F478930
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 747 | 392 | 712 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300048924|Ga0496121_0119109|Ga0496121_0119109_444_1097 |
| Length | 217 |
| Sequence | MPGAWRLSVNPVTQVSGRAYPWGAKNVDTDVIIPAHWLKTITREGLGKGAFETVRAQPGNIFDDPAYAGSPILIAGDNFGCGSSREHAAWALGDMGIVAVIAPSFSDIFSGNAFKNGIVTVVLPQEAIDRLIEVAKTDKVTIDLETMTVTTPFQDRFAFALDPFRRQCLMEGLDEIGLTLARDTAISKYESGVREHRPWMSGEQGYAGTVVEGAGRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 4 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 5 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 6 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 7 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 8 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 9 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 10 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 11 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 12 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 13 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 14 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 15 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 16 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 17 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 18 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 19 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 20 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 21 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 22 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 23 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 24 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 25 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 26 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 27 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 28 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 29 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 30 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 31 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 32 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 33 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 34 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 35 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 36 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 37 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 38 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 39 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 40 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 41 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 42 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 43 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 44 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 45 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 46 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 47 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 48 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 49 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 50 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 51 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 55 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 56 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 57 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 58 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 59 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 61 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 64 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 71 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 86 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 88 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 97 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 108 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 124 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 136 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 139 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 210 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 211 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 212 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 214 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 226 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 227 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 228 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 234 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 235 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 236 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 237 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 245 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 246 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 247 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 248 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 249 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 250 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 251 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 252 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 253 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 254 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 255 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 256 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 257 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 258 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 259 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 260 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 261 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 262 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 305 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 306 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 307 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 308 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 309 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 310 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 311 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 312 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 313 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 314 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 315 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 316 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 318 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 319 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 320 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 321 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 339 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 340 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 341 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 342 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 343 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 344 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 345 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 346 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 347 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 348 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 349 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 350 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 351 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 352 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 353 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 354 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 358 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 359 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 360 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 363 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 364 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 365 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 366 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 367 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 368 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 369 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 370 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 371 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 372 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 373 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 374 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 375 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 376 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 377 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 379 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 380 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 381 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 382 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 383 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 384 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 385 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 386 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 387 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 390 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 391 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 392 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.05 |
| Metatranscriptomes | 0.27 |
| Isolates | 4.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.67 |
| Bulb | 0 |
| Endosphere | 18.74 |
| Nodule | 0 |
| Rhizoplane | 3.61 |
| Rhizosphere | 67.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_209707 | 2162886007 | Bacteria | 1439 |
| 2 | JGI24741J21665_1000574 | 3300001915 | Bacteria | 11196 |
| 3 | JGI24741J21665_1005598 | 3300001915 | Bacteria | 2609 |
| 4 | JGI24752J21851_1000644 | 3300001976 | Bacteria | 4647 |
| 5 | JGI24740J21852_10011115 | 3300001979 | Bacteria | 3438 |
| 6 | JGI24740J21852_10030584 | 3300001979 | Bacteria | 1749 |
| 7 | JGI24739J22299_10000162 | 3300001989 | Bacteria | 21912 |
| 8 | JGI24739J22299_10003471 | 3300001989 | Bacteria | 6016 |
| 9 | JGI24737J22298_10001306 | 3300001990 | Bacteria | 8830 |
| 10 | JGI24737J22298_10002915 | 3300001990 | Bacteria | 6064 |
| 11 | JGI24737J22298_10022907 | 3300001990 | Bacteria | 1983 |
| 12 | JGI24735J21928_10002382 | 3300002067 | Bacteria | 6535 |
| 13 | JGI24735J21928_10014433 | 3300002067 | Bacteria | 2474 |
| 14 | JGI24735J21928_10021894 | 3300002067 | Bacteria | 1949 |
| 15 | JGI24738J21930_10005613 | 3300002075 | Bacteria | 2992 |
| 16 | JGI24034J26672_10028667 | 3300002239 | Bacteria | 899 |
| 17 | JGI25152J39213_1032197 | 3300002773 | Bacteria | 799 |
| 18 | JGI25150J39212_1001984 | 3300002774 | Bacteria | 5350 |
| 19 | JGI25151J46595_10033499 | 3300003187 | Bacteria | 1979 |
| 20 | JGI25165J46597_1000041 | 3300003214 | Bacteria | 272566 |
| 21 | JGI25153J46596_10000395 | 3300003215 | Bacteria | 29365 |
| 22 | JGI25153J46596_10000654 | 3300003215 | Bacteria | 21202 |
| 23 | JGI25153J46596_10027670 | 3300003215 | Bacteria | 1981 |
| 24 | rootH1_10065199 | 3300003316 | Bacteria | 2950 |
| 25 | rootH2_10200773 | 3300003320 | Bacteria | 2994 |
| 26 | rootH1_10176977 | 3300003323 | Bacteria | 1033 |
| 27 | Ga0055525_1000186 | 3300003759 | Bacteria | 75686 |
| 28 | Ga0055542_1000025 | 3300003762 | Bacteria | 263538 |
| 29 | Ga0055542_1004375 | 3300003762 | Bacteria | 3452 |
| 30 | Ga0055529_1000014 | 3300003763 | Bacteria | 367283 |
| 31 | Ga0055526_1007921 | 3300003771 | Bacteria | 5406 |
| 32 | Ga0055537_1001019 | 3300003773 | Bacteria | 12668 |
| 33 | Ga0055537_1003939 | 3300003773 | Bacteria | 4403 |
| 34 | Ga0055524_1000539 | 3300003775 | Bacteria | 28724 |
| 35 | Ga0055536_1002308 | 3300003781 | Bacteria | 10806 |
| 36 | Ga0055536_1004688 | 3300003781 | Bacteria | 6890 |
| 37 | Ga0055536_1006328 | 3300003781 | Bacteria | 5558 |
| 38 | Ga0055536_1020724 | 3300003781 | Bacteria | 2018 |
| 39 | Ga0055528_1024486 | 3300003790 | Bacteria | 1807 |
| 40 | Ga0055530_10000012 | 3300003791 | Bacteria | 164829 |
| 41 | Ga0055530_10007314 | 3300003791 | Bacteria | 4682 |
| 42 | Ga0055540_1002064 | 3300003792 | Bacteria | 11085 |
| 43 | Ga0055531_10000466 | 3300003794 | Bacteria | 37479 |
| 44 | Ga0055531_10006558 | 3300003794 | Bacteria | 6578 |
| 45 | Ga0055543_1015053 | 3300004625 | Bacteria | 1495 |
| 46 | Ga0065165_1003679 | 3300005262 | Bacteria | 10426 |
| 47 | Ga0065165_1018346 | 3300005262 | Bacteria | 2535 |
| 48 | Ga0065165_1018890 | 3300005262 | Bacteria | 2480 |
| 49 | Ga0065165_1029939 | 3300005262 | Bacteria | 1737 |
| 50 | Ga0065165_1052550 | 3300005262 | Bacteria | 1150 |
| 51 | Ga0065165_1053763 | 3300005262 | Bacteria | 1132 |
| 52 | Ga0065704_10102737 | 3300005289 | Bacteria | 2192 |
| 53 | Ga0065704_10124492 | 3300005289 | Bacteria | 1717 |
| 54 | Ga0065707_10000505 | 3300005295 | Bacteria | 50569 |
| 55 | Ga0065707_10098261 | 3300005295 | Bacteria | 3099 |
| 56 | Ga0070658_10002160 | 3300005327 | Bacteria | 16501 |
| 57 | Ga0070658_10003033 | 3300005327 | Bacteria | 13895 |
| 58 | Ga0070676_10202206 | 3300005328 | Bacteria | 1303 |
| 59 | Ga0070670_100000021 | 3300005331 | Bacteria | 202776 |
| 60 | Ga0070670_100004170 | 3300005331 | Bacteria | 12090 |
| 61 | Ga0070670_100130734 | 3300005331 | Bacteria | 2168 |
| 62 | Ga0070666_10000184 | 3300005335 | Bacteria | 42807 |
| 63 | Ga0068868_100949084 | 3300005338 | Bacteria | 784 |
| 64 | Ga0070660_100000264 | 3300005339 | Bacteria | 34742 |
| 65 | Ga0070660_100002081 | 3300005339 | Bacteria | 13821 |
| 66 | Ga0070661_100076930 | 3300005344 | Bacteria | 2459 |
| 67 | Ga0070661_100112882 | 3300005344 | Bacteria | 2030 |
| 68 | Ga0070668_100068244 | 3300005347 | Bacteria | 2764 |
| 69 | Ga0070668_100208292 | 3300005347 | Bacteria | 1607 |
| 70 | Ga0070668_100778248 | 3300005347 | Bacteria | 849 |
| 71 | Ga0070669_100000008 | 3300005353 | Bacteria | 226764 |
| 72 | Ga0070669_100124866 | 3300005353 | Bacteria | 1968 |
| 73 | Ga0070671_100000015 | 3300005355 | Bacteria | 166132 |
| 74 | Ga0070671_100027553 | 3300005355 | Bacteria | 4677 |
| 75 | Ga0070674_100013554 | 3300005356 | Bacteria | 5043 |
| 76 | Ga0070673_100508085 | 3300005364 | Bacteria | 1091 |
| 77 | Ga0070673_101031205 | 3300005364 | Bacteria | 767 |
| 78 | Ga0070659_100306021 | 3300005366 | Bacteria | 1326 |
| 79 | Ga0070667_100000089 | 3300005367 | Bacteria | 113661 |
| 80 | Ga0070667_100000642 | 3300005367 | Bacteria | 33958 |
| 81 | Ga0070711_100090920 | 3300005439 | Bacteria | 2199 |
| 82 | Ga0070708_100148074 | 3300005445 | Bacteria | 2182 |
| 83 | Ga0070708_100658238 | 3300005445 | Bacteria | 987 |
| 84 | Ga0070663_100001723 | 3300005455 | Bacteria | 12131 |
| 85 | Ga0070678_100001546 | 3300005456 | Bacteria | 12294 |
| 86 | Ga0070662_100024637 | 3300005457 | Bacteria | 4148 |
| 87 | Ga0070662_100112452 | 3300005457 | Bacteria | 2076 |
| 88 | Ga0070662_100326198 | 3300005457 | Bacteria | 1253 |
| 89 | Ga0068867_100138893 | 3300005459 | Bacteria | 1897 |
| 90 | Ga0070685_10103920 | 3300005466 | Bacteria | 1739 |
| 91 | Ga0068853_100003716 | 3300005539 | Bacteria | 11716 |
| 92 | Ga0068853_100014059 | 3300005539 | Bacteria | 6551 |
| 93 | Ga0068853_100029990 | 3300005539 | Bacteria | 4591 |
| 94 | Ga0068853_100142612 | 3300005539 | Bacteria | 2151 |
| 95 | Ga0068853_100692327 | 3300005539 | Bacteria | 972 |
| 96 | Ga0070672_100099057 | 3300005543 | Bacteria | 2362 |
| 97 | Ga0070686_100207507 | 3300005544 | Bacteria | 1408 |
| 98 | Ga0070665_100000323 | 3300005548 | Bacteria | 73605 |
| 99 | Ga0070665_100001470 | 3300005548 | Bacteria | 27596 |
| 100 | Ga0070665_100632641 | 3300005548 | Bacteria | 1083 |
| 101 | Ga0068855_100000027 | 3300005563 | Bacteria | 173316 |
| 102 | Ga0068855_100015022 | 3300005563 | Bacteria | 9326 |
| 103 | Ga0068855_100217133 | 3300005563 | Bacteria | 2146 |
| 104 | Ga0068855_100691743 | 3300005563 | Bacteria | 1092 |
| 105 | Ga0070664_100072257 | 3300005564 | Bacteria | 2958 |
| 106 | Ga0068857_100012302 | 3300005577 | Bacteria | 7445 |
| 107 | Ga0068857_100059311 | 3300005577 | Bacteria | 3399 |
| 108 | Ga0068857_100501888 | 3300005577 | Bacteria | 1139 |
| 109 | Ga0068857_100532151 | 3300005577 | Bacteria | 1105 |
| 110 | Ga0068854_100000274 | 3300005578 | Bacteria | 34804 |
| 111 | Ga0068854_100646133 | 3300005578 | Bacteria | 908 |
| 112 | Ga0068856_101251733 | 3300005614 | Bacteria | 758 |
| 113 | Ga0068859_100010259 | 3300005617 | Bacteria | 9429 |
| 114 | Ga0068859_100023533 | 3300005617 | Bacteria | 6181 |
| 115 | Ga0068859_100034581 | 3300005617 | Bacteria | 5071 |
| 116 | Ga0068859_100042554 | 3300005617 | Bacteria | 4563 |
| 117 | Ga0068859_100107837 | 3300005617 | Bacteria | 2846 |
| 118 | Ga0068864_100000004 | 3300005618 | Bacteria | 489341 |
| 119 | Ga0068864_100004712 | 3300005618 | Bacteria | 11179 |
| 120 | Ga0068864_100030140 | 3300005618 | Bacteria | 4598 |
| 121 | Ga0068864_100454486 | 3300005618 | Bacteria | 1225 |
| 122 | Ga0068864_100476278 | 3300005618 | Bacteria | 1198 |
| 123 | Ga0068861_100000001 | 3300005719 | Bacteria | 116118 |
| 124 | Ga0068861_100292112 | 3300005719 | Bacteria | 1408 |
| 125 | Ga0068863_100000002 | 3300005841 | Bacteria | 489510 |
| 126 | Ga0068863_100000582 | 3300005841 | Bacteria | 37202 |
| 127 | Ga0068863_100084694 | 3300005841 | Bacteria | 3004 |
| 128 | Ga0068863_100238697 | 3300005841 | Bacteria | 1754 |
| 129 | Ga0068858_100000327 | 3300005842 | Bacteria | 50180 |
| 130 | Ga0068858_100001357 | 3300005842 | Bacteria | 25195 |
| 131 | Ga0068858_100010355 | 3300005842 | Bacteria | 8831 |
| 132 | Ga0068860_100000148 | 3300005843 | Bacteria | 113661 |
| 133 | Ga0068860_100001081 | 3300005843 | Bacteria | 30047 |
| 134 | Ga0068860_100004358 | 3300005843 | Bacteria | 14457 |
| 135 | Ga0068862_100000002 | 3300005844 | Bacteria | 489341 |
| 136 | Ga0068862_100000169 | 3300005844 | Bacteria | 72633 |
| 137 | Ga0068862_100001451 | 3300005844 | Bacteria | 21840 |
| 138 | Ga0081539_10038957 | 3300005985 | Bacteria | 2810 |
| 139 | Ga0075363_100140735 | 3300006048 | Bacteria | 1358 |
| 140 | Ga0070712_100355960 | 3300006175 | Bacteria | 1199 |
| 141 | Ga0097621_100004842 | 3300006237 | Bacteria | 9428 |
| 142 | Ga0075370_10195218 | 3300006353 | Bacteria | 1193 |
| 143 | Ga0075370_10201922 | 3300006353 | Bacteria | 1173 |
| 144 | Ga0068871_100003701 | 3300006358 | Bacteria | 10515 |
| 145 | Ga0068871_100827471 | 3300006358 | Bacteria | 855 |
| 146 | Ga0075430_100011858 | 3300006846 | Bacteria | 7417 |
| 147 | Ga0068865_100244901 | 3300006881 | Bacteria | 1412 |
| 148 | Ga0068865_100684130 | 3300006881 | Bacteria | 875 |
| 149 | Ga0097620_100010259 | 3300006931 | Bacteria | 9429 |
| 150 | Ga0097620_100023532 | 3300006931 | Bacteria | 6181 |
| 151 | Ga0097620_100034580 | 3300006931 | Bacteria | 5071 |
| 152 | Ga0097620_100042555 | 3300006931 | Bacteria | 4563 |
| 153 | Ga0097620_100107840 | 3300006931 | Bacteria | 2846 |
| 154 | Ga0105251_10001284 | 3300009011 | Bacteria | 21706 |
| 155 | Ga0105251_10153187 | 3300009011 | Bacteria | 1041 |
| 156 | Ga0105245_10032215 | 3300009098 | Bacteria | 4641 |
| 157 | Ga0105247_10001891 | 3300009101 | Bacteria | 14614 |
| 158 | Ga0105247_10012595 | 3300009101 | Bacteria | 5078 |
| 159 | Ga0105247_10212670 | 3300009101 | Bacteria | 1305 |
| 160 | Ga0105243_10000033 | 3300009148 | Bacteria | 180464 |
| 161 | Ga0105243_10109651 | 3300009148 | Bacteria | 2306 |
| 162 | Ga0105241_10001031 | 3300009174 | Bacteria | 21221 |
| 163 | Ga0105241_10006727 | 3300009174 | Bacteria | 8458 |
| 164 | Ga0105248_10000010 | 3300009177 | Bacteria | 344314 |
| 165 | Ga0105248_10001758 | 3300009177 | Bacteria | 24108 |
| 166 | Ga0105248_10088281 | 3300009177 | Bacteria | 3490 |
| 167 | Ga0105248_10673378 | 3300009177 | Bacteria | 1167 |
| 168 | Ga0105237_10002470 | 3300009545 | Bacteria | 22937 |
| 169 | Ga0105237_10115681 | 3300009545 | Bacteria | 2675 |
| 170 | Ga0105237_10205975 | 3300009545 | Bacteria | 1967 |
| 171 | Ga0105237_10835070 | 3300009545 | Bacteria | 928 |
| 172 | Ga0105238_10019927 | 3300009551 | Bacteria | 6826 |
| 173 | Ga0105238_10102613 | 3300009551 | Bacteria | 2842 |
| 174 | Ga0105238_10185628 | 3300009551 | Bacteria | 2056 |
| 175 | Ga0105238_11212722 | 3300009551 | Bacteria | 779 |
| 176 | Ga0105249_10000041 | 3300009553 | Bacteria | 195999 |
| 177 | Ga0105249_10019753 | 3300009553 | Bacteria | 6016 |
| 178 | Ga0105148_100540 | 3300009978 | Bacteria | 3258 |
| 179 | Ga0105239_10003505 | 3300010375 | Bacteria | 19209 |
| 180 | Ga0105239_10269509 | 3300010375 | Bacteria | 1915 |
| 181 | Ga0105239_11197231 | 3300010375 | Bacteria | 875 |
| 182 | Ga0157317_1000660 | 3300012475 | Bacteria | 1594 |
| 183 | Ga0157324_1003292 | 3300012506 | Bacteria | 1048 |
| 184 | Ga0157373_10002690 | 3300013100 | Bacteria | 13470 |
| 185 | Ga0157373_10390160 | 3300013100 | Bacteria | 997 |
| 186 | Ga0157371_10000059 | 3300013102 | Bacteria | 170541 |
| 187 | Ga0157371_10058795 | 3300013102 | Bacteria | 2727 |
| 188 | Ga0157371_10257889 | 3300013102 | Bacteria | 1257 |
| 189 | Ga0157369_10502317 | 3300013105 | Bacteria | 1255 |
| 190 | Ga0157374_10089142 | 3300013296 | Bacteria | 2939 |
| 191 | Ga0157374_10148360 | 3300013296 | Bacteria | 2279 |
| 192 | Ga0157374_10280191 | 3300013296 | Bacteria | 1646 |
| 193 | Ga0157378_10202437 | 3300013297 | Bacteria | 1878 |
| 194 | Ga0157378_10336159 | 3300013297 | Bacteria | 1471 |
| 195 | Ga0157378_10659543 | 3300013297 | Bacteria | 1063 |
| 196 | Ga0163162_10013938 | 3300013306 | Bacteria | 7854 |
| 197 | Ga0163162_10019579 | 3300013306 | Bacteria | 6643 |
| 198 | Ga0163162_10115337 | 3300013306 | Bacteria | 2786 |
| 199 | Ga0163162_10227537 | 3300013306 | Bacteria | 1995 |
| 200 | Ga0163162_10739124 | 3300013306 | Bacteria | 1104 |
| 201 | Ga0163162_10878521 | 3300013306 | Bacteria | 1011 |
| 202 | Ga0157372_10027549 | 3300013307 | Bacteria | 6191 |
| 203 | Ga0157372_10102494 | 3300013307 | Bacteria | 3269 |
| 204 | Ga0157372_10127863 | 3300013307 | Bacteria | 2922 |
| 205 | Ga0157372_10160826 | 3300013307 | Bacteria | 2595 |
| 206 | Ga0157372_10386125 | 3300013307 | Bacteria | 1631 |
| 207 | Ga0157372_11061349 | 3300013307 | Bacteria | 938 |
| 208 | Ga0163163_10030114 | 3300014325 | Bacteria | 5225 |
| 209 | Ga0163163_10116830 | 3300014325 | Bacteria | 2699 |
| 210 | Ga0163163_10580027 | 3300014325 | Bacteria | 1184 |
| 211 | Ga0157380_10001161 | 3300014326 | Bacteria | 17056 |
| 212 | Ga0157380_10058444 | 3300014326 | Bacteria | 3074 |
| 213 | Ga0157380_10594754 | 3300014326 | Bacteria | 1093 |
| 214 | Ga0157380_10734016 | 3300014326 | Bacteria | 997 |
| 215 | Ga0157379_10051644 | 3300014968 | Bacteria | 3672 |
| 216 | Ga0157379_10358376 | 3300014968 | Bacteria | 1336 |
| 217 | Ga0183363_1004 | 3300015690 | Bacteria | 416766 |
| 218 | Ga0183361_10506 | 3300016635 | Bacteria | 1719 |
| 219 | Ga0163161_10030181 | 3300017792 | Bacteria | 3856 |
| 220 | Ga0163161_10973501 | 3300017792 | Bacteria | 723 |
| 221 | Ga0213875_10067638 | 3300021388 | Bacteria | 1669 |
| 222 | Ga0213875_10142835 | 3300021388 | Bacteria | 1121 |
| 223 | Ga0209563_100145 | 3300025230 | Bacteria | 75938 |
| 224 | Ga0209437_103614 | 3300025233 | Bacteria | 2776 |
| 225 | Ga0207425_1000041 | 3300025245 | Bacteria | 210441 |
| 226 | Ga0209677_104936 | 3300025253 | Bacteria | 3640 |
| 227 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 228 | Ga0209148_1000116 | 3300025254 | Bacteria | 190078 |
| 229 | Ga0209129_1004489 | 3300025258 | Bacteria | 5421 |
| 230 | Ga0209233_1000104 | 3300025261 | Bacteria | 272675 |
| 231 | Ga0209565_1000008 | 3300025263 | Bacteria | 774179 |
| 232 | Ga0209565_1000134 | 3300025263 | Bacteria | 104013 |
| 233 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 234 | Ga0209455_1011101 | 3300025272 | Bacteria | 2239 |
| 235 | Ga0209673_1015848 | 3300025273 | Bacteria | 2843 |
| 236 | Ga0207673_1011763 | 3300025290 | Bacteria | 1135 |
| 237 | Ga0209675_1000424 | 3300025291 | Bacteria | 34090 |
| 238 | Ga0209675_1009250 | 3300025291 | Bacteria | 3499 |
| 239 | Ga0209676_1000081 | 3300025292 | Bacteria | 285297 |
| 240 | Ga0209676_1000226 | 3300025292 | Bacteria | 124004 |
| 241 | Ga0209676_1000359 | 3300025292 | Bacteria | 86410 |
| 242 | Ga0209676_1003684 | 3300025292 | Bacteria | 9169 |
| 243 | Ga0209676_1039810 | 3300025292 | Bacteria | 1331 |
| 244 | Ga0209676_1052621 | 3300025292 | Bacteria | 1061 |
| 245 | Ga0209676_1059727 | 3300025292 | Bacteria | 955 |
| 246 | Ga0209025_1000068 | 3300025294 | Bacteria | 294129 |
| 247 | Ga0209025_1027288 | 3300025294 | Bacteria | 2835 |
| 248 | Ga0209564_1000622 | 3300025295 | Bacteria | 53970 |
| 249 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 250 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 251 | Ga0209758_1012697 | 3300025297 | Bacteria | 4679 |
| 252 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 253 | Ga0209050_1000067 | 3300025298 | Bacteria | 304206 |
| 254 | Ga0209050_1000581 | 3300025298 | Bacteria | 59224 |
| 255 | Ga0209050_1007158 | 3300025298 | Bacteria | 6354 |
| 256 | Ga0209050_1066066 | 3300025298 | Bacteria | 830 |
| 257 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 258 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 259 | Ga0209051_1000191 | 3300025303 | Bacteria | 108763 |
| 260 | Ga0209257_1000392 | 3300025304 | Bacteria | 87104 |
| 261 | Ga0209257_1000699 | 3300025304 | Bacteria | 51960 |
| 262 | Ga0209257_1000876 | 3300025304 | Bacteria | 42634 |
| 263 | Ga0209257_1002353 | 3300025304 | Bacteria | 19010 |
| 264 | Ga0209257_1002961 | 3300025304 | Bacteria | 15554 |
| 265 | Ga0209257_1019763 | 3300025304 | Bacteria | 2521 |
| 266 | Ga0209257_1064691 | 3300025304 | Bacteria | 982 |
| 267 | Ga0207697_10006525 | 3300025315 | Bacteria | 5267 |
| 268 | Ga0207656_10002881 | 3300025321 | Bacteria | 5864 |
| 269 | Ga0207656_10301149 | 3300025321 | Bacteria | 794 |
| 270 | Ga0207713_1001586 | 3300025735 | Bacteria | 17804 |
| 271 | Ga0207713_1098423 | 3300025735 | Bacteria | 1014 |
| 272 | Ga0207710_10109423 | 3300025900 | Bacteria | 1311 |
| 273 | Ga0207688_10056252 | 3300025901 | Bacteria | 2209 |
| 274 | Ga0207680_10000186 | 3300025903 | Bacteria | 30147 |
| 275 | Ga0207647_10021855 | 3300025904 | Bacteria | 4260 |
| 276 | Ga0207647_10079207 | 3300025904 | Bacteria | 1973 |
| 277 | Ga0207647_10220922 | 3300025904 | Bacteria | 1092 |
| 278 | Ga0207685_10043304 | 3300025905 | Bacteria | 1695 |
| 279 | Ga0207645_10042648 | 3300025907 | Bacteria | 2903 |
| 280 | Ga0207643_10425215 | 3300025908 | Bacteria | 842 |
| 281 | Ga0207705_10000203 | 3300025909 | Bacteria | 60016 |
| 282 | Ga0207705_10000509 | 3300025909 | Bacteria | 33052 |
| 283 | Ga0207654_10000897 | 3300025911 | Bacteria | 16495 |
| 284 | Ga0207654_10031545 | 3300025911 | Bacteria | 2920 |
| 285 | Ga0207695_10020907 | 3300025913 | Bacteria | 7480 |
| 286 | Ga0207671_10062249 | 3300025914 | Bacteria | 2770 |
| 287 | Ga0207671_10068688 | 3300025914 | Bacteria | 2641 |
| 288 | Ga0207671_10073852 | 3300025914 | Bacteria | 2548 |
| 289 | Ga0207663_10428104 | 3300025916 | Bacteria | 1017 |
| 290 | Ga0207657_10000696 | 3300025919 | Bacteria | 35731 |
| 291 | Ga0207657_10001680 | 3300025919 | Bacteria | 23869 |
| 292 | Ga0207657_10203984 | 3300025919 | Bacteria | 1589 |
| 293 | Ga0207649_10000319 | 3300025920 | Bacteria | 36478 |
| 294 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 295 | Ga0207681_10033288 | 3300025923 | Bacteria | 3378 |
| 296 | Ga0207681_10094028 | 3300025923 | Bacteria | 2147 |
| 297 | Ga0207694_10006961 | 3300025924 | Bacteria | 8586 |
| 298 | Ga0207650_10000083 | 3300025925 | Bacteria | 127270 |
| 299 | Ga0207650_10002904 | 3300025925 | Bacteria | 11832 |
| 300 | Ga0207650_10049447 | 3300025925 | Bacteria | 3105 |
| 301 | Ga0207650_10093528 | 3300025925 | Bacteria | 2301 |
| 302 | Ga0207687_10010076 | 3300025927 | Bacteria | 6180 |
| 303 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 304 | Ga0207644_10198546 | 3300025931 | Bacteria | 1581 |
| 305 | Ga0207690_10006519 | 3300025932 | Bacteria | 6919 |
| 306 | Ga0207706_10015340 | 3300025933 | Bacteria | 6923 |
| 307 | Ga0207706_10027007 | 3300025933 | Bacteria | 5135 |
| 308 | Ga0207706_10269744 | 3300025933 | Bacteria | 1485 |
| 309 | Ga0207709_10000059 | 3300025935 | Bacteria | 211914 |
| 310 | Ga0207709_10850924 | 3300025935 | Bacteria | 739 |
| 311 | Ga0207669_10000341 | 3300025937 | Bacteria | 21234 |
| 312 | Ga0207691_10102784 | 3300025940 | Bacteria | 2549 |
| 313 | Ga0207711_10000035 | 3300025941 | Bacteria | 177223 |
| 314 | Ga0207711_10000852 | 3300025941 | Bacteria | 29486 |
| 315 | Ga0207711_10114106 | 3300025941 | Bacteria | 2406 |
| 316 | Ga0207711_10341418 | 3300025941 | Bacteria | 1386 |
| 317 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 318 | Ga0207667_10000013 | 3300025949 | Bacteria | 435875 |
| 319 | Ga0207667_10016335 | 3300025949 | Bacteria | 8389 |
| 320 | Ga0207667_10058314 | 3300025949 | Bacteria | 4050 |
| 321 | Ga0207667_10324647 | 3300025949 | Bacteria | 1572 |
| 322 | Ga0207667_10650165 | 3300025949 | Bacteria | 1060 |
| 323 | Ga0207651_10087500 | 3300025960 | Bacteria | 2268 |
| 324 | Ga0207712_10000174 | 3300025961 | Bacteria | 66500 |
| 325 | Ga0207712_10000620 | 3300025961 | Bacteria | 28034 |
| 326 | Ga0207712_10018137 | 3300025961 | Bacteria | 4580 |
| 327 | Ga0207668_10005340 | 3300025972 | Bacteria | 7558 |
| 328 | Ga0207668_10331967 | 3300025972 | Bacteria | 1265 |
| 329 | Ga0207640_10000292 | 3300025981 | Bacteria | 33424 |
| 330 | Ga0207640_10012827 | 3300025981 | Bacteria | 4787 |
| 331 | Ga0207658_10000069 | 3300025986 | Bacteria | 113687 |
| 332 | Ga0207658_10000388 | 3300025986 | Bacteria | 42759 |
| 333 | Ga0207658_10018656 | 3300025986 | Bacteria | 4795 |
| 334 | Ga0207677_10824478 | 3300026023 | Bacteria | 832 |
| 335 | Ga0207703_10000244 | 3300026035 | Bacteria | 61520 |
| 336 | Ga0207703_10000775 | 3300026035 | Bacteria | 31437 |
| 337 | Ga0207703_10009134 | 3300026035 | Bacteria | 7806 |
| 338 | Ga0207639_10010727 | 3300026041 | Bacteria | 6346 |
| 339 | Ga0207639_10036303 | 3300026041 | Bacteria | 3651 |
| 340 | Ga0207639_10192979 | 3300026041 | Bacteria | 1741 |
| 341 | Ga0207678_10000982 | 3300026067 | Bacteria | 25980 |
| 342 | Ga0207678_10004733 | 3300026067 | Bacteria | 12224 |
| 343 | Ga0207702_10003062 | 3300026078 | Bacteria | 15548 |
| 344 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 345 | Ga0207641_10002512 | 3300026088 | Bacteria | 16895 |
| 346 | Ga0207641_10003319 | 3300026088 | Bacteria | 14317 |
| 347 | Ga0207641_10014410 | 3300026088 | Bacteria | 6478 |
| 348 | Ga0207648_10160855 | 3300026089 | Bacteria | 1983 |
| 349 | Ga0207648_10349465 | 3300026089 | Bacteria | 1333 |
| 350 | Ga0207676_10000005 | 3300026095 | Bacteria | 698744 |
| 351 | Ga0207676_10003426 | 3300026095 | Bacteria | 11218 |
| 352 | Ga0207676_10022559 | 3300026095 | Bacteria | 4630 |
| 353 | Ga0207676_10206510 | 3300026095 | Bacteria | 1739 |
| 354 | Ga0207676_10617213 | 3300026095 | Bacteria | 1043 |
| 355 | Ga0207674_10018179 | 3300026116 | Bacteria | 7649 |
| 356 | Ga0207674_10018188 | 3300026116 | Bacteria | 7647 |
| 357 | Ga0207674_10099190 | 3300026116 | Bacteria | 2895 |
| 358 | Ga0207675_100000159 | 3300026118 | Bacteria | 59714 |
| 359 | Ga0207675_100000358 | 3300026118 | Bacteria | 43765 |
| 360 | Ga0207675_100264382 | 3300026118 | Bacteria | 1668 |
| 361 | Ga0207683_10029198 | 3300026121 | Bacteria | 4774 |
| 362 | Ga0207698_10011565 | 3300026142 | Bacteria | 5729 |
| 363 | Ga0207698_10317899 | 3300026142 | Bacteria | 1457 |
| 364 | Ga0209983_1085221 | 3300027665 | Bacteria | 710 |
| 365 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 366 | Ga0268266_10000514 | 3300028379 | Bacteria | 54510 |
| 367 | Ga0268266_10702837 | 3300028379 | Bacteria | 974 |
| 368 | Ga0268266_10759444 | 3300028379 | Bacteria | 936 |
| 369 | Ga0268266_11379268 | 3300028379 | Bacteria | 680 |
| 370 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 371 | Ga0268265_10000045 | 3300028380 | Bacteria | 180378 |
| 372 | Ga0268265_10000285 | 3300028380 | Bacteria | 57084 |
| 373 | Ga0268264_10000010 | 3300028381 | Bacteria | 596543 |
| 374 | Ga0268264_10000217 | 3300028381 | Bacteria | 113674 |
| 375 | Ga0307517_10024293 | 3300028786 | Bacteria | 7480 |
| 376 | Ga0316177_1129737 | 3300030731 | Bacteria | 1453 |
| 377 | Ga0316182_1300921 | 3300030745 | Bacteria | 797 |
| 378 | Ga0265327_10194633 | 3300031251 | Bacteria | 921 |
| 379 | Ga0307513_10014913 | 3300031456 | Bacteria | 9444 |
| 380 | Ga0307513_10015546 | 3300031456 | Bacteria | 9224 |
| 381 | Ga0307509_10534043 | 3300031507 | Bacteria | 853 |
| 382 | Ga0307408_100027481 | 3300031548 | Bacteria | 3921 |
| 383 | Ga0307508_10000231 | 3300031616 | Bacteria | 67806 |
| 384 | Ga0307405_10015706 | 3300031731 | Bacteria | 4108 |
| 385 | Ga0307405_10145502 | 3300031731 | Bacteria | 1659 |
| 386 | Ga0307413_10061741 | 3300031824 | Bacteria | 2314 |
| 387 | Ga0307413_10243563 | 3300031824 | Bacteria | 1329 |
| 388 | Ga0307413_10548338 | 3300031824 | Bacteria | 937 |
| 389 | Ga0307406_10151212 | 3300031901 | Bacteria | 1656 |
| 390 | Ga0307406_10430796 | 3300031901 | Bacteria | 1053 |
| 391 | Ga0307406_10507423 | 3300031901 | Bacteria | 979 |
| 392 | Ga0307412_10021915 | 3300031911 | Bacteria | 3908 |
| 393 | Ga0307412_10026353 | 3300031911 | Bacteria | 3612 |
| 394 | Ga0307412_10035791 | 3300031911 | Bacteria | 3175 |
| 395 | Ga0307412_10043907 | 3300031911 | Bacteria | 2914 |
| 396 | Ga0307412_10060005 | 3300031911 | Bacteria | 2551 |
| 397 | Ga0307412_10135773 | 3300031911 | Bacteria | 1794 |
| 398 | Ga0307409_100244787 | 3300031995 | Bacteria | 1635 |
| 399 | Ga0307409_100852810 | 3300031995 | Bacteria | 922 |
| 400 | Ga0307416_100061843 | 3300032002 | Bacteria | 3058 |
| 401 | Ga0307414_10000107 | 3300032004 | Bacteria | 58717 |
| 402 | Ga0307414_10001551 | 3300032004 | Bacteria | 11939 |
| 403 | Ga0307414_10023735 | 3300032004 | Bacteria | 3896 |
| 404 | Ga0307414_10026104 | 3300032004 | Bacteria | 3754 |
| 405 | Ga0307414_10033618 | 3300032004 | Bacteria | 3391 |
| 406 | Ga0307414_10062779 | 3300032004 | Bacteria | 2638 |
| 407 | Ga0307414_10066553 | 3300032004 | Bacteria | 2576 |
| 408 | Ga0307414_10245062 | 3300032004 | Bacteria | 1486 |
| 409 | Ga0307414_10254243 | 3300032004 | Bacteria | 1462 |
| 410 | Ga0307414_10546128 | 3300032004 | Bacteria | 1032 |
| 411 | Ga0307414_11018825 | 3300032004 | Bacteria | 762 |
| 412 | Ga0307411_10049558 | 3300032005 | Bacteria | 2730 |
| 413 | Ga0307411_10147845 | 3300032005 | Bacteria | 1742 |
| 414 | Ga0307411_10890465 | 3300032005 | Bacteria | 790 |
| 415 | Ga0307510_10013885 | 3300033180 | Bacteria | 9543 |
| 416 | Ga0395900_0048519 | 3300037418 | Bacteria | 4374 |
| 417 | Ga0395905_0021359 | 3300037471 | Bacteria | 6122 |
| 418 | Ga0395905_0045049 | 3300037471 | Bacteria | 4138 |
| 419 | Ga0395905_0427708 | 3300037471 | Bacteria | 1221 |
| 420 | Ga0436364_0227850 | 3300037853 | Bacteria | 2778 |
| 421 | Ga0436364_0808965 | 3300037853 | Bacteria | 903 |
| 422 | Ga0436364_0927709 | 3300037853 | Bacteria | 1266 |
| 423 | Ga0436364_1114714 | 3300037853 | Bacteria | 849 |
| 424 | Ga0395901_0053488 | 3300038443 | Bacteria | 4195 |
| 425 | Ga0395901_0691350 | 3300038443 | Bacteria | 1019 |
| 426 | Ga0395901_0980778 | 3300038443 | Bacteria | 822 |
| 427 | Ga0237816_01874 | 3300039145 | Bacteria | 1675 |
| 428 | Ga0436365_0238917 | 3300039437 | Bacteria | 1623 |
| 429 | Ga0436365_1036048 | 3300039437 | Bacteria | 794 |
| 430 | Ga0436363_0009048 | 3300039450 | Bacteria | 2676 |
| 431 | Ga0436363_0704191 | 3300039450 | Bacteria | 1503 |
| 432 | Ga0436363_1301281 | 3300039450 | Bacteria | 2110 |
| 433 | Ga0436363_1484770 | 3300039450 | Bacteria | 1052 |
| 434 | Ga0439436_0009694 | 3300041404 | Bacteria | 2950 |
| 435 | Ga0439439_0001779 | 3300041406 | Bacteria | 4402 |
| 436 | Ga0439461_0000869 | 3300041410 | Bacteria | 4466 |
| 437 | Ga0439461_0003679 | 3300041410 | Bacteria | 2530 |
| 438 | Ga0439465_0004274 | 3300041413 | Bacteria | 4644 |
| 439 | Ga0439465_0004757 | 3300041413 | Bacteria | 4375 |
| 440 | Ga0451791_0479436 | 3300041451 | Bacteria | 1130 |
| 441 | Ga0451798_0093360 | 3300041458 | Bacteria | 845 |
| 442 | Ga0451800_1314371 | 3300041459 | Bacteria | 670 |
| 443 | Ga0451802_0390112 | 3300041460 | Bacteria | 1047 |
| 444 | Ga0451806_777577 | 3300041462 | Bacteria | 3251 |
| 445 | Ga0451804_0363059 | 3300041463 | Bacteria | 1097 |
| 446 | Ga0451807_0002468 | 3300041486 | Bacteria | 1889 |
| 447 | Ga0451807_2054855 | 3300041486 | Bacteria | 983 |
| 448 | Ga0451845_0065833 | 3300041501 | Bacteria | 1535 |
| 449 | Ga0451851_0221820 | 3300041507 | Bacteria | 695 |
| 450 | Ga0439431_0018958 | 3300041997 | Bacteria | 1631 |
| 451 | Ga0439431_0068838 | 3300041997 | Bacteria | 940 |
| 452 | Ga0439442_005410 | 3300042002 | Bacteria | 2554 |
| 453 | Ga0439445_0013018 | 3300042004 | Bacteria | 2008 |
| 454 | Ga0439445_0031083 | 3300042004 | Bacteria | 1386 |
| 455 | Ga0439445_0088329 | 3300042004 | Bacteria | 871 |
| 456 | Ga0439457_023079 | 3300042014 | Bacteria | 1377 |
| 457 | Ga0439462_0005952 | 3300042015 | Bacteria | 3021 |
| 458 | Ga0439462_0010494 | 3300042015 | Bacteria | 2346 |
| 459 | Ga0450919_007466 | 3300042121 | Bacteria | 1278 |
| 460 | Ga0450898_052521 | 3300042134 | Bacteria | 790 |
| 461 | Ga0450909_035741 | 3300042185 | Bacteria | 759 |
| 462 | Ga0439434_0060866 | 3300042435 | Bacteria | 1180 |
| 463 | Ga0451577_0402375 | 3300042876 | Bacteria | 1243 |
| 464 | Ga0466963_0046190 | 3300044694 | Bacteria | 2870 |
| 465 | Ga0466971_0008470 | 3300044719 | Bacteria | 4484 |
| 466 | Ga0466968_0242884 | 3300044735 | Bacteria | 853 |
| 467 | Ga0466957_0779262 | 3300044842 | Bacteria | 678 |
| 468 | Ga0451576_0016444 | 3300045051 | Bacteria | 8166 |
| 469 | Ga0466958_0237286 | 3300045836 | Bacteria | 1165 |
| 470 | Ga0495627_000156 | 3300046453 | Bacteria | 78784 |
| 471 | Ga0495627_000578 | 3300046453 | Bacteria | 29484 |
| 472 | Ga0495638_0000758 | 3300046460 | Bacteria | 34400 |
| 473 | Ga0495638_0006069 | 3300046460 | Bacteria | 8842 |
| 474 | Ga0495650_0000440 | 3300046471 | Bacteria | 66809 |
| 475 | Ga0495650_0028011 | 3300046471 | Bacteria | 2594 |
| 476 | Ga0495605_0144332 | 3300046474 | Bacteria | 1066 |
| 477 | Ga0495585_0081724 | 3300046492 | Bacteria | 1750 |
| 478 | Ga0495607_0086883 | 3300046501 | Bacteria | 1704 |
| 479 | Ga0495583_0000218 | 3300046506 | Bacteria | 96349 |
| 480 | Ga0495583_0000680 | 3300046506 | Bacteria | 44152 |
| 481 | Ga0495583_0022715 | 3300046506 | Bacteria | 3192 |
| 482 | Ga0495606_0009337 | 3300046507 | Bacteria | 8313 |
| 483 | Ga0495606_0136853 | 3300046507 | Bacteria | 1450 |
| 484 | Ga0495610_0000291 | 3300046512 | Bacteria | 52599 |
| 485 | Ga0495610_0039771 | 3300046512 | Bacteria | 2375 |
| 486 | Ga0495616_0001456 | 3300046513 | Bacteria | 16481 |
| 487 | Ga0495616_0132633 | 3300046513 | Bacteria | 1140 |
| 488 | Ga0495631_0122789 | 3300046518 | Bacteria | 1117 |
| 489 | Ga0495637_0006994 | 3300046520 | Bacteria | 5621 |
| 490 | Ga0495637_0010852 | 3300046520 | Bacteria | 4391 |
| 491 | Ga0495643_0001726 | 3300046522 | Bacteria | 18888 |
| 492 | Ga0495643_0002313 | 3300046522 | Bacteria | 15374 |
| 493 | Ga0495643_0038480 | 3300046522 | Bacteria | 2619 |
| 494 | Ga0495648_0000459 | 3300046524 | Bacteria | 44196 |
| 495 | Ga0495648_0010683 | 3300046524 | Bacteria | 6974 |
| 496 | Ga0495648_0042230 | 3300046524 | Bacteria | 2871 |
| 497 | Ga0495663_0003362 | 3300046525 | Bacteria | 4626 |
| 498 | Ga0495663_0013399 | 3300046525 | Bacteria | 2293 |
| 499 | Ga0495642_0029861 | 3300046528 | Bacteria | 2179 |
| 500 | Ga0495597_0020763 | 3300046542 | Bacteria | 3056 |
| 501 | Ga0495622_0050440 | 3300046557 | Bacteria | 1931 |
| 502 | Ga0495622_0099018 | 3300046557 | Bacteria | 1337 |
| 503 | Ga0495633_0005764 | 3300046558 | Bacteria | 7484 |
| 504 | Ga0495633_0013695 | 3300046558 | Bacteria | 4264 |
| 505 | Ga0495633_0019840 | 3300046558 | Bacteria | 3392 |
| 506 | Ga0495633_0085188 | 3300046558 | Bacteria | 1470 |
| 507 | Ga0495668_0000002 | 3300046616 | Bacteria | 763179 |
| 508 | Ga0495668_0000072 | 3300046616 | Bacteria | 167170 |
| 509 | Ga0495668_0045706 | 3300046616 | Bacteria | 2434 |
| 510 | Ga0495611_0023270 | 3300046648 | Bacteria | 2687 |
| 511 | Ga0495625_0000106 | 3300046660 | Bacteria | 125985 |
| 512 | Ga0495625_0000629 | 3300046660 | Bacteria | 51047 |
| 513 | Ga0495625_0000853 | 3300046660 | Bacteria | 41514 |
| 514 | Ga0495625_0038886 | 3300046660 | Bacteria | 3478 |
| 515 | Ga0495625_0085412 | 3300046660 | Bacteria | 2190 |
| 516 | Ga0495661_0152132 | 3300046665 | Bacteria | 1249 |
| 517 | Ga0495661_0157288 | 3300046665 | Bacteria | 1223 |
| 518 | Ga0495669_0000148 | 3300046684 | Bacteria | 44972 |
| 519 | Ga0495670_0000002 | 3300046691 | Bacteria | 601814 |
| 520 | Ga0495670_0010027 | 3300046691 | Bacteria | 4659 |
| 521 | Ga0495670_0069982 | 3300046691 | Bacteria | 1775 |
| 522 | Ga0495671_0181594 | 3300046692 | Bacteria | 1022 |
| 523 | Ga0495649_0047187 | 3300046694 | Bacteria | 2343 |
| 524 | Ga0495600_0021061 | 3300046809 | Bacteria | 4172 |
| 525 | Ga0495660_0023772 | 3300046810 | Bacteria | 3495 |
| 526 | Ga0495660_0102720 | 3300046810 | Bacteria | 1469 |
| 527 | Ga0495683_0006914 | 3300047323 | Bacteria | 6164 |
| 528 | Ga0495683_0148674 | 3300047323 | Bacteria | 1092 |
| 529 | Ga0495687_000068 | 3300047443 | Bacteria | 161081 |
| 530 | Ga0495687_000563 | 3300047443 | Bacteria | 43682 |
| 531 | Ga0495677_0028714 | 3300047445 | Bacteria | 2022 |
| 532 | Ga0495677_0042037 | 3300047445 | Bacteria | 1674 |
| 533 | Ga0495681_0000098 | 3300047470 | Bacteria | 75809 |
| 534 | Ga0495681_0009646 | 3300047470 | Bacteria | 5927 |
| 535 | Ga0495681_0056479 | 3300047470 | Bacteria | 1826 |
| 536 | Ga0495686_0001323 | 3300047472 | Bacteria | 27753 |
| 537 | Ga0495686_0004764 | 3300047472 | Bacteria | 10977 |
| 538 | Ga0495686_0008463 | 3300047472 | Bacteria | 7546 |
| 539 | Ga0495686_0013552 | 3300047472 | Bacteria | 5653 |
| 540 | Ga0495686_0029938 | 3300047472 | Bacteria | 3538 |
| 541 | Ga0495686_0182091 | 3300047472 | Bacteria | 1217 |
| 542 | Ga0495686_0229805 | 3300047472 | Bacteria | 1051 |
| 543 | Ga0496101_0061617 | 3300048904 | Bacteria | 2725 |
| 544 | Ga0496101_0396991 | 3300048904 | Bacteria | 1086 |
| 545 | Ga0496102_0002779 | 3300048905 | Bacteria | 14916 |
| 546 | Ga0496102_0090445 | 3300048905 | Bacteria | 2833 |
| 547 | Ga0496103_0000173 | 3300048906 | Bacteria | 67412 |
| 548 | Ga0496103_0001865 | 3300048906 | Bacteria | 13700 |
| 549 | Ga0496103_0030066 | 3300048906 | Bacteria | 3304 |
| 550 | Ga0496103_0127121 | 3300048906 | Bacteria | 1626 |
| 551 | Ga0496104_0146972 | 3300048907 | Bacteria | 2264 |
| 552 | Ga0496105_0060823 | 3300048908 | Bacteria | 3117 |
| 553 | Ga0496109_0758032 | 3300048912 | Bacteria | 908 |
| 554 | Ga0496110_0026296 | 3300048913 | Bacteria | 4978 |
| 555 | Ga0496111_0447311 | 3300048914 | Bacteria | 953 |
| 556 | Ga0496114_0061278 | 3300048917 | Bacteria | 3146 |
| 557 | Ga0496115_0000269 | 3300048918 | Bacteria | 45856 |
| 558 | Ga0496115_0001129 | 3300048918 | Bacteria | 19266 |
| 559 | Ga0496115_0119697 | 3300048918 | Bacteria | 2166 |
| 560 | Ga0496116_0000566 | 3300048919 | Bacteria | 49509 |
| 561 | Ga0496116_0033048 | 3300048919 | Bacteria | 3677 |
| 562 | Ga0496117_0000485 | 3300048920 | Bacteria | 65840 |
| 563 | Ga0496117_0000887 | 3300048920 | Bacteria | 46091 |
| 564 | Ga0496117_0018342 | 3300048920 | Bacteria | 5800 |
| 565 | Ga0496118_0000190 | 3300048921 | Bacteria | 108017 |
| 566 | Ga0496118_0000463 | 3300048921 | Bacteria | 67382 |
| 567 | Ga0496118_0005843 | 3300048921 | Bacteria | 13797 |
| 568 | Ga0496118_0109131 | 3300048921 | Bacteria | 1843 |
| 569 | Ga0496119_0174429 | 3300048922 | Bacteria | 1132 |
| 570 | Ga0496120_0026787 | 3300048923 | Bacteria | 3555 |
| 571 | Ga0496120_0030374 | 3300048923 | Bacteria | 3286 |
| 572 | Ga0496121_0000296 | 3300048924 | Bacteria | 103215 |
| 573 | Ga0496121_0004850 | 3300048924 | Bacteria | 17692 |
| 574 | Ga0496121_0119109 | 3300048924 | Bacteria | 1997 |
| 575 | Ga0496121_0369233 | 3300048924 | Bacteria | 950 |
| 576 | Ga0496123_0036015 | 3300048926 | Bacteria | 3517 |
| 577 | Ga0496123_0042455 | 3300048926 | Bacteria | 3138 |
| 578 | Ga0496123_0059099 | 3300048926 | Bacteria | 2482 |
| 579 | Ga0496124_0000546 | 3300048927 | Bacteria | 63624 |
| 580 | Ga0496124_0000874 | 3300048927 | Bacteria | 49185 |
| 581 | Ga0496124_0000960 | 3300048927 | Bacteria | 45969 |
| 582 | Ga0496124_0005852 | 3300048927 | Bacteria | 13640 |
| 583 | Ga0496124_0048088 | 3300048927 | Bacteria | 3647 |
| 584 | Ga0496124_0125342 | 3300048927 | Bacteria | 2047 |
| 585 | Ga0496124_0376677 | 3300048927 | Bacteria | 994 |
| 586 | Ga0496124_0401143 | 3300048927 | Bacteria | 952 |
| 587 | Ga0496125_0000956 | 3300048928 | Bacteria | 45452 |
| 588 | Ga0496125_0014358 | 3300048928 | Bacteria | 7717 |
| 589 | Ga0496125_0199205 | 3300048928 | Bacteria | 1313 |
| 590 | Ga0496126_0000321 | 3300048929 | Bacteria | 102445 |
| 591 | Ga0496126_0168808 | 3300048929 | Bacteria | 1865 |
| 592 | Ga0496126_0211430 | 3300048929 | Bacteria | 1633 |
| 593 | Ga0496126_0584953 | 3300048929 | Bacteria | 881 |
| 594 | Ga0495678_014836 | 3300049459 | Bacteria | 3610 |
| 595 | Ga0501290_000237 | 3300049513 | Bacteria | 9135 |
| 596 | Ga0501292_000042 | 3300049515 | Bacteria | 29474 |
| 597 | Ga0501294_000032 | 3300049517 | Bacteria | 13769 |
| 598 | Ga0501300_000392 | 3300049523 | Bacteria | 6689 |
| 599 | Ga0501300_014450 | 3300049523 | Bacteria | 1152 |
| 600 | Ga0501300_016995 | 3300049523 | Bacteria | 1062 |
| 601 | Ga0501314_003132 | 3300049530 | Bacteria | 1321 |
| 602 | Ga0501335_006283 | 3300049551 | Bacteria | 1079 |
| 603 | Ga0501031_0099318 | 3300049568 | Bacteria | 1899 |
| 604 | Ga0501032_0040021 | 3300049569 | Bacteria | 3186 |
| 605 | Ga0501033_0062148 | 3300049570 | Bacteria | 2750 |
| 606 | Ga0501034_0015035 | 3300049571 | Bacteria | 7959 |
| 607 | Ga0501034_0107638 | 3300049571 | Bacteria | 2779 |
| 608 | Ga0501034_0282848 | 3300049571 | Bacteria | 1598 |
| 609 | Ga0501034_0303984 | 3300049571 | Bacteria | 1531 |
| 610 | Ga0501034_0601414 | 3300049571 | Bacteria | 1005 |
| 611 | Ga0501036_0016173 | 3300049572 | Bacteria | 6231 |
| 612 | Ga0501037_0024382 | 3300049573 | Bacteria | 4474 |
| 613 | Ga0501038_0057342 | 3300049574 | Bacteria | 3344 |
| 614 | Ga0501038_0059946 | 3300049574 | Bacteria | 3258 |
| 615 | Ga0501039_0229604 | 3300049575 | Bacteria | 1459 |
| 616 | Ga0501039_0645776 | 3300049575 | Bacteria | 829 |
| 617 | Ga0501042_0358107 | 3300049578 | Bacteria | 1056 |
| 618 | Ga0501043_0041028 | 3300049579 | Bacteria | 3636 |
| 619 | Ga0501046_0036602 | 3300049580 | Bacteria | 3949 |
| 620 | Ga0501047_0074409 | 3300049581 | Bacteria | 3270 |
| 621 | Ga0501047_0130480 | 3300049581 | Bacteria | 2394 |
| 622 | Ga0501048_0196129 | 3300049582 | Bacteria | 1431 |
| 623 | Ga0501069_0002703 | 3300049585 | Bacteria | 9050 |
| 624 | Ga0501071_0279836 | 3300049587 | Bacteria | 1263 |
| 625 | Ga0501206_003378 | 3300049653 | Bacteria | 2028 |
| 626 | Ga0501211_000103 | 3300049658 | Bacteria | 6327 |
| 627 | Ga0501222_001746 | 3300049662 | Bacteria | 3014 |
| 628 | Ga0501222_008414 | 3300049662 | Bacteria | 1368 |
| 629 | Ga0501223_000072 | 3300049663 | Bacteria | 30438 |
| 630 | Ga0501224_000004 | 3300049664 | Bacteria | 169090 |
| 631 | Ga0501233_001952 | 3300049668 | Bacteria | 3587 |
| 632 | Ga0501233_030349 | 3300049668 | Bacteria | 1217 |
| 633 | Ga0501235_001097 | 3300049669 | Bacteria | 5663 |
| 634 | Ga0501257_000049 | 3300049686 | Bacteria | 33138 |
| 635 | Ga0501257_174324 | 3300049686 | Bacteria | 605 |
| 636 | Ga0501261_000021 | 3300049690 | Bacteria | 37511 |
| 637 | Ga0501221_003846 | 3300049704 | Bacteria | 2478 |
| 638 | Ga0501225_0000048 | 3300049705 | Bacteria | 40596 |
| 639 | Ga0501234_004313 | 3300049707 | Bacteria | 2232 |
| 640 | Ga0501279_000010 | 3300049775 | Bacteria | 103375 |
| 641 | Ga0501280_000064 | 3300049776 | Bacteria | 31054 |
| 642 | Ga0501281_00086 | 3300049777 | Bacteria | 10989 |
| 643 | Ga0501282_000404 | 3300049778 | Bacteria | 5157 |
| 644 | Ga0501282_006831 | 3300049778 | Bacteria | 1219 |
| 645 | Ga0501283_001453 | 3300049779 | Bacteria | 3071 |
| 646 | Ga0501035_0018213 | 3300049822 | Bacteria | 6468 |
| 647 | Ga0501044_0192235 | 3300049823 | Bacteria | 2003 |
| 648 | Ga0501226_000018 | 3300049853 | Bacteria | 147268 |
| 649 | nmdc:mga03n38_105808_c1 | 3300050490 | Bacteria | 1363 |
| 650 | nmdc:mga0k408_384420_c1 | 3300050493 | Bacteria | 836 |
| 651 | nmdc:mga07m45_133583_c1 | 3300050496 | Bacteria | 1436 |
| 652 | nmdc:mga0qj67_475486_c1 | 3300050509 | Bacteria | 1006 |
| 653 | Ga0500610_0000607 | 3300053079 | Bacteria | 10987 |
| 654 | Ga0500643_000135 | 3300053087 | Bacteria | 74911 |
| 655 | Ga0500643_000195 | 3300053087 | Bacteria | 57960 |
| 656 | Ga0500643_000644 | 3300053087 | Bacteria | 23511 |
| 657 | Ga0500643_001242 | 3300053087 | Bacteria | 15099 |
| 658 | Ga0500643_003224 | 3300053087 | Bacteria | 7943 |
| 659 | Ga0500643_008402 | 3300053087 | Bacteria | 4060 |
| 660 | Ga0500643_025886 | 3300053087 | Bacteria | 1844 |
| 661 | Ga0500651_0103812 | 3300053093 | Bacteria | 1740 |
| 662 | Ga0500566_0006685 | 3300053094 | Bacteria | 6826 |
| 663 | Ga0500641_0008791 | 3300053096 | Bacteria | 3615 |
| 664 | Ga0500555_000575 | 3300053103 | Bacteria | 14512 |
| 665 | Ga0500562_026290 | 3300053108 | Bacteria | 1525 |
| 666 | Ga0500592_000031 | 3300053116 | Bacteria | 47686 |
| 667 | Ga0500592_002102 | 3300053116 | Bacteria | 3208 |
| 668 | Ga0500592_002248 | 3300053116 | Bacteria | 3112 |
| 669 | Ga0500594_0029115 | 3300053118 | Bacteria | 1442 |
| 670 | Ga0500594_0043684 | 3300053118 | Bacteria | 1237 |
| 671 | Ga0500594_0061312 | 3300053118 | Bacteria | 1085 |
| 672 | Ga0500595_000572 | 3300053119 | Bacteria | 21961 |
| 673 | Ga0500595_001506 | 3300053119 | Bacteria | 12379 |
| 674 | Ga0500607_184075 | 3300053121 | Bacteria | 922 |
| 675 | Ga0500626_146353 | 3300053128 | Bacteria | 986 |
| 676 | Ga0500642_0044565 | 3300053130 | Bacteria | 1933 |
| 677 | Ga0500642_0057188 | 3300053130 | Bacteria | 1740 |
| 678 | Ga0500652_099335 | 3300053131 | Bacteria | 1217 |
| 679 | Ga0500655_000251 | 3300053133 | Bacteria | 12576 |
| 680 | Ga0500658_0001656 | 3300053134 | Bacteria | 8862 |
| 681 | Ga0500658_0006467 | 3300053134 | Bacteria | 4345 |
| 682 | Ga0500658_0014446 | 3300053134 | Bacteria | 2923 |
| 683 | Ga0500658_0119062 | 3300053134 | Bacteria | 1169 |
| 684 | Ga0500559_0003794 | 3300053136 | Bacteria | 7323 |
| 685 | Ga0500559_0070195 | 3300053136 | Bacteria | 1576 |
| 686 | Ga0500559_0211547 | 3300053136 | Bacteria | 914 |
| 687 | Ga0500568_0002370 | 3300053139 | Bacteria | 11148 |
| 688 | Ga0500568_0003157 | 3300053139 | Bacteria | 9385 |
| 689 | Ga0500568_0039397 | 3300053139 | Bacteria | 1908 |
| 690 | Ga0500573_0000086 | 3300053140 | Bacteria | 42361 |
| 691 | Ga0500573_0228123 | 3300053140 | Bacteria | 973 |
| 692 | Ga0500604_0000002 | 3300053151 | Bacteria | 165603 |
| 693 | Ga0500604_0090082 | 3300053151 | Bacteria | 1001 |
| 694 | Ga0500616_0000238 | 3300053153 | Bacteria | 86573 |
| 695 | Ga0500616_0008241 | 3300053153 | Bacteria | 6496 |
| 696 | Ga0500616_0033520 | 3300053153 | Bacteria | 2802 |
| 697 | Ga0500619_000184 | 3300053154 | Bacteria | 14772 |
| 698 | Ga0500619_018582 | 3300053154 | Bacteria | 1955 |
| 699 | Ga0500622_0253895 | 3300053156 | Bacteria | 770 |
| 700 | Ga0500624_000063 | 3300053157 | Bacteria | 65333 |
| 701 | Ga0500627_0000017 | 3300053158 | Bacteria | 119507 |
| 702 | Ga0500627_0001223 | 3300053158 | Bacteria | 7068 |
| 703 | Ga0500627_0027041 | 3300053158 | Bacteria | 2372 |
| 704 | Ga0500627_0057381 | 3300053158 | Bacteria | 1708 |
| 705 | Ga0500636_0027233 | 3300053177 | Bacteria | 3376 |
| 706 | Ga0500636_0058873 | 3300053177 | Bacteria | 2245 |
| 707 | Ga0500645_000002 | 3300053730 | Bacteria | 388892 |
| 708 | Ga0500645_001488 | 3300053730 | Bacteria | 11755 |
| 709 | Ga0500645_026811 | 3300053730 | Bacteria | 1751 |
| 710 | Ga0500596_002198 | 3300053735 | Bacteria | 3867 |
| 711 | Ga0500661_000092 | 3300055283 | Bacteria | 14368 |
| 712 | Ga0466962_0013156 | 3300061719 | Bacteria | 3980 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2958512119 | 2958512766 | 181 |
| 2 | 3300005548 | Ga0070665_100001470 | Ga0070665_10000147021 | 187 |
| 3 | 3300028379 | Ga0268266_10000514 | Ga0268266_1000051435 | 187 |
| 4 | 3300030731 | Ga0316177_1129737 | Ga0316177_11297372 | 187 |
| 5 | 3300031911 | Ga0307412_10035791 | Ga0307412_100357912 | 187 |
| 6 | 3300032005 | Ga0307411_10147845 | Ga0307411_101478452 | 187 |
| 7 | 3300038443 | Ga0395901_0691350 | Ga0395901_0691350_104_667 | 187 |
| 8 | 3300039450 | Ga0436363_0704191 | Ga0436363_0704191_452_1015 | 187 |
| 9 | 3300042004 | Ga0439445_0088329 | Ga0439445_0088329_103_666 | 187 |
| 10 | 3300042134 | Ga0450898_052521 | Ga0450898_052521_107_670 | 187 |
| 11 | 3300048929 | Ga0496126_0211430 | Ga0496126_0211430_95_658 | 187 |
| 12 | 3300049658 | Ga0501211_000103 | Ga0501211_000103_5063_5626 | 187 |
| 13 | 3300050493 | nmdc:mga0k408_384420_c1 | nmdc:mga0k408_384420_c1_76_639 | 187 |
| 14 | 3300005445 | Ga0070708_100658238 | Ga0070708_1006582382 | 188 |
| 15 | 3300005617 | Ga0068859_100107837 | Ga0068859_1001078372 | 188 |
| 16 | 3300006846 | Ga0075430_100011858 | Ga0075430_1000118582 | 188 |
| 17 | 3300006931 | Ga0097620_100107840 | Ga0097620_1001078402 | 188 |
| 18 | 3300049571 | Ga0501034_0282848 | Ga0501034_0282848_172_741 | 188 |
| 19 | 3300050509 | nmdc:mga0qj67_475486_c1 | nmdc:mga0qj67_475486_c1_234_800 | 188 |
| 20 | iso_pu_bacteria | 2582581305 | 2585262262 | 188 |
| 21 | 3300032004 | Ga0307414_10546128 | Ga0307414_105461282 | 189 |
| 22 | 3300041459 | Ga0451800_1314371 | Ga0451800_1314371_70_642 | 189 |
| 23 | 3300053139 | Ga0500568_0002370 | Ga0500568_0002370_476_1045 | 189 |
| 24 | 3300053151 | Ga0500604_0000002 | Ga0500604_0000002_113579_114148 | 189 |
| 25 | 3300053153 | Ga0500616_0000238 | Ga0500616_0000238_64493_65062 | 189 |
| 26 | 3300005439 | Ga0070711_100090920 | Ga0070711_1000909202 | 190 |
| 27 | 3300006175 | Ga0070712_100355960 | Ga0070712_1003559602 | 190 |
| 28 | 3300014326 | Ga0157380_10594754 | Ga0157380_105947541 | 190 |
| 29 | 3300025905 | Ga0207685_10043304 | Ga0207685_100433042 | 190 |
| 30 | 3300025916 | Ga0207663_10428104 | Ga0207663_104281041 | 190 |
| 31 | iso_pu_bacteria | 2643221560 | 2643820705 | 190 |
| 32 | iso_pu_bacteria | 2643221563 | 2643833141 | 190 |
| 33 | iso_pu_bacteria | 2643221608 | 2644053064 | 190 |
| 34 | iso_pu_bacteria | 2852653556 | 2852656191 | 190 |
| 35 | iso_pu_bacteria | 2852680915 | 2852682523 | 190 |
| 36 | iso_pu_bacteria | 8057101203 | 8057101253 | 190 |
| 37 | 3300039450 | Ga0436363_1301281 | Ga0436363_1301281_148_729 | 191 |
| 38 | 3300053087 | Ga0500643_003224 | Ga0500643_003224_3763_4341 | 191 |
| 39 | iso_pu_bacteria | 2852653556 | 2852657136 | 191 |
| 40 | iso_pu_bacteria | 2882806704 | 2882807019 | 191 |
| 41 | 3300001915 | JGI24741J21665_1005598 | JGI24741J21665_10055983 | 192 |
| 42 | 3300001979 | JGI24740J21852_10030584 | JGI24740J21852_100305842 | 192 |
| 43 | 3300001989 | JGI24739J22299_10003471 | JGI24739J22299_100034714 | 192 |
| 44 | 3300001990 | JGI24737J22298_10002915 | JGI24737J22298_100029154 | 192 |
| 45 | 3300002067 | JGI24735J21928_10002382 | JGI24735J21928_100023823 | 192 |
| 46 | 3300002067 | JGI24735J21928_10014433 | JGI24735J21928_100144332 | 192 |
| 47 | 3300002067 | JGI24735J21928_10021894 | JGI24735J21928_100218942 | 192 |
| 48 | 3300002075 | JGI24738J21930_10005613 | JGI24738J21930_100056133 | 192 |
| 49 | 3300003316 | rootH1_10065199 | rootH1_100651994 | 192 |
| 50 | 3300003320 | rootH2_10200773 | rootH2_102007734 | 192 |
| 51 | 3300003762 | Ga0055542_1004375 | Ga0055542_10043754 | 192 |
| 52 | 3300005327 | Ga0070658_10002160 | Ga0070658_1000216013 | 192 |
| 53 | 3300005339 | Ga0070660_100000264 | Ga0070660_10000026429 | 192 |
| 54 | 3300005339 | Ga0070660_100002081 | Ga0070660_1000020819 | 192 |
| 55 | 3300005347 | Ga0070668_100068244 | Ga0070668_1000682442 | 192 |
| 56 | 3300005367 | Ga0070667_100000089 | Ga0070667_10000008915 | 192 |
| 57 | 3300005455 | Ga0070663_100001723 | Ga0070663_1000017232 | 192 |
| 58 | 3300005457 | Ga0070662_100024637 | Ga0070662_1000246372 | 192 |
| 59 | 3300005457 | Ga0070662_100326198 | Ga0070662_1003261982 | 192 |
| 60 | 3300005539 | Ga0068853_100029990 | Ga0068853_1000299904 | 192 |
| 61 | 3300005539 | Ga0068853_100692327 | Ga0068853_1006923271 | 192 |
| 62 | 3300005548 | Ga0070665_100632641 | Ga0070665_1006326411 | 192 |
| 63 | 3300005563 | Ga0068855_100000027 | Ga0068855_100000027120 | 192 |
| 64 | 3300005563 | Ga0068855_100015022 | Ga0068855_10001502211 | 192 |
| 65 | 3300005563 | Ga0068855_100691743 | Ga0068855_1006917432 | 192 |
| 66 | 3300005577 | Ga0068857_100501888 | Ga0068857_1005018882 | 192 |
| 67 | 3300005578 | Ga0068854_100000274 | Ga0068854_10000027419 | 192 |
| 68 | 3300005617 | Ga0068859_100034581 | Ga0068859_1000345816 | 192 |
| 69 | 3300005841 | Ga0068863_100000582 | Ga0068863_1000005829 | 192 |
| 70 | 3300005841 | Ga0068863_100238697 | Ga0068863_1002386974 | 192 |
| 71 | 3300005843 | Ga0068860_100000148 | Ga0068860_100000148116 | 192 |
| 72 | 3300005843 | Ga0068860_100004358 | Ga0068860_1000043585 | 192 |
| 73 | 3300005844 | Ga0068862_100001451 | Ga0068862_10000145114 | 192 |
| 74 | 3300006237 | Ga0097621_100004842 | Ga0097621_1000048426 | 192 |
| 75 | 3300006353 | Ga0075370_10195218 | Ga0075370_101952182 | 192 |
| 76 | 3300006358 | Ga0068871_100003701 | Ga0068871_1000037016 | 192 |
| 77 | 3300006931 | Ga0097620_100034580 | Ga0097620_1000345804 | 192 |
| 78 | 3300009101 | Ga0105247_10012595 | Ga0105247_100125955 | 192 |
| 79 | 3300009174 | Ga0105241_10006727 | Ga0105241_100067279 | 192 |
| 80 | 3300009545 | Ga0105237_10115681 | Ga0105237_101156813 | 192 |
| 81 | 3300009545 | Ga0105237_10835070 | Ga0105237_108350701 | 192 |
| 82 | 3300009551 | Ga0105238_11212722 | Ga0105238_112127221 | 192 |
| 83 | 3300010375 | Ga0105239_10003505 | Ga0105239_100035053 | 192 |
| 84 | 3300010375 | Ga0105239_10269509 | Ga0105239_102695092 | 192 |
| 85 | 3300010375 | Ga0105239_11197231 | Ga0105239_111972311 | 192 |
| 86 | 3300013100 | Ga0157373_10002690 | Ga0157373_1000269011 | 192 |
| 87 | 3300013105 | Ga0157369_10502317 | Ga0157369_105023172 | 192 |
| 88 | 3300013296 | Ga0157374_10089142 | Ga0157374_100891422 | 192 |
| 89 | 3300013306 | Ga0163162_10227537 | Ga0163162_102275372 | 192 |
| 90 | 3300013307 | Ga0157372_10027549 | Ga0157372_100275493 | 192 |
| 91 | 3300013307 | Ga0157372_10102494 | Ga0157372_101024943 | 192 |
| 92 | 3300013307 | Ga0157372_10127863 | Ga0157372_101278632 | 192 |
| 93 | 3300013307 | Ga0157372_10386125 | Ga0157372_103861251 | 192 |
| 94 | 3300014326 | Ga0157380_10734016 | Ga0157380_107340162 | 192 |
| 95 | 3300017792 | Ga0163161_10973501 | Ga0163161_109735011 | 192 |
| 96 | 3300025254 | Ga0209148_1000116 | Ga0209148_100011663 | 192 |
| 97 | 3300025904 | Ga0207647_10021855 | Ga0207647_100218552 | 192 |
| 98 | 3300025904 | Ga0207647_10220922 | Ga0207647_102209222 | 192 |
| 99 | 3300025909 | Ga0207705_10000509 | Ga0207705_1000050913 | 192 |
| 100 | 3300025911 | Ga0207654_10031545 | Ga0207654_100315453 | 192 |
| 101 | 3300025914 | Ga0207671_10062249 | Ga0207671_100622493 | 192 |
| 102 | 3300025919 | Ga0207657_10000696 | Ga0207657_100006969 | 192 |
| 103 | 3300025919 | Ga0207657_10001680 | Ga0207657_1000168011 | 192 |
| 104 | 3300025933 | Ga0207706_10027007 | Ga0207706_100270073 | 192 |
| 105 | 3300025949 | Ga0207667_10000013 | Ga0207667_10000013339 | 192 |
| 106 | 3300025949 | Ga0207667_10058314 | Ga0207667_100583144 | 192 |
| 107 | 3300025949 | Ga0207667_10324647 | Ga0207667_103246472 | 192 |
| 108 | 3300025949 | Ga0207667_10650165 | Ga0207667_106501652 | 192 |
| 109 | 3300025961 | Ga0207712_10000174 | Ga0207712_100001749 | 192 |
| 110 | 3300025972 | Ga0207668_10331967 | Ga0207668_103319672 | 192 |
| 111 | 3300025981 | Ga0207640_10000292 | Ga0207640_1000029219 | 192 |
| 112 | 3300025981 | Ga0207640_10012827 | Ga0207640_100128274 | 192 |
| 113 | 3300025986 | Ga0207658_10000069 | Ga0207658_10000069113 | 192 |
| 114 | 3300026041 | Ga0207639_10010727 | Ga0207639_100107272 | 192 |
| 115 | 3300026041 | Ga0207639_10192979 | Ga0207639_101929791 | 192 |
| 116 | 3300026067 | Ga0207678_10000982 | Ga0207678_1000098210 | 192 |
| 117 | 3300026088 | Ga0207641_10002512 | Ga0207641_1000251210 | 192 |
| 118 | 3300026088 | Ga0207641_10003319 | Ga0207641_100033194 | 192 |
| 119 | 3300026142 | Ga0207698_10317899 | Ga0207698_103178992 | 192 |
| 120 | 3300028379 | Ga0268266_10759444 | Ga0268266_107594441 | 192 |
| 121 | 3300028380 | Ga0268265_10000045 | Ga0268265_100000459 | 192 |
| 122 | 3300028381 | Ga0268264_10000217 | Ga0268264_10000217113 | 192 |
| 123 | 3300031456 | Ga0307513_10015546 | Ga0307513_100155462 | 192 |
| 124 | 3300031731 | Ga0307405_10015706 | Ga0307405_100157062 | 192 |
| 125 | 3300031901 | Ga0307406_10507423 | Ga0307406_105074232 | 192 |
| 126 | 3300031911 | Ga0307412_10135773 | Ga0307412_101357731 | 192 |
| 127 | 3300037418 | Ga0395900_0048519 | Ga0395900_0048519_303_881 | 192 |
| 128 | 3300037471 | Ga0395905_0021359 | Ga0395905_0021359_3355_3933 | 192 |
| 129 | 3300037471 | Ga0395905_0045049 | Ga0395905_0045049_1695_2273 | 192 |
| 130 | 3300038443 | Ga0395901_0053488 | Ga0395901_0053488_1404_1982 | 192 |
| 131 | 3300041458 | Ga0451798_0093360 | Ga0451798_0093360_169_750 | 192 |
| 132 | 3300041460 | Ga0451802_0390112 | Ga0451802_0390112_402_983 | 192 |
| 133 | 3300041462 | Ga0451806_777577 | Ga0451806_777577_2494_3075 | 192 |
| 134 | 3300041463 | Ga0451804_0363059 | Ga0451804_0363059_101_682 | 192 |
| 135 | 3300041486 | Ga0451807_0002468 | Ga0451807_0002468_292_873 | 192 |
| 136 | 3300041501 | Ga0451845_0065833 | Ga0451845_0065833_187_768 | 192 |
| 137 | 3300044694 | Ga0466963_0046190 | Ga0466963_0046190_1813_2391 | 192 |
| 138 | 3300044719 | Ga0466971_0008470 | Ga0466971_0008470_2156_2734 | 192 |
| 139 | 3300044735 | Ga0466968_0242884 | Ga0466968_0242884_136_714 | 192 |
| 140 | 3300044842 | Ga0466957_0779262 | Ga0466957_0779262_65_643 | 192 |
| 141 | 3300045836 | Ga0466958_0237286 | Ga0466958_0237286_65_643 | 192 |
| 142 | 3300046506 | Ga0495583_0000218 | Ga0495583_0000218_86212_86790 | 192 |
| 143 | 3300046691 | Ga0495670_0010027 | Ga0495670_0010027_441_1019 | 192 |
| 144 | 3300047472 | Ga0495686_0004764 | Ga0495686_0004764_10169_10801 | 192 |
| 145 | 3300047472 | Ga0495686_0013552 | Ga0495686_0013552_892_1470 | 192 |
| 146 | 3300048906 | Ga0496103_0000173 | Ga0496103_0000173_17065_17643 | 192 |
| 147 | 3300048912 | Ga0496109_0758032 | Ga0496109_0758032_100_678 | 192 |
| 148 | 3300048919 | Ga0496116_0000566 | Ga0496116_0000566_8295_8873 | 192 |
| 149 | 3300048920 | Ga0496117_0000485 | Ga0496117_0000485_48967_49545 | 192 |
| 150 | 3300048921 | Ga0496118_0000190 | Ga0496118_0000190_48967_49545 | 192 |
| 151 | 3300048921 | Ga0496118_0109131 | Ga0496118_0109131_1193_1771 | 192 |
| 152 | 3300048927 | Ga0496124_0000546 | Ga0496124_0000546_14080_14658 | 192 |
| 153 | 3300048927 | Ga0496124_0401143 | Ga0496124_0401143_154_732 | 192 |
| 154 | 3300048928 | Ga0496125_0014358 | Ga0496125_0014358_640_1218 | 192 |
| 155 | 3300048929 | Ga0496126_0168808 | Ga0496126_0168808_873_1451 | 192 |
| 156 | 3300049513 | Ga0501290_000237 | Ga0501290_000237_5705_6283 | 192 |
| 157 | 3300049515 | Ga0501292_000042 | Ga0501292_000042_26918_27496 | 192 |
| 158 | 3300049517 | Ga0501294_000032 | Ga0501294_000032_3313_3891 | 192 |
| 159 | 3300049523 | Ga0501300_000392 | Ga0501300_000392_4662_5240 | 192 |
| 160 | 3300049551 | Ga0501335_006283 | Ga0501335_006283_292_870 | 192 |
| 161 | 3300049571 | Ga0501034_0303984 | Ga0501034_0303984_116_706 | 192 |
| 162 | 3300049585 | Ga0501069_0002703 | Ga0501069_0002703_730_1320 | 192 |
| 163 | 3300049653 | Ga0501206_003378 | Ga0501206_003378_691_1269 | 192 |
| 164 | 3300049662 | Ga0501222_001746 | Ga0501222_001746_30_608 | 192 |
| 165 | 3300049662 | Ga0501222_008414 | Ga0501222_008414_759_1337 | 192 |
| 166 | 3300049668 | Ga0501233_030349 | Ga0501233_030349_229_807 | 192 |
| 167 | 3300049669 | Ga0501235_001097 | Ga0501235_001097_1584_2162 | 192 |
| 168 | 3300049686 | Ga0501257_174324 | Ga0501257_174324_17_595 | 192 |
| 169 | 3300049690 | Ga0501261_000021 | Ga0501261_000021_23203_23781 | 192 |
| 170 | 3300049704 | Ga0501221_003846 | Ga0501221_003846_1386_1964 | 192 |
| 171 | 3300049775 | Ga0501279_000010 | Ga0501279_000010_10715_11293 | 192 |
| 172 | 3300049776 | Ga0501280_000064 | Ga0501280_000064_13349_13927 | 192 |
| 173 | 3300049777 | Ga0501281_00086 | Ga0501281_00086_1975_2553 | 192 |
| 174 | 3300049778 | Ga0501282_000404 | Ga0501282_000404_1682_2260 | 192 |
| 175 | 3300049779 | Ga0501283_001453 | Ga0501283_001453_1496_2074 | 192 |
| 176 | 3300053087 | Ga0500643_025886 | Ga0500643_025886_1121_1699 | 192 |
| 177 | 3300053093 | Ga0500651_0103812 | Ga0500651_0103812_55_633 | 192 |
| 178 | 3300053103 | Ga0500555_000575 | Ga0500555_000575_9556_10134 | 192 |
| 179 | 3300053118 | Ga0500594_0029115 | Ga0500594_0029115_790_1368 | 192 |
| 180 | 3300053130 | Ga0500642_0057188 | Ga0500642_0057188_90_668 | 192 |
| 181 | 3300053133 | Ga0500655_000251 | Ga0500655_000251_9404_9982 | 192 |
| 182 | 3300053136 | Ga0500559_0211547 | Ga0500559_0211547_62_640 | 192 |
| 183 | 3300053153 | Ga0500616_0008241 | Ga0500616_0008241_4823_5401 | 192 |
| 184 | 3300061719 | Ga0466962_0013156 | Ga0466962_0013156_1138_1716 | 192 |
| 185 | iso_pu_bacteria | 2751185897 | 2753767181 | 192 |
| 186 | 3300001976 | JGI24752J21851_1000644 | JGI24752J21851_10006443 | 193 |
| 187 | 3300001989 | JGI24739J22299_10000162 | JGI24739J22299_1000016217 | 193 |
| 188 | 3300005289 | Ga0065704_10124492 | Ga0065704_101244924 | 193 |
| 189 | 3300005295 | Ga0065707_10000505 | Ga0065707_1000050533 | 193 |
| 190 | 3300005331 | Ga0070670_100000021 | Ga0070670_100000021193 | 193 |
| 191 | 3300005367 | Ga0070667_100000642 | Ga0070667_10000064224 | 193 |
| 192 | 3300005457 | Ga0070662_100112452 | Ga0070662_1001124524 | 193 |
| 193 | 3300005539 | Ga0068853_100003716 | Ga0068853_10000371615 | 193 |
| 194 | 3300005577 | Ga0068857_100059311 | Ga0068857_1000593113 | 193 |
| 195 | 3300005617 | Ga0068859_100042554 | Ga0068859_1000425542 | 193 |
| 196 | 3300005618 | Ga0068864_100000004 | Ga0068864_100000004162 | 193 |
| 197 | 3300005841 | Ga0068863_100000002 | Ga0068863_100000002163 | 193 |
| 198 | 3300005844 | Ga0068862_100000002 | Ga0068862_100000002339 | 193 |
| 199 | 3300006931 | Ga0097620_100042555 | Ga0097620_1000425552 | 193 |
| 200 | 3300009011 | Ga0105251_10001284 | Ga0105251_1000128418 | 193 |
| 201 | 3300009101 | Ga0105247_10212670 | Ga0105247_102126702 | 193 |
| 202 | 3300009177 | Ga0105248_10000010 | Ga0105248_10000010182 | 193 |
| 203 | 3300009551 | Ga0105238_10102613 | Ga0105238_101026132 | 193 |
| 204 | 3300009553 | Ga0105249_10000041 | Ga0105249_10000041130 | 193 |
| 205 | 3300013306 | Ga0163162_10115337 | Ga0163162_101153372 | 193 |
| 206 | 3300014325 | Ga0163163_10116830 | Ga0163163_101168304 | 193 |
| 207 | 3300014326 | Ga0157380_10001161 | Ga0157380_100011618 | 193 |
| 208 | 3300014968 | Ga0157379_10051644 | Ga0157379_100516444 | 193 |
| 209 | 3300025321 | Ga0207656_10301149 | Ga0207656_103011491 | 193 |
| 210 | 3300025735 | Ga0207713_1001586 | Ga0207713_100158616 | 193 |
| 211 | 3300025900 | Ga0207710_10109423 | Ga0207710_101094233 | 193 |
| 212 | 3300025925 | Ga0207650_10000083 | Ga0207650_1000008330 | 193 |
| 213 | 3300025933 | Ga0207706_10015340 | Ga0207706_100153402 | 193 |
| 214 | 3300025941 | Ga0207711_10000035 | Ga0207711_1000003519 | 193 |
| 215 | 3300025961 | Ga0207712_10000620 | Ga0207712_1000062018 | 193 |
| 216 | 3300025986 | Ga0207658_10000388 | Ga0207658_1000038840 | 193 |
| 217 | 3300026088 | Ga0207641_10000002 | Ga0207641_10000002643 | 193 |
| 218 | 3300026095 | Ga0207676_10000005 | Ga0207676_10000005164 | 193 |
| 219 | 3300026116 | Ga0207674_10099190 | Ga0207674_100991901 | 193 |
| 220 | 3300028380 | Ga0268265_10000003 | Ga0268265_10000003346 | 193 |
| 221 | 3300031901 | Ga0307406_10151212 | Ga0307406_101512124 | 193 |
| 222 | 3300031911 | Ga0307412_10026353 | Ga0307412_100263532 | 193 |
| 223 | 3300031995 | Ga0307409_100244787 | Ga0307409_1002447874 | 193 |
| 224 | 3300048904 | Ga0496101_0061617 | Ga0496101_0061617_2094_2678 | 193 |
| 225 | 3300048906 | Ga0496103_0030066 | Ga0496103_0030066_568_1152 | 193 |
| 226 | 3300048920 | Ga0496117_0018342 | Ga0496117_0018342_2055_2639 | 193 |
| 227 | 3300048921 | Ga0496118_0000463 | Ga0496118_0000463_63837_64421 | 193 |
| 228 | 3300049523 | Ga0501300_014450 | Ga0501300_014450_278_874 | 193 |
| 229 | 3300049686 | Ga0501257_000049 | Ga0501257_000049_23350_23946 | 193 |
| 230 | 3300049778 | Ga0501282_006831 | Ga0501282_006831_585_1178 | 193 |
| 231 | 3300053087 | Ga0500643_000135 | Ga0500643_000135_51359_51943 | 193 |
| 232 | 3300053087 | Ga0500643_000195 | Ga0500643_000195_55418_56011 | 193 |
| 233 | 3300053116 | Ga0500592_000031 | Ga0500592_000031_3481_4125 | 193 |
| 234 | 3300053116 | Ga0500592_002248 | Ga0500592_002248_2244_2834 | 193 |
| 235 | 3300053134 | Ga0500658_0119062 | Ga0500658_0119062_177_764 | 193 |
| 236 | 3300053151 | Ga0500604_0090082 | Ga0500604_0090082_115_705 | 193 |
| 237 | 3300053158 | Ga0500627_0001223 | Ga0500627_0001223_4447_5091 | 193 |
| 238 | iso_pu_bacteria | 2512564014 | 2512645202 | 193 |
| 239 | iso_pu_bacteria | 2599185354 | 2600202832 | 193 |
| 240 | iso_pu_bacteria | 2599185359 | 2600225499 | 193 |
| 241 | iso_pu_bacteria | 2643221622 | 2644126035 | 193 |
| 242 | iso_pu_bacteria | 2808606401 | 2809063040 | 193 |
| 243 | iso_pu_bacteria | 2808606404 | 2809079004 | 193 |
| 244 | iso_pu_bacteria | 2808606405 | 2809083621 | 193 |
| 245 | iso_pu_bacteria | 2818991466 | 2819713938 | 193 |
| 246 | iso_pu_bacteria | 2830075706 | 2830076928 | 193 |
| 247 | iso_pu_bacteria | 2848297114 | 2848297403 | 193 |
| 248 | iso_pu_bacteria | 2879163058 | 2879165170 | 193 |
| 249 | iso_pu_bacteria | 2880518877 | 2880520295 | 193 |
| 250 | iso_pu_bacteria | 2895880812 | 2895888358 | 193 |
| 251 | iso_pu_bacteria | 2919709256 | 2919713324 | 193 |
| 252 | iso_pu_bacteria | 2928027323 | 2928030300 | 193 |
| 253 | iso_pu_bacteria | 2928526807 | 2928528500 | 193 |
| 254 | iso_pu_bacteria | 2928968154 | 2928970045 | 193 |
| 255 | iso_pu_bacteria | 2946787523 | 2946789286 | 193 |
| 256 | iso_pu_bacteria | 2984555340 | 2984558877 | 193 |
| 257 | iso_pu_bacteria | 2984564862 | 2984566609 | 193 |
| 258 | iso_pu_bacteria | 2990265787 | 2990267513 | 193 |
| 259 | iso_pu_bacteria | 2993356040 | 2993357805 | 193 |
| 260 | iso_pu_bacteria | 2993693658 | 2993695252 | 193 |
| 261 | 3300003781 | Ga0055536_1002308 | Ga0055536_10023085 | 194 |
| 262 | 3300003781 | Ga0055536_1004688 | Ga0055536_10046881 | 194 |
| 263 | 3300003781 | Ga0055536_1006328 | Ga0055536_10063282 | 194 |
| 264 | 3300003791 | Ga0055530_10000012 | Ga0055530_1000001251 | 194 |
| 265 | 3300003794 | Ga0055531_10000466 | Ga0055531_1000046636 | 194 |
| 266 | 3300003794 | Ga0055531_10006558 | Ga0055531_100065583 | 194 |
| 267 | 3300005338 | Ga0068868_100949084 | Ga0068868_1009490841 | 194 |
| 268 | 3300005617 | Ga0068859_100010259 | Ga0068859_1000102595 | 194 |
| 269 | 3300005618 | Ga0068864_100454486 | Ga0068864_1004544863 | 194 |
| 270 | 3300005719 | Ga0068861_100000001 | Ga0068861_10000000166 | 194 |
| 271 | 3300006881 | Ga0068865_100244901 | Ga0068865_1002449013 | 194 |
| 272 | 3300006931 | Ga0097620_100010259 | Ga0097620_1000102598 | 194 |
| 273 | 3300009177 | Ga0105248_10001758 | Ga0105248_1000175819 | 194 |
| 274 | 3300014325 | Ga0163163_10580027 | Ga0163163_105800272 | 194 |
| 275 | 3300014968 | Ga0157379_10358376 | Ga0157379_103583763 | 194 |
| 276 | 3300021388 | Ga0213875_10067638 | Ga0213875_100676382 | 194 |
| 277 | 3300025291 | Ga0209675_1000424 | Ga0209675_10004248 | 194 |
| 278 | 3300025292 | Ga0209676_1000081 | Ga0209676_1000081202 | 194 |
| 279 | 3300025292 | Ga0209676_1000226 | Ga0209676_100022624 | 194 |
| 280 | 3300025292 | Ga0209676_1000359 | Ga0209676_100035953 | 194 |
| 281 | 3300025292 | Ga0209676_1039810 | Ga0209676_10398102 | 194 |
| 282 | 3300025292 | Ga0209676_1052621 | Ga0209676_10526212 | 194 |
| 283 | 3300025292 | Ga0209676_1059727 | Ga0209676_10597272 | 194 |
| 284 | 3300025294 | Ga0209025_1027288 | Ga0209025_10272882 | 194 |
| 285 | 3300025298 | Ga0209050_1000067 | Ga0209050_1000067273 | 194 |
| 286 | 3300025298 | Ga0209050_1066066 | Ga0209050_10660661 | 194 |
| 287 | 3300025304 | Ga0209257_1000392 | Ga0209257_100039221 | 194 |
| 288 | 3300025304 | Ga0209257_1000699 | Ga0209257_100069910 | 194 |
| 289 | 3300025304 | Ga0209257_1002961 | Ga0209257_10029616 | 194 |
| 290 | 3300025941 | Ga0207711_10000852 | Ga0207711_1000085219 | 194 |
| 291 | 3300026023 | Ga0207677_10824478 | Ga0207677_108244781 | 194 |
| 292 | 3300026095 | Ga0207676_10617213 | Ga0207676_106172131 | 194 |
| 293 | 3300026118 | Ga0207675_100000159 | Ga0207675_1000001593 | 194 |
| 294 | 3300027665 | Ga0209983_1085221 | Ga0209983_10852211 | 194 |
| 295 | 3300030745 | Ga0316182_1300921 | Ga0316182_13009212 | 194 |
| 296 | 3300031251 | Ga0265327_10194633 | Ga0265327_101946332 | 194 |
| 297 | 3300031548 | Ga0307408_100027481 | Ga0307408_1000274814 | 194 |
| 298 | 3300031731 | Ga0307405_10145502 | Ga0307405_101455023 | 194 |
| 299 | 3300031824 | Ga0307413_10243563 | Ga0307413_102435633 | 194 |
| 300 | 3300031901 | Ga0307406_10430796 | Ga0307406_104307962 | 194 |
| 301 | 3300031911 | Ga0307412_10021915 | Ga0307412_100219153 | 194 |
| 302 | 3300031911 | Ga0307412_10043907 | Ga0307412_100439073 | 194 |
| 303 | 3300032002 | Ga0307416_100061843 | Ga0307416_1000618432 | 194 |
| 304 | 3300032004 | Ga0307414_10000107 | Ga0307414_100001075 | 194 |
| 305 | 3300032004 | Ga0307414_10001551 | Ga0307414_100015515 | 194 |
| 306 | 3300032004 | Ga0307414_10023735 | Ga0307414_100237353 | 194 |
| 307 | 3300032004 | Ga0307414_10026104 | Ga0307414_100261042 | 194 |
| 308 | 3300032004 | Ga0307414_10033618 | Ga0307414_100336182 | 194 |
| 309 | 3300032004 | Ga0307414_10062779 | Ga0307414_100627794 | 194 |
| 310 | 3300032004 | Ga0307414_10254243 | Ga0307414_102542431 | 194 |
| 311 | 3300032004 | Ga0307414_11018825 | Ga0307414_110188251 | 194 |
| 312 | 3300037471 | Ga0395905_0427708 | Ga0395905_0427708_255_848 | 194 |
| 313 | 3300037853 | Ga0436364_0227850 | Ga0436364_0227850_1660_2280 | 194 |
| 314 | 3300037853 | Ga0436364_0808965 | Ga0436364_0808965_30_659 | 194 |
| 315 | 3300037853 | Ga0436364_0927709 | Ga0436364_0927709_151_783 | 194 |
| 316 | 3300039437 | Ga0436365_1036048 | Ga0436365_1036048_124_756 | 194 |
| 317 | 3300039450 | Ga0436363_0009048 | Ga0436363_0009048_301_900 | 194 |
| 318 | 3300039450 | Ga0436363_1484770 | Ga0436363_1484770_338_934 | 194 |
| 319 | 3300042876 | Ga0451577_0402375 | Ga0451577_0402375_519_1133 | 194 |
| 320 | 3300045051 | Ga0451576_0016444 | Ga0451576_0016444_2132_2734 | 194 |
| 321 | 3300046522 | Ga0495643_0002313 | Ga0495643_0002313_5342_5983 | 194 |
| 322 | 3300046616 | Ga0495668_0000002 | Ga0495668_0000002_707640_708230 | 194 |
| 323 | 3300046660 | Ga0495625_0000853 | Ga0495625_0000853_37792_38382 | 194 |
| 324 | 3300048927 | Ga0496124_0125342 | Ga0496124_0125342_100_699 | 194 |
| 325 | 3300048929 | Ga0496126_0584953 | Ga0496126_0584953_73_672 | 194 |
| 326 | 3300049523 | Ga0501300_016995 | Ga0501300_016995_141_731 | 194 |
| 327 | 3300049530 | Ga0501314_003132 | Ga0501314_003132_330_914 | 194 |
| 328 | 3300049568 | Ga0501031_0099318 | Ga0501031_0099318_367_960 | 194 |
| 329 | 3300049569 | Ga0501032_0040021 | Ga0501032_0040021_1485_2078 | 194 |
| 330 | 3300049570 | Ga0501033_0062148 | Ga0501033_0062148_548_1141 | 194 |
| 331 | 3300049571 | Ga0501034_0015035 | Ga0501034_0015035_5098_5691 | 194 |
| 332 | 3300049571 | Ga0501034_0107638 | Ga0501034_0107638_2149_2733 | 194 |
| 333 | 3300049572 | Ga0501036_0016173 | Ga0501036_0016173_3701_4294 | 194 |
| 334 | 3300049573 | Ga0501037_0024382 | Ga0501037_0024382_2243_2836 | 194 |
| 335 | 3300049574 | Ga0501038_0057342 | Ga0501038_0057342_2219_2812 | 194 |
| 336 | 3300049575 | Ga0501039_0645776 | Ga0501039_0645776_61_654 | 194 |
| 337 | 3300049578 | Ga0501042_0358107 | Ga0501042_0358107_135_728 | 194 |
| 338 | 3300049579 | Ga0501043_0041028 | Ga0501043_0041028_823_1416 | 194 |
| 339 | 3300049580 | Ga0501046_0036602 | Ga0501046_0036602_2028_2621 | 194 |
| 340 | 3300049581 | Ga0501047_0074409 | Ga0501047_0074409_2145_2738 | 194 |
| 341 | 3300049582 | Ga0501048_0196129 | Ga0501048_0196129_247_840 | 194 |
| 342 | 3300049663 | Ga0501223_000072 | Ga0501223_000072_8233_8817 | 194 |
| 343 | 3300049664 | Ga0501224_000004 | Ga0501224_000004_110585_111169 | 194 |
| 344 | 3300049668 | Ga0501233_001952 | Ga0501233_001952_1663_2247 | 194 |
| 345 | 3300049705 | Ga0501225_0000048 | Ga0501225_0000048_28381_28965 | 194 |
| 346 | 3300049707 | Ga0501234_004313 | Ga0501234_004313_46_630 | 194 |
| 347 | 3300049822 | Ga0501035_0018213 | Ga0501035_0018213_3607_4200 | 194 |
| 348 | 3300049853 | Ga0501226_000018 | Ga0501226_000018_57901_58485 | 194 |
| 349 | 3300053116 | Ga0500592_002102 | Ga0500592_002102_1085_1678 | 194 |
| 350 | 3300053139 | Ga0500568_0003157 | Ga0500568_0003157_6113_6703 | 194 |
| 351 | 3300053140 | Ga0500573_0000086 | Ga0500573_0000086_25385_25969 | 194 |
| 352 | 3300053154 | Ga0500619_000184 | Ga0500619_000184_5464_6111 | 194 |
| 353 | 3300053158 | Ga0500627_0000017 | Ga0500627_0000017_5911_6504 | 194 |
| 354 | 3300053158 | Ga0500627_0057381 | Ga0500627_0057381_831_1430 | 194 |
| 355 | 3300013102 | Ga0157371_10257889 | Ga0157371_102578892 | 195 |
| 356 | 3300031824 | Ga0307413_10061741 | Ga0307413_100617413 | 195 |
| 357 | 3300032004 | Ga0307414_10066553 | Ga0307414_100665533 | 195 |
| 358 | 3300032004 | Ga0307414_10245062 | Ga0307414_102450622 | 195 |
| 359 | 3300032005 | Ga0307411_10049558 | Ga0307411_100495585 | 195 |
| 360 | 3300032005 | Ga0307411_10890465 | Ga0307411_108904651 | 195 |
| 361 | 3300038443 | Ga0395901_0980778 | Ga0395901_0980778_59_655 | 195 |
| 362 | 3300048904 | Ga0496101_0396991 | Ga0496101_0396991_269_865 | 195 |
| 363 | 3300048905 | Ga0496102_0002779 | Ga0496102_0002779_6406_7002 | 195 |
| 364 | 3300048906 | Ga0496103_0001865 | Ga0496103_0001865_44_640 | 195 |
| 365 | 3300048907 | Ga0496104_0146972 | Ga0496104_0146972_68_664 | 195 |
| 366 | 3300048908 | Ga0496105_0060823 | Ga0496105_0060823_2311_2907 | 195 |
| 367 | 3300048913 | Ga0496110_0026296 | Ga0496110_0026296_202_798 | 195 |
| 368 | 3300048914 | Ga0496111_0447311 | Ga0496111_0447311_141_737 | 195 |
| 369 | 3300048917 | Ga0496114_0061278 | Ga0496114_0061278_2478_3074 | 195 |
| 370 | 3300048918 | Ga0496115_0000269 | Ga0496115_0000269_32201_32797 | 195 |
| 371 | 3300048919 | Ga0496116_0033048 | Ga0496116_0033048_2849_3445 | 195 |
| 372 | 3300048920 | Ga0496117_0000887 | Ga0496117_0000887_32432_33028 | 195 |
| 373 | 3300048921 | Ga0496118_0005843 | Ga0496118_0005843_13066_13662 | 195 |
| 374 | 3300048922 | Ga0496119_0174429 | Ga0496119_0174429_360_956 | 195 |
| 375 | 3300048923 | Ga0496120_0026787 | Ga0496120_0026787_66_662 | 195 |
| 376 | 3300048924 | Ga0496121_0004850 | Ga0496121_0004850_13058_13654 | 195 |
| 377 | 3300048927 | Ga0496124_0000960 | Ga0496124_0000960_13071_13667 | 195 |
| 378 | 3300048929 | Ga0496126_0000321 | Ga0496126_0000321_69490_70086 | 195 |
| 379 | 3300049571 | Ga0501034_0601414 | Ga0501034_0601414_42_644 | 195 |
| 380 | 3300001915 | JGI24741J21665_1000574 | JGI24741J21665_10005749 | 196 |
| 381 | 3300001979 | JGI24740J21852_10011115 | JGI24740J21852_100111155 | 196 |
| 382 | 3300001990 | JGI24737J22298_10022907 | JGI24737J22298_100229073 | 196 |
| 383 | 3300003215 | JGI25153J46596_10000654 | JGI25153J46596_1000065418 | 196 |
| 384 | 3300003323 | rootH1_10176977 | rootH1_101769771 | 196 |
| 385 | 3300003759 | Ga0055525_1000186 | Ga0055525_100018666 | 196 |
| 386 | 3300003762 | Ga0055542_1000025 | Ga0055542_1000025168 | 196 |
| 387 | 3300003763 | Ga0055529_1000014 | Ga0055529_100001485 | 196 |
| 388 | 3300005327 | Ga0070658_10003033 | Ga0070658_100030336 | 196 |
| 389 | 3300005328 | Ga0070676_10202206 | Ga0070676_102022062 | 196 |
| 390 | 3300005344 | Ga0070661_100076930 | Ga0070661_1000769302 | 196 |
| 391 | 3300005344 | Ga0070661_100112882 | Ga0070661_1001128822 | 196 |
| 392 | 3300005347 | Ga0070668_100778248 | Ga0070668_1007782482 | 196 |
| 393 | 3300005356 | Ga0070674_100013554 | Ga0070674_1000135542 | 196 |
| 394 | 3300005364 | Ga0070673_100508085 | Ga0070673_1005080851 | 196 |
| 395 | 3300005366 | Ga0070659_100306021 | Ga0070659_1003060211 | 196 |
| 396 | 3300005456 | Ga0070678_100001546 | Ga0070678_1000015462 | 196 |
| 397 | 3300005459 | Ga0068867_100138893 | Ga0068867_1001388932 | 196 |
| 398 | 3300005539 | Ga0068853_100142612 | Ga0068853_1001426122 | 196 |
| 399 | 3300005543 | Ga0070672_100099057 | Ga0070672_1000990572 | 196 |
| 400 | 3300005548 | Ga0070665_100000323 | Ga0070665_10000032355 | 196 |
| 401 | 3300005563 | Ga0068855_100217133 | Ga0068855_1002171332 | 196 |
| 402 | 3300005564 | Ga0070664_100072257 | Ga0070664_1000722573 | 196 |
| 403 | 3300005577 | Ga0068857_100532151 | Ga0068857_1005321512 | 196 |
| 404 | 3300006358 | Ga0068871_100827471 | Ga0068871_1008274712 | 196 |
| 405 | 3300006881 | Ga0068865_100684130 | Ga0068865_1006841302 | 196 |
| 406 | 3300009148 | Ga0105243_10000033 | Ga0105243_10000033165 | 196 |
| 407 | 3300009174 | Ga0105241_10001031 | Ga0105241_1000103111 | 196 |
| 408 | 3300009545 | Ga0105237_10205975 | Ga0105237_102059753 | 196 |
| 409 | 3300012475 | Ga0157317_1000660 | Ga0157317_10006602 | 196 |
| 410 | 3300012506 | Ga0157324_1003292 | Ga0157324_10032922 | 196 |
| 411 | 3300013102 | Ga0157371_10000059 | Ga0157371_10000059109 | 196 |
| 412 | 3300013296 | Ga0157374_10280191 | Ga0157374_102801913 | 196 |
| 413 | 3300013297 | Ga0157378_10202437 | Ga0157378_102024372 | 196 |
| 414 | 3300013297 | Ga0157378_10336159 | Ga0157378_103361592 | 196 |
| 415 | 3300013307 | Ga0157372_10160826 | Ga0157372_101608263 | 196 |
| 416 | 3300017792 | Ga0163161_10030181 | Ga0163161_100301814 | 196 |
| 417 | 3300025230 | Ga0209563_100145 | Ga0209563_10014519 | 196 |
| 418 | 3300025253 | Ga0209677_104936 | Ga0209677_1049363 | 196 |
| 419 | 3300025254 | Ga0209148_1000011 | Ga0209148_100001187 | 196 |
| 420 | 3300025272 | Ga0209455_1000006 | Ga0209455_10000061107 | 196 |
| 421 | 3300025297 | Ga0209758_1000001 | Ga0209758_1000001731 | 196 |
| 422 | 3300025321 | Ga0207656_10002881 | Ga0207656_100028816 | 196 |
| 423 | 3300025901 | Ga0207688_10056252 | Ga0207688_100562522 | 196 |
| 424 | 3300025904 | Ga0207647_10079207 | Ga0207647_100792073 | 196 |
| 425 | 3300025907 | Ga0207645_10042648 | Ga0207645_100426483 | 196 |
| 426 | 3300025908 | Ga0207643_10425215 | Ga0207643_104252151 | 196 |
| 427 | 3300025909 | Ga0207705_10000203 | Ga0207705_1000020364 | 196 |
| 428 | 3300025911 | Ga0207654_10000897 | Ga0207654_1000089716 | 196 |
| 429 | 3300025913 | Ga0207695_10020907 | Ga0207695_100209075 | 196 |
| 430 | 3300025914 | Ga0207671_10068688 | Ga0207671_100686883 | 196 |
| 431 | 3300025919 | Ga0207657_10203984 | Ga0207657_102039841 | 196 |
| 432 | 3300025920 | Ga0207649_10000319 | Ga0207649_1000031938 | 196 |
| 433 | 3300025924 | Ga0207694_10006961 | Ga0207694_100069618 | 196 |
| 434 | 3300025925 | Ga0207650_10093528 | Ga0207650_100935282 | 196 |
| 435 | 3300025932 | Ga0207690_10006519 | Ga0207690_100065196 | 196 |
| 436 | 3300025933 | Ga0207706_10269744 | Ga0207706_102697442 | 196 |
| 437 | 3300025935 | Ga0207709_10000059 | Ga0207709_1000005989 | 196 |
| 438 | 3300025937 | Ga0207669_10000341 | Ga0207669_100003418 | 196 |
| 439 | 3300025940 | Ga0207691_10102784 | Ga0207691_101027843 | 196 |
| 440 | 3300025949 | Ga0207667_10000002 | Ga0207667_1000000251 | 196 |
| 441 | 3300025949 | Ga0207667_10016335 | Ga0207667_100163355 | 196 |
| 442 | 3300025960 | Ga0207651_10087500 | Ga0207651_100875003 | 196 |
| 443 | 3300026067 | Ga0207678_10004733 | Ga0207678_100047335 | 196 |
| 444 | 3300026078 | Ga0207702_10003062 | Ga0207702_1000306213 | 196 |
| 445 | 3300026089 | Ga0207648_10160855 | Ga0207648_101608552 | 196 |
| 446 | 3300026116 | Ga0207674_10018179 | Ga0207674_100181793 | 196 |
| 447 | 3300026121 | Ga0207683_10029198 | Ga0207683_100291986 | 196 |
| 448 | 3300026142 | Ga0207698_10011565 | Ga0207698_100115654 | 196 |
| 449 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000022967 | 196 |
| 450 | 3300028786 | Ga0307517_10024293 | Ga0307517_100242937 | 196 |
| 451 | 3300031456 | Ga0307513_10014913 | Ga0307513_100149131 | 196 |
| 452 | 3300031507 | Ga0307509_10534043 | Ga0307509_105340432 | 196 |
| 453 | 3300031911 | Ga0307412_10060005 | Ga0307412_100600054 | 196 |
| 454 | 3300041451 | Ga0451791_0479436 | Ga0451791_0479436_98_727 | 196 |
| 455 | 3300046471 | Ga0495650_0000440 | Ga0495650_0000440_39812_40441 | 196 |
| 456 | 3300046471 | Ga0495650_0028011 | Ga0495650_0028011_1879_2490 | 196 |
| 457 | 3300046474 | Ga0495605_0144332 | Ga0495605_0144332_197_826 | 196 |
| 458 | 3300046492 | Ga0495585_0081724 | Ga0495585_0081724_806_1435 | 196 |
| 459 | 3300046506 | Ga0495583_0000680 | Ga0495583_0000680_16865_17494 | 196 |
| 460 | 3300046506 | Ga0495583_0022715 | Ga0495583_0022715_955_1584 | 196 |
| 461 | 3300046507 | Ga0495606_0009337 | Ga0495606_0009337_4813_5442 | 196 |
| 462 | 3300046507 | Ga0495606_0136853 | Ga0495606_0136853_159_788 | 196 |
| 463 | 3300046513 | Ga0495616_0132633 | Ga0495616_0132633_175_804 | 196 |
| 464 | 3300046520 | Ga0495637_0006994 | Ga0495637_0006994_3455_4084 | 196 |
| 465 | 3300046522 | Ga0495643_0001726 | Ga0495643_0001726_7665_8294 | 196 |
| 466 | 3300046522 | Ga0495643_0038480 | Ga0495643_0038480_658_1287 | 196 |
| 467 | 3300046524 | Ga0495648_0000459 | Ga0495648_0000459_32396_33025 | 196 |
| 468 | 3300046524 | Ga0495648_0042230 | Ga0495648_0042230_566_1195 | 196 |
| 469 | 3300046525 | Ga0495663_0003362 | Ga0495663_0003362_3201_3830 | 196 |
| 470 | 3300046528 | Ga0495642_0029861 | Ga0495642_0029861_1055_1684 | 196 |
| 471 | 3300046542 | Ga0495597_0020763 | Ga0495597_0020763_137_766 | 196 |
| 472 | 3300046557 | Ga0495622_0050440 | Ga0495622_0050440_360_989 | 196 |
| 473 | 3300046558 | Ga0495633_0005764 | Ga0495633_0005764_1651_2280 | 196 |
| 474 | 3300046558 | Ga0495633_0019840 | Ga0495633_0019840_1995_2624 | 196 |
| 475 | 3300046616 | Ga0495668_0000072 | Ga0495668_0000072_17170_17799 | 196 |
| 476 | 3300046648 | Ga0495611_0023270 | Ga0495611_0023270_163_792 | 196 |
| 477 | 3300046660 | Ga0495625_0000106 | Ga0495625_0000106_103499_104128 | 196 |
| 478 | 3300046660 | Ga0495625_0085412 | Ga0495625_0085412_1444_2073 | 196 |
| 479 | 3300046665 | Ga0495661_0157288 | Ga0495661_0157288_545_1174 | 196 |
| 480 | 3300046684 | Ga0495669_0000148 | Ga0495669_0000148_7497_8126 | 196 |
| 481 | 3300046691 | Ga0495670_0069982 | Ga0495670_0069982_153_782 | 196 |
| 482 | 3300046692 | Ga0495671_0181594 | Ga0495671_0181594_85_714 | 196 |
| 483 | 3300046694 | Ga0495649_0047187 | Ga0495649_0047187_807_1436 | 196 |
| 484 | 3300046809 | Ga0495600_0021061 | Ga0495600_0021061_708_1337 | 196 |
| 485 | 3300046810 | Ga0495660_0023772 | Ga0495660_0023772_1371_2000 | 196 |
| 486 | 3300047323 | Ga0495683_0006914 | Ga0495683_0006914_3287_3916 | 196 |
| 487 | 3300047323 | Ga0495683_0148674 | Ga0495683_0148674_170_799 | 196 |
| 488 | 3300047443 | Ga0495687_000068 | Ga0495687_000068_35342_35971 | 196 |
| 489 | 3300047443 | Ga0495687_000563 | Ga0495687_000563_14997_15626 | 196 |
| 490 | 3300047445 | Ga0495677_0042037 | Ga0495677_0042037_271_900 | 196 |
| 491 | 3300047470 | Ga0495681_0056479 | Ga0495681_0056479_201_830 | 196 |
| 492 | 3300047472 | Ga0495686_0182091 | Ga0495686_0182091_216_845 | 196 |
| 493 | 3300048926 | Ga0496123_0036015 | Ga0496123_0036015_674_1303 | 196 |
| 494 | 3300048928 | Ga0496125_0000956 | Ga0496125_0000956_13060_13689 | 196 |
| 495 | 3300053079 | Ga0500610_0000607 | Ga0500610_0000607_4378_5007 | 196 |
| 496 | 3300053119 | Ga0500595_001506 | Ga0500595_001506_6205_6834 | 196 |
| 497 | 3300053121 | Ga0500607_184075 | Ga0500607_184075_71_700 | 196 |
| 498 | 3300053130 | Ga0500642_0044565 | Ga0500642_0044565_386_1015 | 196 |
| 499 | 3300053154 | Ga0500619_018582 | Ga0500619_018582_25_654 | 196 |
| 500 | 3300053177 | Ga0500636_0027233 | Ga0500636_0027233_538_1167 | 196 |
| 501 | 3300053730 | Ga0500645_000002 | Ga0500645_000002_351858_352487 | 196 |
| 502 | 3300053735 | Ga0500596_002198 | Ga0500596_002198_2511_3140 | 196 |
| 503 | iso_pu_bacteria | 2885429604 | 2885429811 | 196 |
| 504 | 2162886007 | SwRhRL2b_contig_209707 | SwRhRL2b_0642.00005780 | 197 |
| 505 | 3300001990 | JGI24737J22298_10001306 | JGI24737J22298_100013066 | 197 |
| 506 | 3300002239 | JGI24034J26672_10028667 | JGI24034J26672_100286671 | 197 |
| 507 | 3300002773 | JGI25152J39213_1032197 | JGI25152J39213_10321971 | 197 |
| 508 | 3300002774 | JGI25150J39212_1001984 | JGI25150J39212_10019842 | 197 |
| 509 | 3300003187 | JGI25151J46595_10033499 | JGI25151J46595_100334992 | 197 |
| 510 | 3300003214 | JGI25165J46597_1000041 | JGI25165J46597_1000041226 | 197 |
| 511 | 3300003215 | JGI25153J46596_10000395 | JGI25153J46596_1000039519 | 197 |
| 512 | 3300003215 | JGI25153J46596_10027670 | JGI25153J46596_100276702 | 197 |
| 513 | 3300003771 | Ga0055526_1007921 | Ga0055526_10079212 | 197 |
| 514 | 3300003773 | Ga0055537_1001019 | Ga0055537_10010197 | 197 |
| 515 | 3300003773 | Ga0055537_1003939 | Ga0055537_10039393 | 197 |
| 516 | 3300003775 | Ga0055524_1000539 | Ga0055524_100053934 | 197 |
| 517 | 3300003781 | Ga0055536_1020724 | Ga0055536_10207242 | 197 |
| 518 | 3300003790 | Ga0055528_1024486 | Ga0055528_10244862 | 197 |
| 519 | 3300003791 | Ga0055530_10007314 | Ga0055530_100073145 | 197 |
| 520 | 3300003792 | Ga0055540_1002064 | Ga0055540_100206411 | 197 |
| 521 | 3300004625 | Ga0055543_1015053 | Ga0055543_10150532 | 197 |
| 522 | 3300005262 | Ga0065165_1003679 | Ga0065165_10036799 | 197 |
| 523 | 3300005262 | Ga0065165_1018346 | Ga0065165_10183462 | 197 |
| 524 | 3300005262 | Ga0065165_1018890 | Ga0065165_10188902 | 197 |
| 525 | 3300005262 | Ga0065165_1029939 | Ga0065165_10299391 | 197 |
| 526 | 3300005262 | Ga0065165_1052550 | Ga0065165_10525501 | 197 |
| 527 | 3300005262 | Ga0065165_1053763 | Ga0065165_10537632 | 197 |
| 528 | 3300005289 | Ga0065704_10102737 | Ga0065704_101027372 | 197 |
| 529 | 3300005295 | Ga0065707_10098261 | Ga0065707_100982612 | 197 |
| 530 | 3300005331 | Ga0070670_100004170 | Ga0070670_10000417018 | 197 |
| 531 | 3300005331 | Ga0070670_100130734 | Ga0070670_1001307341 | 197 |
| 532 | 3300005335 | Ga0070666_10000184 | Ga0070666_1000018425 | 197 |
| 533 | 3300005347 | Ga0070668_100208292 | Ga0070668_1002082921 | 197 |
| 534 | 3300005353 | Ga0070669_100000008 | Ga0070669_10000000848 | 197 |
| 535 | 3300005353 | Ga0070669_100124866 | Ga0070669_1001248664 | 197 |
| 536 | 3300005355 | Ga0070671_100000015 | Ga0070671_100000015141 | 197 |
| 537 | 3300005355 | Ga0070671_100027553 | Ga0070671_1000275536 | 197 |
| 538 | 3300005364 | Ga0070673_101031205 | Ga0070673_1010312051 | 197 |
| 539 | 3300005445 | Ga0070708_100148074 | Ga0070708_1001480743 | 197 |
| 540 | 3300005466 | Ga0070685_10103920 | Ga0070685_101039202 | 197 |
| 541 | 3300005539 | Ga0068853_100014059 | Ga0068853_1000140595 | 197 |
| 542 | 3300005544 | Ga0070686_100207507 | Ga0070686_1002075073 | 197 |
| 543 | 3300005577 | Ga0068857_100012302 | Ga0068857_1000123023 | 197 |
| 544 | 3300005578 | Ga0068854_100646133 | Ga0068854_1006461332 | 197 |
| 545 | 3300005614 | Ga0068856_101251733 | Ga0068856_1012517332 | 197 |
| 546 | 3300005617 | Ga0068859_100023533 | Ga0068859_1000235333 | 197 |
| 547 | 3300005618 | Ga0068864_100004712 | Ga0068864_1000047122 | 197 |
| 548 | 3300005618 | Ga0068864_100030140 | Ga0068864_1000301406 | 197 |
| 549 | 3300005618 | Ga0068864_100476278 | Ga0068864_1004762783 | 197 |
| 550 | 3300005719 | Ga0068861_100292112 | Ga0068861_1002921122 | 197 |
| 551 | 3300005841 | Ga0068863_100084694 | Ga0068863_1000846943 | 197 |
| 552 | 3300005842 | Ga0068858_100000327 | Ga0068858_10000032743 | 197 |
| 553 | 3300005842 | Ga0068858_100001357 | Ga0068858_10000135713 | 197 |
| 554 | 3300005842 | Ga0068858_100010355 | Ga0068858_10001035510 | 197 |
| 555 | 3300005843 | Ga0068860_100001081 | Ga0068860_10000108115 | 197 |
| 556 | 3300005844 | Ga0068862_100000169 | Ga0068862_1000001693 | 197 |
| 557 | 3300005985 | Ga0081539_10038957 | Ga0081539_100389572 | 197 |
| 558 | 3300006048 | Ga0075363_100140735 | Ga0075363_1001407352 | 197 |
| 559 | 3300006353 | Ga0075370_10201922 | Ga0075370_102019222 | 197 |
| 560 | 3300006931 | Ga0097620_100023532 | Ga0097620_1000235328 | 197 |
| 561 | 3300009011 | Ga0105251_10153187 | Ga0105251_101531871 | 197 |
| 562 | 3300009098 | Ga0105245_10032215 | Ga0105245_100322157 | 197 |
| 563 | 3300009101 | Ga0105247_10001891 | Ga0105247_1000189117 | 197 |
| 564 | 3300009148 | Ga0105243_10109651 | Ga0105243_101096512 | 197 |
| 565 | 3300009177 | Ga0105248_10088281 | Ga0105248_100882814 | 197 |
| 566 | 3300009177 | Ga0105248_10673378 | Ga0105248_106733783 | 197 |
| 567 | 3300009545 | Ga0105237_10002470 | Ga0105237_100024702 | 197 |
| 568 | 3300009551 | Ga0105238_10019927 | Ga0105238_100199272 | 197 |
| 569 | 3300009551 | Ga0105238_10185628 | Ga0105238_101856282 | 197 |
| 570 | 3300009553 | Ga0105249_10019753 | Ga0105249_100197533 | 197 |
| 571 | 3300009978 | Ga0105148_100540 | Ga0105148_1005403 | 197 |
| 572 | 3300013100 | Ga0157373_10390160 | Ga0157373_103901603 | 197 |
| 573 | 3300013102 | Ga0157371_10058795 | Ga0157371_100587952 | 197 |
| 574 | 3300013296 | Ga0157374_10148360 | Ga0157374_101483602 | 197 |
| 575 | 3300013297 | Ga0157378_10659543 | Ga0157378_106595431 | 197 |
| 576 | 3300013306 | Ga0163162_10013938 | Ga0163162_100139388 | 197 |
| 577 | 3300013306 | Ga0163162_10019579 | Ga0163162_100195795 | 197 |
| 578 | 3300013306 | Ga0163162_10739124 | Ga0163162_107391242 | 197 |
| 579 | 3300013306 | Ga0163162_10878521 | Ga0163162_108785211 | 197 |
| 580 | 3300013307 | Ga0157372_11061349 | Ga0157372_110613492 | 197 |
| 581 | 3300014325 | Ga0163163_10030114 | Ga0163163_100301148 | 197 |
| 582 | 3300014326 | Ga0157380_10058444 | Ga0157380_100584445 | 197 |
| 583 | 3300015690 | Ga0183363_1004 | Ga0183363_1004235 | 197 |
| 584 | 3300016635 | Ga0183361_10506 | Ga0183361_105063 | 197 |
| 585 | 3300021388 | Ga0213875_10142835 | Ga0213875_101428353 | 197 |
| 586 | 3300025233 | Ga0209437_103614 | Ga0209437_1036143 | 197 |
| 587 | 3300025245 | Ga0207425_1000041 | Ga0207425_100004160 | 197 |
| 588 | 3300025258 | Ga0209129_1004489 | Ga0209129_10044895 | 197 |
| 589 | 3300025261 | Ga0209233_1000104 | Ga0209233_1000104230 | 197 |
| 590 | 3300025263 | Ga0209565_1000008 | Ga0209565_1000008636 | 197 |
| 591 | 3300025263 | Ga0209565_1000134 | Ga0209565_100013444 | 197 |
| 592 | 3300025272 | Ga0209455_1011101 | Ga0209455_10111013 | 197 |
| 593 | 3300025273 | Ga0209673_1015848 | Ga0209673_10158482 | 197 |
| 594 | 3300025290 | Ga0207673_1011763 | Ga0207673_10117631 | 197 |
| 595 | 3300025291 | Ga0209675_1009250 | Ga0209675_10092502 | 197 |
| 596 | 3300025292 | Ga0209676_1003684 | Ga0209676_100368410 | 197 |
| 597 | 3300025294 | Ga0209025_1000068 | Ga0209025_1000068229 | 197 |
| 598 | 3300025295 | Ga0209564_1000622 | Ga0209564_100062259 | 197 |
| 599 | 3300025297 | Ga0209758_1000004 | Ga0209758_1000004128 | 197 |
| 600 | 3300025297 | Ga0209758_1012697 | Ga0209758_10126974 | 197 |
| 601 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000012058 | 197 |
| 602 | 3300025298 | Ga0209050_1000581 | Ga0209050_100058121 | 197 |
| 603 | 3300025298 | Ga0209050_1007158 | Ga0209050_10071586 | 197 |
| 604 | 3300025299 | Ga0209256_1000009 | Ga0209256_1000009233 | 197 |
| 605 | 3300025299 | Ga0209256_1000010 | Ga0209256_1000010157 | 197 |
| 606 | 3300025303 | Ga0209051_1000191 | Ga0209051_100019111 | 197 |
| 607 | 3300025304 | Ga0209257_1000876 | Ga0209257_10008768 | 197 |
| 608 | 3300025304 | Ga0209257_1002353 | Ga0209257_10023537 | 197 |
| 609 | 3300025304 | Ga0209257_1019763 | Ga0209257_10197632 | 197 |
| 610 | 3300025304 | Ga0209257_1064691 | Ga0209257_10646911 | 197 |
| 611 | 3300025315 | Ga0207697_10006525 | Ga0207697_100065253 | 197 |
| 612 | 3300025735 | Ga0207713_1098423 | Ga0207713_10984232 | 197 |
| 613 | 3300025903 | Ga0207680_10000186 | Ga0207680_1000018612 | 197 |
| 614 | 3300025914 | Ga0207671_10073852 | Ga0207671_100738522 | 197 |
| 615 | 3300025923 | Ga0207681_10000002 | Ga0207681_10000002140 | 197 |
| 616 | 3300025923 | Ga0207681_10033288 | Ga0207681_100332881 | 197 |
| 617 | 3300025923 | Ga0207681_10094028 | Ga0207681_100940283 | 197 |
| 618 | 3300025925 | Ga0207650_10002904 | Ga0207650_1000290413 | 197 |
| 619 | 3300025925 | Ga0207650_10049447 | Ga0207650_100494473 | 197 |
| 620 | 3300025927 | Ga0207687_10010076 | Ga0207687_100100763 | 197 |
| 621 | 3300025931 | Ga0207644_10000002 | Ga0207644_10000002139 | 197 |
| 622 | 3300025931 | Ga0207644_10198546 | Ga0207644_101985462 | 197 |
| 623 | 3300025935 | Ga0207709_10850924 | Ga0207709_108509242 | 197 |
| 624 | 3300025941 | Ga0207711_10114106 | Ga0207711_101141064 | 197 |
| 625 | 3300025941 | Ga0207711_10341418 | Ga0207711_103414183 | 197 |
| 626 | 3300025961 | Ga0207712_10018137 | Ga0207712_100181373 | 197 |
| 627 | 3300025972 | Ga0207668_10005340 | Ga0207668_1000534011 | 197 |
| 628 | 3300025986 | Ga0207658_10018656 | Ga0207658_100186566 | 197 |
| 629 | 3300026035 | Ga0207703_10000244 | Ga0207703_1000024455 | 197 |
| 630 | 3300026035 | Ga0207703_10000775 | Ga0207703_1000077513 | 197 |
| 631 | 3300026035 | Ga0207703_10009134 | Ga0207703_1000913410 | 197 |
| 632 | 3300026041 | Ga0207639_10036303 | Ga0207639_100363035 | 197 |
| 633 | 3300026088 | Ga0207641_10014410 | Ga0207641_100144107 | 197 |
| 634 | 3300026089 | Ga0207648_10349465 | Ga0207648_103494652 | 197 |
| 635 | 3300026095 | Ga0207676_10003426 | Ga0207676_1000342615 | 197 |
| 636 | 3300026095 | Ga0207676_10022559 | Ga0207676_100225593 | 197 |
| 637 | 3300026095 | Ga0207676_10206510 | Ga0207676_102065103 | 197 |
| 638 | 3300026116 | Ga0207674_10018188 | Ga0207674_100181883 | 197 |
| 639 | 3300026118 | Ga0207675_100000358 | Ga0207675_1000003588 | 197 |
| 640 | 3300026118 | Ga0207675_100264382 | Ga0207675_1002643822 | 197 |
| 641 | 3300028379 | Ga0268266_10702837 | Ga0268266_107028372 | 197 |
| 642 | 3300028379 | Ga0268266_11379268 | Ga0268266_113792681 | 197 |
| 643 | 3300028380 | Ga0268265_10000285 | Ga0268265_1000028542 | 197 |
| 644 | 3300028381 | Ga0268264_10000010 | Ga0268264_10000010357 | 197 |
| 645 | 3300031616 | Ga0307508_10000231 | Ga0307508_1000023139 | 197 |
| 646 | 3300031824 | Ga0307413_10548338 | Ga0307413_105483381 | 197 |
| 647 | 3300031995 | Ga0307409_100852810 | Ga0307409_1008528102 | 197 |
| 648 | 3300033180 | Ga0307510_10013885 | Ga0307510_100138853 | 197 |
| 649 | 3300037853 | Ga0436364_1114714 | Ga0436364_1114714_177_806 | 197 |
| 650 | 3300039145 | Ga0237816_01874 | Ga0237816_01874_738_1334 | 197 |
| 651 | 3300039437 | Ga0436365_0238917 | Ga0436365_0238917_550_1179 | 197 |
| 652 | 3300041404 | Ga0439436_0009694 | Ga0439436_0009694_590_1219 | 197 |
| 653 | 3300041406 | Ga0439439_0001779 | Ga0439439_0001779_699_1328 | 197 |
| 654 | 3300041410 | Ga0439461_0000869 | Ga0439461_0000869_621_1250 | 197 |
| 655 | 3300041410 | Ga0439461_0003679 | Ga0439461_0003679_1713_2342 | 197 |
| 656 | 3300041413 | Ga0439465_0004274 | Ga0439465_0004274_465_1094 | 197 |
| 657 | 3300041413 | Ga0439465_0004757 | Ga0439465_0004757_1145_1774 | 197 |
| 658 | 3300041486 | Ga0451807_2054855 | Ga0451807_2054855_92_721 | 197 |
| 659 | 3300041507 | Ga0451851_0221820 | Ga0451851_0221820_44_673 | 197 |
| 660 | 3300041997 | Ga0439431_0018958 | Ga0439431_0018958_503_1132 | 197 |
| 661 | 3300041997 | Ga0439431_0068838 | Ga0439431_0068838_26_655 | 197 |
| 662 | 3300042002 | Ga0439442_005410 | Ga0439442_005410_261_890 | 197 |
| 663 | 3300042004 | Ga0439445_0013018 | Ga0439445_0013018_529_1158 | 197 |
| 664 | 3300042004 | Ga0439445_0031083 | Ga0439445_0031083_103_732 | 197 |
| 665 | 3300042014 | Ga0439457_023079 | Ga0439457_023079_444_1073 | 197 |
| 666 | 3300042015 | Ga0439462_0005952 | Ga0439462_0005952_1856_2485 | 197 |
| 667 | 3300042015 | Ga0439462_0010494 | Ga0439462_0010494_274_903 | 197 |
| 668 | 3300042121 | Ga0450919_007466 | Ga0450919_007466_89_718 | 197 |
| 669 | 3300042185 | Ga0450909_035741 | Ga0450909_035741_62_691 | 197 |
| 670 | 3300042435 | Ga0439434_0060866 | Ga0439434_0060866_67_696 | 197 |
| 671 | 3300046453 | Ga0495627_000156 | Ga0495627_000156_30065_30685 | 197 |
| 672 | 3300046453 | Ga0495627_000578 | Ga0495627_000578_24101_24712 | 197 |
| 673 | 3300046460 | Ga0495638_0000758 | Ga0495638_0000758_24315_24944 | 197 |
| 674 | 3300046460 | Ga0495638_0006069 | Ga0495638_0006069_3707_4300 | 197 |
| 675 | 3300046501 | Ga0495607_0086883 | Ga0495607_0086883_405_1025 | 197 |
| 676 | 3300046512 | Ga0495610_0000291 | Ga0495610_0000291_50482_51102 | 197 |
| 677 | 3300046512 | Ga0495610_0039771 | Ga0495610_0039771_277_888 | 197 |
| 678 | 3300046513 | Ga0495616_0001456 | Ga0495616_0001456_3799_4392 | 197 |
| 679 | 3300046518 | Ga0495631_0122789 | Ga0495631_0122789_210_821 | 197 |
| 680 | 3300046520 | Ga0495637_0010852 | Ga0495637_0010852_1250_1870 | 197 |
| 681 | 3300046524 | Ga0495648_0010683 | Ga0495648_0010683_4943_5554 | 197 |
| 682 | 3300046525 | Ga0495663_0013399 | Ga0495663_0013399_769_1398 | 197 |
| 683 | 3300046557 | Ga0495622_0099018 | Ga0495622_0099018_681_1310 | 197 |
| 684 | 3300046558 | Ga0495633_0013695 | Ga0495633_0013695_3432_4028 | 197 |
| 685 | 3300046558 | Ga0495633_0085188 | Ga0495633_0085188_503_1123 | 197 |
| 686 | 3300046616 | Ga0495668_0045706 | Ga0495668_0045706_688_1317 | 197 |
| 687 | 3300046660 | Ga0495625_0000629 | Ga0495625_0000629_10175_10804 | 197 |
| 688 | 3300046660 | Ga0495625_0038886 | Ga0495625_0038886_77_724 | 197 |
| 689 | 3300046665 | Ga0495661_0152132 | Ga0495661_0152132_46_666 | 197 |
| 690 | 3300046691 | Ga0495670_0000002 | Ga0495670_0000002_84088_84717 | 197 |
| 691 | 3300046810 | Ga0495660_0102720 | Ga0495660_0102720_751_1371 | 197 |
| 692 | 3300047445 | Ga0495677_0028714 | Ga0495677_0028714_1215_1844 | 197 |
| 693 | 3300047470 | Ga0495681_0000098 | Ga0495681_0000098_10671_11291 | 197 |
| 694 | 3300047470 | Ga0495681_0009646 | Ga0495681_0009646_5106_5735 | 197 |
| 695 | 3300047472 | Ga0495686_0001323 | Ga0495686_0001323_19378_20019 | 197 |
| 696 | 3300047472 | Ga0495686_0008463 | Ga0495686_0008463_4316_4936 | 197 |
| 697 | 3300047472 | Ga0495686_0029938 | Ga0495686_0029938_810_1439 | 197 |
| 698 | 3300047472 | Ga0495686_0229805 | Ga0495686_0229805_24_653 | 197 |
| 699 | 3300048905 | Ga0496102_0090445 | Ga0496102_0090445_1635_2231 | 197 |
| 700 | 3300048906 | Ga0496103_0127121 | Ga0496103_0127121_802_1431 | 197 |
| 701 | 3300048918 | Ga0496115_0001129 | Ga0496115_0001129_14138_14767 | 197 |
| 702 | 3300048918 | Ga0496115_0119697 | Ga0496115_0119697_646_1275 | 197 |
| 703 | 3300048923 | Ga0496120_0030374 | Ga0496120_0030374_116_745 | 197 |
| 704 | 3300048924 | Ga0496121_0000296 | Ga0496121_0000296_30165_30794 | 197 |
| 705 | 3300048924 | Ga0496121_0119109 | Ga0496121_0119109_444_1097 | 197 |
| 706 | 3300048924 | Ga0496121_0369233 | Ga0496121_0369233_278_907 | 197 |
| 707 | 3300048926 | Ga0496123_0042455 | Ga0496123_0042455_1449_2078 | 197 |
| 708 | 3300048926 | Ga0496123_0059099 | Ga0496123_0059099_534_1166 | 197 |
| 709 | 3300048927 | Ga0496124_0000874 | Ga0496124_0000874_17929_18558 | 197 |
| 710 | 3300048927 | Ga0496124_0005852 | Ga0496124_0005852_8525_9154 | 197 |
| 711 | 3300048927 | Ga0496124_0048088 | Ga0496124_0048088_2607_3236 | 197 |
| 712 | 3300048927 | Ga0496124_0376677 | Ga0496124_0376677_232_834 | 197 |
| 713 | 3300048928 | Ga0496125_0199205 | Ga0496125_0199205_448_1077 | 197 |
| 714 | 3300049459 | Ga0495678_014836 | Ga0495678_014836_2355_2975 | 197 |
| 715 | 3300049574 | Ga0501038_0059946 | Ga0501038_0059946_1986_2582 | 197 |
| 716 | 3300049575 | Ga0501039_0229604 | Ga0501039_0229604_95_691 | 197 |
| 717 | 3300049581 | Ga0501047_0130480 | Ga0501047_0130480_64_705 | 197 |
| 718 | 3300049587 | Ga0501071_0279836 | Ga0501071_0279836_23_652 | 197 |
| 719 | 3300049823 | Ga0501044_0192235 | Ga0501044_0192235_941_1570 | 197 |
| 720 | 3300050490 | nmdc:mga03n38_105808_c1 | nmdc:mga03n38_105808_c1_682_1311 | 197 |
| 721 | 3300050496 | nmdc:mga07m45_133583_c1 | nmdc:mga07m45_133583_c1_579_1208 | 197 |
| 722 | 3300053087 | Ga0500643_000644 | Ga0500643_000644_8673_9266 | 197 |
| 723 | 3300053087 | Ga0500643_001242 | Ga0500643_001242_13675_14322 | 197 |
| 724 | 3300053087 | Ga0500643_008402 | Ga0500643_008402_71_700 | 197 |
| 725 | 3300053094 | Ga0500566_0006685 | Ga0500566_0006685_992_1621 | 197 |
| 726 | 3300053096 | Ga0500641_0008791 | Ga0500641_0008791_2846_3475 | 197 |
| 727 | 3300053108 | Ga0500562_026290 | Ga0500562_026290_513_1109 | 197 |
| 728 | 3300053118 | Ga0500594_0043684 | Ga0500594_0043684_26_655 | 197 |
| 729 | 3300053118 | Ga0500594_0061312 | Ga0500594_0061312_170_799 | 197 |
| 730 | 3300053119 | Ga0500595_000572 | Ga0500595_000572_15662_16291 | 197 |
| 731 | 3300053128 | Ga0500626_146353 | Ga0500626_146353_21_650 | 197 |
| 732 | 3300053131 | Ga0500652_099335 | Ga0500652_099335_448_1077 | 197 |
| 733 | 3300053134 | Ga0500658_0001656 | Ga0500658_0001656_7554_8183 | 197 |
| 734 | 3300053134 | Ga0500658_0006467 | Ga0500658_0006467_3325_3957 | 197 |
| 735 | 3300053134 | Ga0500658_0014446 | Ga0500658_0014446_1741_2370 | 197 |
| 736 | 3300053136 | Ga0500559_0003794 | Ga0500559_0003794_2543_3136 | 197 |
| 737 | 3300053136 | Ga0500559_0070195 | Ga0500559_0070195_603_1232 | 197 |
| 738 | 3300053139 | Ga0500568_0039397 | Ga0500568_0039397_781_1410 | 197 |
| 739 | 3300053140 | Ga0500573_0228123 | Ga0500573_0228123_20_631 | 197 |
| 740 | 3300053153 | Ga0500616_0033520 | Ga0500616_0033520_162_791 | 197 |
| 741 | 3300053156 | Ga0500622_0253895 | Ga0500622_0253895_79_699 | 197 |
| 742 | 3300053157 | Ga0500624_000063 | Ga0500624_000063_27503_28099 | 197 |
| 743 | 3300053158 | Ga0500627_0027041 | Ga0500627_0027041_1645_2238 | 197 |
| 744 | 3300053177 | Ga0500636_0058873 | Ga0500636_0058873_336_929 | 197 |
| 745 | 3300053730 | Ga0500645_001488 | Ga0500645_001488_982_1611 | 197 |
| 746 | 3300053730 | Ga0500645_026811 | Ga0500645_026811_515_1144 | 197 |
| 747 | 3300055283 | Ga0500661_000092 | Ga0500661_000092_9451_10044 | 197 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3h5j-assembly1.cif.gz_A | leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis | 0.9556 | 1 | 166 |
| 2hcu-assembly1.cif.gz_A | crystal structure of smu.1381 (or leud) from streptococcus mutans | 0.9467 | 1 | 166 |
| 3h5j-assembly1.cif.gz_A | leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis | 0.9391 | 1 | 166 |
| 3h5e-assembly2.cif.gz_B | leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis | 0.9246 | 4 | 153 |
| 3q3w-assembly1.cif.gz_A | isopropylmalate isomerase small subunit from campylobacter jejuni. | 0.9232 | 1 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O14289_535_712_3.20.19.10 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.956 | 3 | 169 | 3.20.19.10 |
| 3h5jA00 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.9556 | 1 | 166 | 3.20.19.10 |
| 3h5jA00 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.9391 | 1 | 166 | 3.20.19.10 |
| af_Q2FWK0_1_171_3.20.19.10 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.9367 | 2 | 166 | 3.20.19.10 |
| 3q3wA00 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.9178 | 1 | 167 | 3.20.19.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5SBZ3-F1-model_v4 | 3-isopropylmalate dehydratase (EC 4.2.1.33) | 0.9957 | 1 | 169 |
GO:0003861
GO:0009098 GO:0009316 |
| AF-A0A2A2K0E1-F1-model_v4 | 3-isopropylmalate dehydratase (EC 4.2.1.33) | 0.9957 | 1 | 115 |
GO:0003861
GO:0009098 GO:0009316 GO:0016491 |
| AF-A0A4Q2X6Z5-F1-model_v4 | deleted | 0.9942 | 1 | 112 |
|
| AF-A0A4Q5SBZ3-F1-model_v4 | 3-isopropylmalate dehydratase (EC 4.2.1.33) | 0.9898 | 1 | 169 |
GO:0003861
GO:0009098 GO:0009316 |
| AF-A0A3D4LX70-F1-model_v4 | deleted | 0.987 | 1 | 139 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar