F478930

General Info

Members Datasets Scaffolds Average Seq Length
747 392 712 201

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0119109|Ga0496121_0119109_444_1097
Length 217
Sequence MPGAWRLSVNPVTQVSGRAYPWGAKNVDTDVIIPAHWLKTITREGLGKGAFETVRAQPGNIFDDPAYAGSPILIAGDNFGCGSSREHAAWALGDMGIVAVIAPSFSDIFSGNAFKNGIVTVVLPQEAIDRLIEVAKTDKVTIDLETMTVTTPFQDRFAFALDPFRRQCLMEGLDEIGLTLARDTAISKYESGVREHRPWMSGEQGYAGTVVEGAGRA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
4 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
5 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
6 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
7 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
8 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
9 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
10 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
11 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
12 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
13 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
14 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
15 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
16 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
17 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
18 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
19 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
20 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
21 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
22 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
23 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
24 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
25 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
26 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
27 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
28 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
29 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
30 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
31 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
32 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
33 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
34 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
35 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
36 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
39 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
40 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
41 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
42 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
43 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
44 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
45 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
46 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
47 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
48 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
49 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
50 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
51 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
52 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
53 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
54 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
55 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
56 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
57 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
58 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
65 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
66 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
67 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
70 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
71 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
72 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
73 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
76 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
77 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
78 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
79 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
80 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
81 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
82 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
83 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
84 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
85 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
86 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
124 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
136 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
139 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
142 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
150 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
210 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
211 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
212 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
213 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
214 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
234 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
235 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
236 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
237 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
238 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
239 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
240 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
241 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
242 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
243 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
244 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
245 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
246 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
247 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
248 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
249 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
250 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
251 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
252 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
253 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
254 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
257 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
258 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
259 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
263 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
264 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
265 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
266 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
267 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
268 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
269 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
270 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
271 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
272 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
273 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
274 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
275 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
276 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
277 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
278 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
279 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
280 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
281 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
282 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
283 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
284 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
287 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
288 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
291 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
292 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
293 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
294 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
295 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
307 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
310 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
311 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
312 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
317 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
318 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
319 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
320 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
321 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
337 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
338 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
339 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
340 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
341 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
342 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
343 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
344 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
345 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
346 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
347 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
348 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
349 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
350 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
351 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
352 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
353 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
354 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
358 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
359 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
360 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
361 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
362 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
363 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
364 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
365 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
366 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
367 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
368 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
369 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
370 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
371 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
372 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
373 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
374 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
375 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
376 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
377 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
378 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
379 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
380 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
381 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
382 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
383 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
384 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
385 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
386 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
387 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
388 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
389 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
390 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
391 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
392 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.05
Metatranscriptomes 0.27
Isolates 4.69

Biome Distribution

Category Percentage (%)
Aerial Root 0.67
Bulb 0
Endosphere 18.74
Nodule 0
Rhizoplane 3.61
Rhizosphere 67.74
Stem 0
Stem Tuber 0
Unclassified 9.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_209707 2162886007 Bacteria 1439
2 JGI24741J21665_1000574 3300001915 Bacteria 11196
3 JGI24741J21665_1005598 3300001915 Bacteria 2609
4 JGI24752J21851_1000644 3300001976 Bacteria 4647
5 JGI24740J21852_10011115 3300001979 Bacteria 3438
6 JGI24740J21852_10030584 3300001979 Bacteria 1749
7 JGI24739J22299_10000162 3300001989 Bacteria 21912
8 JGI24739J22299_10003471 3300001989 Bacteria 6016
9 JGI24737J22298_10001306 3300001990 Bacteria 8830
10 JGI24737J22298_10002915 3300001990 Bacteria 6064
11 JGI24737J22298_10022907 3300001990 Bacteria 1983
12 JGI24735J21928_10002382 3300002067 Bacteria 6535
13 JGI24735J21928_10014433 3300002067 Bacteria 2474
14 JGI24735J21928_10021894 3300002067 Bacteria 1949
15 JGI24738J21930_10005613 3300002075 Bacteria 2992
16 JGI24034J26672_10028667 3300002239 Bacteria 899
17 JGI25152J39213_1032197 3300002773 Bacteria 799
18 JGI25150J39212_1001984 3300002774 Bacteria 5350
19 JGI25151J46595_10033499 3300003187 Bacteria 1979
20 JGI25165J46597_1000041 3300003214 Bacteria 272566
21 JGI25153J46596_10000395 3300003215 Bacteria 29365
22 JGI25153J46596_10000654 3300003215 Bacteria 21202
23 JGI25153J46596_10027670 3300003215 Bacteria 1981
24 rootH1_10065199 3300003316 Bacteria 2950
25 rootH2_10200773 3300003320 Bacteria 2994
26 rootH1_10176977 3300003323 Bacteria 1033
27 Ga0055525_1000186 3300003759 Bacteria 75686
28 Ga0055542_1000025 3300003762 Bacteria 263538
29 Ga0055542_1004375 3300003762 Bacteria 3452
30 Ga0055529_1000014 3300003763 Bacteria 367283
31 Ga0055526_1007921 3300003771 Bacteria 5406
32 Ga0055537_1001019 3300003773 Bacteria 12668
33 Ga0055537_1003939 3300003773 Bacteria 4403
34 Ga0055524_1000539 3300003775 Bacteria 28724
35 Ga0055536_1002308 3300003781 Bacteria 10806
36 Ga0055536_1004688 3300003781 Bacteria 6890
37 Ga0055536_1006328 3300003781 Bacteria 5558
38 Ga0055536_1020724 3300003781 Bacteria 2018
39 Ga0055528_1024486 3300003790 Bacteria 1807
40 Ga0055530_10000012 3300003791 Bacteria 164829
41 Ga0055530_10007314 3300003791 Bacteria 4682
42 Ga0055540_1002064 3300003792 Bacteria 11085
43 Ga0055531_10000466 3300003794 Bacteria 37479
44 Ga0055531_10006558 3300003794 Bacteria 6578
45 Ga0055543_1015053 3300004625 Bacteria 1495
46 Ga0065165_1003679 3300005262 Bacteria 10426
47 Ga0065165_1018346 3300005262 Bacteria 2535
48 Ga0065165_1018890 3300005262 Bacteria 2480
49 Ga0065165_1029939 3300005262 Bacteria 1737
50 Ga0065165_1052550 3300005262 Bacteria 1150
51 Ga0065165_1053763 3300005262 Bacteria 1132
52 Ga0065704_10102737 3300005289 Bacteria 2192
53 Ga0065704_10124492 3300005289 Bacteria 1717
54 Ga0065707_10000505 3300005295 Bacteria 50569
55 Ga0065707_10098261 3300005295 Bacteria 3099
56 Ga0070658_10002160 3300005327 Bacteria 16501
57 Ga0070658_10003033 3300005327 Bacteria 13895
58 Ga0070676_10202206 3300005328 Bacteria 1303
59 Ga0070670_100000021 3300005331 Bacteria 202776
60 Ga0070670_100004170 3300005331 Bacteria 12090
61 Ga0070670_100130734 3300005331 Bacteria 2168
62 Ga0070666_10000184 3300005335 Bacteria 42807
63 Ga0068868_100949084 3300005338 Bacteria 784
64 Ga0070660_100000264 3300005339 Bacteria 34742
65 Ga0070660_100002081 3300005339 Bacteria 13821
66 Ga0070661_100076930 3300005344 Bacteria 2459
67 Ga0070661_100112882 3300005344 Bacteria 2030
68 Ga0070668_100068244 3300005347 Bacteria 2764
69 Ga0070668_100208292 3300005347 Bacteria 1607
70 Ga0070668_100778248 3300005347 Bacteria 849
71 Ga0070669_100000008 3300005353 Bacteria 226764
72 Ga0070669_100124866 3300005353 Bacteria 1968
73 Ga0070671_100000015 3300005355 Bacteria 166132
74 Ga0070671_100027553 3300005355 Bacteria 4677
75 Ga0070674_100013554 3300005356 Bacteria 5043
76 Ga0070673_100508085 3300005364 Bacteria 1091
77 Ga0070673_101031205 3300005364 Bacteria 767
78 Ga0070659_100306021 3300005366 Bacteria 1326
79 Ga0070667_100000089 3300005367 Bacteria 113661
80 Ga0070667_100000642 3300005367 Bacteria 33958
81 Ga0070711_100090920 3300005439 Bacteria 2199
82 Ga0070708_100148074 3300005445 Bacteria 2182
83 Ga0070708_100658238 3300005445 Bacteria 987
84 Ga0070663_100001723 3300005455 Bacteria 12131
85 Ga0070678_100001546 3300005456 Bacteria 12294
86 Ga0070662_100024637 3300005457 Bacteria 4148
87 Ga0070662_100112452 3300005457 Bacteria 2076
88 Ga0070662_100326198 3300005457 Bacteria 1253
89 Ga0068867_100138893 3300005459 Bacteria 1897
90 Ga0070685_10103920 3300005466 Bacteria 1739
91 Ga0068853_100003716 3300005539 Bacteria 11716
92 Ga0068853_100014059 3300005539 Bacteria 6551
93 Ga0068853_100029990 3300005539 Bacteria 4591
94 Ga0068853_100142612 3300005539 Bacteria 2151
95 Ga0068853_100692327 3300005539 Bacteria 972
96 Ga0070672_100099057 3300005543 Bacteria 2362
97 Ga0070686_100207507 3300005544 Bacteria 1408
98 Ga0070665_100000323 3300005548 Bacteria 73605
99 Ga0070665_100001470 3300005548 Bacteria 27596
100 Ga0070665_100632641 3300005548 Bacteria 1083
101 Ga0068855_100000027 3300005563 Bacteria 173316
102 Ga0068855_100015022 3300005563 Bacteria 9326
103 Ga0068855_100217133 3300005563 Bacteria 2146
104 Ga0068855_100691743 3300005563 Bacteria 1092
105 Ga0070664_100072257 3300005564 Bacteria 2958
106 Ga0068857_100012302 3300005577 Bacteria 7445
107 Ga0068857_100059311 3300005577 Bacteria 3399
108 Ga0068857_100501888 3300005577 Bacteria 1139
109 Ga0068857_100532151 3300005577 Bacteria 1105
110 Ga0068854_100000274 3300005578 Bacteria 34804
111 Ga0068854_100646133 3300005578 Bacteria 908
112 Ga0068856_101251733 3300005614 Bacteria 758
113 Ga0068859_100010259 3300005617 Bacteria 9429
114 Ga0068859_100023533 3300005617 Bacteria 6181
115 Ga0068859_100034581 3300005617 Bacteria 5071
116 Ga0068859_100042554 3300005617 Bacteria 4563
117 Ga0068859_100107837 3300005617 Bacteria 2846
118 Ga0068864_100000004 3300005618 Bacteria 489341
119 Ga0068864_100004712 3300005618 Bacteria 11179
120 Ga0068864_100030140 3300005618 Bacteria 4598
121 Ga0068864_100454486 3300005618 Bacteria 1225
122 Ga0068864_100476278 3300005618 Bacteria 1198
123 Ga0068861_100000001 3300005719 Bacteria 116118
124 Ga0068861_100292112 3300005719 Bacteria 1408
125 Ga0068863_100000002 3300005841 Bacteria 489510
126 Ga0068863_100000582 3300005841 Bacteria 37202
127 Ga0068863_100084694 3300005841 Bacteria 3004
128 Ga0068863_100238697 3300005841 Bacteria 1754
129 Ga0068858_100000327 3300005842 Bacteria 50180
130 Ga0068858_100001357 3300005842 Bacteria 25195
131 Ga0068858_100010355 3300005842 Bacteria 8831
132 Ga0068860_100000148 3300005843 Bacteria 113661
133 Ga0068860_100001081 3300005843 Bacteria 30047
134 Ga0068860_100004358 3300005843 Bacteria 14457
135 Ga0068862_100000002 3300005844 Bacteria 489341
136 Ga0068862_100000169 3300005844 Bacteria 72633
137 Ga0068862_100001451 3300005844 Bacteria 21840
138 Ga0081539_10038957 3300005985 Bacteria 2810
139 Ga0075363_100140735 3300006048 Bacteria 1358
140 Ga0070712_100355960 3300006175 Bacteria 1199
141 Ga0097621_100004842 3300006237 Bacteria 9428
142 Ga0075370_10195218 3300006353 Bacteria 1193
143 Ga0075370_10201922 3300006353 Bacteria 1173
144 Ga0068871_100003701 3300006358 Bacteria 10515
145 Ga0068871_100827471 3300006358 Bacteria 855
146 Ga0075430_100011858 3300006846 Bacteria 7417
147 Ga0068865_100244901 3300006881 Bacteria 1412
148 Ga0068865_100684130 3300006881 Bacteria 875
149 Ga0097620_100010259 3300006931 Bacteria 9429
150 Ga0097620_100023532 3300006931 Bacteria 6181
151 Ga0097620_100034580 3300006931 Bacteria 5071
152 Ga0097620_100042555 3300006931 Bacteria 4563
153 Ga0097620_100107840 3300006931 Bacteria 2846
154 Ga0105251_10001284 3300009011 Bacteria 21706
155 Ga0105251_10153187 3300009011 Bacteria 1041
156 Ga0105245_10032215 3300009098 Bacteria 4641
157 Ga0105247_10001891 3300009101 Bacteria 14614
158 Ga0105247_10012595 3300009101 Bacteria 5078
159 Ga0105247_10212670 3300009101 Bacteria 1305
160 Ga0105243_10000033 3300009148 Bacteria 180464
161 Ga0105243_10109651 3300009148 Bacteria 2306
162 Ga0105241_10001031 3300009174 Bacteria 21221
163 Ga0105241_10006727 3300009174 Bacteria 8458
164 Ga0105248_10000010 3300009177 Bacteria 344314
165 Ga0105248_10001758 3300009177 Bacteria 24108
166 Ga0105248_10088281 3300009177 Bacteria 3490
167 Ga0105248_10673378 3300009177 Bacteria 1167
168 Ga0105237_10002470 3300009545 Bacteria 22937
169 Ga0105237_10115681 3300009545 Bacteria 2675
170 Ga0105237_10205975 3300009545 Bacteria 1967
171 Ga0105237_10835070 3300009545 Bacteria 928
172 Ga0105238_10019927 3300009551 Bacteria 6826
173 Ga0105238_10102613 3300009551 Bacteria 2842
174 Ga0105238_10185628 3300009551 Bacteria 2056
175 Ga0105238_11212722 3300009551 Bacteria 779
176 Ga0105249_10000041 3300009553 Bacteria 195999
177 Ga0105249_10019753 3300009553 Bacteria 6016
178 Ga0105148_100540 3300009978 Bacteria 3258
179 Ga0105239_10003505 3300010375 Bacteria 19209
180 Ga0105239_10269509 3300010375 Bacteria 1915
181 Ga0105239_11197231 3300010375 Bacteria 875
182 Ga0157317_1000660 3300012475 Bacteria 1594
183 Ga0157324_1003292 3300012506 Bacteria 1048
184 Ga0157373_10002690 3300013100 Bacteria 13470
185 Ga0157373_10390160 3300013100 Bacteria 997
186 Ga0157371_10000059 3300013102 Bacteria 170541
187 Ga0157371_10058795 3300013102 Bacteria 2727
188 Ga0157371_10257889 3300013102 Bacteria 1257
189 Ga0157369_10502317 3300013105 Bacteria 1255
190 Ga0157374_10089142 3300013296 Bacteria 2939
191 Ga0157374_10148360 3300013296 Bacteria 2279
192 Ga0157374_10280191 3300013296 Bacteria 1646
193 Ga0157378_10202437 3300013297 Bacteria 1878
194 Ga0157378_10336159 3300013297 Bacteria 1471
195 Ga0157378_10659543 3300013297 Bacteria 1063
196 Ga0163162_10013938 3300013306 Bacteria 7854
197 Ga0163162_10019579 3300013306 Bacteria 6643
198 Ga0163162_10115337 3300013306 Bacteria 2786
199 Ga0163162_10227537 3300013306 Bacteria 1995
200 Ga0163162_10739124 3300013306 Bacteria 1104
201 Ga0163162_10878521 3300013306 Bacteria 1011
202 Ga0157372_10027549 3300013307 Bacteria 6191
203 Ga0157372_10102494 3300013307 Bacteria 3269
204 Ga0157372_10127863 3300013307 Bacteria 2922
205 Ga0157372_10160826 3300013307 Bacteria 2595
206 Ga0157372_10386125 3300013307 Bacteria 1631
207 Ga0157372_11061349 3300013307 Bacteria 938
208 Ga0163163_10030114 3300014325 Bacteria 5225
209 Ga0163163_10116830 3300014325 Bacteria 2699
210 Ga0163163_10580027 3300014325 Bacteria 1184
211 Ga0157380_10001161 3300014326 Bacteria 17056
212 Ga0157380_10058444 3300014326 Bacteria 3074
213 Ga0157380_10594754 3300014326 Bacteria 1093
214 Ga0157380_10734016 3300014326 Bacteria 997
215 Ga0157379_10051644 3300014968 Bacteria 3672
216 Ga0157379_10358376 3300014968 Bacteria 1336
217 Ga0183363_1004 3300015690 Bacteria 416766
218 Ga0183361_10506 3300016635 Bacteria 1719
219 Ga0163161_10030181 3300017792 Bacteria 3856
220 Ga0163161_10973501 3300017792 Bacteria 723
221 Ga0213875_10067638 3300021388 Bacteria 1669
222 Ga0213875_10142835 3300021388 Bacteria 1121
223 Ga0209563_100145 3300025230 Bacteria 75938
224 Ga0209437_103614 3300025233 Bacteria 2776
225 Ga0207425_1000041 3300025245 Bacteria 210441
226 Ga0209677_104936 3300025253 Bacteria 3640
227 Ga0209148_1000011 3300025254 Bacteria 1196503
228 Ga0209148_1000116 3300025254 Bacteria 190078
229 Ga0209129_1004489 3300025258 Bacteria 5421
230 Ga0209233_1000104 3300025261 Bacteria 272675
231 Ga0209565_1000008 3300025263 Bacteria 774179
232 Ga0209565_1000134 3300025263 Bacteria 104013
233 Ga0209455_1000006 3300025272 Bacteria 1196503
234 Ga0209455_1011101 3300025272 Bacteria 2239
235 Ga0209673_1015848 3300025273 Bacteria 2843
236 Ga0207673_1011763 3300025290 Bacteria 1135
237 Ga0209675_1000424 3300025291 Bacteria 34090
238 Ga0209675_1009250 3300025291 Bacteria 3499
239 Ga0209676_1000081 3300025292 Bacteria 285297
240 Ga0209676_1000226 3300025292 Bacteria 124004
241 Ga0209676_1000359 3300025292 Bacteria 86410
242 Ga0209676_1003684 3300025292 Bacteria 9169
243 Ga0209676_1039810 3300025292 Bacteria 1331
244 Ga0209676_1052621 3300025292 Bacteria 1061
245 Ga0209676_1059727 3300025292 Bacteria 955
246 Ga0209025_1000068 3300025294 Bacteria 294129
247 Ga0209025_1027288 3300025294 Bacteria 2835
248 Ga0209564_1000622 3300025295 Bacteria 53970
249 Ga0209758_1000001 3300025297 Bacteria 1981790
250 Ga0209758_1000004 3300025297 Bacteria 1375322
251 Ga0209758_1012697 3300025297 Bacteria 4679
252 Ga0209050_1000001 3300025298 Bacteria 3563507
253 Ga0209050_1000067 3300025298 Bacteria 304206
254 Ga0209050_1000581 3300025298 Bacteria 59224
255 Ga0209050_1007158 3300025298 Bacteria 6354
256 Ga0209050_1066066 3300025298 Bacteria 830
257 Ga0209256_1000009 3300025299 Bacteria 922071
258 Ga0209256_1000010 3300025299 Bacteria 912110
259 Ga0209051_1000191 3300025303 Bacteria 108763
260 Ga0209257_1000392 3300025304 Bacteria 87104
261 Ga0209257_1000699 3300025304 Bacteria 51960
262 Ga0209257_1000876 3300025304 Bacteria 42634
263 Ga0209257_1002353 3300025304 Bacteria 19010
264 Ga0209257_1002961 3300025304 Bacteria 15554
265 Ga0209257_1019763 3300025304 Bacteria 2521
266 Ga0209257_1064691 3300025304 Bacteria 982
267 Ga0207697_10006525 3300025315 Bacteria 5267
268 Ga0207656_10002881 3300025321 Bacteria 5864
269 Ga0207656_10301149 3300025321 Bacteria 794
270 Ga0207713_1001586 3300025735 Bacteria 17804
271 Ga0207713_1098423 3300025735 Bacteria 1014
272 Ga0207710_10109423 3300025900 Bacteria 1311
273 Ga0207688_10056252 3300025901 Bacteria 2209
274 Ga0207680_10000186 3300025903 Bacteria 30147
275 Ga0207647_10021855 3300025904 Bacteria 4260
276 Ga0207647_10079207 3300025904 Bacteria 1973
277 Ga0207647_10220922 3300025904 Bacteria 1092
278 Ga0207685_10043304 3300025905 Bacteria 1695
279 Ga0207645_10042648 3300025907 Bacteria 2903
280 Ga0207643_10425215 3300025908 Bacteria 842
281 Ga0207705_10000203 3300025909 Bacteria 60016
282 Ga0207705_10000509 3300025909 Bacteria 33052
283 Ga0207654_10000897 3300025911 Bacteria 16495
284 Ga0207654_10031545 3300025911 Bacteria 2920
285 Ga0207695_10020907 3300025913 Bacteria 7480
286 Ga0207671_10062249 3300025914 Bacteria 2770
287 Ga0207671_10068688 3300025914 Bacteria 2641
288 Ga0207671_10073852 3300025914 Bacteria 2548
289 Ga0207663_10428104 3300025916 Bacteria 1017
290 Ga0207657_10000696 3300025919 Bacteria 35731
291 Ga0207657_10001680 3300025919 Bacteria 23869
292 Ga0207657_10203984 3300025919 Bacteria 1589
293 Ga0207649_10000319 3300025920 Bacteria 36478
294 Ga0207681_10000002 3300025923 Bacteria 985597
295 Ga0207681_10033288 3300025923 Bacteria 3378
296 Ga0207681_10094028 3300025923 Bacteria 2147
297 Ga0207694_10006961 3300025924 Bacteria 8586
298 Ga0207650_10000083 3300025925 Bacteria 127270
299 Ga0207650_10002904 3300025925 Bacteria 11832
300 Ga0207650_10049447 3300025925 Bacteria 3105
301 Ga0207650_10093528 3300025925 Bacteria 2301
302 Ga0207687_10010076 3300025927 Bacteria 6180
303 Ga0207644_10000002 3300025931 Bacteria 942221
304 Ga0207644_10198546 3300025931 Bacteria 1581
305 Ga0207690_10006519 3300025932 Bacteria 6919
306 Ga0207706_10015340 3300025933 Bacteria 6923
307 Ga0207706_10027007 3300025933 Bacteria 5135
308 Ga0207706_10269744 3300025933 Bacteria 1485
309 Ga0207709_10000059 3300025935 Bacteria 211914
310 Ga0207709_10850924 3300025935 Bacteria 739
311 Ga0207669_10000341 3300025937 Bacteria 21234
312 Ga0207691_10102784 3300025940 Bacteria 2549
313 Ga0207711_10000035 3300025941 Bacteria 177223
314 Ga0207711_10000852 3300025941 Bacteria 29486
315 Ga0207711_10114106 3300025941 Bacteria 2406
316 Ga0207711_10341418 3300025941 Bacteria 1386
317 Ga0207667_10000002 3300025949 Bacteria 895662
318 Ga0207667_10000013 3300025949 Bacteria 435875
319 Ga0207667_10016335 3300025949 Bacteria 8389
320 Ga0207667_10058314 3300025949 Bacteria 4050
321 Ga0207667_10324647 3300025949 Bacteria 1572
322 Ga0207667_10650165 3300025949 Bacteria 1060
323 Ga0207651_10087500 3300025960 Bacteria 2268
324 Ga0207712_10000174 3300025961 Bacteria 66500
325 Ga0207712_10000620 3300025961 Bacteria 28034
326 Ga0207712_10018137 3300025961 Bacteria 4580
327 Ga0207668_10005340 3300025972 Bacteria 7558
328 Ga0207668_10331967 3300025972 Bacteria 1265
329 Ga0207640_10000292 3300025981 Bacteria 33424
330 Ga0207640_10012827 3300025981 Bacteria 4787
331 Ga0207658_10000069 3300025986 Bacteria 113687
332 Ga0207658_10000388 3300025986 Bacteria 42759
333 Ga0207658_10018656 3300025986 Bacteria 4795
334 Ga0207677_10824478 3300026023 Bacteria 832
335 Ga0207703_10000244 3300026035 Bacteria 61520
336 Ga0207703_10000775 3300026035 Bacteria 31437
337 Ga0207703_10009134 3300026035 Bacteria 7806
338 Ga0207639_10010727 3300026041 Bacteria 6346
339 Ga0207639_10036303 3300026041 Bacteria 3651
340 Ga0207639_10192979 3300026041 Bacteria 1741
341 Ga0207678_10000982 3300026067 Bacteria 25980
342 Ga0207678_10004733 3300026067 Bacteria 12224
343 Ga0207702_10003062 3300026078 Bacteria 15548
344 Ga0207641_10000002 3300026088 Bacteria 981004
345 Ga0207641_10002512 3300026088 Bacteria 16895
346 Ga0207641_10003319 3300026088 Bacteria 14317
347 Ga0207641_10014410 3300026088 Bacteria 6478
348 Ga0207648_10160855 3300026089 Bacteria 1983
349 Ga0207648_10349465 3300026089 Bacteria 1333
350 Ga0207676_10000005 3300026095 Bacteria 698744
351 Ga0207676_10003426 3300026095 Bacteria 11218
352 Ga0207676_10022559 3300026095 Bacteria 4630
353 Ga0207676_10206510 3300026095 Bacteria 1739
354 Ga0207676_10617213 3300026095 Bacteria 1043
355 Ga0207674_10018179 3300026116 Bacteria 7649
356 Ga0207674_10018188 3300026116 Bacteria 7647
357 Ga0207674_10099190 3300026116 Bacteria 2895
358 Ga0207675_100000159 3300026118 Bacteria 59714
359 Ga0207675_100000358 3300026118 Bacteria 43765
360 Ga0207675_100264382 3300026118 Bacteria 1668
361 Ga0207683_10029198 3300026121 Bacteria 4774
362 Ga0207698_10011565 3300026142 Bacteria 5729
363 Ga0207698_10317899 3300026142 Bacteria 1457
364 Ga0209983_1085221 3300027665 Bacteria 710
365 Ga0268266_10000002 3300028379 Bacteria 3059047
366 Ga0268266_10000514 3300028379 Bacteria 54510
367 Ga0268266_10702837 3300028379 Bacteria 974
368 Ga0268266_10759444 3300028379 Bacteria 936
369 Ga0268266_11379268 3300028379 Bacteria 680
370 Ga0268265_10000003 3300028380 Bacteria 949201
371 Ga0268265_10000045 3300028380 Bacteria 180378
372 Ga0268265_10000285 3300028380 Bacteria 57084
373 Ga0268264_10000010 3300028381 Bacteria 596543
374 Ga0268264_10000217 3300028381 Bacteria 113674
375 Ga0307517_10024293 3300028786 Bacteria 7480
376 Ga0316177_1129737 3300030731 Bacteria 1453
377 Ga0316182_1300921 3300030745 Bacteria 797
378 Ga0265327_10194633 3300031251 Bacteria 921
379 Ga0307513_10014913 3300031456 Bacteria 9444
380 Ga0307513_10015546 3300031456 Bacteria 9224
381 Ga0307509_10534043 3300031507 Bacteria 853
382 Ga0307408_100027481 3300031548 Bacteria 3921
383 Ga0307508_10000231 3300031616 Bacteria 67806
384 Ga0307405_10015706 3300031731 Bacteria 4108
385 Ga0307405_10145502 3300031731 Bacteria 1659
386 Ga0307413_10061741 3300031824 Bacteria 2314
387 Ga0307413_10243563 3300031824 Bacteria 1329
388 Ga0307413_10548338 3300031824 Bacteria 937
389 Ga0307406_10151212 3300031901 Bacteria 1656
390 Ga0307406_10430796 3300031901 Bacteria 1053
391 Ga0307406_10507423 3300031901 Bacteria 979
392 Ga0307412_10021915 3300031911 Bacteria 3908
393 Ga0307412_10026353 3300031911 Bacteria 3612
394 Ga0307412_10035791 3300031911 Bacteria 3175
395 Ga0307412_10043907 3300031911 Bacteria 2914
396 Ga0307412_10060005 3300031911 Bacteria 2551
397 Ga0307412_10135773 3300031911 Bacteria 1794
398 Ga0307409_100244787 3300031995 Bacteria 1635
399 Ga0307409_100852810 3300031995 Bacteria 922
400 Ga0307416_100061843 3300032002 Bacteria 3058
401 Ga0307414_10000107 3300032004 Bacteria 58717
402 Ga0307414_10001551 3300032004 Bacteria 11939
403 Ga0307414_10023735 3300032004 Bacteria 3896
404 Ga0307414_10026104 3300032004 Bacteria 3754
405 Ga0307414_10033618 3300032004 Bacteria 3391
406 Ga0307414_10062779 3300032004 Bacteria 2638
407 Ga0307414_10066553 3300032004 Bacteria 2576
408 Ga0307414_10245062 3300032004 Bacteria 1486
409 Ga0307414_10254243 3300032004 Bacteria 1462
410 Ga0307414_10546128 3300032004 Bacteria 1032
411 Ga0307414_11018825 3300032004 Bacteria 762
412 Ga0307411_10049558 3300032005 Bacteria 2730
413 Ga0307411_10147845 3300032005 Bacteria 1742
414 Ga0307411_10890465 3300032005 Bacteria 790
415 Ga0307510_10013885 3300033180 Bacteria 9543
416 Ga0395900_0048519 3300037418 Bacteria 4374
417 Ga0395905_0021359 3300037471 Bacteria 6122
418 Ga0395905_0045049 3300037471 Bacteria 4138
419 Ga0395905_0427708 3300037471 Bacteria 1221
420 Ga0436364_0227850 3300037853 Bacteria 2778
421 Ga0436364_0808965 3300037853 Bacteria 903
422 Ga0436364_0927709 3300037853 Bacteria 1266
423 Ga0436364_1114714 3300037853 Bacteria 849
424 Ga0395901_0053488 3300038443 Bacteria 4195
425 Ga0395901_0691350 3300038443 Bacteria 1019
426 Ga0395901_0980778 3300038443 Bacteria 822
427 Ga0237816_01874 3300039145 Bacteria 1675
428 Ga0436365_0238917 3300039437 Bacteria 1623
429 Ga0436365_1036048 3300039437 Bacteria 794
430 Ga0436363_0009048 3300039450 Bacteria 2676
431 Ga0436363_0704191 3300039450 Bacteria 1503
432 Ga0436363_1301281 3300039450 Bacteria 2110
433 Ga0436363_1484770 3300039450 Bacteria 1052
434 Ga0439436_0009694 3300041404 Bacteria 2950
435 Ga0439439_0001779 3300041406 Bacteria 4402
436 Ga0439461_0000869 3300041410 Bacteria 4466
437 Ga0439461_0003679 3300041410 Bacteria 2530
438 Ga0439465_0004274 3300041413 Bacteria 4644
439 Ga0439465_0004757 3300041413 Bacteria 4375
440 Ga0451791_0479436 3300041451 Bacteria 1130
441 Ga0451798_0093360 3300041458 Bacteria 845
442 Ga0451800_1314371 3300041459 Bacteria 670
443 Ga0451802_0390112 3300041460 Bacteria 1047
444 Ga0451806_777577 3300041462 Bacteria 3251
445 Ga0451804_0363059 3300041463 Bacteria 1097
446 Ga0451807_0002468 3300041486 Bacteria 1889
447 Ga0451807_2054855 3300041486 Bacteria 983
448 Ga0451845_0065833 3300041501 Bacteria 1535
449 Ga0451851_0221820 3300041507 Bacteria 695
450 Ga0439431_0018958 3300041997 Bacteria 1631
451 Ga0439431_0068838 3300041997 Bacteria 940
452 Ga0439442_005410 3300042002 Bacteria 2554
453 Ga0439445_0013018 3300042004 Bacteria 2008
454 Ga0439445_0031083 3300042004 Bacteria 1386
455 Ga0439445_0088329 3300042004 Bacteria 871
456 Ga0439457_023079 3300042014 Bacteria 1377
457 Ga0439462_0005952 3300042015 Bacteria 3021
458 Ga0439462_0010494 3300042015 Bacteria 2346
459 Ga0450919_007466 3300042121 Bacteria 1278
460 Ga0450898_052521 3300042134 Bacteria 790
461 Ga0450909_035741 3300042185 Bacteria 759
462 Ga0439434_0060866 3300042435 Bacteria 1180
463 Ga0451577_0402375 3300042876 Bacteria 1243
464 Ga0466963_0046190 3300044694 Bacteria 2870
465 Ga0466971_0008470 3300044719 Bacteria 4484
466 Ga0466968_0242884 3300044735 Bacteria 853
467 Ga0466957_0779262 3300044842 Bacteria 678
468 Ga0451576_0016444 3300045051 Bacteria 8166
469 Ga0466958_0237286 3300045836 Bacteria 1165
470 Ga0495627_000156 3300046453 Bacteria 78784
471 Ga0495627_000578 3300046453 Bacteria 29484
472 Ga0495638_0000758 3300046460 Bacteria 34400
473 Ga0495638_0006069 3300046460 Bacteria 8842
474 Ga0495650_0000440 3300046471 Bacteria 66809
475 Ga0495650_0028011 3300046471 Bacteria 2594
476 Ga0495605_0144332 3300046474 Bacteria 1066
477 Ga0495585_0081724 3300046492 Bacteria 1750
478 Ga0495607_0086883 3300046501 Bacteria 1704
479 Ga0495583_0000218 3300046506 Bacteria 96349
480 Ga0495583_0000680 3300046506 Bacteria 44152
481 Ga0495583_0022715 3300046506 Bacteria 3192
482 Ga0495606_0009337 3300046507 Bacteria 8313
483 Ga0495606_0136853 3300046507 Bacteria 1450
484 Ga0495610_0000291 3300046512 Bacteria 52599
485 Ga0495610_0039771 3300046512 Bacteria 2375
486 Ga0495616_0001456 3300046513 Bacteria 16481
487 Ga0495616_0132633 3300046513 Bacteria 1140
488 Ga0495631_0122789 3300046518 Bacteria 1117
489 Ga0495637_0006994 3300046520 Bacteria 5621
490 Ga0495637_0010852 3300046520 Bacteria 4391
491 Ga0495643_0001726 3300046522 Bacteria 18888
492 Ga0495643_0002313 3300046522 Bacteria 15374
493 Ga0495643_0038480 3300046522 Bacteria 2619
494 Ga0495648_0000459 3300046524 Bacteria 44196
495 Ga0495648_0010683 3300046524 Bacteria 6974
496 Ga0495648_0042230 3300046524 Bacteria 2871
497 Ga0495663_0003362 3300046525 Bacteria 4626
498 Ga0495663_0013399 3300046525 Bacteria 2293
499 Ga0495642_0029861 3300046528 Bacteria 2179
500 Ga0495597_0020763 3300046542 Bacteria 3056
501 Ga0495622_0050440 3300046557 Bacteria 1931
502 Ga0495622_0099018 3300046557 Bacteria 1337
503 Ga0495633_0005764 3300046558 Bacteria 7484
504 Ga0495633_0013695 3300046558 Bacteria 4264
505 Ga0495633_0019840 3300046558 Bacteria 3392
506 Ga0495633_0085188 3300046558 Bacteria 1470
507 Ga0495668_0000002 3300046616 Bacteria 763179
508 Ga0495668_0000072 3300046616 Bacteria 167170
509 Ga0495668_0045706 3300046616 Bacteria 2434
510 Ga0495611_0023270 3300046648 Bacteria 2687
511 Ga0495625_0000106 3300046660 Bacteria 125985
512 Ga0495625_0000629 3300046660 Bacteria 51047
513 Ga0495625_0000853 3300046660 Bacteria 41514
514 Ga0495625_0038886 3300046660 Bacteria 3478
515 Ga0495625_0085412 3300046660 Bacteria 2190
516 Ga0495661_0152132 3300046665 Bacteria 1249
517 Ga0495661_0157288 3300046665 Bacteria 1223
518 Ga0495669_0000148 3300046684 Bacteria 44972
519 Ga0495670_0000002 3300046691 Bacteria 601814
520 Ga0495670_0010027 3300046691 Bacteria 4659
521 Ga0495670_0069982 3300046691 Bacteria 1775
522 Ga0495671_0181594 3300046692 Bacteria 1022
523 Ga0495649_0047187 3300046694 Bacteria 2343
524 Ga0495600_0021061 3300046809 Bacteria 4172
525 Ga0495660_0023772 3300046810 Bacteria 3495
526 Ga0495660_0102720 3300046810 Bacteria 1469
527 Ga0495683_0006914 3300047323 Bacteria 6164
528 Ga0495683_0148674 3300047323 Bacteria 1092
529 Ga0495687_000068 3300047443 Bacteria 161081
530 Ga0495687_000563 3300047443 Bacteria 43682
531 Ga0495677_0028714 3300047445 Bacteria 2022
532 Ga0495677_0042037 3300047445 Bacteria 1674
533 Ga0495681_0000098 3300047470 Bacteria 75809
534 Ga0495681_0009646 3300047470 Bacteria 5927
535 Ga0495681_0056479 3300047470 Bacteria 1826
536 Ga0495686_0001323 3300047472 Bacteria 27753
537 Ga0495686_0004764 3300047472 Bacteria 10977
538 Ga0495686_0008463 3300047472 Bacteria 7546
539 Ga0495686_0013552 3300047472 Bacteria 5653
540 Ga0495686_0029938 3300047472 Bacteria 3538
541 Ga0495686_0182091 3300047472 Bacteria 1217
542 Ga0495686_0229805 3300047472 Bacteria 1051
543 Ga0496101_0061617 3300048904 Bacteria 2725
544 Ga0496101_0396991 3300048904 Bacteria 1086
545 Ga0496102_0002779 3300048905 Bacteria 14916
546 Ga0496102_0090445 3300048905 Bacteria 2833
547 Ga0496103_0000173 3300048906 Bacteria 67412
548 Ga0496103_0001865 3300048906 Bacteria 13700
549 Ga0496103_0030066 3300048906 Bacteria 3304
550 Ga0496103_0127121 3300048906 Bacteria 1626
551 Ga0496104_0146972 3300048907 Bacteria 2264
552 Ga0496105_0060823 3300048908 Bacteria 3117
553 Ga0496109_0758032 3300048912 Bacteria 908
554 Ga0496110_0026296 3300048913 Bacteria 4978
555 Ga0496111_0447311 3300048914 Bacteria 953
556 Ga0496114_0061278 3300048917 Bacteria 3146
557 Ga0496115_0000269 3300048918 Bacteria 45856
558 Ga0496115_0001129 3300048918 Bacteria 19266
559 Ga0496115_0119697 3300048918 Bacteria 2166
560 Ga0496116_0000566 3300048919 Bacteria 49509
561 Ga0496116_0033048 3300048919 Bacteria 3677
562 Ga0496117_0000485 3300048920 Bacteria 65840
563 Ga0496117_0000887 3300048920 Bacteria 46091
564 Ga0496117_0018342 3300048920 Bacteria 5800
565 Ga0496118_0000190 3300048921 Bacteria 108017
566 Ga0496118_0000463 3300048921 Bacteria 67382
567 Ga0496118_0005843 3300048921 Bacteria 13797
568 Ga0496118_0109131 3300048921 Bacteria 1843
569 Ga0496119_0174429 3300048922 Bacteria 1132
570 Ga0496120_0026787 3300048923 Bacteria 3555
571 Ga0496120_0030374 3300048923 Bacteria 3286
572 Ga0496121_0000296 3300048924 Bacteria 103215
573 Ga0496121_0004850 3300048924 Bacteria 17692
574 Ga0496121_0119109 3300048924 Bacteria 1997
575 Ga0496121_0369233 3300048924 Bacteria 950
576 Ga0496123_0036015 3300048926 Bacteria 3517
577 Ga0496123_0042455 3300048926 Bacteria 3138
578 Ga0496123_0059099 3300048926 Bacteria 2482
579 Ga0496124_0000546 3300048927 Bacteria 63624
580 Ga0496124_0000874 3300048927 Bacteria 49185
581 Ga0496124_0000960 3300048927 Bacteria 45969
582 Ga0496124_0005852 3300048927 Bacteria 13640
583 Ga0496124_0048088 3300048927 Bacteria 3647
584 Ga0496124_0125342 3300048927 Bacteria 2047
585 Ga0496124_0376677 3300048927 Bacteria 994
586 Ga0496124_0401143 3300048927 Bacteria 952
587 Ga0496125_0000956 3300048928 Bacteria 45452
588 Ga0496125_0014358 3300048928 Bacteria 7717
589 Ga0496125_0199205 3300048928 Bacteria 1313
590 Ga0496126_0000321 3300048929 Bacteria 102445
591 Ga0496126_0168808 3300048929 Bacteria 1865
592 Ga0496126_0211430 3300048929 Bacteria 1633
593 Ga0496126_0584953 3300048929 Bacteria 881
594 Ga0495678_014836 3300049459 Bacteria 3610
595 Ga0501290_000237 3300049513 Bacteria 9135
596 Ga0501292_000042 3300049515 Bacteria 29474
597 Ga0501294_000032 3300049517 Bacteria 13769
598 Ga0501300_000392 3300049523 Bacteria 6689
599 Ga0501300_014450 3300049523 Bacteria 1152
600 Ga0501300_016995 3300049523 Bacteria 1062
601 Ga0501314_003132 3300049530 Bacteria 1321
602 Ga0501335_006283 3300049551 Bacteria 1079
603 Ga0501031_0099318 3300049568 Bacteria 1899
604 Ga0501032_0040021 3300049569 Bacteria 3186
605 Ga0501033_0062148 3300049570 Bacteria 2750
606 Ga0501034_0015035 3300049571 Bacteria 7959
607 Ga0501034_0107638 3300049571 Bacteria 2779
608 Ga0501034_0282848 3300049571 Bacteria 1598
609 Ga0501034_0303984 3300049571 Bacteria 1531
610 Ga0501034_0601414 3300049571 Bacteria 1005
611 Ga0501036_0016173 3300049572 Bacteria 6231
612 Ga0501037_0024382 3300049573 Bacteria 4474
613 Ga0501038_0057342 3300049574 Bacteria 3344
614 Ga0501038_0059946 3300049574 Bacteria 3258
615 Ga0501039_0229604 3300049575 Bacteria 1459
616 Ga0501039_0645776 3300049575 Bacteria 829
617 Ga0501042_0358107 3300049578 Bacteria 1056
618 Ga0501043_0041028 3300049579 Bacteria 3636
619 Ga0501046_0036602 3300049580 Bacteria 3949
620 Ga0501047_0074409 3300049581 Bacteria 3270
621 Ga0501047_0130480 3300049581 Bacteria 2394
622 Ga0501048_0196129 3300049582 Bacteria 1431
623 Ga0501069_0002703 3300049585 Bacteria 9050
624 Ga0501071_0279836 3300049587 Bacteria 1263
625 Ga0501206_003378 3300049653 Bacteria 2028
626 Ga0501211_000103 3300049658 Bacteria 6327
627 Ga0501222_001746 3300049662 Bacteria 3014
628 Ga0501222_008414 3300049662 Bacteria 1368
629 Ga0501223_000072 3300049663 Bacteria 30438
630 Ga0501224_000004 3300049664 Bacteria 169090
631 Ga0501233_001952 3300049668 Bacteria 3587
632 Ga0501233_030349 3300049668 Bacteria 1217
633 Ga0501235_001097 3300049669 Bacteria 5663
634 Ga0501257_000049 3300049686 Bacteria 33138
635 Ga0501257_174324 3300049686 Bacteria 605
636 Ga0501261_000021 3300049690 Bacteria 37511
637 Ga0501221_003846 3300049704 Bacteria 2478
638 Ga0501225_0000048 3300049705 Bacteria 40596
639 Ga0501234_004313 3300049707 Bacteria 2232
640 Ga0501279_000010 3300049775 Bacteria 103375
641 Ga0501280_000064 3300049776 Bacteria 31054
642 Ga0501281_00086 3300049777 Bacteria 10989
643 Ga0501282_000404 3300049778 Bacteria 5157
644 Ga0501282_006831 3300049778 Bacteria 1219
645 Ga0501283_001453 3300049779 Bacteria 3071
646 Ga0501035_0018213 3300049822 Bacteria 6468
647 Ga0501044_0192235 3300049823 Bacteria 2003
648 Ga0501226_000018 3300049853 Bacteria 147268
649 nmdc:mga03n38_105808_c1 3300050490 Bacteria 1363
650 nmdc:mga0k408_384420_c1 3300050493 Bacteria 836
651 nmdc:mga07m45_133583_c1 3300050496 Bacteria 1436
652 nmdc:mga0qj67_475486_c1 3300050509 Bacteria 1006
653 Ga0500610_0000607 3300053079 Bacteria 10987
654 Ga0500643_000135 3300053087 Bacteria 74911
655 Ga0500643_000195 3300053087 Bacteria 57960
656 Ga0500643_000644 3300053087 Bacteria 23511
657 Ga0500643_001242 3300053087 Bacteria 15099
658 Ga0500643_003224 3300053087 Bacteria 7943
659 Ga0500643_008402 3300053087 Bacteria 4060
660 Ga0500643_025886 3300053087 Bacteria 1844
661 Ga0500651_0103812 3300053093 Bacteria 1740
662 Ga0500566_0006685 3300053094 Bacteria 6826
663 Ga0500641_0008791 3300053096 Bacteria 3615
664 Ga0500555_000575 3300053103 Bacteria 14512
665 Ga0500562_026290 3300053108 Bacteria 1525
666 Ga0500592_000031 3300053116 Bacteria 47686
667 Ga0500592_002102 3300053116 Bacteria 3208
668 Ga0500592_002248 3300053116 Bacteria 3112
669 Ga0500594_0029115 3300053118 Bacteria 1442
670 Ga0500594_0043684 3300053118 Bacteria 1237
671 Ga0500594_0061312 3300053118 Bacteria 1085
672 Ga0500595_000572 3300053119 Bacteria 21961
673 Ga0500595_001506 3300053119 Bacteria 12379
674 Ga0500607_184075 3300053121 Bacteria 922
675 Ga0500626_146353 3300053128 Bacteria 986
676 Ga0500642_0044565 3300053130 Bacteria 1933
677 Ga0500642_0057188 3300053130 Bacteria 1740
678 Ga0500652_099335 3300053131 Bacteria 1217
679 Ga0500655_000251 3300053133 Bacteria 12576
680 Ga0500658_0001656 3300053134 Bacteria 8862
681 Ga0500658_0006467 3300053134 Bacteria 4345
682 Ga0500658_0014446 3300053134 Bacteria 2923
683 Ga0500658_0119062 3300053134 Bacteria 1169
684 Ga0500559_0003794 3300053136 Bacteria 7323
685 Ga0500559_0070195 3300053136 Bacteria 1576
686 Ga0500559_0211547 3300053136 Bacteria 914
687 Ga0500568_0002370 3300053139 Bacteria 11148
688 Ga0500568_0003157 3300053139 Bacteria 9385
689 Ga0500568_0039397 3300053139 Bacteria 1908
690 Ga0500573_0000086 3300053140 Bacteria 42361
691 Ga0500573_0228123 3300053140 Bacteria 973
692 Ga0500604_0000002 3300053151 Bacteria 165603
693 Ga0500604_0090082 3300053151 Bacteria 1001
694 Ga0500616_0000238 3300053153 Bacteria 86573
695 Ga0500616_0008241 3300053153 Bacteria 6496
696 Ga0500616_0033520 3300053153 Bacteria 2802
697 Ga0500619_000184 3300053154 Bacteria 14772
698 Ga0500619_018582 3300053154 Bacteria 1955
699 Ga0500622_0253895 3300053156 Bacteria 770
700 Ga0500624_000063 3300053157 Bacteria 65333
701 Ga0500627_0000017 3300053158 Bacteria 119507
702 Ga0500627_0001223 3300053158 Bacteria 7068
703 Ga0500627_0027041 3300053158 Bacteria 2372
704 Ga0500627_0057381 3300053158 Bacteria 1708
705 Ga0500636_0027233 3300053177 Bacteria 3376
706 Ga0500636_0058873 3300053177 Bacteria 2245
707 Ga0500645_000002 3300053730 Bacteria 388892
708 Ga0500645_001488 3300053730 Bacteria 11755
709 Ga0500645_026811 3300053730 Bacteria 1751
710 Ga0500596_002198 3300053735 Bacteria 3867
711 Ga0500661_000092 3300055283 Bacteria 14368
712 Ga0466962_0013156 3300061719 Bacteria 3980

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2958512119 2958512766 181
2 3300005548 Ga0070665_100001470 Ga0070665_10000147021 187
3 3300028379 Ga0268266_10000514 Ga0268266_1000051435 187
4 3300030731 Ga0316177_1129737 Ga0316177_11297372 187
5 3300031911 Ga0307412_10035791 Ga0307412_100357912 187
6 3300032005 Ga0307411_10147845 Ga0307411_101478452 187
7 3300038443 Ga0395901_0691350 Ga0395901_0691350_104_667 187
8 3300039450 Ga0436363_0704191 Ga0436363_0704191_452_1015 187
9 3300042004 Ga0439445_0088329 Ga0439445_0088329_103_666 187
10 3300042134 Ga0450898_052521 Ga0450898_052521_107_670 187
11 3300048929 Ga0496126_0211430 Ga0496126_0211430_95_658 187
12 3300049658 Ga0501211_000103 Ga0501211_000103_5063_5626 187
13 3300050493 nmdc:mga0k408_384420_c1 nmdc:mga0k408_384420_c1_76_639 187
14 3300005445 Ga0070708_100658238 Ga0070708_1006582382 188
15 3300005617 Ga0068859_100107837 Ga0068859_1001078372 188
16 3300006846 Ga0075430_100011858 Ga0075430_1000118582 188
17 3300006931 Ga0097620_100107840 Ga0097620_1001078402 188
18 3300049571 Ga0501034_0282848 Ga0501034_0282848_172_741 188
19 3300050509 nmdc:mga0qj67_475486_c1 nmdc:mga0qj67_475486_c1_234_800 188
20 iso_pu_bacteria 2582581305 2585262262 188
21 3300032004 Ga0307414_10546128 Ga0307414_105461282 189
22 3300041459 Ga0451800_1314371 Ga0451800_1314371_70_642 189
23 3300053139 Ga0500568_0002370 Ga0500568_0002370_476_1045 189
24 3300053151 Ga0500604_0000002 Ga0500604_0000002_113579_114148 189
25 3300053153 Ga0500616_0000238 Ga0500616_0000238_64493_65062 189
26 3300005439 Ga0070711_100090920 Ga0070711_1000909202 190
27 3300006175 Ga0070712_100355960 Ga0070712_1003559602 190
28 3300014326 Ga0157380_10594754 Ga0157380_105947541 190
29 3300025905 Ga0207685_10043304 Ga0207685_100433042 190
30 3300025916 Ga0207663_10428104 Ga0207663_104281041 190
31 iso_pu_bacteria 2643221560 2643820705 190
32 iso_pu_bacteria 2643221563 2643833141 190
33 iso_pu_bacteria 2643221608 2644053064 190
34 iso_pu_bacteria 2852653556 2852656191 190
35 iso_pu_bacteria 2852680915 2852682523 190
36 iso_pu_bacteria 8057101203 8057101253 190
37 3300039450 Ga0436363_1301281 Ga0436363_1301281_148_729 191
38 3300053087 Ga0500643_003224 Ga0500643_003224_3763_4341 191
39 iso_pu_bacteria 2852653556 2852657136 191
40 iso_pu_bacteria 2882806704 2882807019 191
41 3300001915 JGI24741J21665_1005598 JGI24741J21665_10055983 192
42 3300001979 JGI24740J21852_10030584 JGI24740J21852_100305842 192
43 3300001989 JGI24739J22299_10003471 JGI24739J22299_100034714 192
44 3300001990 JGI24737J22298_10002915 JGI24737J22298_100029154 192
45 3300002067 JGI24735J21928_10002382 JGI24735J21928_100023823 192
46 3300002067 JGI24735J21928_10014433 JGI24735J21928_100144332 192
47 3300002067 JGI24735J21928_10021894 JGI24735J21928_100218942 192
48 3300002075 JGI24738J21930_10005613 JGI24738J21930_100056133 192
49 3300003316 rootH1_10065199 rootH1_100651994 192
50 3300003320 rootH2_10200773 rootH2_102007734 192
51 3300003762 Ga0055542_1004375 Ga0055542_10043754 192
52 3300005327 Ga0070658_10002160 Ga0070658_1000216013 192
53 3300005339 Ga0070660_100000264 Ga0070660_10000026429 192
54 3300005339 Ga0070660_100002081 Ga0070660_1000020819 192
55 3300005347 Ga0070668_100068244 Ga0070668_1000682442 192
56 3300005367 Ga0070667_100000089 Ga0070667_10000008915 192
57 3300005455 Ga0070663_100001723 Ga0070663_1000017232 192
58 3300005457 Ga0070662_100024637 Ga0070662_1000246372 192
59 3300005457 Ga0070662_100326198 Ga0070662_1003261982 192
60 3300005539 Ga0068853_100029990 Ga0068853_1000299904 192
61 3300005539 Ga0068853_100692327 Ga0068853_1006923271 192
62 3300005548 Ga0070665_100632641 Ga0070665_1006326411 192
63 3300005563 Ga0068855_100000027 Ga0068855_100000027120 192
64 3300005563 Ga0068855_100015022 Ga0068855_10001502211 192
65 3300005563 Ga0068855_100691743 Ga0068855_1006917432 192
66 3300005577 Ga0068857_100501888 Ga0068857_1005018882 192
67 3300005578 Ga0068854_100000274 Ga0068854_10000027419 192
68 3300005617 Ga0068859_100034581 Ga0068859_1000345816 192
69 3300005841 Ga0068863_100000582 Ga0068863_1000005829 192
70 3300005841 Ga0068863_100238697 Ga0068863_1002386974 192
71 3300005843 Ga0068860_100000148 Ga0068860_100000148116 192
72 3300005843 Ga0068860_100004358 Ga0068860_1000043585 192
73 3300005844 Ga0068862_100001451 Ga0068862_10000145114 192
74 3300006237 Ga0097621_100004842 Ga0097621_1000048426 192
75 3300006353 Ga0075370_10195218 Ga0075370_101952182 192
76 3300006358 Ga0068871_100003701 Ga0068871_1000037016 192
77 3300006931 Ga0097620_100034580 Ga0097620_1000345804 192
78 3300009101 Ga0105247_10012595 Ga0105247_100125955 192
79 3300009174 Ga0105241_10006727 Ga0105241_100067279 192
80 3300009545 Ga0105237_10115681 Ga0105237_101156813 192
81 3300009545 Ga0105237_10835070 Ga0105237_108350701 192
82 3300009551 Ga0105238_11212722 Ga0105238_112127221 192
83 3300010375 Ga0105239_10003505 Ga0105239_100035053 192
84 3300010375 Ga0105239_10269509 Ga0105239_102695092 192
85 3300010375 Ga0105239_11197231 Ga0105239_111972311 192
86 3300013100 Ga0157373_10002690 Ga0157373_1000269011 192
87 3300013105 Ga0157369_10502317 Ga0157369_105023172 192
88 3300013296 Ga0157374_10089142 Ga0157374_100891422 192
89 3300013306 Ga0163162_10227537 Ga0163162_102275372 192
90 3300013307 Ga0157372_10027549 Ga0157372_100275493 192
91 3300013307 Ga0157372_10102494 Ga0157372_101024943 192
92 3300013307 Ga0157372_10127863 Ga0157372_101278632 192
93 3300013307 Ga0157372_10386125 Ga0157372_103861251 192
94 3300014326 Ga0157380_10734016 Ga0157380_107340162 192
95 3300017792 Ga0163161_10973501 Ga0163161_109735011 192
96 3300025254 Ga0209148_1000116 Ga0209148_100011663 192
97 3300025904 Ga0207647_10021855 Ga0207647_100218552 192
98 3300025904 Ga0207647_10220922 Ga0207647_102209222 192
99 3300025909 Ga0207705_10000509 Ga0207705_1000050913 192
100 3300025911 Ga0207654_10031545 Ga0207654_100315453 192
101 3300025914 Ga0207671_10062249 Ga0207671_100622493 192
102 3300025919 Ga0207657_10000696 Ga0207657_100006969 192
103 3300025919 Ga0207657_10001680 Ga0207657_1000168011 192
104 3300025933 Ga0207706_10027007 Ga0207706_100270073 192
105 3300025949 Ga0207667_10000013 Ga0207667_10000013339 192
106 3300025949 Ga0207667_10058314 Ga0207667_100583144 192
107 3300025949 Ga0207667_10324647 Ga0207667_103246472 192
108 3300025949 Ga0207667_10650165 Ga0207667_106501652 192
109 3300025961 Ga0207712_10000174 Ga0207712_100001749 192
110 3300025972 Ga0207668_10331967 Ga0207668_103319672 192
111 3300025981 Ga0207640_10000292 Ga0207640_1000029219 192
112 3300025981 Ga0207640_10012827 Ga0207640_100128274 192
113 3300025986 Ga0207658_10000069 Ga0207658_10000069113 192
114 3300026041 Ga0207639_10010727 Ga0207639_100107272 192
115 3300026041 Ga0207639_10192979 Ga0207639_101929791 192
116 3300026067 Ga0207678_10000982 Ga0207678_1000098210 192
117 3300026088 Ga0207641_10002512 Ga0207641_1000251210 192
118 3300026088 Ga0207641_10003319 Ga0207641_100033194 192
119 3300026142 Ga0207698_10317899 Ga0207698_103178992 192
120 3300028379 Ga0268266_10759444 Ga0268266_107594441 192
121 3300028380 Ga0268265_10000045 Ga0268265_100000459 192
122 3300028381 Ga0268264_10000217 Ga0268264_10000217113 192
123 3300031456 Ga0307513_10015546 Ga0307513_100155462 192
124 3300031731 Ga0307405_10015706 Ga0307405_100157062 192
125 3300031901 Ga0307406_10507423 Ga0307406_105074232 192
126 3300031911 Ga0307412_10135773 Ga0307412_101357731 192
127 3300037418 Ga0395900_0048519 Ga0395900_0048519_303_881 192
128 3300037471 Ga0395905_0021359 Ga0395905_0021359_3355_3933 192
129 3300037471 Ga0395905_0045049 Ga0395905_0045049_1695_2273 192
130 3300038443 Ga0395901_0053488 Ga0395901_0053488_1404_1982 192
131 3300041458 Ga0451798_0093360 Ga0451798_0093360_169_750 192
132 3300041460 Ga0451802_0390112 Ga0451802_0390112_402_983 192
133 3300041462 Ga0451806_777577 Ga0451806_777577_2494_3075 192
134 3300041463 Ga0451804_0363059 Ga0451804_0363059_101_682 192
135 3300041486 Ga0451807_0002468 Ga0451807_0002468_292_873 192
136 3300041501 Ga0451845_0065833 Ga0451845_0065833_187_768 192
137 3300044694 Ga0466963_0046190 Ga0466963_0046190_1813_2391 192
138 3300044719 Ga0466971_0008470 Ga0466971_0008470_2156_2734 192
139 3300044735 Ga0466968_0242884 Ga0466968_0242884_136_714 192
140 3300044842 Ga0466957_0779262 Ga0466957_0779262_65_643 192
141 3300045836 Ga0466958_0237286 Ga0466958_0237286_65_643 192
142 3300046506 Ga0495583_0000218 Ga0495583_0000218_86212_86790 192
143 3300046691 Ga0495670_0010027 Ga0495670_0010027_441_1019 192
144 3300047472 Ga0495686_0004764 Ga0495686_0004764_10169_10801 192
145 3300047472 Ga0495686_0013552 Ga0495686_0013552_892_1470 192
146 3300048906 Ga0496103_0000173 Ga0496103_0000173_17065_17643 192
147 3300048912 Ga0496109_0758032 Ga0496109_0758032_100_678 192
148 3300048919 Ga0496116_0000566 Ga0496116_0000566_8295_8873 192
149 3300048920 Ga0496117_0000485 Ga0496117_0000485_48967_49545 192
150 3300048921 Ga0496118_0000190 Ga0496118_0000190_48967_49545 192
151 3300048921 Ga0496118_0109131 Ga0496118_0109131_1193_1771 192
152 3300048927 Ga0496124_0000546 Ga0496124_0000546_14080_14658 192
153 3300048927 Ga0496124_0401143 Ga0496124_0401143_154_732 192
154 3300048928 Ga0496125_0014358 Ga0496125_0014358_640_1218 192
155 3300048929 Ga0496126_0168808 Ga0496126_0168808_873_1451 192
156 3300049513 Ga0501290_000237 Ga0501290_000237_5705_6283 192
157 3300049515 Ga0501292_000042 Ga0501292_000042_26918_27496 192
158 3300049517 Ga0501294_000032 Ga0501294_000032_3313_3891 192
159 3300049523 Ga0501300_000392 Ga0501300_000392_4662_5240 192
160 3300049551 Ga0501335_006283 Ga0501335_006283_292_870 192
161 3300049571 Ga0501034_0303984 Ga0501034_0303984_116_706 192
162 3300049585 Ga0501069_0002703 Ga0501069_0002703_730_1320 192
163 3300049653 Ga0501206_003378 Ga0501206_003378_691_1269 192
164 3300049662 Ga0501222_001746 Ga0501222_001746_30_608 192
165 3300049662 Ga0501222_008414 Ga0501222_008414_759_1337 192
166 3300049668 Ga0501233_030349 Ga0501233_030349_229_807 192
167 3300049669 Ga0501235_001097 Ga0501235_001097_1584_2162 192
168 3300049686 Ga0501257_174324 Ga0501257_174324_17_595 192
169 3300049690 Ga0501261_000021 Ga0501261_000021_23203_23781 192
170 3300049704 Ga0501221_003846 Ga0501221_003846_1386_1964 192
171 3300049775 Ga0501279_000010 Ga0501279_000010_10715_11293 192
172 3300049776 Ga0501280_000064 Ga0501280_000064_13349_13927 192
173 3300049777 Ga0501281_00086 Ga0501281_00086_1975_2553 192
174 3300049778 Ga0501282_000404 Ga0501282_000404_1682_2260 192
175 3300049779 Ga0501283_001453 Ga0501283_001453_1496_2074 192
176 3300053087 Ga0500643_025886 Ga0500643_025886_1121_1699 192
177 3300053093 Ga0500651_0103812 Ga0500651_0103812_55_633 192
178 3300053103 Ga0500555_000575 Ga0500555_000575_9556_10134 192
179 3300053118 Ga0500594_0029115 Ga0500594_0029115_790_1368 192
180 3300053130 Ga0500642_0057188 Ga0500642_0057188_90_668 192
181 3300053133 Ga0500655_000251 Ga0500655_000251_9404_9982 192
182 3300053136 Ga0500559_0211547 Ga0500559_0211547_62_640 192
183 3300053153 Ga0500616_0008241 Ga0500616_0008241_4823_5401 192
184 3300061719 Ga0466962_0013156 Ga0466962_0013156_1138_1716 192
185 iso_pu_bacteria 2751185897 2753767181 192
186 3300001976 JGI24752J21851_1000644 JGI24752J21851_10006443 193
187 3300001989 JGI24739J22299_10000162 JGI24739J22299_1000016217 193
188 3300005289 Ga0065704_10124492 Ga0065704_101244924 193
189 3300005295 Ga0065707_10000505 Ga0065707_1000050533 193
190 3300005331 Ga0070670_100000021 Ga0070670_100000021193 193
191 3300005367 Ga0070667_100000642 Ga0070667_10000064224 193
192 3300005457 Ga0070662_100112452 Ga0070662_1001124524 193
193 3300005539 Ga0068853_100003716 Ga0068853_10000371615 193
194 3300005577 Ga0068857_100059311 Ga0068857_1000593113 193
195 3300005617 Ga0068859_100042554 Ga0068859_1000425542 193
196 3300005618 Ga0068864_100000004 Ga0068864_100000004162 193
197 3300005841 Ga0068863_100000002 Ga0068863_100000002163 193
198 3300005844 Ga0068862_100000002 Ga0068862_100000002339 193
199 3300006931 Ga0097620_100042555 Ga0097620_1000425552 193
200 3300009011 Ga0105251_10001284 Ga0105251_1000128418 193
201 3300009101 Ga0105247_10212670 Ga0105247_102126702 193
202 3300009177 Ga0105248_10000010 Ga0105248_10000010182 193
203 3300009551 Ga0105238_10102613 Ga0105238_101026132 193
204 3300009553 Ga0105249_10000041 Ga0105249_10000041130 193
205 3300013306 Ga0163162_10115337 Ga0163162_101153372 193
206 3300014325 Ga0163163_10116830 Ga0163163_101168304 193
207 3300014326 Ga0157380_10001161 Ga0157380_100011618 193
208 3300014968 Ga0157379_10051644 Ga0157379_100516444 193
209 3300025321 Ga0207656_10301149 Ga0207656_103011491 193
210 3300025735 Ga0207713_1001586 Ga0207713_100158616 193
211 3300025900 Ga0207710_10109423 Ga0207710_101094233 193
212 3300025925 Ga0207650_10000083 Ga0207650_1000008330 193
213 3300025933 Ga0207706_10015340 Ga0207706_100153402 193
214 3300025941 Ga0207711_10000035 Ga0207711_1000003519 193
215 3300025961 Ga0207712_10000620 Ga0207712_1000062018 193
216 3300025986 Ga0207658_10000388 Ga0207658_1000038840 193
217 3300026088 Ga0207641_10000002 Ga0207641_10000002643 193
218 3300026095 Ga0207676_10000005 Ga0207676_10000005164 193
219 3300026116 Ga0207674_10099190 Ga0207674_100991901 193
220 3300028380 Ga0268265_10000003 Ga0268265_10000003346 193
221 3300031901 Ga0307406_10151212 Ga0307406_101512124 193
222 3300031911 Ga0307412_10026353 Ga0307412_100263532 193
223 3300031995 Ga0307409_100244787 Ga0307409_1002447874 193
224 3300048904 Ga0496101_0061617 Ga0496101_0061617_2094_2678 193
225 3300048906 Ga0496103_0030066 Ga0496103_0030066_568_1152 193
226 3300048920 Ga0496117_0018342 Ga0496117_0018342_2055_2639 193
227 3300048921 Ga0496118_0000463 Ga0496118_0000463_63837_64421 193
228 3300049523 Ga0501300_014450 Ga0501300_014450_278_874 193
229 3300049686 Ga0501257_000049 Ga0501257_000049_23350_23946 193
230 3300049778 Ga0501282_006831 Ga0501282_006831_585_1178 193
231 3300053087 Ga0500643_000135 Ga0500643_000135_51359_51943 193
232 3300053087 Ga0500643_000195 Ga0500643_000195_55418_56011 193
233 3300053116 Ga0500592_000031 Ga0500592_000031_3481_4125 193
234 3300053116 Ga0500592_002248 Ga0500592_002248_2244_2834 193
235 3300053134 Ga0500658_0119062 Ga0500658_0119062_177_764 193
236 3300053151 Ga0500604_0090082 Ga0500604_0090082_115_705 193
237 3300053158 Ga0500627_0001223 Ga0500627_0001223_4447_5091 193
238 iso_pu_bacteria 2512564014 2512645202 193
239 iso_pu_bacteria 2599185354 2600202832 193
240 iso_pu_bacteria 2599185359 2600225499 193
241 iso_pu_bacteria 2643221622 2644126035 193
242 iso_pu_bacteria 2808606401 2809063040 193
243 iso_pu_bacteria 2808606404 2809079004 193
244 iso_pu_bacteria 2808606405 2809083621 193
245 iso_pu_bacteria 2818991466 2819713938 193
246 iso_pu_bacteria 2830075706 2830076928 193
247 iso_pu_bacteria 2848297114 2848297403 193
248 iso_pu_bacteria 2879163058 2879165170 193
249 iso_pu_bacteria 2880518877 2880520295 193
250 iso_pu_bacteria 2895880812 2895888358 193
251 iso_pu_bacteria 2919709256 2919713324 193
252 iso_pu_bacteria 2928027323 2928030300 193
253 iso_pu_bacteria 2928526807 2928528500 193
254 iso_pu_bacteria 2928968154 2928970045 193
255 iso_pu_bacteria 2946787523 2946789286 193
256 iso_pu_bacteria 2984555340 2984558877 193
257 iso_pu_bacteria 2984564862 2984566609 193
258 iso_pu_bacteria 2990265787 2990267513 193
259 iso_pu_bacteria 2993356040 2993357805 193
260 iso_pu_bacteria 2993693658 2993695252 193
261 3300003781 Ga0055536_1002308 Ga0055536_10023085 194
262 3300003781 Ga0055536_1004688 Ga0055536_10046881 194
263 3300003781 Ga0055536_1006328 Ga0055536_10063282 194
264 3300003791 Ga0055530_10000012 Ga0055530_1000001251 194
265 3300003794 Ga0055531_10000466 Ga0055531_1000046636 194
266 3300003794 Ga0055531_10006558 Ga0055531_100065583 194
267 3300005338 Ga0068868_100949084 Ga0068868_1009490841 194
268 3300005617 Ga0068859_100010259 Ga0068859_1000102595 194
269 3300005618 Ga0068864_100454486 Ga0068864_1004544863 194
270 3300005719 Ga0068861_100000001 Ga0068861_10000000166 194
271 3300006881 Ga0068865_100244901 Ga0068865_1002449013 194
272 3300006931 Ga0097620_100010259 Ga0097620_1000102598 194
273 3300009177 Ga0105248_10001758 Ga0105248_1000175819 194
274 3300014325 Ga0163163_10580027 Ga0163163_105800272 194
275 3300014968 Ga0157379_10358376 Ga0157379_103583763 194
276 3300021388 Ga0213875_10067638 Ga0213875_100676382 194
277 3300025291 Ga0209675_1000424 Ga0209675_10004248 194
278 3300025292 Ga0209676_1000081 Ga0209676_1000081202 194
279 3300025292 Ga0209676_1000226 Ga0209676_100022624 194
280 3300025292 Ga0209676_1000359 Ga0209676_100035953 194
281 3300025292 Ga0209676_1039810 Ga0209676_10398102 194
282 3300025292 Ga0209676_1052621 Ga0209676_10526212 194
283 3300025292 Ga0209676_1059727 Ga0209676_10597272 194
284 3300025294 Ga0209025_1027288 Ga0209025_10272882 194
285 3300025298 Ga0209050_1000067 Ga0209050_1000067273 194
286 3300025298 Ga0209050_1066066 Ga0209050_10660661 194
287 3300025304 Ga0209257_1000392 Ga0209257_100039221 194
288 3300025304 Ga0209257_1000699 Ga0209257_100069910 194
289 3300025304 Ga0209257_1002961 Ga0209257_10029616 194
290 3300025941 Ga0207711_10000852 Ga0207711_1000085219 194
291 3300026023 Ga0207677_10824478 Ga0207677_108244781 194
292 3300026095 Ga0207676_10617213 Ga0207676_106172131 194
293 3300026118 Ga0207675_100000159 Ga0207675_1000001593 194
294 3300027665 Ga0209983_1085221 Ga0209983_10852211 194
295 3300030745 Ga0316182_1300921 Ga0316182_13009212 194
296 3300031251 Ga0265327_10194633 Ga0265327_101946332 194
297 3300031548 Ga0307408_100027481 Ga0307408_1000274814 194
298 3300031731 Ga0307405_10145502 Ga0307405_101455023 194
299 3300031824 Ga0307413_10243563 Ga0307413_102435633 194
300 3300031901 Ga0307406_10430796 Ga0307406_104307962 194
301 3300031911 Ga0307412_10021915 Ga0307412_100219153 194
302 3300031911 Ga0307412_10043907 Ga0307412_100439073 194
303 3300032002 Ga0307416_100061843 Ga0307416_1000618432 194
304 3300032004 Ga0307414_10000107 Ga0307414_100001075 194
305 3300032004 Ga0307414_10001551 Ga0307414_100015515 194
306 3300032004 Ga0307414_10023735 Ga0307414_100237353 194
307 3300032004 Ga0307414_10026104 Ga0307414_100261042 194
308 3300032004 Ga0307414_10033618 Ga0307414_100336182 194
309 3300032004 Ga0307414_10062779 Ga0307414_100627794 194
310 3300032004 Ga0307414_10254243 Ga0307414_102542431 194
311 3300032004 Ga0307414_11018825 Ga0307414_110188251 194
312 3300037471 Ga0395905_0427708 Ga0395905_0427708_255_848 194
313 3300037853 Ga0436364_0227850 Ga0436364_0227850_1660_2280 194
314 3300037853 Ga0436364_0808965 Ga0436364_0808965_30_659 194
315 3300037853 Ga0436364_0927709 Ga0436364_0927709_151_783 194
316 3300039437 Ga0436365_1036048 Ga0436365_1036048_124_756 194
317 3300039450 Ga0436363_0009048 Ga0436363_0009048_301_900 194
318 3300039450 Ga0436363_1484770 Ga0436363_1484770_338_934 194
319 3300042876 Ga0451577_0402375 Ga0451577_0402375_519_1133 194
320 3300045051 Ga0451576_0016444 Ga0451576_0016444_2132_2734 194
321 3300046522 Ga0495643_0002313 Ga0495643_0002313_5342_5983 194
322 3300046616 Ga0495668_0000002 Ga0495668_0000002_707640_708230 194
323 3300046660 Ga0495625_0000853 Ga0495625_0000853_37792_38382 194
324 3300048927 Ga0496124_0125342 Ga0496124_0125342_100_699 194
325 3300048929 Ga0496126_0584953 Ga0496126_0584953_73_672 194
326 3300049523 Ga0501300_016995 Ga0501300_016995_141_731 194
327 3300049530 Ga0501314_003132 Ga0501314_003132_330_914 194
328 3300049568 Ga0501031_0099318 Ga0501031_0099318_367_960 194
329 3300049569 Ga0501032_0040021 Ga0501032_0040021_1485_2078 194
330 3300049570 Ga0501033_0062148 Ga0501033_0062148_548_1141 194
331 3300049571 Ga0501034_0015035 Ga0501034_0015035_5098_5691 194
332 3300049571 Ga0501034_0107638 Ga0501034_0107638_2149_2733 194
333 3300049572 Ga0501036_0016173 Ga0501036_0016173_3701_4294 194
334 3300049573 Ga0501037_0024382 Ga0501037_0024382_2243_2836 194
335 3300049574 Ga0501038_0057342 Ga0501038_0057342_2219_2812 194
336 3300049575 Ga0501039_0645776 Ga0501039_0645776_61_654 194
337 3300049578 Ga0501042_0358107 Ga0501042_0358107_135_728 194
338 3300049579 Ga0501043_0041028 Ga0501043_0041028_823_1416 194
339 3300049580 Ga0501046_0036602 Ga0501046_0036602_2028_2621 194
340 3300049581 Ga0501047_0074409 Ga0501047_0074409_2145_2738 194
341 3300049582 Ga0501048_0196129 Ga0501048_0196129_247_840 194
342 3300049663 Ga0501223_000072 Ga0501223_000072_8233_8817 194
343 3300049664 Ga0501224_000004 Ga0501224_000004_110585_111169 194
344 3300049668 Ga0501233_001952 Ga0501233_001952_1663_2247 194
345 3300049705 Ga0501225_0000048 Ga0501225_0000048_28381_28965 194
346 3300049707 Ga0501234_004313 Ga0501234_004313_46_630 194
347 3300049822 Ga0501035_0018213 Ga0501035_0018213_3607_4200 194
348 3300049853 Ga0501226_000018 Ga0501226_000018_57901_58485 194
349 3300053116 Ga0500592_002102 Ga0500592_002102_1085_1678 194
350 3300053139 Ga0500568_0003157 Ga0500568_0003157_6113_6703 194
351 3300053140 Ga0500573_0000086 Ga0500573_0000086_25385_25969 194
352 3300053154 Ga0500619_000184 Ga0500619_000184_5464_6111 194
353 3300053158 Ga0500627_0000017 Ga0500627_0000017_5911_6504 194
354 3300053158 Ga0500627_0057381 Ga0500627_0057381_831_1430 194
355 3300013102 Ga0157371_10257889 Ga0157371_102578892 195
356 3300031824 Ga0307413_10061741 Ga0307413_100617413 195
357 3300032004 Ga0307414_10066553 Ga0307414_100665533 195
358 3300032004 Ga0307414_10245062 Ga0307414_102450622 195
359 3300032005 Ga0307411_10049558 Ga0307411_100495585 195
360 3300032005 Ga0307411_10890465 Ga0307411_108904651 195
361 3300038443 Ga0395901_0980778 Ga0395901_0980778_59_655 195
362 3300048904 Ga0496101_0396991 Ga0496101_0396991_269_865 195
363 3300048905 Ga0496102_0002779 Ga0496102_0002779_6406_7002 195
364 3300048906 Ga0496103_0001865 Ga0496103_0001865_44_640 195
365 3300048907 Ga0496104_0146972 Ga0496104_0146972_68_664 195
366 3300048908 Ga0496105_0060823 Ga0496105_0060823_2311_2907 195
367 3300048913 Ga0496110_0026296 Ga0496110_0026296_202_798 195
368 3300048914 Ga0496111_0447311 Ga0496111_0447311_141_737 195
369 3300048917 Ga0496114_0061278 Ga0496114_0061278_2478_3074 195
370 3300048918 Ga0496115_0000269 Ga0496115_0000269_32201_32797 195
371 3300048919 Ga0496116_0033048 Ga0496116_0033048_2849_3445 195
372 3300048920 Ga0496117_0000887 Ga0496117_0000887_32432_33028 195
373 3300048921 Ga0496118_0005843 Ga0496118_0005843_13066_13662 195
374 3300048922 Ga0496119_0174429 Ga0496119_0174429_360_956 195
375 3300048923 Ga0496120_0026787 Ga0496120_0026787_66_662 195
376 3300048924 Ga0496121_0004850 Ga0496121_0004850_13058_13654 195
377 3300048927 Ga0496124_0000960 Ga0496124_0000960_13071_13667 195
378 3300048929 Ga0496126_0000321 Ga0496126_0000321_69490_70086 195
379 3300049571 Ga0501034_0601414 Ga0501034_0601414_42_644 195
380 3300001915 JGI24741J21665_1000574 JGI24741J21665_10005749 196
381 3300001979 JGI24740J21852_10011115 JGI24740J21852_100111155 196
382 3300001990 JGI24737J22298_10022907 JGI24737J22298_100229073 196
383 3300003215 JGI25153J46596_10000654 JGI25153J46596_1000065418 196
384 3300003323 rootH1_10176977 rootH1_101769771 196
385 3300003759 Ga0055525_1000186 Ga0055525_100018666 196
386 3300003762 Ga0055542_1000025 Ga0055542_1000025168 196
387 3300003763 Ga0055529_1000014 Ga0055529_100001485 196
388 3300005327 Ga0070658_10003033 Ga0070658_100030336 196
389 3300005328 Ga0070676_10202206 Ga0070676_102022062 196
390 3300005344 Ga0070661_100076930 Ga0070661_1000769302 196
391 3300005344 Ga0070661_100112882 Ga0070661_1001128822 196
392 3300005347 Ga0070668_100778248 Ga0070668_1007782482 196
393 3300005356 Ga0070674_100013554 Ga0070674_1000135542 196
394 3300005364 Ga0070673_100508085 Ga0070673_1005080851 196
395 3300005366 Ga0070659_100306021 Ga0070659_1003060211 196
396 3300005456 Ga0070678_100001546 Ga0070678_1000015462 196
397 3300005459 Ga0068867_100138893 Ga0068867_1001388932 196
398 3300005539 Ga0068853_100142612 Ga0068853_1001426122 196
399 3300005543 Ga0070672_100099057 Ga0070672_1000990572 196
400 3300005548 Ga0070665_100000323 Ga0070665_10000032355 196
401 3300005563 Ga0068855_100217133 Ga0068855_1002171332 196
402 3300005564 Ga0070664_100072257 Ga0070664_1000722573 196
403 3300005577 Ga0068857_100532151 Ga0068857_1005321512 196
404 3300006358 Ga0068871_100827471 Ga0068871_1008274712 196
405 3300006881 Ga0068865_100684130 Ga0068865_1006841302 196
406 3300009148 Ga0105243_10000033 Ga0105243_10000033165 196
407 3300009174 Ga0105241_10001031 Ga0105241_1000103111 196
408 3300009545 Ga0105237_10205975 Ga0105237_102059753 196
409 3300012475 Ga0157317_1000660 Ga0157317_10006602 196
410 3300012506 Ga0157324_1003292 Ga0157324_10032922 196
411 3300013102 Ga0157371_10000059 Ga0157371_10000059109 196
412 3300013296 Ga0157374_10280191 Ga0157374_102801913 196
413 3300013297 Ga0157378_10202437 Ga0157378_102024372 196
414 3300013297 Ga0157378_10336159 Ga0157378_103361592 196
415 3300013307 Ga0157372_10160826 Ga0157372_101608263 196
416 3300017792 Ga0163161_10030181 Ga0163161_100301814 196
417 3300025230 Ga0209563_100145 Ga0209563_10014519 196
418 3300025253 Ga0209677_104936 Ga0209677_1049363 196
419 3300025254 Ga0209148_1000011 Ga0209148_100001187 196
420 3300025272 Ga0209455_1000006 Ga0209455_10000061107 196
421 3300025297 Ga0209758_1000001 Ga0209758_1000001731 196
422 3300025321 Ga0207656_10002881 Ga0207656_100028816 196
423 3300025901 Ga0207688_10056252 Ga0207688_100562522 196
424 3300025904 Ga0207647_10079207 Ga0207647_100792073 196
425 3300025907 Ga0207645_10042648 Ga0207645_100426483 196
426 3300025908 Ga0207643_10425215 Ga0207643_104252151 196
427 3300025909 Ga0207705_10000203 Ga0207705_1000020364 196
428 3300025911 Ga0207654_10000897 Ga0207654_1000089716 196
429 3300025913 Ga0207695_10020907 Ga0207695_100209075 196
430 3300025914 Ga0207671_10068688 Ga0207671_100686883 196
431 3300025919 Ga0207657_10203984 Ga0207657_102039841 196
432 3300025920 Ga0207649_10000319 Ga0207649_1000031938 196
433 3300025924 Ga0207694_10006961 Ga0207694_100069618 196
434 3300025925 Ga0207650_10093528 Ga0207650_100935282 196
435 3300025932 Ga0207690_10006519 Ga0207690_100065196 196
436 3300025933 Ga0207706_10269744 Ga0207706_102697442 196
437 3300025935 Ga0207709_10000059 Ga0207709_1000005989 196
438 3300025937 Ga0207669_10000341 Ga0207669_100003418 196
439 3300025940 Ga0207691_10102784 Ga0207691_101027843 196
440 3300025949 Ga0207667_10000002 Ga0207667_1000000251 196
441 3300025949 Ga0207667_10016335 Ga0207667_100163355 196
442 3300025960 Ga0207651_10087500 Ga0207651_100875003 196
443 3300026067 Ga0207678_10004733 Ga0207678_100047335 196
444 3300026078 Ga0207702_10003062 Ga0207702_1000306213 196
445 3300026089 Ga0207648_10160855 Ga0207648_101608552 196
446 3300026116 Ga0207674_10018179 Ga0207674_100181793 196
447 3300026121 Ga0207683_10029198 Ga0207683_100291986 196
448 3300026142 Ga0207698_10011565 Ga0207698_100115654 196
449 3300028379 Ga0268266_10000002 Ga0268266_100000022967 196
450 3300028786 Ga0307517_10024293 Ga0307517_100242937 196
451 3300031456 Ga0307513_10014913 Ga0307513_100149131 196
452 3300031507 Ga0307509_10534043 Ga0307509_105340432 196
453 3300031911 Ga0307412_10060005 Ga0307412_100600054 196
454 3300041451 Ga0451791_0479436 Ga0451791_0479436_98_727 196
455 3300046471 Ga0495650_0000440 Ga0495650_0000440_39812_40441 196
456 3300046471 Ga0495650_0028011 Ga0495650_0028011_1879_2490 196
457 3300046474 Ga0495605_0144332 Ga0495605_0144332_197_826 196
458 3300046492 Ga0495585_0081724 Ga0495585_0081724_806_1435 196
459 3300046506 Ga0495583_0000680 Ga0495583_0000680_16865_17494 196
460 3300046506 Ga0495583_0022715 Ga0495583_0022715_955_1584 196
461 3300046507 Ga0495606_0009337 Ga0495606_0009337_4813_5442 196
462 3300046507 Ga0495606_0136853 Ga0495606_0136853_159_788 196
463 3300046513 Ga0495616_0132633 Ga0495616_0132633_175_804 196
464 3300046520 Ga0495637_0006994 Ga0495637_0006994_3455_4084 196
465 3300046522 Ga0495643_0001726 Ga0495643_0001726_7665_8294 196
466 3300046522 Ga0495643_0038480 Ga0495643_0038480_658_1287 196
467 3300046524 Ga0495648_0000459 Ga0495648_0000459_32396_33025 196
468 3300046524 Ga0495648_0042230 Ga0495648_0042230_566_1195 196
469 3300046525 Ga0495663_0003362 Ga0495663_0003362_3201_3830 196
470 3300046528 Ga0495642_0029861 Ga0495642_0029861_1055_1684 196
471 3300046542 Ga0495597_0020763 Ga0495597_0020763_137_766 196
472 3300046557 Ga0495622_0050440 Ga0495622_0050440_360_989 196
473 3300046558 Ga0495633_0005764 Ga0495633_0005764_1651_2280 196
474 3300046558 Ga0495633_0019840 Ga0495633_0019840_1995_2624 196
475 3300046616 Ga0495668_0000072 Ga0495668_0000072_17170_17799 196
476 3300046648 Ga0495611_0023270 Ga0495611_0023270_163_792 196
477 3300046660 Ga0495625_0000106 Ga0495625_0000106_103499_104128 196
478 3300046660 Ga0495625_0085412 Ga0495625_0085412_1444_2073 196
479 3300046665 Ga0495661_0157288 Ga0495661_0157288_545_1174 196
480 3300046684 Ga0495669_0000148 Ga0495669_0000148_7497_8126 196
481 3300046691 Ga0495670_0069982 Ga0495670_0069982_153_782 196
482 3300046692 Ga0495671_0181594 Ga0495671_0181594_85_714 196
483 3300046694 Ga0495649_0047187 Ga0495649_0047187_807_1436 196
484 3300046809 Ga0495600_0021061 Ga0495600_0021061_708_1337 196
485 3300046810 Ga0495660_0023772 Ga0495660_0023772_1371_2000 196
486 3300047323 Ga0495683_0006914 Ga0495683_0006914_3287_3916 196
487 3300047323 Ga0495683_0148674 Ga0495683_0148674_170_799 196
488 3300047443 Ga0495687_000068 Ga0495687_000068_35342_35971 196
489 3300047443 Ga0495687_000563 Ga0495687_000563_14997_15626 196
490 3300047445 Ga0495677_0042037 Ga0495677_0042037_271_900 196
491 3300047470 Ga0495681_0056479 Ga0495681_0056479_201_830 196
492 3300047472 Ga0495686_0182091 Ga0495686_0182091_216_845 196
493 3300048926 Ga0496123_0036015 Ga0496123_0036015_674_1303 196
494 3300048928 Ga0496125_0000956 Ga0496125_0000956_13060_13689 196
495 3300053079 Ga0500610_0000607 Ga0500610_0000607_4378_5007 196
496 3300053119 Ga0500595_001506 Ga0500595_001506_6205_6834 196
497 3300053121 Ga0500607_184075 Ga0500607_184075_71_700 196
498 3300053130 Ga0500642_0044565 Ga0500642_0044565_386_1015 196
499 3300053154 Ga0500619_018582 Ga0500619_018582_25_654 196
500 3300053177 Ga0500636_0027233 Ga0500636_0027233_538_1167 196
501 3300053730 Ga0500645_000002 Ga0500645_000002_351858_352487 196
502 3300053735 Ga0500596_002198 Ga0500596_002198_2511_3140 196
503 iso_pu_bacteria 2885429604 2885429811 196
504 2162886007 SwRhRL2b_contig_209707 SwRhRL2b_0642.00005780 197
505 3300001990 JGI24737J22298_10001306 JGI24737J22298_100013066 197
506 3300002239 JGI24034J26672_10028667 JGI24034J26672_100286671 197
507 3300002773 JGI25152J39213_1032197 JGI25152J39213_10321971 197
508 3300002774 JGI25150J39212_1001984 JGI25150J39212_10019842 197
509 3300003187 JGI25151J46595_10033499 JGI25151J46595_100334992 197
510 3300003214 JGI25165J46597_1000041 JGI25165J46597_1000041226 197
511 3300003215 JGI25153J46596_10000395 JGI25153J46596_1000039519 197
512 3300003215 JGI25153J46596_10027670 JGI25153J46596_100276702 197
513 3300003771 Ga0055526_1007921 Ga0055526_10079212 197
514 3300003773 Ga0055537_1001019 Ga0055537_10010197 197
515 3300003773 Ga0055537_1003939 Ga0055537_10039393 197
516 3300003775 Ga0055524_1000539 Ga0055524_100053934 197
517 3300003781 Ga0055536_1020724 Ga0055536_10207242 197
518 3300003790 Ga0055528_1024486 Ga0055528_10244862 197
519 3300003791 Ga0055530_10007314 Ga0055530_100073145 197
520 3300003792 Ga0055540_1002064 Ga0055540_100206411 197
521 3300004625 Ga0055543_1015053 Ga0055543_10150532 197
522 3300005262 Ga0065165_1003679 Ga0065165_10036799 197
523 3300005262 Ga0065165_1018346 Ga0065165_10183462 197
524 3300005262 Ga0065165_1018890 Ga0065165_10188902 197
525 3300005262 Ga0065165_1029939 Ga0065165_10299391 197
526 3300005262 Ga0065165_1052550 Ga0065165_10525501 197
527 3300005262 Ga0065165_1053763 Ga0065165_10537632 197
528 3300005289 Ga0065704_10102737 Ga0065704_101027372 197
529 3300005295 Ga0065707_10098261 Ga0065707_100982612 197
530 3300005331 Ga0070670_100004170 Ga0070670_10000417018 197
531 3300005331 Ga0070670_100130734 Ga0070670_1001307341 197
532 3300005335 Ga0070666_10000184 Ga0070666_1000018425 197
533 3300005347 Ga0070668_100208292 Ga0070668_1002082921 197
534 3300005353 Ga0070669_100000008 Ga0070669_10000000848 197
535 3300005353 Ga0070669_100124866 Ga0070669_1001248664 197
536 3300005355 Ga0070671_100000015 Ga0070671_100000015141 197
537 3300005355 Ga0070671_100027553 Ga0070671_1000275536 197
538 3300005364 Ga0070673_101031205 Ga0070673_1010312051 197
539 3300005445 Ga0070708_100148074 Ga0070708_1001480743 197
540 3300005466 Ga0070685_10103920 Ga0070685_101039202 197
541 3300005539 Ga0068853_100014059 Ga0068853_1000140595 197
542 3300005544 Ga0070686_100207507 Ga0070686_1002075073 197
543 3300005577 Ga0068857_100012302 Ga0068857_1000123023 197
544 3300005578 Ga0068854_100646133 Ga0068854_1006461332 197
545 3300005614 Ga0068856_101251733 Ga0068856_1012517332 197
546 3300005617 Ga0068859_100023533 Ga0068859_1000235333 197
547 3300005618 Ga0068864_100004712 Ga0068864_1000047122 197
548 3300005618 Ga0068864_100030140 Ga0068864_1000301406 197
549 3300005618 Ga0068864_100476278 Ga0068864_1004762783 197
550 3300005719 Ga0068861_100292112 Ga0068861_1002921122 197
551 3300005841 Ga0068863_100084694 Ga0068863_1000846943 197
552 3300005842 Ga0068858_100000327 Ga0068858_10000032743 197
553 3300005842 Ga0068858_100001357 Ga0068858_10000135713 197
554 3300005842 Ga0068858_100010355 Ga0068858_10001035510 197
555 3300005843 Ga0068860_100001081 Ga0068860_10000108115 197
556 3300005844 Ga0068862_100000169 Ga0068862_1000001693 197
557 3300005985 Ga0081539_10038957 Ga0081539_100389572 197
558 3300006048 Ga0075363_100140735 Ga0075363_1001407352 197
559 3300006353 Ga0075370_10201922 Ga0075370_102019222 197
560 3300006931 Ga0097620_100023532 Ga0097620_1000235328 197
561 3300009011 Ga0105251_10153187 Ga0105251_101531871 197
562 3300009098 Ga0105245_10032215 Ga0105245_100322157 197
563 3300009101 Ga0105247_10001891 Ga0105247_1000189117 197
564 3300009148 Ga0105243_10109651 Ga0105243_101096512 197
565 3300009177 Ga0105248_10088281 Ga0105248_100882814 197
566 3300009177 Ga0105248_10673378 Ga0105248_106733783 197
567 3300009545 Ga0105237_10002470 Ga0105237_100024702 197
568 3300009551 Ga0105238_10019927 Ga0105238_100199272 197
569 3300009551 Ga0105238_10185628 Ga0105238_101856282 197
570 3300009553 Ga0105249_10019753 Ga0105249_100197533 197
571 3300009978 Ga0105148_100540 Ga0105148_1005403 197
572 3300013100 Ga0157373_10390160 Ga0157373_103901603 197
573 3300013102 Ga0157371_10058795 Ga0157371_100587952 197
574 3300013296 Ga0157374_10148360 Ga0157374_101483602 197
575 3300013297 Ga0157378_10659543 Ga0157378_106595431 197
576 3300013306 Ga0163162_10013938 Ga0163162_100139388 197
577 3300013306 Ga0163162_10019579 Ga0163162_100195795 197
578 3300013306 Ga0163162_10739124 Ga0163162_107391242 197
579 3300013306 Ga0163162_10878521 Ga0163162_108785211 197
580 3300013307 Ga0157372_11061349 Ga0157372_110613492 197
581 3300014325 Ga0163163_10030114 Ga0163163_100301148 197
582 3300014326 Ga0157380_10058444 Ga0157380_100584445 197
583 3300015690 Ga0183363_1004 Ga0183363_1004235 197
584 3300016635 Ga0183361_10506 Ga0183361_105063 197
585 3300021388 Ga0213875_10142835 Ga0213875_101428353 197
586 3300025233 Ga0209437_103614 Ga0209437_1036143 197
587 3300025245 Ga0207425_1000041 Ga0207425_100004160 197
588 3300025258 Ga0209129_1004489 Ga0209129_10044895 197
589 3300025261 Ga0209233_1000104 Ga0209233_1000104230 197
590 3300025263 Ga0209565_1000008 Ga0209565_1000008636 197
591 3300025263 Ga0209565_1000134 Ga0209565_100013444 197
592 3300025272 Ga0209455_1011101 Ga0209455_10111013 197
593 3300025273 Ga0209673_1015848 Ga0209673_10158482 197
594 3300025290 Ga0207673_1011763 Ga0207673_10117631 197
595 3300025291 Ga0209675_1009250 Ga0209675_10092502 197
596 3300025292 Ga0209676_1003684 Ga0209676_100368410 197
597 3300025294 Ga0209025_1000068 Ga0209025_1000068229 197
598 3300025295 Ga0209564_1000622 Ga0209564_100062259 197
599 3300025297 Ga0209758_1000004 Ga0209758_1000004128 197
600 3300025297 Ga0209758_1012697 Ga0209758_10126974 197
601 3300025298 Ga0209050_1000001 Ga0209050_10000012058 197
602 3300025298 Ga0209050_1000581 Ga0209050_100058121 197
603 3300025298 Ga0209050_1007158 Ga0209050_10071586 197
604 3300025299 Ga0209256_1000009 Ga0209256_1000009233 197
605 3300025299 Ga0209256_1000010 Ga0209256_1000010157 197
606 3300025303 Ga0209051_1000191 Ga0209051_100019111 197
607 3300025304 Ga0209257_1000876 Ga0209257_10008768 197
608 3300025304 Ga0209257_1002353 Ga0209257_10023537 197
609 3300025304 Ga0209257_1019763 Ga0209257_10197632 197
610 3300025304 Ga0209257_1064691 Ga0209257_10646911 197
611 3300025315 Ga0207697_10006525 Ga0207697_100065253 197
612 3300025735 Ga0207713_1098423 Ga0207713_10984232 197
613 3300025903 Ga0207680_10000186 Ga0207680_1000018612 197
614 3300025914 Ga0207671_10073852 Ga0207671_100738522 197
615 3300025923 Ga0207681_10000002 Ga0207681_10000002140 197
616 3300025923 Ga0207681_10033288 Ga0207681_100332881 197
617 3300025923 Ga0207681_10094028 Ga0207681_100940283 197
618 3300025925 Ga0207650_10002904 Ga0207650_1000290413 197
619 3300025925 Ga0207650_10049447 Ga0207650_100494473 197
620 3300025927 Ga0207687_10010076 Ga0207687_100100763 197
621 3300025931 Ga0207644_10000002 Ga0207644_10000002139 197
622 3300025931 Ga0207644_10198546 Ga0207644_101985462 197
623 3300025935 Ga0207709_10850924 Ga0207709_108509242 197
624 3300025941 Ga0207711_10114106 Ga0207711_101141064 197
625 3300025941 Ga0207711_10341418 Ga0207711_103414183 197
626 3300025961 Ga0207712_10018137 Ga0207712_100181373 197
627 3300025972 Ga0207668_10005340 Ga0207668_1000534011 197
628 3300025986 Ga0207658_10018656 Ga0207658_100186566 197
629 3300026035 Ga0207703_10000244 Ga0207703_1000024455 197
630 3300026035 Ga0207703_10000775 Ga0207703_1000077513 197
631 3300026035 Ga0207703_10009134 Ga0207703_1000913410 197
632 3300026041 Ga0207639_10036303 Ga0207639_100363035 197
633 3300026088 Ga0207641_10014410 Ga0207641_100144107 197
634 3300026089 Ga0207648_10349465 Ga0207648_103494652 197
635 3300026095 Ga0207676_10003426 Ga0207676_1000342615 197
636 3300026095 Ga0207676_10022559 Ga0207676_100225593 197
637 3300026095 Ga0207676_10206510 Ga0207676_102065103 197
638 3300026116 Ga0207674_10018188 Ga0207674_100181883 197
639 3300026118 Ga0207675_100000358 Ga0207675_1000003588 197
640 3300026118 Ga0207675_100264382 Ga0207675_1002643822 197
641 3300028379 Ga0268266_10702837 Ga0268266_107028372 197
642 3300028379 Ga0268266_11379268 Ga0268266_113792681 197
643 3300028380 Ga0268265_10000285 Ga0268265_1000028542 197
644 3300028381 Ga0268264_10000010 Ga0268264_10000010357 197
645 3300031616 Ga0307508_10000231 Ga0307508_1000023139 197
646 3300031824 Ga0307413_10548338 Ga0307413_105483381 197
647 3300031995 Ga0307409_100852810 Ga0307409_1008528102 197
648 3300033180 Ga0307510_10013885 Ga0307510_100138853 197
649 3300037853 Ga0436364_1114714 Ga0436364_1114714_177_806 197
650 3300039145 Ga0237816_01874 Ga0237816_01874_738_1334 197
651 3300039437 Ga0436365_0238917 Ga0436365_0238917_550_1179 197
652 3300041404 Ga0439436_0009694 Ga0439436_0009694_590_1219 197
653 3300041406 Ga0439439_0001779 Ga0439439_0001779_699_1328 197
654 3300041410 Ga0439461_0000869 Ga0439461_0000869_621_1250 197
655 3300041410 Ga0439461_0003679 Ga0439461_0003679_1713_2342 197
656 3300041413 Ga0439465_0004274 Ga0439465_0004274_465_1094 197
657 3300041413 Ga0439465_0004757 Ga0439465_0004757_1145_1774 197
658 3300041486 Ga0451807_2054855 Ga0451807_2054855_92_721 197
659 3300041507 Ga0451851_0221820 Ga0451851_0221820_44_673 197
660 3300041997 Ga0439431_0018958 Ga0439431_0018958_503_1132 197
661 3300041997 Ga0439431_0068838 Ga0439431_0068838_26_655 197
662 3300042002 Ga0439442_005410 Ga0439442_005410_261_890 197
663 3300042004 Ga0439445_0013018 Ga0439445_0013018_529_1158 197
664 3300042004 Ga0439445_0031083 Ga0439445_0031083_103_732 197
665 3300042014 Ga0439457_023079 Ga0439457_023079_444_1073 197
666 3300042015 Ga0439462_0005952 Ga0439462_0005952_1856_2485 197
667 3300042015 Ga0439462_0010494 Ga0439462_0010494_274_903 197
668 3300042121 Ga0450919_007466 Ga0450919_007466_89_718 197
669 3300042185 Ga0450909_035741 Ga0450909_035741_62_691 197
670 3300042435 Ga0439434_0060866 Ga0439434_0060866_67_696 197
671 3300046453 Ga0495627_000156 Ga0495627_000156_30065_30685 197
672 3300046453 Ga0495627_000578 Ga0495627_000578_24101_24712 197
673 3300046460 Ga0495638_0000758 Ga0495638_0000758_24315_24944 197
674 3300046460 Ga0495638_0006069 Ga0495638_0006069_3707_4300 197
675 3300046501 Ga0495607_0086883 Ga0495607_0086883_405_1025 197
676 3300046512 Ga0495610_0000291 Ga0495610_0000291_50482_51102 197
677 3300046512 Ga0495610_0039771 Ga0495610_0039771_277_888 197
678 3300046513 Ga0495616_0001456 Ga0495616_0001456_3799_4392 197
679 3300046518 Ga0495631_0122789 Ga0495631_0122789_210_821 197
680 3300046520 Ga0495637_0010852 Ga0495637_0010852_1250_1870 197
681 3300046524 Ga0495648_0010683 Ga0495648_0010683_4943_5554 197
682 3300046525 Ga0495663_0013399 Ga0495663_0013399_769_1398 197
683 3300046557 Ga0495622_0099018 Ga0495622_0099018_681_1310 197
684 3300046558 Ga0495633_0013695 Ga0495633_0013695_3432_4028 197
685 3300046558 Ga0495633_0085188 Ga0495633_0085188_503_1123 197
686 3300046616 Ga0495668_0045706 Ga0495668_0045706_688_1317 197
687 3300046660 Ga0495625_0000629 Ga0495625_0000629_10175_10804 197
688 3300046660 Ga0495625_0038886 Ga0495625_0038886_77_724 197
689 3300046665 Ga0495661_0152132 Ga0495661_0152132_46_666 197
690 3300046691 Ga0495670_0000002 Ga0495670_0000002_84088_84717 197
691 3300046810 Ga0495660_0102720 Ga0495660_0102720_751_1371 197
692 3300047445 Ga0495677_0028714 Ga0495677_0028714_1215_1844 197
693 3300047470 Ga0495681_0000098 Ga0495681_0000098_10671_11291 197
694 3300047470 Ga0495681_0009646 Ga0495681_0009646_5106_5735 197
695 3300047472 Ga0495686_0001323 Ga0495686_0001323_19378_20019 197
696 3300047472 Ga0495686_0008463 Ga0495686_0008463_4316_4936 197
697 3300047472 Ga0495686_0029938 Ga0495686_0029938_810_1439 197
698 3300047472 Ga0495686_0229805 Ga0495686_0229805_24_653 197
699 3300048905 Ga0496102_0090445 Ga0496102_0090445_1635_2231 197
700 3300048906 Ga0496103_0127121 Ga0496103_0127121_802_1431 197
701 3300048918 Ga0496115_0001129 Ga0496115_0001129_14138_14767 197
702 3300048918 Ga0496115_0119697 Ga0496115_0119697_646_1275 197
703 3300048923 Ga0496120_0030374 Ga0496120_0030374_116_745 197
704 3300048924 Ga0496121_0000296 Ga0496121_0000296_30165_30794 197
705 3300048924 Ga0496121_0119109 Ga0496121_0119109_444_1097 197
706 3300048924 Ga0496121_0369233 Ga0496121_0369233_278_907 197
707 3300048926 Ga0496123_0042455 Ga0496123_0042455_1449_2078 197
708 3300048926 Ga0496123_0059099 Ga0496123_0059099_534_1166 197
709 3300048927 Ga0496124_0000874 Ga0496124_0000874_17929_18558 197
710 3300048927 Ga0496124_0005852 Ga0496124_0005852_8525_9154 197
711 3300048927 Ga0496124_0048088 Ga0496124_0048088_2607_3236 197
712 3300048927 Ga0496124_0376677 Ga0496124_0376677_232_834 197
713 3300048928 Ga0496125_0199205 Ga0496125_0199205_448_1077 197
714 3300049459 Ga0495678_014836 Ga0495678_014836_2355_2975 197
715 3300049574 Ga0501038_0059946 Ga0501038_0059946_1986_2582 197
716 3300049575 Ga0501039_0229604 Ga0501039_0229604_95_691 197
717 3300049581 Ga0501047_0130480 Ga0501047_0130480_64_705 197
718 3300049587 Ga0501071_0279836 Ga0501071_0279836_23_652 197
719 3300049823 Ga0501044_0192235 Ga0501044_0192235_941_1570 197
720 3300050490 nmdc:mga03n38_105808_c1 nmdc:mga03n38_105808_c1_682_1311 197
721 3300050496 nmdc:mga07m45_133583_c1 nmdc:mga07m45_133583_c1_579_1208 197
722 3300053087 Ga0500643_000644 Ga0500643_000644_8673_9266 197
723 3300053087 Ga0500643_001242 Ga0500643_001242_13675_14322 197
724 3300053087 Ga0500643_008402 Ga0500643_008402_71_700 197
725 3300053094 Ga0500566_0006685 Ga0500566_0006685_992_1621 197
726 3300053096 Ga0500641_0008791 Ga0500641_0008791_2846_3475 197
727 3300053108 Ga0500562_026290 Ga0500562_026290_513_1109 197
728 3300053118 Ga0500594_0043684 Ga0500594_0043684_26_655 197
729 3300053118 Ga0500594_0061312 Ga0500594_0061312_170_799 197
730 3300053119 Ga0500595_000572 Ga0500595_000572_15662_16291 197
731 3300053128 Ga0500626_146353 Ga0500626_146353_21_650 197
732 3300053131 Ga0500652_099335 Ga0500652_099335_448_1077 197
733 3300053134 Ga0500658_0001656 Ga0500658_0001656_7554_8183 197
734 3300053134 Ga0500658_0006467 Ga0500658_0006467_3325_3957 197
735 3300053134 Ga0500658_0014446 Ga0500658_0014446_1741_2370 197
736 3300053136 Ga0500559_0003794 Ga0500559_0003794_2543_3136 197
737 3300053136 Ga0500559_0070195 Ga0500559_0070195_603_1232 197
738 3300053139 Ga0500568_0039397 Ga0500568_0039397_781_1410 197
739 3300053140 Ga0500573_0228123 Ga0500573_0228123_20_631 197
740 3300053153 Ga0500616_0033520 Ga0500616_0033520_162_791 197
741 3300053156 Ga0500622_0253895 Ga0500622_0253895_79_699 197
742 3300053157 Ga0500624_000063 Ga0500624_000063_27503_28099 197
743 3300053158 Ga0500627_0027041 Ga0500627_0027041_1645_2238 197
744 3300053177 Ga0500636_0058873 Ga0500636_0058873_336_929 197
745 3300053730 Ga0500645_001488 Ga0500645_001488_982_1611 197
746 3300053730 Ga0500645_026811 Ga0500645_026811_515_1144 197
747 3300055283 Ga0500661_000092 Ga0500661_000092_9451_10044 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00694

Aconitase_C

Aconitase C-terminal domain

9

126

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9556 1 166
2hcu-assembly1.cif.gz_A crystal structure of smu.1381 (or leud) from streptococcus mutans 0.9467 1 166
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9391 1 166
3h5e-assembly2.cif.gz_B leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9246 4 153
3q3w-assembly1.cif.gz_A isopropylmalate isomerase small subunit from campylobacter jejuni. 0.9232 1 167
ID Description Score Start End Superfamily
af_O14289_535_712_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.956 3 169 3.20.19.10
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9556 1 166 3.20.19.10
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9391 1 166 3.20.19.10
af_Q2FWK0_1_171_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9367 2 166 3.20.19.10
3q3wA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9178 1 167 3.20.19.10
ID Description Score Start End GO Terms
AF-A0A4Q5SBZ3-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9957 1 169 GO:0003861
GO:0009098
GO:0009316
AF-A0A2A2K0E1-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9957 1 115 GO:0003861
GO:0009098
GO:0009316
GO:0016491
AF-A0A4Q2X6Z5-F1-model_v4 deleted 0.9942 1 112
AF-A0A4Q5SBZ3-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9898 1 169 GO:0003861
GO:0009098
GO:0009316
AF-A0A3D4LX70-F1-model_v4 deleted 0.987 1 139

Feature Viewer

pLDDT pTM Quality
91.98 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map