F479161

General Info

Members Datasets Scaffolds Average Seq Length
752 386 1504 332

Family's Representative Sequence

Representative Sequence 3300025292|Ga0209676_1000906|Ga0209676_100090629
Length 376
Sequence MDKLQAPNPEYGQVVCVLWDLPVPRGGDRGVIIAGMRVLGIESSCDETGVAVYDTDLAGSAALRAHAVYSQIALHAEYGGVVPELASRDHVRKLLPLVRQTLAEAGLGVGDIDGVAYTAGPGLVGALLVGAGVARSLAWALEVPAVGVHHMEGHLLAPLMEDDPPEAPFVALLVSGGHTQLVAVDAIGQYRLLGETLDDAAGEAFDKTAKMMGLPYPGGPQLARLAEQGTPGVYRFARPMTDRPGLDFSFSGLKTQVLMAWRDSDQSEQTRADIARGFEDAVVETLSIKCERALEAAGTNVIVVAGGVGANKRLRARLQQMAERLGGRACFPRPALCTDNGAMIAFAGALRLQAGQHNPPKVDVTPRWDMATLPAV

Samples

Sample ID Description Type Environment
1 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
109 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
110 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
114 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
115 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
116 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
174 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
175 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
176 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
179 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
180 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
181 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
182 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
190 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
191 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
203 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
204 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
213 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
214 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
215 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
216 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
217 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
218 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
219 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
220 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
221 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
222 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
226 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
240 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
241 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
242 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
243 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
244 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
245 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
246 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
247 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
248 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
254 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
255 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
276 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
277 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
278 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
279 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
312 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
318 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
321 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
329 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
332 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
333 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
334 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
337 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
338 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
339 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
340 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
341 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
342 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
343 2643221573 Lysobacter sp. Root604 Isolate Unclassified
344 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
345 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
346 2643221593 Lysobacter sp. Root690 Isolate Unclassified
347 2643221695 Lysobacter sp. Root494 Isolate Unclassified
348 2643221720 Lysobacter sp. Root916 Isolate Unclassified
349 2643221728 Lysobacter sp. Root983 Isolate Unclassified
350 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
351 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
352 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
353 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
354 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
355 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
356 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
357 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
358 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
359 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
360 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
361 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
362 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
363 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
364 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
365 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
366 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
367 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
368 2919513703 Luteimonas sp. 3794 Isolate Unclassified
369 2919675420 Luteimonas terrae 4099 Isolate Unclassified
370 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
371 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
372 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
373 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
374 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
375 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
376 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
377 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
378 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
379 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
380 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
381 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
382 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
383 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
384 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
385 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
386 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.22
Metatranscriptomes 0.27
Isolates 6.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 9.57
Nodule 0.13
Rhizoplane 4.52
Rhizosphere 76.33
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209676_1000906 3300025292 Bacteria 37292
2 SwRhRL2b_contig_24145 2162886007 Bacteria 4392
3 JGI24739J22299_10004160 3300001989 Bacteria 5537
4 JGI25152J39213_1000039 3300002773 Bacteria 89573
5 JGI25150J39212_1000422 3300002774 Bacteria 19529
6 JGI25151J46595_10000008 3300003187 Bacteria 334180
7 JGI25151J46595_10000154 3300003187 Bacteria 89582
8 JGI25151J46595_10047611 3300003187 Bacteria 1490
9 JGI25153J46596_10000120 3300003215 Bacteria 89582
10 rootH2_10050576 3300003320 Bacteria 5405
11 JGI25160J50197_1006305 3300003354 Bacteria 4817
12 JGI25407J50210_10045132 3300003373 Bacteria 1124
13 Ga0055526_1000015 3300003771 Bacteria 226543
14 Ga0055526_1011436 3300003771 Bacteria 3996
15 Ga0055526_1011939 3300003771 Bacteria 3849
16 Ga0055537_1000132 3300003773 Bacteria 56953
17 Ga0055537_1000177 3300003773 Bacteria 47558
18 Ga0055524_1000132 3300003775 Bacteria 87907
19 Ga0055536_1000626 3300003781 Bacteria 24000
20 Ga0055536_1002286 3300003781 Bacteria 10882
21 Ga0055536_1007175 3300003781 Bacteria 5037
22 Ga0055534_1000055 3300003784 Bacteria 88009
23 Ga0055534_1000706 3300003784 Bacteria 16374
24 Ga0055534_1000870 3300003784 Bacteria 13802
25 Ga0055528_1000008 3300003790 Bacteria 226543
26 Ga0055528_1000045 3300003790 Bacteria 101917
27 Ga0055530_10002878 3300003791 Bacteria 10485
28 Ga0055531_10005845 3300003794 Bacteria 7108
29 Ga0055531_10011945 3300003794 Bacteria 4131
30 Ga0055531_10014427 3300003794 Bacteria 3556
31 Ga0058692_1000026 3300003856 Bacteria 203096
32 Ga0065704_10072580 3300005289 Bacteria 8305
33 Ga0070658_10069423 3300005327 Bacteria 2883
34 Ga0070658_10145276 3300005327 Bacteria 1983
35 Ga0070683_100060010 3300005329 Bacteria 3534
36 Ga0070683_100092653 3300005329 Bacteria 2838
37 Ga0070690_100036047 3300005330 Bacteria 3106
38 Ga0070670_100231701 3300005331 Bacteria 1607
39 Ga0070666_10257039 3300005335 Bacteria 1238
40 Ga0070680_100003170 3300005336 Bacteria 12221
41 Ga0070682_100011512 3300005337 Bacteria 5056
42 Ga0070660_100010096 3300005339 Bacteria 6662
43 Ga0070660_100170424 3300005339 Bacteria 1758
44 Ga0070668_100016107 3300005347 Bacteria 5594
45 Ga0070668_100019159 3300005347 Bacteria 5146
46 Ga0070668_100031994 3300005347 Bacteria 4003
47 Ga0070669_100049635 3300005353 Bacteria 3064
48 Ga0070674_100174385 3300005356 Bacteria 1642
49 Ga0070674_100254978 3300005356 Bacteria 1379
50 Ga0070673_100110039 3300005364 Bacteria 2283
51 Ga0070659_100001553 3300005366 Bacteria 16555
52 Ga0070659_100068955 3300005366 Bacteria 2807
53 Ga0070703_10000599 3300005406 Bacteria 12921
54 Ga0070709_10021134 3300005434 Bacteria 3788
55 Ga0070714_100062593 3300005435 Bacteria 3198
56 Ga0070713_100030412 3300005436 Bacteria 4288
57 Ga0070711_100248503 3300005439 Bacteria 1394
58 Ga0070705_100030815 3300005440 Bacteria 2964
59 Ga0070708_100002202 3300005445 Bacteria 15054
60 Ga0070708_100022520 3300005445 Bacteria 5345
61 Ga0070678_100038110 3300005456 Bacteria 3381
62 Ga0070681_10223970 3300005458 Bacteria 1796
63 Ga0068867_100193782 3300005459 Bacteria 1623
64 Ga0070706_100000503 3300005467 Bacteria 45861
65 Ga0070706_100208148 3300005467 Bacteria 1826
66 Ga0070707_100144123 3300005468 Bacteria 2318
67 Ga0070698_100022834 3300005471 Bacteria 6541
68 Ga0070698_100053404 3300005471 Bacteria 4106
69 Ga0070699_100132740 3300005518 Bacteria 2196
70 Ga0070679_100014388 3300005530 Bacteria 7599
71 Ga0070679_100098566 3300005530 Bacteria 2910
72 Ga0070684_100165652 3300005535 Bacteria 2006
73 Ga0070697_100000833 3300005536 Bacteria 23139
74 Ga0070672_100006123 3300005543 Bacteria 8051
75 Ga0070696_100045575 3300005546 Bacteria 3038
76 Ga0070693_100069355 3300005547 Bacteria 2072
77 Ga0070665_100394780 3300005548 Bacteria 1391
78 Ga0070704_100008393 3300005549 Bacteria 6193
79 Ga0068855_100002748 3300005563 Bacteria 21663
80 Ga0068855_100008913 3300005563 Bacteria 12128
81 Ga0068855_100163780 3300005563 Bacteria 2522
82 Ga0068855_100361331 3300005563 Bacteria 1597
83 Ga0070664_100170132 3300005564 Bacteria 1933
84 Ga0068857_100000234 3300005577 Bacteria 37184
85 Ga0068854_100011394 3300005578 Bacteria 5786
86 Ga0068856_100200048 3300005614 Bacteria 2012
87 Ga0068852_100002465 3300005616 Bacteria 12738
88 Ga0068861_100402577 3300005719 Bacteria 1215
89 Ga0068862_100001242 3300005844 Bacteria 24005
90 Ga0068862_100185166 3300005844 Bacteria 1871
91 Ga0081455_10005471 3300005937 Bacteria 13923
92 Ga0081455_10009400 3300005937 Bacteria 10057
93 Ga0081455_10055449 3300005937 Bacteria 3371
94 Ga0081538_10000132 3300005981 Bacteria 77110
95 Ga0081538_10000280 3300005981 Bacteria 58428
96 Ga0081538_10003124 3300005981 Bacteria 15747
97 Ga0081538_10004486 3300005981 Bacteria 12856
98 Ga0081538_10008088 3300005981 Bacteria 8979
99 Ga0081538_10015017 3300005981 Bacteria 6023
100 Ga0081538_10027674 3300005981 Bacteria 3922
101 Ga0081539_10002871 3300005985 Bacteria 22885
102 Ga0070717_10438328 3300006028 Bacteria 1176
103 Ga0075364_10000016 3300006051 Bacteria 57197
104 Ga0075432_10007403 3300006058 Bacteria 3738
105 Ga0075432_10019233 3300006058 Bacteria 2332
106 Ga0070715_10049380 3300006163 Bacteria 1802
107 Ga0075367_10156062 3300006178 Bacteria 1418
108 Ga0075369_10065216 3300006186 Bacteria 1596
109 Ga0097621_100024439 3300006237 Bacteria 4718
110 Ga0075428_100069454 3300006844 Bacteria 3851
111 Ga0075430_100045499 3300006846 Bacteria 3708
112 Ga0075431_100103054 3300006847 Bacteria 2945
113 Ga0075431_100103287 3300006847 Bacteria 2942
114 Ga0075431_100200873 3300006847 Bacteria 2039
115 Ga0075433_10051269 3300006852 Bacteria 3593
116 Ga0075434_100000846 3300006871 Bacteria 24336
117 Ga0075429_100040897 3300006880 Bacteria 4036
118 Ga0075436_100010273 3300006914 Bacteria 6410
119 Ga0099794_10009725 3300007265 Bacteria 4058
120 Ga0105251_10000135 3300009011 Bacteria 74718
121 Ga0105251_10004487 3300009011 Bacteria 9472
122 Ga0105244_10024368 3300009036 Bacteria 3303
123 Ga0105240_10009127 3300009093 Bacteria 14078
124 Ga0105240_10051930 3300009093 Bacteria 5156
125 Ga0111539_10028573 3300009094 Bacteria 6802
126 Ga0111539_10057290 3300009094 Bacteria 4628
127 Ga0111539_10113234 3300009094 Bacteria 3182
128 Ga0111539_10349560 3300009094 Bacteria 1721
129 Ga0105245_10003103 3300009098 Bacteria 14866
130 Ga0105245_10173198 3300009098 Bacteria 2056
131 Ga0114129_10013338 3300009147 Bacteria 11707
132 Ga0114129_10042807 3300009147 Bacteria 6373
133 Ga0114129_10108436 3300009147 Bacteria 3833
134 Ga0114129_10239391 3300009147 Bacteria 2440
135 Ga0114129_10493503 3300009147 Bacteria 1600
136 Ga0105243_10022597 3300009148 Bacteria 4782
137 Ga0105243_10051475 3300009148 Bacteria 3257
138 Ga0105241_10162986 3300009174 Bacteria 1834
139 Ga0105242_10131717 3300009176 Bacteria 2159
140 Ga0105242_10355426 3300009176 Bacteria 1354
141 Ga0105248_10353770 3300009177 Bacteria 1654
142 Ga0105237_10029977 3300009545 Bacteria 5527
143 Ga0105237_10053657 3300009545 Bacteria 4043
144 Ga0105238_10259111 3300009551 Bacteria 1718
145 Ga0105249_10022114 3300009553 Bacteria 5696
146 Ga0105239_10045602 3300010375 Bacteria 4805
147 Ga0105239_10124122 3300010375 Bacteria 2869
148 Ga0157373_10152790 3300013100 Bacteria 1624
149 Ga0157373_10172457 3300013100 Bacteria 1522
150 Ga0157371_10001308 3300013102 Bacteria 26174
151 Ga0157371_10076836 3300013102 Bacteria 2364
152 Ga0157371_10084153 3300013102 Bacteria 2253
153 Ga0157370_10004629 3300013104 Bacteria 15729
154 Ga0157370_10022411 3300013104 Bacteria 6284
155 Ga0157370_10054285 3300013104 Bacteria 3819
156 Ga0157369_10014378 3300013105 Bacteria 8937
157 Ga0157369_10031143 3300013105 Bacteria 5878
158 Ga0157369_10037255 3300013105 Bacteria 5325
159 Ga0157369_10037763 3300013105 Bacteria 5287
160 Ga0157369_10103111 3300013105 Bacteria 3039
161 Ga0157369_10302380 3300013105 Bacteria 1664
162 Ga0157378_10027228 3300013297 Bacteria 5045
163 Ga0157372_10007977 3300013307 Bacteria 11260
164 Ga0157375_10247026 3300013308 Bacteria 1945
165 Ga0157380_10049821 3300014326 Bacteria 3305
166 Ga0157380_10074859 3300014326 Bacteria 2750
167 Ga0182008_10014732 3300014497 Bacteria 4089
168 Ga0157379_10186197 3300014968 Bacteria 1876
169 Ga0182006_1015869 3300015261 Bacteria 3220
170 Ga0182006_1058647 3300015261 Bacteria 1459
171 Ga0182007_10000025 3300015262 Bacteria 172058
172 Ga0182005_1000293 3300015265 Bacteria 31203
173 Ga0183360_10003 3300015689 Bacteria 713221
174 Ga0183361_10402 3300016635 Bacteria 1839
175 Ga0163161_10024320 3300017792 Bacteria 4279
176 Ga0206353_11046508 3300020082 Bacteria 7214
177 Ga0206353_11888363 3300020082 Bacteria 2480
178 Ga0213871_10000823 3300021441 Bacteria 4653
179 Ga0207425_1000074 3300025245 Bacteria 108738
180 Ga0207425_1005126 3300025245 Bacteria 3790
181 Ga0209129_1000150 3300025258 Bacteria 113886
182 Ga0209565_1000001 3300025263 Bacteria 2950419
183 Ga0209565_1000037 3300025263 Bacteria 289371
184 Ga0209673_1000001 3300025273 Bacteria 3176258
185 Ga0209673_1000494 3300025273 Bacteria 65078
186 Ga0209673_1007568 3300025273 Bacteria 4973
187 Ga0209130_1004530 3300025284 Bacteria 5228
188 Ga0209675_1000001 3300025291 Bacteria 2950293
189 Ga0209675_1000020 3300025291 Bacteria 335854
190 Ga0209676_1000035 3300025292 Bacteria 459284
191 Ga0209676_1000307 3300025292 Bacteria 96239
192 Ga0209676_1001357 3300025292 Bacteria 24182
193 Ga0209676_1002821 3300025292 Bacteria 11496
194 Ga0209676_1024112 3300025292 Bacteria 1978
195 Ga0209676_1027433 3300025292 Bacteria 1792
196 Ga0209676_1034159 3300025292 Bacteria 1506
197 Ga0209025_1000030 3300025294 Bacteria 441196
198 Ga0209025_1000048 3300025294 Bacteria 335574
199 Ga0209025_1001262 3300025294 Bacteria 34940
200 Ga0209564_1000001 3300025295 Bacteria 3176258
201 Ga0209564_1000993 3300025295 Bacteria 35449
202 Ga0209564_1007388 3300025295 Bacteria 5686
203 Ga0209758_1000056 3300025297 Bacteria 335574
204 Ga0209758_1006559 3300025297 Bacteria 8283
205 Ga0209050_1000429 3300025298 Bacteria 77085
206 Ga0209050_1000670 3300025298 Bacteria 51926
207 Ga0209050_1000711 3300025298 Bacteria 49107
208 Ga0209256_1000006 3300025299 Bacteria 1250310
209 Ga0209256_1003920 3300025299 Bacteria 9816
210 Ga0209256_1004659 3300025299 Bacteria 8438
211 Ga0209256_1014385 3300025299 Bacteria 2851
212 Ga0209256_1037534 3300025299 Bacteria 1261
213 Ga0209051_1001115 3300025303 Bacteria 24576
214 Ga0209051_1016812 3300025303 Bacteria 3289
215 Ga0209257_1000091 3300025304 Bacteria 270637
216 Ga0209257_1000587 3300025304 Bacteria 60909
217 Ga0209257_1001339 3300025304 Bacteria 29896
218 Ga0209257_1017145 3300025304 Bacteria 2874
219 Ga0209257_1040972 3300025304 Bacteria 1377
220 Ga0207655_1044618 3300025728 Bacteria 1861
221 Ga0207713_1000417 3300025735 Bacteria 45375
222 Ga0207713_1003755 3300025735 Bacteria 10197
223 Ga0207653_10000045 3300025885 Bacteria 94691
224 Ga0207680_10135023 3300025903 Bacteria 1630
225 Ga0207699_10133374 3300025906 Bacteria 1623
226 Ga0207705_10025354 3300025909 Bacteria 4234
227 Ga0207705_10070623 3300025909 Bacteria 2531
228 Ga0207705_10190849 3300025909 Bacteria 1549
229 Ga0207684_10000158 3300025910 Bacteria 115693
230 Ga0207684_10000652 3300025910 Bacteria 41078
231 Ga0207695_10011130 3300025913 Bacteria 10919
232 Ga0207695_10041208 3300025913 Bacteria 4943
233 Ga0207671_10017913 3300025914 Bacteria 5448
234 Ga0207693_10019987 3300025915 Bacteria 5327
235 Ga0207693_10020013 3300025915 Bacteria 5324
236 Ga0207693_10079116 3300025915 Bacteria 2572
237 Ga0207693_10219745 3300025915 Bacteria 1493
238 Ga0207657_10013269 3300025919 Bacteria 8084
239 Ga0207652_10107030 3300025921 Bacteria 2476
240 Ga0207652_10117953 3300025921 Bacteria 2358
241 Ga0207652_10275951 3300025921 Bacteria 1516
242 Ga0207646_10060964 3300025922 Bacteria 3368
243 Ga0207681_10094276 3300025923 Bacteria 2145
244 Ga0207694_10087539 3300025924 Bacteria 2454
245 Ga0207650_10001342 3300025925 Bacteria 17794
246 Ga0207650_10153484 3300025925 Bacteria 1819
247 Ga0207659_10114138 3300025926 Bacteria 2059
248 Ga0207700_10206251 3300025928 Bacteria 1659
249 Ga0207664_10234313 3300025929 Bacteria 1597
250 Ga0207664_10292684 3300025929 Bacteria 1431
251 Ga0207644_10219136 3300025931 Bacteria 1507
252 Ga0207706_10005511 3300025933 Bacteria 11800
253 Ga0207709_10002055 3300025935 Bacteria 13012
254 Ga0207709_10085344 3300025935 Bacteria 2047
255 Ga0207669_10165172 3300025937 Bacteria 1569
256 Ga0207665_10002293 3300025939 Bacteria 12916
257 Ga0207665_10013449 3300025939 Bacteria 5381
258 Ga0207691_10001588 3300025940 Bacteria 22555
259 Ga0207661_10016758 3300025944 Bacteria 5410
260 Ga0207679_10290791 3300025945 Bacteria 1405
261 Ga0207667_10000151 3300025949 Bacteria 104054
262 Ga0207667_10108167 3300025949 Bacteria 2869
263 Ga0207651_10180060 3300025960 Bacteria 1676
264 Ga0207712_10032133 3300025961 Bacteria 3541
265 Ga0207668_10012526 3300025972 Bacteria 5194
266 Ga0207668_10015590 3300025972 Bacteria 4724
267 Ga0207668_10022768 3300025972 Bacteria 4016
268 Ga0207640_10009438 3300025981 Bacteria 5465
269 Ga0207640_10170193 3300025981 Bacteria 1622
270 Ga0207677_10295046 3300026023 Bacteria 1337
271 Ga0207639_10104928 3300026041 Bacteria 2292
272 Ga0207708_10005607 3300026075 Bacteria 9263
273 Ga0207708_10277985 3300026075 Bacteria 1356
274 Ga0207648_10041415 3300026089 Bacteria 4044
275 Ga0207648_10220889 3300026089 Bacteria 1684
276 Ga0207648_10425133 3300026089 Bacteria 1207
277 Ga0207674_10002882 3300026116 Bacteria 21375
278 Ga0207683_10001345 3300026121 Bacteria 22193
279 Ga0207683_10128202 3300026121 Bacteria 2281
280 Ga0207698_10015099 3300026142 Bacteria 5162
281 Ga0209371_1000028 3300027312 Bacteria 429688
282 Ga0209983_1000837 3300027665 Bacteria 6741
283 Ga0209588_1075766 3300027671 Bacteria 1087
284 Ga0209971_1000564 3300027682 Bacteria 9701
285 Ga0209974_10022179 3300027876 Bacteria 2103
286 Ga0268266_10353744 3300028379 Bacteria 1381
287 Ga0268265_10001651 3300028380 Bacteria 18273
288 Ga0268265_10171494 3300028380 Bacteria 1855
289 Ga0265337_1026456 3300028556 Bacteria 1758
290 Ga0265319_1002310 3300028563 Bacteria 10520
291 Ga0265318_10014419 3300028577 Bacteria 3317
292 Ga0265322_10002939 3300028654 Bacteria 5192
293 Ga0265322_10007118 3300028654 Bacteria 3277
294 Ga0265338_10021437 3300028800 Bacteria 6737
295 Ga0265338_10060021 3300028800 Bacteria 3346
296 Ga0265338_10110644 3300028800 Bacteria 2213
297 Ga0268256_1000030 3300030500 Bacteria 429688
298 Ga0316177_1093440 3300030731 Bacteria 1334
299 Ga0314311_1115363 3300030733 Bacteria 5402
300 Ga0316178_1075419 3300030735 Bacteria 2059
301 Ga0265329_10046532 3300031242 Bacteria 1386
302 Ga0265331_10065095 3300031250 Bacteria 1715
303 Ga0265327_10003143 3300031251 Bacteria 16217
304 Ga0265327_10004332 3300031251 Bacteria 12650
305 Ga0265316_10142866 3300031344 Bacteria 1797
306 Ga0307513_10041457 3300031456 Bacteria 5080
307 Ga0307513_10283085 3300031456 Bacteria 1434
308 Ga0307408_100012782 3300031548 Bacteria 5567
309 Ga0307408_100038495 3300031548 Bacteria 3375
310 Ga0307408_100184660 3300031548 Bacteria 1675
311 Ga0307408_100245857 3300031548 Bacteria 1473
312 Ga0265314_10031649 3300031711 Bacteria 3901
313 Ga0265342_10030763 3300031712 Bacteria 3323
314 Ga0316576_10047922 3300031727 Unclassified 3097
315 Ga0316578_10079129 3300031728 Bacteria 1954
316 Ga0307405_10070963 3300031731 Bacteria 2240
317 Ga0307405_10081198 3300031731 Bacteria 2119
318 Ga0307413_10036531 3300031824 Bacteria 2829
319 Ga0307410_10104257 3300031852 Bacteria 2039
320 Ga0307406_10000482 3300031901 Bacteria 23030
321 Ga0307406_10074932 3300031901 Bacteria 2231
322 Ga0307406_10166811 3300031901 Bacteria 1589
323 Ga0307406_10169090 3300031901 Bacteria 1580
324 Ga0307412_10012010 3300031911 Bacteria 5032
325 Ga0307412_10018570 3300031911 Bacteria 4188
326 Ga0307409_100013950 3300031995 Bacteria 5200
327 Ga0307409_100125863 3300031995 Bacteria 2179
328 Ga0307409_100303559 3300031995 Bacteria 1486
329 Ga0307409_100403657 3300031995 Bacteria 1306
330 Ga0307416_100020402 3300032002 Bacteria 4727
331 Ga0307416_100022144 3300032002 Bacteria 4580
332 Ga0307416_100121837 3300032002 Bacteria 2326
333 Ga0307416_100170465 3300032002 Bacteria 2025
334 Ga0307416_100248631 3300032002 Bacteria 1729
335 Ga0307416_100479298 3300032002 Bacteria 1304
336 Ga0307414_10001446 3300032004 Bacteria 12337
337 Ga0307414_10003915 3300032004 Bacteria 8024
338 Ga0307414_10005234 3300032004 Bacteria 7127
339 Ga0307414_10012489 3300032004 Bacteria 5023
340 Ga0307414_10038057 3300032004 Bacteria 3226
341 Ga0307414_10075701 3300032004 Bacteria 2443
342 Ga0307414_10077994 3300032004 Bacteria 2413
343 Ga0307414_10131703 3300032004 Bacteria 1942
344 Ga0307414_10196488 3300032004 Bacteria 1637
345 Ga0307411_10128860 3300032005 Bacteria 1845
346 Ga0307415_100000143 3300032126 Bacteria 31696
347 Ga0307415_100082595 3300032126 Bacteria 2299
348 Ga0307415_100147242 3300032126 Bacteria 1807
349 Ga0307415_100206173 3300032126 Bacteria 1564
350 Ga0316580_10041578 3300032139 Unclassified 1419
351 Ga0373932_0026421 3300035112 Bacteria 1579
352 Ga0373932_0045064 3300035112 Bacteria 1289
353 Ga0316574_0003146 3300035398 Bacteria 8446
354 Ga0316574_0015419 3300035398 Bacteria 4434
355 Ga0373933_0129523 3300035724 Bacteria 1586
356 Ga0373947_0063442 3300035725 Bacteria 2251
357 Ga0395899_0001867 3300037312 Bacteria 17398
358 Ga0395899_0002198 3300037312 Bacteria 15987
359 Ga0395899_0018330 3300037312 Bacteria 5321
360 Ga0395899_0021868 3300037312 Bacteria 4852
361 Ga0395899_0032819 3300037312 Bacteria 3901
362 Ga0395899_0068649 3300037312 Bacteria 2598
363 Ga0395899_0142568 3300037312 Bacteria 1704
364 Ga0395899_0199916 3300037312 Bacteria 1394
365 Ga0395900_0003030 3300037418 Bacteria 18287
366 Ga0395900_0006843 3300037418 Bacteria 11828
367 Ga0395900_0011100 3300037418 Bacteria 9207
368 Ga0395900_0026078 3300037418 Bacteria 5984
369 Ga0395900_0039484 3300037418 Bacteria 4864
370 Ga0395900_0049493 3300037418 Bacteria 4330
371 Ga0395900_0061093 3300037418 Bacteria 3875
372 Ga0395900_0065349 3300037418 Bacteria 3737
373 Ga0395900_0111714 3300037418 Bacteria 2806
374 Ga0395900_0130907 3300037418 Bacteria 2571
375 Ga0395900_0132679 3300037418 Bacteria 2552
376 Ga0395900_0207023 3300037418 Bacteria 1982
377 Ga0395898_0003844 3300037466 Bacteria 16633
378 Ga0395898_0003922 3300037466 Bacteria 16418
379 Ga0395898_0004765 3300037466 Bacteria 14766
380 Ga0395898_0022255 3300037466 Bacteria 6423
381 Ga0395898_0028222 3300037466 Bacteria 5627
382 Ga0395898_0043602 3300037466 Bacteria 4419
383 Ga0395898_0075351 3300037466 Bacteria 3259
384 Ga0395898_0102688 3300037466 Bacteria 2744
385 Ga0395898_0185109 3300037466 Bacteria 1990
386 Ga0395898_0205849 3300037466 Bacteria 1877
387 Ga0395898_0207901 3300037466 Bacteria 1868
388 Ga0395898_0297896 3300037466 Bacteria 1538
389 Ga0395905_0001678 3300037471 Bacteria 26104
390 Ga0395905_0003679 3300037471 Bacteria 16247
391 Ga0395905_0017681 3300037471 Bacteria 6768
392 Ga0395905_0023137 3300037471 Bacteria 5874
393 Ga0395905_0025798 3300037471 Bacteria 5540
394 Ga0395905_0044914 3300037471 Bacteria 4144
395 Ga0395905_0082461 3300037471 Bacteria 3013
396 Ga0395905_0446934 3300037471 Bacteria 1190
397 Ga0395901_0003395 3300038443 Bacteria 16041
398 Ga0395901_0033804 3300038443 Bacteria 5279
399 Ga0395901_0035303 3300038443 Bacteria 5165
400 Ga0395901_0035657 3300038443 Bacteria 5140
401 Ga0395901_0037863 3300038443 Bacteria 4987
402 Ga0395901_0041723 3300038443 Bacteria 4756
403 Ga0395901_0048492 3300038443 Bacteria 4411
404 Ga0395901_0061909 3300038443 Bacteria 3894
405 Ga0395901_0063486 3300038443 Bacteria 3844
406 Ga0395901_0066493 3300038443 Bacteria 3754
407 Ga0395901_0085674 3300038443 Bacteria 3294
408 Ga0395901_0137904 3300038443 Bacteria 2564
409 Ga0395901_0193881 3300038443 Bacteria 2130
410 Ga0395901_0219499 3300038443 Bacteria 1987
411 Ga0395901_0304758 3300038443 Bacteria 1651
412 Ga0395901_0548847 3300038443 Bacteria 1171
413 Ga0237819_00061 3300038705 Bacteria 38106
414 Ga0400484_03784 3300038725 Bacteria 19256
415 Ga0400489_65446 3300039093 Bacteria 1602
416 Ga0237816_00232 3300039145 Bacteria 4657
417 Ga0439436_0004143 3300041404 Bacteria 4446
418 Ga0439436_0010636 3300041404 Bacteria 2804
419 Ga0439436_0012266 3300041404 Bacteria 2601
420 Ga0439447_002627 3300041407 Bacteria 6516
421 Ga0439465_0000127 3300041413 Bacteria 18321
422 Ga0439465_0001965 3300041413 Bacteria 6745
423 Ga0439465_0005093 3300041413 Bacteria 4216
424 Ga0451797_0221659 3300041453 Bacteria 1304
425 Ga0439432_015932 3300042006 Bacteria 2532
426 Ga0439449_0004920 3300042007 Bacteria 5144
427 Ga0439449_0018047 3300042007 Bacteria 2649
428 Ga0439449_0019299 3300042007 Bacteria 2555
429 Ga0439449_0024803 3300042007 Bacteria 2241
430 Ga0439449_0039458 3300042007 Bacteria 1755
431 Ga0450911_001216 3300042115 Bacteria 6249
432 Ga0451577_0029445 3300042876 Bacteria 4963
433 Ga0466969_0014427 3300044656 Bacteria 4155
434 Ga0466972_0011785 3300044658 Bacteria 4391
435 Ga0453683_0190476 3300044673 Bacteria 1301
436 Ga0466966_0028489 3300044684 Bacteria 3638
437 Ga0466961_0004981 3300044693 Bacteria 8354
438 Ga0466961_0008653 3300044693 Bacteria 6487
439 Ga0466961_0037271 3300044693 Bacteria 3119
440 Ga0466963_0004507 3300044694 Bacteria 8106
441 Ga0466963_0017812 3300044694 Bacteria 4432
442 Ga0466963_0020278 3300044694 Bacteria 4180
443 Ga0466963_0030453 3300044694 Bacteria 3483
444 Ga0466963_0058030 3300044694 Bacteria 2579
445 Ga0466963_0136879 3300044694 Bacteria 1695
446 Ga0466964_0098914 3300044706 Bacteria 1283
447 Ga0453684_0036612 3300044712 Bacteria 6759
448 Ga0466971_0008317 3300044719 Bacteria 4527
449 Ga0466971_0025090 3300044719 Bacteria 2662
450 Ga0466971_0030874 3300044719 Bacteria 2398
451 Ga0466957_0005089 3300044842 Bacteria 7355
452 Ga0466957_0115968 3300044842 Bacteria 1703
453 Ga0466959_0050755 3300045049 Bacteria 3044
454 Ga0466959_0105492 3300045049 Unclassified 2015
455 Ga0451576_0012693 3300045051 Bacteria 9460
456 Ga0466958_0037262 3300045836 Bacteria 2914
457 Ga0466958_0063667 3300045836 Unclassified 2249
458 Ga0466967_0053604 3300045976 Bacteria 3545
459 Ga0466967_0100175 3300045976 Bacteria 2647
460 Ga0466967_0305226 3300045976 Bacteria 1532
461 Ga0495603_0041890 3300046455 Bacteria 2738
462 Ga0495638_0014897 3300046460 Bacteria 5237
463 Ga0495638_0067672 3300046460 Bacteria 2192
464 Ga0495584_0113104 3300046491 Bacteria 1374
465 Ga0495585_0148869 3300046492 Bacteria 1222
466 Ga0495607_0020327 3300046501 Bacteria 4200
467 Ga0495610_0014871 3300046512 Bacteria 4551
468 Ga0495618_0028394 3300046514 Bacteria 3487
469 Ga0495618_0034493 3300046514 Bacteria 3173
470 Ga0495631_0003909 3300046518 Bacteria 8049
471 Ga0495643_0001494 3300046522 Bacteria 21238
472 Ga0495643_0072356 3300046522 Bacteria 1808
473 Ga0495663_0000563 3300046525 Bacteria 13078
474 Ga0495633_0008243 3300046558 Bacteria 5895
475 Ga0495633_0051720 3300046558 Bacteria 1935
476 Ga0495656_0010234 3300046615 Bacteria 3403
477 Ga0495656_0038148 3300046615 Bacteria 1988
478 Ga0495668_0003552 3300046616 Bacteria 11588
479 Ga0495625_0098783 3300046660 Bacteria 2007
480 Ga0495658_0211468 3300046683 Bacteria 1212
481 Ga0495624_0081552 3300046690 Bacteria 2003
482 Ga0495671_0007904 3300046692 Bacteria 6015
483 Ga0495636_0054559 3300047318 Bacteria 1679
484 Ga0495636_0078857 3300047318 Bacteria 1415
485 Ga0495672_0000594 3300047320 Bacteria 40835
486 Ga0495676_0102427 3300047321 Bacteria 2115
487 Ga0495676_0209623 3300047321 Bacteria 1349
488 Ga0495680_0153142 3300047322 Bacteria 1679
489 Ga0495684_0136386 3300047471 Bacteria 1841
490 Ga0495686_0022158 3300047472 Bacteria 4205
491 Ga0496100_0033464 3300048903 Bacteria 3216
492 Ga0496100_0113532 3300048903 Bacteria 1886
493 Ga0496102_0007168 3300048905 Bacteria 9518
494 Ga0496102_0007577 3300048905 Bacteria 9274
495 Ga0496102_0416014 3300048905 Bacteria 1263
496 Ga0496103_0008200 3300048906 Bacteria 6199
497 Ga0496103_0093917 3300048906 Bacteria 1895
498 Ga0496104_0087302 3300048907 Bacteria 2979
499 Ga0496105_0052365 3300048908 Bacteria 3372
500 Ga0496105_0056707 3300048908 Bacteria 3234
501 Ga0496105_0220928 3300048908 Bacteria 1542
502 Ga0496106_0003316 3300048909 Bacteria 11997
503 Ga0496106_0103323 3300048909 Bacteria 2211
504 Ga0496106_0201475 3300048909 Bacteria 1584
505 Ga0496106_0417840 3300048909 Bacteria 1078
506 Ga0496107_0004360 3300048910 Bacteria 9581
507 Ga0496107_0014375 3300048910 Bacteria 5543
508 Ga0496107_0027828 3300048910 Bacteria 4016
509 Ga0496108_0005735 3300048911 Bacteria 10053
510 Ga0496108_0063679 3300048911 Bacteria 3105
511 Ga0496108_0114985 3300048911 Bacteria 2304
512 Ga0496109_0015790 3300048912 Bacteria 6591
513 Ga0496109_0102809 3300048912 Bacteria 2652
514 Ga0496109_0218782 3300048912 Bacteria 1791
515 Ga0496110_0079573 3300048913 Bacteria 2918
516 Ga0496110_0101263 3300048913 Bacteria 2582
517 Ga0496112_0001751 3300048915 Bacteria 17014
518 Ga0496112_0013805 3300048915 Bacteria 7471
519 Ga0496112_0047465 3300048915 Bacteria 4213
520 Ga0496113_0076553 3300048916 Bacteria 2556
521 Ga0496114_0001241 3300048917 Bacteria 19288
522 Ga0496115_0005999 3300048918 Bacteria 8869
523 Ga0496115_0097841 3300048918 Bacteria 2403
524 Ga0496116_0026626 3300048919 Bacteria 4224
525 Ga0496116_0063433 3300048919 Bacteria 2381
526 Ga0496117_0005821 3300048920 Bacteria 12769
527 Ga0496117_0030989 3300048920 Bacteria 4091
528 Ga0496118_0001226 3300048921 Bacteria 39410
529 Ga0496118_0007402 3300048921 Bacteria 11647
530 Ga0496118_0073764 3300048921 Bacteria 2443
531 Ga0496119_0000303 3300048922 Bacteria 68844
532 Ga0496119_0001216 3300048922 Bacteria 32142
533 Ga0496120_0000437 3300048923 Bacteria 66014
534 Ga0496120_0000710 3300048923 Bacteria 48861
535 Ga0496121_0004776 3300048924 Bacteria 17874
536 Ga0496121_0026510 3300048924 Bacteria 5459
537 Ga0496121_0063685 3300048924 Bacteria 3010
538 Ga0496121_0191780 3300048924 Bacteria 1464
539 Ga0496122_0000379 3300048925 Bacteria 95139
540 Ga0496122_0000915 3300048925 Bacteria 54089
541 Ga0496122_0025501 3300048925 Bacteria 5132
542 Ga0496122_0048381 3300048925 Bacteria 3270
543 Ga0496123_0000313 3300048926 Bacteria 93165
544 Ga0496123_0000635 3300048926 Bacteria 58668
545 Ga0496123_0032869 3300048926 Bacteria 3745
546 Ga0496123_0051997 3300048926 Bacteria 2722
547 Ga0496124_0000115 3300048927 Bacteria 164929
548 Ga0496124_0000398 3300048927 Bacteria 79279
549 Ga0496124_0015628 3300048927 Bacteria 7265
550 Ga0496124_0030831 3300048927 Bacteria 4751
551 Ga0496124_0033677 3300048927 Bacteria 4505
552 Ga0496124_0113215 3300048927 Bacteria 2180
553 Ga0496125_0018256 3300048928 Bacteria 6666
554 Ga0496125_0039444 3300048928 Bacteria 4066
555 Ga0496125_0052087 3300048928 Bacteria 3368
556 Ga0496125_0065331 3300048928 Bacteria 2883
557 Ga0496126_0002933 3300048929 Bacteria 22177
558 Ga0496126_0078862 3300048929 Bacteria 2917
559 Ga0501031_0008297 3300049568 Bacteria 6756
560 Ga0501031_0009504 3300049568 Bacteria 6327
561 Ga0501031_0037607 3300049568 Bacteria 3158
562 Ga0501032_0004860 3300049569 Bacteria 10063
563 Ga0501032_0006583 3300049569 Bacteria 8530
564 Ga0501032_0023619 3300049569 Bacteria 4244
565 Ga0501033_0000751 3300049570 Bacteria 29835
566 Ga0501033_0032264 3300049570 Bacteria 3933
567 Ga0501033_0184119 3300049570 Bacteria 1496
568 Ga0501034_0000309 3300049571 Bacteria 86590
569 Ga0501034_0000311 3300049571 Bacteria 86241
570 Ga0501034_0007516 3300049571 Bacteria 11592
571 Ga0501034_0034158 3300049571 Bacteria 5156
572 Ga0501036_0004153 3300049572 Bacteria 11654
573 Ga0501036_0078377 3300049572 Bacteria 2794
574 Ga0501036_0422091 3300049572 Bacteria 1112
575 Ga0501037_0001504 3300049573 Bacteria 17049
576 Ga0501037_0032274 3300049573 Bacteria 3867
577 Ga0501037_0083448 3300049573 Bacteria 2315
578 Ga0501038_0000399 3300049574 Bacteria 37785
579 Ga0501038_0003005 3300049574 Bacteria 15719
580 Ga0501038_0027118 3300049574 Bacteria 5098
581 Ga0501038_0193745 3300049574 Bacteria 1634
582 Ga0501039_0015934 3300049575 Bacteria 5755
583 Ga0501039_0020428 3300049575 Bacteria 5075
584 Ga0501040_0000991 3300049576 Bacteria 17960
585 Ga0501040_0006195 3300049576 Bacteria 7756
586 Ga0501040_0060491 3300049576 Bacteria 2603
587 Ga0501040_0103026 3300049576 Bacteria 1992
588 Ga0501041_0000643 3300049577 Bacteria 18283
589 Ga0501041_0025337 3300049577 Bacteria 3564
590 Ga0501042_0008464 3300049578 Bacteria 6791
591 Ga0501042_0014784 3300049578 Bacteria 5330
592 Ga0501043_0018319 3300049579 Bacteria 5490
593 Ga0501043_0028920 3300049579 Bacteria 4350
594 Ga0501043_0039265 3300049579 Bacteria 3720
595 Ga0501043_0039441 3300049579 Bacteria 3711
596 Ga0501046_0005323 3300049580 Bacteria 11507
597 Ga0501046_0015319 3300049580 Bacteria 6447
598 Ga0501047_0001290 3300049581 Bacteria 24727
599 Ga0501047_0053749 3300049581 Bacteria 3896
600 Ga0501047_0089639 3300049581 Bacteria 2953
601 Ga0501048_0000176 3300049582 Bacteria 40373
602 Ga0501048_0000668 3300049582 Bacteria 24832
603 Ga0501048_0017781 3300049582 Bacteria 5231
604 Ga0501067_0017766 3300049583 Bacteria 3938
605 Ga0501067_0065319 3300049583 Bacteria 2014
606 Ga0501067_0068449 3300049583 Bacteria 1965
607 Ga0501068_0000266 3300049584 Bacteria 25796
608 Ga0501068_0063823 3300049584 Bacteria 2241
609 Ga0501068_0093288 3300049584 Bacteria 1859
610 Ga0501069_0004227 3300049585 Bacteria 7420
611 Ga0501069_0005669 3300049585 Bacteria 6504
612 Ga0501069_0006582 3300049585 Bacteria 6072
613 Ga0501069_0086462 3300049585 Bacteria 1770
614 Ga0501070_0002030 3300049586 Bacteria 17801
615 Ga0501070_0008772 3300049586 Bacteria 8549
616 Ga0501070_0042887 3300049586 Bacteria 3766
617 Ga0501070_0050585 3300049586 Bacteria 3449
618 Ga0501071_0015981 3300049587 Bacteria 5156
619 Ga0501071_0024158 3300049587 Bacteria 4249
620 Ga0501071_0297207 3300049587 Bacteria 1224
621 Ga0501072_0000870 3300049588 Bacteria 22145
622 Ga0501072_0015504 3300049588 Bacteria 5841
623 Ga0501073_0001604 3300049589 Bacteria 16747
624 Ga0501073_0001742 3300049589 Bacteria 16172
625 Ga0501074_0004583 3300049590 Bacteria 9900
626 Ga0501074_0008266 3300049590 Bacteria 7544
627 Ga0501074_0029258 3300049590 Bacteria 3990
628 Ga0501075_0000298 3300049591 Bacteria 27595
629 Ga0501075_0113468 3300049591 Bacteria 2060
630 Ga0501075_0171788 3300049591 Bacteria 1654
631 Ga0501076_0013602 3300049592 Bacteria 6104
632 Ga0501076_0102840 3300049592 Bacteria 2304
633 Ga0501076_0143235 3300049592 Bacteria 1942
634 Ga0501077_0000718 3300049593 Bacteria 20025
635 Ga0501077_0024815 3300049593 Bacteria 3806
636 Ga0501202_049155 3300049652 Unclassified 930
637 Ga0501079_0009091 3300049741 Bacteria 7523
638 Ga0501079_0062446 3300049741 Bacteria 2874
639 Ga0501079_0062584 3300049741 Bacteria 2870
640 Ga0501079_0126797 3300049741 Bacteria 1985
641 Ga0501080_0000450 3300049742 Bacteria 31992
642 Ga0501080_0007118 3300049742 Bacteria 10101
643 Ga0501080_0065727 3300049742 Bacteria 3373
644 Ga0501081_0000447 3300049743 Bacteria 22828
645 Ga0501081_0009614 3300049743 Bacteria 6302
646 Ga0501081_0052394 3300049743 Bacteria 2816
647 Ga0501083_0001240 3300049744 Bacteria 17307
648 Ga0501083_0008730 3300049744 Bacteria 7150
649 Ga0501083_0009464 3300049744 Bacteria 6883
650 Ga0501265_002107 3300049762 Bacteria 2269
651 Ga0501035_0005550 3300049822 Bacteria 11917
652 Ga0501035_0023125 3300049822 Bacteria 5703
653 Ga0501044_0013823 3300049823 Bacteria 8723
654 Ga0501044_0013996 3300049823 Bacteria 8666
655 Ga0501044_0018071 3300049823 Bacteria 7562
656 Ga0501044_0038281 3300049823 Bacteria 5009
657 Ga0501044_0098980 3300049823 Bacteria 2935
658 Ga0501044_0382898 3300049823 Bacteria 1321
659 Ga0501045_0003128 3300049824 Bacteria 11316
660 Ga0501045_0065941 3300049824 Bacteria 2658
661 Ga0501045_0128325 3300049824 Bacteria 1885
662 nmdc:mga00v17_20464_c1 3300050491 Bacteria 3791
663 nmdc:mga05p37_244362_c1 3300050507 Bacteria 2156
664 nmdc:mga05p37_383015_c1 3300050507 Bacteria 1647
665 nmdc:mga05p37_50983_c1 3300050507 Bacteria 5089
666 nmdc:mga05p37_65045_c1 3300050507 Bacteria 4487
667 nmdc:mga05p37_85673_c1 3300050507 Bacteria 3883
668 nmdc:mga09592_57037_c1 3300050508 Bacteria 3300
669 nmdc:mga0qj67_17327_c1 3300050509 Bacteria 2741
670 nmdc:mga0qj67_193164_c1 3300050509 Bacteria 1654
671 nmdc:mga0qj67_270537_c1 3300050509 Bacteria 1378
672 nmdc:mga06r32_160071_c1 3300050510 Bacteria 2233
673 nmdc:mga06r32_237806_c1 3300050510 Bacteria 1809
674 nmdc:mga06r32_592686_c1 3300050510 Bacteria 1080
675 nmdc:mga08y16_140247_c1 3300050511 Bacteria 2513
676 nmdc:mga08y16_177411_c1 3300050511 Bacteria 2212
677 nmdc:mga08y16_379430_c1 3300050511 Bacteria 1449
678 nmdc:mga08y16_39216_c1 3300050511 Bacteria 4970
679 nmdc:mga08y16_86589_c1 3300050511 Bacteria 3265
680 nmdc:mga0n895_37071_c1 3300050512 Bacteria 4714
681 nmdc:mga0n895_481381_c1 3300050512 Bacteria 1252
682 nmdc:mga0rr50_67012_c1 3300050513 Bacteria 2726
683 nmdc:mga08x19_160219_c1 3300050514 Bacteria 1528
684 Ga0495601_0003616 3300053077 Bacteria 8889
685 Ga0495601_0148344 3300053077 Bacteria 1531
686 Ga0495595_0028648 3300053084 Bacteria 2488
687 Ga0495595_0248197 3300053084 Bacteria 891
688 Ga0495619_0017923 3300053085 Bacteria 4489
689 Ga0500634_0000369 3300053161 Bacteria 14334
690 Ga0501084_0008367 3300054114 Bacteria 8541
691 Ga0501084_0040628 3300054114 Bacteria 3891
692 Ga0501084_0313190 3300054114 Bacteria 1325
693 Ga0501082_0005344 3300060353 Bacteria 11152
694 Ga0501082_0008847 3300060353 Bacteria 8685
695 Ga0501082_0041383 3300060353 Bacteria 3973
696 Ga0501082_0163686 3300060353 Bacteria 1933
697 Ga0466962_0002540 3300061719 Bacteria 8660
698 Ga0466962_0005481 3300061719 Bacteria 6100
699 Ga0466962_0008807 3300061719 Bacteria 4836
700 Ga0466962_0153510 3300061719 Bacteria 1117
701 Ga0530510_0011891 3300061734 Bacteria 6107
702 Ga0530510_0013136 3300061734 Bacteria 5824
703 Ga0530510_0182838 3300061734 Bacteria 1555
704 2525556335 2524614729 Bacteria 3091755
705 2547499561 2547132130 Bacteria 4660562
706 2572256107 2571042365 Bacteria 3289345
707 2578459937 2576861471 Bacteria 4648976
708 2630649565 2627854209 Bacteria 3093011
709 2643881415 2643221573 Bacteria 4784121
710 2643907651 2643221579 Bacteria 4443405
711 2643914089 2643221581 Bacteria 3893603
712 2643977168 2643221593 Bacteria 6296053
713 2644530359 2643221695 Bacteria 3441323
714 2644662188 2643221720 Bacteria 4694283
715 2644700330 2643221728 Bacteria 4797149
716 2747950312 2747842428 Bacteria 4689383
717 2748017671 2747842501 Bacteria 5293829
718 2765577333 2765235840 Bacteria 4663337
719 2816519961 2816332141 Bacteria 4436036
720 2842395445 2842391507 Bacteria 4486072
721 2842761118 2842757796 Bacteria 3981385
722 2842782930 2842780639 Bacteria 4337790
723 2852653362 2852649853 Bacteria 4036942
724 2857445759 2857442823 Bacteria 4562550
725 2874224215 2874220319 Bacteria 4594709
726 2884792441 2884791551 Bacteria 8511252
727 2895502904 2895498888 Bacteria 5283788
728 2895512943 2895511927 Bacteria 6802080
729 2895522954 2895522137 Bacteria 3284416
730 2895525271 2895525241 Bacteria 3388457
731 2896089956 2896085136 Bacteria 6129793
732 2919092108 2919089067 Bacteria 4560942
733 2919135360 2919134579 Bacteria 4480386
734 2919514210 2919513703 Bacteria 3844312
735 2919676016 2919675420 Bacteria 3969095
736 2923516549 2923516293 Bacteria 3716336
737 2928498741 2928496128 Bacteria 4631123
738 2931382381 2931380184 Bacteria 4455911
739 2937612991 2937610967 Bacteria 4618818
740 2939592288 2939589442 Bacteria 4214238
741 2939625244 2939622612 Bacteria 4698046
742 2939629516 2939626828 Bacteria 4695272
743 2941477644 2941475908 Bacteria 4145589
744 2941494354 2941489479 Bacteria 6313767
745 2961050979 2961047084 Bacteria 4594415
746 2961065701 2961064222 Bacteria 4749990
747 2974310369 2974307012 Bacteria 4172388
748 2977251098 2977247770 Bacteria 4160543
749 2984514408 2984514374 Bacteria 4172479
750 2987609131 2987605356 Bacteria 4187822
751 2995953760 2995948881 Bacteria 6358104
752 8003017696 8003014200 Bacteria 4059994
753 Ga0209676_1000906
754 SwRhRL2b_contig_24145
755 JGI24739J22299_10004160
756 JGI25152J39213_1000039
757 JGI25150J39212_1000422
758 JGI25151J46595_10000008
759 JGI25151J46595_10000154
760 JGI25151J46595_10047611
761 JGI25153J46596_10000120
762 rootH2_10050576
763 JGI25160J50197_1006305
764 JGI25407J50210_10045132
765 Ga0055526_1000015
766 Ga0055526_1011436
767 Ga0055526_1011939
768 Ga0055537_1000132
769 Ga0055537_1000177
770 Ga0055524_1000132
771 Ga0055536_1000626
772 Ga0055536_1002286
773 Ga0055536_1007175
774 Ga0055534_1000055
775 Ga0055534_1000706
776 Ga0055534_1000870
777 Ga0055528_1000008
778 Ga0055528_1000045
779 Ga0055530_10002878
780 Ga0055531_10005845
781 Ga0055531_10011945
782 Ga0055531_10014427
783 Ga0058692_1000026
784 Ga0065704_10072580
785 Ga0070658_10069423
786 Ga0070658_10145276
787 Ga0070683_100060010
788 Ga0070683_100092653
789 Ga0070690_100036047
790 Ga0070670_100231701
791 Ga0070666_10257039
792 Ga0070680_100003170
793 Ga0070682_100011512
794 Ga0070660_100010096
795 Ga0070660_100170424
796 Ga0070668_100016107
797 Ga0070668_100019159
798 Ga0070668_100031994
799 Ga0070669_100049635
800 Ga0070674_100174385
801 Ga0070674_100254978
802 Ga0070673_100110039
803 Ga0070659_100001553
804 Ga0070659_100068955
805 Ga0070703_10000599
806 Ga0070709_10021134
807 Ga0070714_100062593
808 Ga0070713_100030412
809 Ga0070711_100248503
810 Ga0070705_100030815
811 Ga0070708_100002202
812 Ga0070708_100022520
813 Ga0070678_100038110
814 Ga0070681_10223970
815 Ga0068867_100193782
816 Ga0070706_100000503
817 Ga0070706_100208148
818 Ga0070707_100144123
819 Ga0070698_100022834
820 Ga0070698_100053404
821 Ga0070699_100132740
822 Ga0070679_100014388
823 Ga0070679_100098566
824 Ga0070684_100165652
825 Ga0070697_100000833
826 Ga0070672_100006123
827 Ga0070696_100045575
828 Ga0070693_100069355
829 Ga0070665_100394780
830 Ga0070704_100008393
831 Ga0068855_100002748
832 Ga0068855_100008913
833 Ga0068855_100163780
834 Ga0068855_100361331
835 Ga0070664_100170132
836 Ga0068857_100000234
837 Ga0068854_100011394
838 Ga0068856_100200048
839 Ga0068852_100002465
840 Ga0068861_100402577
841 Ga0068862_100001242
842 Ga0068862_100185166
843 Ga0081455_10005471
844 Ga0081455_10009400
845 Ga0081455_10055449
846 Ga0081538_10000132
847 Ga0081538_10000280
848 Ga0081538_10003124
849 Ga0081538_10004486
850 Ga0081538_10008088
851 Ga0081538_10015017
852 Ga0081538_10027674
853 Ga0081539_10002871
854 Ga0070717_10438328
855 Ga0075364_10000016
856 Ga0075432_10007403
857 Ga0075432_10019233
858 Ga0070715_10049380
859 Ga0075367_10156062
860 Ga0075369_10065216
861 Ga0097621_100024439
862 Ga0075428_100069454
863 Ga0075430_100045499
864 Ga0075431_100103054
865 Ga0075431_100103287
866 Ga0075431_100200873
867 Ga0075433_10051269
868 Ga0075434_100000846
869 Ga0075429_100040897
870 Ga0075436_100010273
871 Ga0099794_10009725
872 Ga0105251_10000135
873 Ga0105251_10004487
874 Ga0105244_10024368
875 Ga0105240_10009127
876 Ga0105240_10051930
877 Ga0111539_10028573
878 Ga0111539_10057290
879 Ga0111539_10113234
880 Ga0111539_10349560
881 Ga0105245_10003103
882 Ga0105245_10173198
883 Ga0114129_10013338
884 Ga0114129_10042807
885 Ga0114129_10108436
886 Ga0114129_10239391
887 Ga0114129_10493503
888 Ga0105243_10022597
889 Ga0105243_10051475
890 Ga0105241_10162986
891 Ga0105242_10131717
892 Ga0105242_10355426
893 Ga0105248_10353770
894 Ga0105237_10029977
895 Ga0105237_10053657
896 Ga0105238_10259111
897 Ga0105249_10022114
898 Ga0105239_10045602
899 Ga0105239_10124122
900 Ga0157373_10152790
901 Ga0157373_10172457
902 Ga0157371_10001308
903 Ga0157371_10076836
904 Ga0157371_10084153
905 Ga0157370_10004629
906 Ga0157370_10022411
907 Ga0157370_10054285
908 Ga0157369_10014378
909 Ga0157369_10031143
910 Ga0157369_10037255
911 Ga0157369_10037763
912 Ga0157369_10103111
913 Ga0157369_10302380
914 Ga0157378_10027228
915 Ga0157372_10007977
916 Ga0157375_10247026
917 Ga0157380_10049821
918 Ga0157380_10074859
919 Ga0182008_10014732
920 Ga0157379_10186197
921 Ga0182006_1015869
922 Ga0182006_1058647
923 Ga0182007_10000025
924 Ga0182005_1000293
925 Ga0183360_10003
926 Ga0183361_10402
927 Ga0163161_10024320
928 Ga0206353_11046508
929 Ga0206353_11888363
930 Ga0213871_10000823
931 Ga0207425_1000074
932 Ga0207425_1005126
933 Ga0209129_1000150
934 Ga0209565_1000001
935 Ga0209565_1000037
936 Ga0209673_1000001
937 Ga0209673_1000494
938 Ga0209673_1007568
939 Ga0209130_1004530
940 Ga0209675_1000001
941 Ga0209675_1000020
942 Ga0209676_1000035
943 Ga0209676_1000307
944 Ga0209676_1001357
945 Ga0209676_1002821
946 Ga0209676_1024112
947 Ga0209676_1027433
948 Ga0209676_1034159
949 Ga0209025_1000030
950 Ga0209025_1000048
951 Ga0209025_1001262
952 Ga0209564_1000001
953 Ga0209564_1000993
954 Ga0209564_1007388
955 Ga0209758_1000056
956 Ga0209758_1006559
957 Ga0209050_1000429
958 Ga0209050_1000670
959 Ga0209050_1000711
960 Ga0209256_1000006
961 Ga0209256_1003920
962 Ga0209256_1004659
963 Ga0209256_1014385
964 Ga0209256_1037534
965 Ga0209051_1001115
966 Ga0209051_1016812
967 Ga0209257_1000091
968 Ga0209257_1000587
969 Ga0209257_1001339
970 Ga0209257_1017145
971 Ga0209257_1040972
972 Ga0207655_1044618
973 Ga0207713_1000417
974 Ga0207713_1003755
975 Ga0207653_10000045
976 Ga0207680_10135023
977 Ga0207699_10133374
978 Ga0207705_10025354
979 Ga0207705_10070623
980 Ga0207705_10190849
981 Ga0207684_10000158
982 Ga0207684_10000652
983 Ga0207695_10011130
984 Ga0207695_10041208
985 Ga0207671_10017913
986 Ga0207693_10019987
987 Ga0207693_10020013
988 Ga0207693_10079116
989 Ga0207693_10219745
990 Ga0207657_10013269
991 Ga0207652_10107030
992 Ga0207652_10117953
993 Ga0207652_10275951
994 Ga0207646_10060964
995 Ga0207681_10094276
996 Ga0207694_10087539
997 Ga0207650_10001342
998 Ga0207650_10153484
999 Ga0207659_10114138
1000 Ga0207700_10206251
1001 Ga0207664_10234313
1002 Ga0207664_10292684
1003 Ga0207644_10219136
1004 Ga0207706_10005511
1005 Ga0207709_10002055
1006 Ga0207709_10085344
1007 Ga0207669_10165172
1008 Ga0207665_10002293
1009 Ga0207665_10013449
1010 Ga0207691_10001588
1011 Ga0207661_10016758
1012 Ga0207679_10290791
1013 Ga0207667_10000151
1014 Ga0207667_10108167
1015 Ga0207651_10180060
1016 Ga0207712_10032133
1017 Ga0207668_10012526
1018 Ga0207668_10015590
1019 Ga0207668_10022768
1020 Ga0207640_10009438
1021 Ga0207640_10170193
1022 Ga0207677_10295046
1023 Ga0207639_10104928
1024 Ga0207708_10005607
1025 Ga0207708_10277985
1026 Ga0207648_10041415
1027 Ga0207648_10220889
1028 Ga0207648_10425133
1029 Ga0207674_10002882
1030 Ga0207683_10001345
1031 Ga0207683_10128202
1032 Ga0207698_10015099
1033 Ga0209371_1000028
1034 Ga0209983_1000837
1035 Ga0209588_1075766
1036 Ga0209971_1000564
1037 Ga0209974_10022179
1038 Ga0268266_10353744
1039 Ga0268265_10001651
1040 Ga0268265_10171494
1041 Ga0265337_1026456
1042 Ga0265319_1002310
1043 Ga0265318_10014419
1044 Ga0265322_10002939
1045 Ga0265322_10007118
1046 Ga0265338_10021437
1047 Ga0265338_10060021
1048 Ga0265338_10110644
1049 Ga0268256_1000030
1050 Ga0316177_1093440
1051 Ga0314311_1115363
1052 Ga0316178_1075419
1053 Ga0265329_10046532
1054 Ga0265331_10065095
1055 Ga0265327_10003143
1056 Ga0265327_10004332
1057 Ga0265316_10142866
1058 Ga0307513_10041457
1059 Ga0307513_10283085
1060 Ga0307408_100012782
1061 Ga0307408_100038495
1062 Ga0307408_100184660
1063 Ga0307408_100245857
1064 Ga0265314_10031649
1065 Ga0265342_10030763
1066 Ga0316576_10047922
1067 Ga0316578_10079129
1068 Ga0307405_10070963
1069 Ga0307405_10081198
1070 Ga0307413_10036531
1071 Ga0307410_10104257
1072 Ga0307406_10000482
1073 Ga0307406_10074932
1074 Ga0307406_10166811
1075 Ga0307406_10169090
1076 Ga0307412_10012010
1077 Ga0307412_10018570
1078 Ga0307409_100013950
1079 Ga0307409_100125863
1080 Ga0307409_100303559
1081 Ga0307409_100403657
1082 Ga0307416_100020402
1083 Ga0307416_100022144
1084 Ga0307416_100121837
1085 Ga0307416_100170465
1086 Ga0307416_100248631
1087 Ga0307416_100479298
1088 Ga0307414_10001446
1089 Ga0307414_10003915
1090 Ga0307414_10005234
1091 Ga0307414_10012489
1092 Ga0307414_10038057
1093 Ga0307414_10075701
1094 Ga0307414_10077994
1095 Ga0307414_10131703
1096 Ga0307414_10196488
1097 Ga0307411_10128860
1098 Ga0307415_100000143
1099 Ga0307415_100082595
1100 Ga0307415_100147242
1101 Ga0307415_100206173
1102 Ga0316580_10041578
1103 Ga0373932_0026421
1104 Ga0373932_0045064
1105 Ga0316574_0003146
1106 Ga0316574_0015419
1107 Ga0373933_0129523
1108 Ga0373947_0063442
1109 Ga0395899_0001867
1110 Ga0395899_0002198
1111 Ga0395899_0018330
1112 Ga0395899_0021868
1113 Ga0395899_0032819
1114 Ga0395899_0068649
1115 Ga0395899_0142568
1116 Ga0395899_0199916
1117 Ga0395900_0003030
1118 Ga0395900_0006843
1119 Ga0395900_0011100
1120 Ga0395900_0026078
1121 Ga0395900_0039484
1122 Ga0395900_0049493
1123 Ga0395900_0061093
1124 Ga0395900_0065349
1125 Ga0395900_0111714
1126 Ga0395900_0130907
1127 Ga0395900_0132679
1128 Ga0395900_0207023
1129 Ga0395898_0003844
1130 Ga0395898_0003922
1131 Ga0395898_0004765
1132 Ga0395898_0022255
1133 Ga0395898_0028222
1134 Ga0395898_0043602
1135 Ga0395898_0075351
1136 Ga0395898_0102688
1137 Ga0395898_0185109
1138 Ga0395898_0205849
1139 Ga0395898_0207901
1140 Ga0395898_0297896
1141 Ga0395905_0001678
1142 Ga0395905_0003679
1143 Ga0395905_0017681
1144 Ga0395905_0023137
1145 Ga0395905_0025798
1146 Ga0395905_0044914
1147 Ga0395905_0082461
1148 Ga0395905_0446934
1149 Ga0395901_0003395
1150 Ga0395901_0033804
1151 Ga0395901_0035303
1152 Ga0395901_0035657
1153 Ga0395901_0037863
1154 Ga0395901_0041723
1155 Ga0395901_0048492
1156 Ga0395901_0061909
1157 Ga0395901_0063486
1158 Ga0395901_0066493
1159 Ga0395901_0085674
1160 Ga0395901_0137904
1161 Ga0395901_0193881
1162 Ga0395901_0219499
1163 Ga0395901_0304758
1164 Ga0395901_0548847
1165 Ga0237819_00061
1166 Ga0400484_03784
1167 Ga0400489_65446
1168 Ga0237816_00232
1169 Ga0439436_0004143
1170 Ga0439436_0010636
1171 Ga0439436_0012266
1172 Ga0439447_002627
1173 Ga0439465_0000127
1174 Ga0439465_0001965
1175 Ga0439465_0005093
1176 Ga0451797_0221659
1177 Ga0439432_015932
1178 Ga0439449_0004920
1179 Ga0439449_0018047
1180 Ga0439449_0019299
1181 Ga0439449_0024803
1182 Ga0439449_0039458
1183 Ga0450911_001216
1184 Ga0451577_0029445
1185 Ga0466969_0014427
1186 Ga0466972_0011785
1187 Ga0453683_0190476
1188 Ga0466966_0028489
1189 Ga0466961_0004981
1190 Ga0466961_0008653
1191 Ga0466961_0037271
1192 Ga0466963_0004507
1193 Ga0466963_0017812
1194 Ga0466963_0020278
1195 Ga0466963_0030453
1196 Ga0466963_0058030
1197 Ga0466963_0136879
1198 Ga0466964_0098914
1199 Ga0453684_0036612
1200 Ga0466971_0008317
1201 Ga0466971_0025090
1202 Ga0466971_0030874
1203 Ga0466957_0005089
1204 Ga0466957_0115968
1205 Ga0466959_0050755
1206 Ga0466959_0105492
1207 Ga0451576_0012693
1208 Ga0466958_0037262
1209 Ga0466958_0063667
1210 Ga0466967_0053604
1211 Ga0466967_0100175
1212 Ga0466967_0305226
1213 Ga0495603_0041890
1214 Ga0495638_0014897
1215 Ga0495638_0067672
1216 Ga0495584_0113104
1217 Ga0495585_0148869
1218 Ga0495607_0020327
1219 Ga0495610_0014871
1220 Ga0495618_0028394
1221 Ga0495618_0034493
1222 Ga0495631_0003909
1223 Ga0495643_0001494
1224 Ga0495643_0072356
1225 Ga0495663_0000563
1226 Ga0495633_0008243
1227 Ga0495633_0051720
1228 Ga0495656_0010234
1229 Ga0495656_0038148
1230 Ga0495668_0003552
1231 Ga0495625_0098783
1232 Ga0495658_0211468
1233 Ga0495624_0081552
1234 Ga0495671_0007904
1235 Ga0495636_0054559
1236 Ga0495636_0078857
1237 Ga0495672_0000594
1238 Ga0495676_0102427
1239 Ga0495676_0209623
1240 Ga0495680_0153142
1241 Ga0495684_0136386
1242 Ga0495686_0022158
1243 Ga0496100_0033464
1244 Ga0496100_0113532
1245 Ga0496102_0007168
1246 Ga0496102_0007577
1247 Ga0496102_0416014
1248 Ga0496103_0008200
1249 Ga0496103_0093917
1250 Ga0496104_0087302
1251 Ga0496105_0052365
1252 Ga0496105_0056707
1253 Ga0496105_0220928
1254 Ga0496106_0003316
1255 Ga0496106_0103323
1256 Ga0496106_0201475
1257 Ga0496106_0417840
1258 Ga0496107_0004360
1259 Ga0496107_0014375
1260 Ga0496107_0027828
1261 Ga0496108_0005735
1262 Ga0496108_0063679
1263 Ga0496108_0114985
1264 Ga0496109_0015790
1265 Ga0496109_0102809
1266 Ga0496109_0218782
1267 Ga0496110_0079573
1268 Ga0496110_0101263
1269 Ga0496112_0001751
1270 Ga0496112_0013805
1271 Ga0496112_0047465
1272 Ga0496113_0076553
1273 Ga0496114_0001241
1274 Ga0496115_0005999
1275 Ga0496115_0097841
1276 Ga0496116_0026626
1277 Ga0496116_0063433
1278 Ga0496117_0005821
1279 Ga0496117_0030989
1280 Ga0496118_0001226
1281 Ga0496118_0007402
1282 Ga0496118_0073764
1283 Ga0496119_0000303
1284 Ga0496119_0001216
1285 Ga0496120_0000437
1286 Ga0496120_0000710
1287 Ga0496121_0004776
1288 Ga0496121_0026510
1289 Ga0496121_0063685
1290 Ga0496121_0191780
1291 Ga0496122_0000379
1292 Ga0496122_0000915
1293 Ga0496122_0025501
1294 Ga0496122_0048381
1295 Ga0496123_0000313
1296 Ga0496123_0000635
1297 Ga0496123_0032869
1298 Ga0496123_0051997
1299 Ga0496124_0000115
1300 Ga0496124_0000398
1301 Ga0496124_0015628
1302 Ga0496124_0030831
1303 Ga0496124_0033677
1304 Ga0496124_0113215
1305 Ga0496125_0018256
1306 Ga0496125_0039444
1307 Ga0496125_0052087
1308 Ga0496125_0065331
1309 Ga0496126_0002933
1310 Ga0496126_0078862
1311 Ga0501031_0008297
1312 Ga0501031_0009504
1313 Ga0501031_0037607
1314 Ga0501032_0004860
1315 Ga0501032_0006583
1316 Ga0501032_0023619
1317 Ga0501033_0000751
1318 Ga0501033_0032264
1319 Ga0501033_0184119
1320 Ga0501034_0000309
1321 Ga0501034_0000311
1322 Ga0501034_0007516
1323 Ga0501034_0034158
1324 Ga0501036_0004153
1325 Ga0501036_0078377
1326 Ga0501036_0422091
1327 Ga0501037_0001504
1328 Ga0501037_0032274
1329 Ga0501037_0083448
1330 Ga0501038_0000399
1331 Ga0501038_0003005
1332 Ga0501038_0027118
1333 Ga0501038_0193745
1334 Ga0501039_0015934
1335 Ga0501039_0020428
1336 Ga0501040_0000991
1337 Ga0501040_0006195
1338 Ga0501040_0060491
1339 Ga0501040_0103026
1340 Ga0501041_0000643
1341 Ga0501041_0025337
1342 Ga0501042_0008464
1343 Ga0501042_0014784
1344 Ga0501043_0018319
1345 Ga0501043_0028920
1346 Ga0501043_0039265
1347 Ga0501043_0039441
1348 Ga0501046_0005323
1349 Ga0501046_0015319
1350 Ga0501047_0001290
1351 Ga0501047_0053749
1352 Ga0501047_0089639
1353 Ga0501048_0000176
1354 Ga0501048_0000668
1355 Ga0501048_0017781
1356 Ga0501067_0017766
1357 Ga0501067_0065319
1358 Ga0501067_0068449
1359 Ga0501068_0000266
1360 Ga0501068_0063823
1361 Ga0501068_0093288
1362 Ga0501069_0004227
1363 Ga0501069_0005669
1364 Ga0501069_0006582
1365 Ga0501069_0086462
1366 Ga0501070_0002030
1367 Ga0501070_0008772
1368 Ga0501070_0042887
1369 Ga0501070_0050585
1370 Ga0501071_0015981
1371 Ga0501071_0024158
1372 Ga0501071_0297207
1373 Ga0501072_0000870
1374 Ga0501072_0015504
1375 Ga0501073_0001604
1376 Ga0501073_0001742
1377 Ga0501074_0004583
1378 Ga0501074_0008266
1379 Ga0501074_0029258
1380 Ga0501075_0000298
1381 Ga0501075_0113468
1382 Ga0501075_0171788
1383 Ga0501076_0013602
1384 Ga0501076_0102840
1385 Ga0501076_0143235
1386 Ga0501077_0000718
1387 Ga0501077_0024815
1388 Ga0501202_049155
1389 Ga0501079_0009091
1390 Ga0501079_0062446
1391 Ga0501079_0062584
1392 Ga0501079_0126797
1393 Ga0501080_0000450
1394 Ga0501080_0007118
1395 Ga0501080_0065727
1396 Ga0501081_0000447
1397 Ga0501081_0009614
1398 Ga0501081_0052394
1399 Ga0501083_0001240
1400 Ga0501083_0008730
1401 Ga0501083_0009464
1402 Ga0501265_002107
1403 Ga0501035_0005550
1404 Ga0501035_0023125
1405 Ga0501044_0013823
1406 Ga0501044_0013996
1407 Ga0501044_0018071
1408 Ga0501044_0038281
1409 Ga0501044_0098980
1410 Ga0501044_0382898
1411 Ga0501045_0003128
1412 Ga0501045_0065941
1413 Ga0501045_0128325
1414 nmdc:mga00v17_20464_c1
1415 nmdc:mga05p37_244362_c1
1416 nmdc:mga05p37_383015_c1
1417 nmdc:mga05p37_50983_c1
1418 nmdc:mga05p37_65045_c1
1419 nmdc:mga05p37_85673_c1
1420 nmdc:mga09592_57037_c1
1421 nmdc:mga0qj67_17327_c1
1422 nmdc:mga0qj67_193164_c1
1423 nmdc:mga0qj67_270537_c1
1424 nmdc:mga06r32_160071_c1
1425 nmdc:mga06r32_237806_c1
1426 nmdc:mga06r32_592686_c1
1427 nmdc:mga08y16_140247_c1
1428 nmdc:mga08y16_177411_c1
1429 nmdc:mga08y16_379430_c1
1430 nmdc:mga08y16_39216_c1
1431 nmdc:mga08y16_86589_c1
1432 nmdc:mga0n895_37071_c1
1433 nmdc:mga0n895_481381_c1
1434 nmdc:mga0rr50_67012_c1
1435 nmdc:mga08x19_160219_c1
1436 Ga0495601_0003616
1437 Ga0495601_0148344
1438 Ga0495595_0028648
1439 Ga0495595_0248197
1440 Ga0495619_0017923
1441 Ga0500634_0000369
1442 Ga0501084_0008367
1443 Ga0501084_0040628
1444 Ga0501084_0313190
1445 Ga0501082_0005344
1446 Ga0501082_0008847
1447 Ga0501082_0041383
1448 Ga0501082_0163686
1449 Ga0466962_0002540
1450 Ga0466962_0005481
1451 Ga0466962_0008807
1452 Ga0466962_0153510
1453 Ga0530510_0011891
1454 Ga0530510_0013136
1455 Ga0530510_0182838
1456 2525556335
1457 2547499561
1458 2572256107
1459 2578459937
1460 2630649565
1461 2643881415
1462 2643907651
1463 2643914089
1464 2643977168
1465 2644530359
1466 2644662188
1467 2644700330
1468 2747950312
1469 2748017671
1470 2765577333
1471 2816519961
1472 2842395445
1473 2842761118
1474 2842782930
1475 2852653362
1476 2857445759
1477 2874224215
1478 2884792441
1479 2895502904
1480 2895512943
1481 2895522954
1482 2895525271
1483 2896089956
1484 2919092108
1485 2919135360
1486 2919514210
1487 2919676016
1488 2923516549
1489 2928498741
1490 2931382381
1491 2937612991
1492 2939592288
1493 2939625244
1494 2939629516
1495 2941477644
1496 2941494354
1497 2961050979
1498 2961065701
1499 2974310369
1500 2977251098
1501 2984514408
1502 2987609131
1503 2995953760
1504 8003017696

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00814

TsaD

tRNA N6-adenosine threonylcarbamoyltransferase

62

346

0.97

PF22521

HypF_C_2

Carbamoyltransferase, Kae1-like Domain, second subdomain

231

345

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wq5-assembly1.cif.gz_A ygjd(v85e)-yeaz heterodimer in complex with atp 0.985 1 336
3zeu-assembly2.cif.gz_B structure of a salmonella typhimurium ygjd-yeaz heterodimer bound to atpgammas 0.9827 1 340
4ydu-assembly1.cif.gz_A crystal structure of e. coli ygjd-yeaz heterodimer in complex with adp 0.9825 1 339
4wq5-assembly1.cif.gz_A ygjd(v85e)-yeaz heterodimer in complex with atp 0.9821 1 336
4wq4-assembly2.cif.gz_B e. coli ygjd(e12a)-yeaz heterodimer in complex with atp 0.9807 1 339
ID Description Score Start End Superfamily
3zeuB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.991 133 296 3.30.420.40
af_P05852_1_106_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9876 1 110 3.30.420.40
3zeuB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9791 133 296 3.30.420.40
af_P05852_1_106_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9785 1 110 3.30.420.40
3zeuB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9781 1 339 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A2R7QVQ1-F1-model_v4 N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) 0.9973 1 117 GO:0008033
GO:0046872
GO:0061711
AF-A0A836ZSF3-F1-model_v4 N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) 0.9963 1 241 GO:0002949
GO:0016746
GO:0046872
AF-D0X787-F1-model_v4 deleted 0.9949 1 342
AF-A0A562BN05-F1-model_v4 tRNA N6-adenosine threonylcarbamoyltransferase (EC 2.3.1.234) (N6-L-threonylcarbamoyladenine synthase) (t(6)A synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaD) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaD) 0.9947 1 293 GO:0002949
GO:0004150
GO:0005506
GO:0005737
GO:0046654
GO:0046656
GO:0061711
AF-A0A1G6TZV3-F1-model_v4 tRNA N6-adenosine threonylcarbamoyltransferase (EC 2.3.1.234) (N6-L-threonylcarbamoyladenine synthase) (t(6)A synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaD) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaD) 0.9941 1 341 GO:0002949
GO:0005506
GO:0005737
GO:0061711

Map