899_0018330 | |||
| 1112 | Ga0395899_0021868 | |||
| 1113 | Ga0395899_0032819 | |||
| 1114 | Ga0395899_0068649 | |||
| 1115 | Ga0395899_0142568 | |||
| 1116 | Ga0395899_0199916 | |||
| 1117 | Ga0395900_0003030 | |||
| 1118 | Ga0395900_0006843 | |||
| 1119 | Ga0395900_0011100 | |||
| 1120 | Ga0395900_0026078 | |||
| 1121 | Ga0395900_0039484 | |||
| 1122 | Ga0395900_0049493 | |||
| 1123 | Ga0395900_0061093 | |||
| 1124 | Ga0395900_0065349 | |||
| 1125 | Ga0395900_0111714 | |||
| 1126 | Ga0395900_0130907 | |||
| 1127 | Ga0395900_0132679 | |||
| 1128 | Ga0395900_0207023 | |||
| 1129 | Ga0395898_0003844 | |||
| 1130 | Ga0395898_0003922 | |||
| 1131 | Ga0395898_0004765 | |||
| 1132 | Ga0395898_0022255 | |||
| 1133 | Ga0395898_0028222 | |||
| 1134 | Ga0395898_0043602 | |||
| 1135 | Ga0395898_0075351 | |||
| 1136 | Ga0395898_0102688 | |||
| 1137 | Ga0395898_0185109 | |||
| 1138 | Ga0395898_0205849 | |||
| 1139 | Ga0395898_0207901 | |||
| 1140 | Ga0395898_0297896 | |||
| 1141 | Ga0395905_0001678 | |||
| 1142 | Ga0395905_0003679 | |||
| 1143 | Ga0395905_0017681 | |||
| 1144 | Ga0395905_0023137 | |||
| 1145 | Ga0395905_0025798 | |||
| 1146 | Ga0395905_0044914 | |||
| 1147 | Ga0395905_0082461 | |||
| 1148 | Ga0395905_0446934 | |||
| 1149 | Ga0395901_0003395 | |||
| 1150 | Ga0395901_0033804 | |||
| 1151 | Ga0395901_0035303 | |||
| 1152 | Ga0395901_0035657 | |||
| 1153 | Ga0395901_0037863 | |||
| 1154 | Ga0395901_0041723 | |||
| 1155 | Ga0395901_0048492 | |||
| 1156 | Ga0395901_0061909 | |||
| 1157 | Ga0395901_0063486 | |||
| 1158 | Ga0395901_0066493 | |||
| 1159 | Ga0395901_0085674 | |||
| 1160 | Ga0395901_0137904 | |||
| 1161 | Ga0395901_0193881 | |||
| 1162 | Ga0395901_0219499 | |||
| 1163 | Ga0395901_0304758 | |||
| 1164 | Ga0395901_0548847 | |||
| 1165 | Ga0237819_00061 | |||
| 1166 | Ga0400484_03784 | |||
| 1167 | Ga0400489_65446 | |||
| 1168 | Ga0237816_00232 | |||
| 1169 | Ga0439436_0004143 | |||
| 1170 | Ga0439436_0010636 | |||
| 1171 | Ga0439436_0012266 | |||
| 1172 | Ga0439447_002627 | |||
| 1173 | Ga0439465_0000127 | |||
| 1174 | Ga0439465_0001965 | |||
| 1175 | Ga0439465_0005093 | |||
| 1176 | Ga0451797_0221659 | |||
| 1177 | Ga0439432_015932 | |||
| 1178 | Ga0439449_0004920 | |||
| 1179 | Ga0439449_0018047 | |||
| 1180 | Ga0439449_0019299 | |||
| 1181 | Ga0439449_0024803 | |||
| 1182 | Ga0439449_0039458 | |||
| 1183 | Ga0450911_001216 | |||
| 1184 | Ga0451577_0029445 | |||
| 1185 | Ga0466969_0014427 | |||
| 1186 | Ga0466972_0011785 | |||
| 1187 | Ga0453683_0190476 | |||
| 1188 | Ga0466966_0028489 | |||
| 1189 | Ga0466961_0004981 | |||
| 1190 | Ga0466961_0008653 | |||
| 1191 | Ga0466961_0037271 | |||
| 1192 | Ga0466963_0004507 | |||
| 1193 | Ga0466963_0017812 | |||
| 1194 | Ga0466963_0020278 | |||
| 1195 | Ga0466963_0030453 | |||
| 1196 | Ga0466963_0058030 | |||
| 1197 | Ga0466963_0136879 | |||
| 1198 | Ga0466964_0098914 | |||
| 1199 | Ga0453684_0036612 | |||
| 1200 | Ga0466971_0008317 | |||
| 1201 | Ga0466971_0025090 | |||
| 1202 | Ga0466971_0030874 | |||
| 1203 | Ga0466957_0005089 | |||
| 1204 | Ga0466957_0115968 | |||
| 1205 | Ga0466959_0050755 | |||
| 1206 | Ga0466959_0105492 | |||
| 1207 | Ga0451576_0012693 | |||
| 1208 | Ga0466958_0037262 | |||
| 1209 | Ga0466958_0063667 | |||
| 1210 | Ga0466967_0053604 | |||
| 1211 | Ga0466967_0100175 | |||
| 1212 | Ga0466967_0305226 | |||
| 1213 | Ga0495603_0041890 | |||
| 1214 | Ga0495638_0014897 | |||
| 1215 | Ga0495638_0067672 | |||
| 1216 | Ga0495584_0113104 | |||
| 1217 | Ga0495585_0148869 | |||
| 1218 | Ga0495607_0020327 | |||
| 1219 | Ga0495610_0014871 | |||
| 1220 | Ga0495618_0028394 | |||
| 1221 | Ga0495618_0034493 | |||
| 1222 | Ga0495631_0003909 | |||
| 1223 | Ga0495643_0001494 | |||
| 1224 | Ga0495643_0072356 | |||
| 1225 | Ga0495663_0000563 | |||
| 1226 | Ga0495633_0008243 | |||
| 1227 | Ga0495633_0051720 | |||
| 1228 | Ga0495656_0010234 | |||
| 1229 | Ga0495656_0038148 | |||
| 1230 | Ga0495668_0003552 | |||
| 1231 | Ga0495625_0098783 | |||
| 1232 | Ga0495658_0211468 | |||
| 1233 | Ga0495624_0081552 | |||
| 1234 | Ga0495671_0007904 | |||
| 1235 | Ga0495636_0054559 | |||
| 1236 | Ga0495636_0078857 | |||
| 1237 | Ga0495672_0000594 | |||
| 1238 | Ga0495676_0102427 | |||
| 1239 | Ga0495676_0209623 | |||
| 1240 | Ga0495680_0153142 | |||
| 1241 | Ga0495684_0136386 | |||
| 1242 | Ga0495686_0022158 | |||
| 1243 | Ga0496100_0033464 | |||
| 1244 | Ga0496100_0113532 | |||
| 1245 | Ga0496102_0007168 | |||
| 1246 | Ga0496102_0007577 | |||
| 1247 | Ga0496102_0416014 | |||
| 1248 | Ga0496103_0008200 | |||
| 1249 | Ga0496103_0093917 | |||
| 1250 | Ga0496104_0087302 | |||
| 1251 | Ga0496105_0052365 | |||
| 1252 | Ga0496105_0056707 | |||
| 1253 | Ga0496105_0220928 | |||
| 1254 | Ga0496106_0003316 | |||
| 1255 | Ga0496106_0103323 | |||
| 1256 | Ga0496106_0201475 | |||
| 1257 | Ga0496106_0417840 | |||
| 1258 | Ga0496107_0004360 | |||
| 1259 | Ga0496107_0014375 | |||
| 1260 | Ga0496107_0027828 | |||
| 1261 | Ga0496108_0005735 | |||
| 1262 | Ga0496108_0063679 | |||
| 1263 | Ga0496108_0114985 | |||
| 1264 | Ga0496109_0015790 | |||
| 1265 | Ga0496109_0102809 | |||
| 1266 | Ga0496109_0218782 | |||
| 1267 | Ga0496110_0079573 | |||
| 1268 | Ga0496110_0101263 | |||
| 1269 | Ga0496112_0001751 | |||
| 1270 | Ga0496112_0013805 | |||
| 1271 | Ga0496112_0047465 | |||
| 1272 | Ga0496113_0076553 | |||
| 1273 | Ga0496114_0001241 | |||
| 1274 | Ga0496115_0005999 | |||
| 1275 | Ga0496115_0097841 | |||
| 1276 | Ga0496116_0026626 | |||
| 1277 | Ga0496116_0063433 | |||
| 1278 | Ga0496117_0005821 | |||
| 1279 | Ga0496117_0030989 | |||
| 1280 | Ga0496118_0001226 | |||
| 1281 | Ga0496118_0007402 | |||
| 1282 | Ga0496118_0073764 | |||
| 1283 | Ga0496119_0000303 | |||
| 1284 | Ga0496119_0001216 | |||
| 1285 | Ga0496120_0000437 | |||
| 1286 | Ga0496120_0000710 | |||
| 1287 | Ga0496121_0004776 | |||
| 1288 | Ga0496121_0026510 | |||
| 1289 | Ga0496121_0063685 | |||
| 1290 | Ga0496121_0191780 | |||
| 1291 | Ga0496122_0000379 | |||
| 1292 | Ga0496122_0000915 | |||
| 1293 | Ga0496122_0025501 | |||
| 1294 | Ga0496122_0048381 | |||
| 1295 | Ga0496123_0000313 | |||
| 1296 | Ga0496123_0000635 | |||
| 1297 | Ga0496123_0032869 | |||
| 1298 | Ga0496123_0051997 | |||
| 1299 | Ga0496124_0000115 | |||
| 1300 | Ga0496124_0000398 | |||
| 1301 | Ga0496124_0015628 | |||
| 1302 | Ga0496124_0030831 | |||
| 1303 | Ga0496124_0033677 | |||
| 1304 | Ga0496124_0113215 | |||
| 1305 | Ga0496125_0018256 | |||
| 1306 | Ga0496125_0039444 | |||
| 1307 | Ga0496125_0052087 | |||
| 1308 | Ga0496125_0065331 | |||
| 1309 | Ga0496126_0002933 | |||
| 1310 | Ga0496126_0078862 | |||
| 1311 | Ga0501031_0008297 | |||
| 1312 | Ga0501031_0009504 | |||
| 1313 | Ga0501031_0037607 | |||
| 1314 | Ga0501032_0004860 | |||
| 1315 | Ga0501032_0006583 | |||
| 1316 | Ga0501032_0023619 | |||
| 1317 | Ga0501033_0000751 | |||
| 1318 | Ga0501033_0032264 | |||
| 1319 | Ga0501033_0184119 | |||
| 1320 | Ga0501034_0000309 | |||
| 1321 | Ga0501034_0000311 | |||
| 1322 | Ga0501034_0007516 | |||
| 1323 | Ga0501034_0034158 | |||
| 1324 | Ga0501036_0004153 | |||
| 1325 | Ga0501036_0078377 | |||
| 1326 | Ga0501036_0422091 | |||
| 1327 | Ga0501037_0001504 | |||
| 1328 | Ga0501037_0032274 | |||
| 1329 | Ga0501037_0083448 | |||
| 1330 | Ga0501038_0000399 | |||
| 1331 | Ga0501038_0003005 | |||
| 1332 | Ga0501038_0027118 | |||
| 1333 | Ga0501038_0193745 | |||
| 1334 | Ga0501039_0015934 | |||
| 1335 | Ga0501039_0020428 | |||
| 1336 | Ga0501040_0000991 | |||
| 1337 | Ga0501040_0006195 | |||
| 1338 | Ga0501040_0060491 | |||
| 1339 | Ga0501040_0103026 | |||
| 1340 | Ga0501041_0000643 | |||
| 1341 | Ga0501041_0025337 | |||
| 1342 | Ga0501042_0008464 | |||
| 1343 | Ga0501042_0014784 | |||
| 1344 | Ga0501043_0018319 | |||
| 1345 | Ga0501043_0028920 | |||
| 1346 | Ga0501043_0039265 | |||
| 1347 | Ga0501043_0039441 | |||
| 1348 | Ga0501046_0005323 | |||
| 1349 | Ga0501046_0015319 | |||
| 1350 | Ga0501047_0001290 | |||
| 1351 | Ga0501047_0053749 | |||
| 1352 | Ga0501047_0089639 | |||
| 1353 | Ga0501048_0000176 | |||
| 1354 | Ga0501048_0000668 | |||
| 1355 | Ga0501048_0017781 | |||
| 1356 | Ga0501067_0017766 | |||
| 1357 | Ga0501067_0065319 | |||
| 1358 | Ga0501067_0068449 | |||
| 1359 | Ga0501068_0000266 | |||
| 1360 | Ga0501068_0063823 | |||
| 1361 | Ga0501068_0093288 | |||
| 1362 | Ga0501069_0004227 | |||
| 1363 | Ga0501069_0005669 | |||
| 1364 | Ga0501069_0006582 | |||
| 1365 | Ga0501069_0086462 | |||
| 1366 | Ga0501070_0002030 | |||
| 1367 | Ga0501070_0008772 | |||
| 1368 | Ga0501070_0042887 | |||
| 1369 | Ga0501070_0050585 | |||
| 1370 | Ga0501071_0015981 | |||
| 1371 | Ga0501071_0024158 | |||
| 1372 | Ga0501071_0297207 | |||
| 1373 | Ga0501072_0000870 | |||
| 1374 | Ga0501072_0015504 | |||
| 1375 | Ga0501073_0001604 | |||
| 1376 | Ga0501073_0001742 | |||
| 1377 | Ga0501074_0004583 | |||
| 1378 | Ga0501074_0008266 | |||
| 1379 | Ga0501074_0029258 | |||
| 1380 | Ga0501075_0000298 | |||
| 1381 | Ga0501075_0113468 | |||
| 1382 | Ga0501075_0171788 | |||
| 1383 | Ga0501076_0013602 | |||
| 1384 | Ga0501076_0102840 | |||
| 1385 | Ga0501076_0143235 | |||
| 1386 | Ga0501077_0000718 | |||
| 1387 | Ga0501077_0024815 | |||
| 1388 | Ga0501202_049155 | |||
| 1389 | Ga0501079_0009091 | |||
| 1390 | Ga0501079_0062446 | |||
| 1391 | Ga0501079_0062584 | |||
| 1392 | Ga0501079_0126797 | |||
| 1393 | Ga0501080_0000450 | |||
| 1394 | Ga0501080_0007118 | |||
| 1395 | Ga0501080_0065727 | |||
| 1396 | Ga0501081_0000447 | |||
| 1397 | Ga0501081_0009614 | |||
| 1398 | Ga0501081_0052394 | |||
| 1399 | Ga0501083_0001240 | |||
| 1400 | Ga0501083_0008730 | |||
| 1401 | Ga0501083_0009464 | |||
| 1402 | Ga0501265_002107 | |||
| 1403 | Ga0501035_0005550 | |||
| 1404 | Ga0501035_0023125 | |||
| 1405 | Ga0501044_0013823 | |||
| 1406 | Ga0501044_0013996 | |||
| 1407 | Ga0501044_0018071 | |||
| 1408 | Ga0501044_0038281 | |||
| 1409 | Ga0501044_0098980 | |||
| 1410 | Ga0501044_0382898 | |||
| 1411 | Ga0501045_0003128 | |||
| 1412 | Ga0501045_0065941 | |||
| 1413 | Ga0501045_0128325 | |||
| 1414 | nmdc:mga00v17_20464_c1 | |||
| 1415 | nmdc:mga05p37_244362_c1 | |||
| 1416 | nmdc:mga05p37_383015_c1 | |||
| 1417 | nmdc:mga05p37_50983_c1 | |||
| 1418 | nmdc:mga05p37_65045_c1 | |||
| 1419 | nmdc:mga05p37_85673_c1 | |||
| 1420 | nmdc:mga09592_57037_c1 | |||
| 1421 | nmdc:mga0qj67_17327_c1 | |||
| 1422 | nmdc:mga0qj67_193164_c1 | |||
| 1423 | nmdc:mga0qj67_270537_c1 | |||
| 1424 | nmdc:mga06r32_160071_c1 | |||
| 1425 | nmdc:mga06r32_237806_c1 | |||
| 1426 | nmdc:mga06r32_592686_c1 | |||
| 1427 | nmdc:mga08y16_140247_c1 | |||
| 1428 | nmdc:mga08y16_177411_c1 | |||
| 1429 | nmdc:mga08y16_379430_c1 | |||
| 1430 | nmdc:mga08y16_39216_c1 | |||
| 1431 | nmdc:mga08y16_86589_c1 | |||
| 1432 | nmdc:mga0n895_37071_c1 | |||
| 1433 | nmdc:mga0n895_481381_c1 | |||
| 1434 | nmdc:mga0rr50_67012_c1 | |||
| 1435 | nmdc:mga08x19_160219_c1 | |||
| 1436 | Ga0495601_0003616 | |||
| 1437 | Ga0495601_0148344 | |||
| 1438 | Ga0495595_0028648 | |||
| 1439 | Ga0495595_0248197 | |||
| 1440 | Ga0495619_0017923 | |||
| 1441 | Ga0500634_0000369 | |||
| 1442 | Ga0501084_0008367 | |||
| 1443 | Ga0501084_0040628 | |||
| 1444 | Ga0501084_0313190 | |||
| 1445 | Ga0501082_0005344 | |||
| 1446 | Ga0501082_0008847 | |||
| 1447 | Ga0501082_0041383 | |||
| 1448 | Ga0501082_0163686 | |||
| 1449 | Ga0466962_0002540 | |||
| 1450 | Ga0466962_0005481 | |||
| 1451 | Ga0466962_0008807 | |||
| 1452 | Ga0466962_0153510 | |||
| 1453 | Ga0530510_0011891 | |||
| 1454 | Ga0530510_0013136 | |||
| 1455 | Ga0530510_0182838 | |||
| 1456 | 2525556335 | |||
| 1457 | 2547499561 | |||
| 1458 | 2572256107 | |||
| 1459 | 2578459937 | |||
| 1460 | 2630649565 | |||
| 1461 | 2643881415 | |||
| 1462 | 2643907651 | |||
| 1463 | 2643914089 | |||
| 1464 | 2643977168 | |||
| 1465 | 2644530359 | |||
| 1466 | 2644662188 | |||
| 1467 | 2644700330 | |||
| 1468 | 2747950312 | |||
| 1469 | 2748017671 | |||
| 1470 | 2765577333 | |||
| 1471 | 2816519961 | |||
| 1472 | 2842395445 | |||
| 1473 | 2842761118 | |||
| 1474 | 2842782930 | |||
| 1475 | 2852653362 | |||
| 1476 | 2857445759 | |||
| 1477 | 2874224215 | |||
| 1478 | 2884792441 | |||
| 1479 | 2895502904 | |||
| 1480 | 2895512943 | |||
| 1481 | 2895522954 | |||
| 1482 | 2895525271 | |||
| 1483 | 2896089956 | |||
| 1484 | 2919092108 | |||
| 1485 | 2919135360 | |||
| 1486 | 2919514210 | |||
| 1487 | 2919676016 | |||
| 1488 | 2923516549 | |||
| 1489 | 2928498741 | |||
| 1490 | 2931382381 | |||
| 1491 | 2937612991 | |||
| 1492 | 2939592288 | |||
| 1493 | 2939625244 | |||
| 1494 | 2939629516 | |||
| 1495 | 2941477644 | |||
| 1496 | 2941494354 | |||
| 1497 | 2961050979 | |||
| 1498 | 2961065701 | |||
| 1499 | 2974310369 | |||
| 1500 | 2977251098 | |||
| 1501 | 2984514408 | |||
| 1502 | 2987609131 | |||
| 1503 | 2995953760 | |||
| 1504 | 8003017696 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wq5-assembly1.cif.gz_A | ygjd(v85e)-yeaz heterodimer in complex with atp | 0.985 | 1 | 336 |
| 3zeu-assembly2.cif.gz_B | structure of a salmonella typhimurium ygjd-yeaz heterodimer bound to atpgammas | 0.9827 | 1 | 340 |
| 4ydu-assembly1.cif.gz_A | crystal structure of e. coli ygjd-yeaz heterodimer in complex with adp | 0.9825 | 1 | 339 |
| 4wq5-assembly1.cif.gz_A | ygjd(v85e)-yeaz heterodimer in complex with atp | 0.9821 | 1 | 336 |
| 4wq4-assembly2.cif.gz_B | e. coli ygjd(e12a)-yeaz heterodimer in complex with atp | 0.9807 | 1 | 339 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3zeuB02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.991 | 133 | 296 | 3.30.420.40 |
| af_P05852_1_106_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9876 | 1 | 110 | 3.30.420.40 |
| 3zeuB02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9791 | 133 | 296 | 3.30.420.40 |
| af_P05852_1_106_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9785 | 1 | 110 | 3.30.420.40 |
| 3zeuB01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9781 | 1 | 339 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7QVQ1-F1-model_v4 | N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) | 0.9973 | 1 | 117 |
GO:0008033
GO:0046872 GO:0061711 |
| AF-A0A836ZSF3-F1-model_v4 | N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) | 0.9963 | 1 | 241 |
GO:0002949
GO:0016746 GO:0046872 |
| AF-D0X787-F1-model_v4 | deleted | 0.9949 | 1 | 342 |
|
| AF-A0A562BN05-F1-model_v4 | tRNA N6-adenosine threonylcarbamoyltransferase (EC 2.3.1.234) (N6-L-threonylcarbamoyladenine synthase) (t(6)A synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaD) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaD) | 0.9947 | 1 | 293 |
GO:0002949
GO:0004150 GO:0005506 GO:0005737 GO:0046654 GO:0046656 GO:0061711 |
| AF-A0A1G6TZV3-F1-model_v4 | tRNA N6-adenosine threonylcarbamoyltransferase (EC 2.3.1.234) (N6-L-threonylcarbamoyladenine synthase) (t(6)A synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaD) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaD) | 0.9941 | 1 | 341 |
GO:0002949
GO:0005506 GO:0005737 GO:0061711 |