F478920
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 747 | 300 | 1494 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300031824|Ga0307413_10016244|Ga0307413_100162443 |
| Length | 249 |
| Sequence | VGDELLDSILFVAAESNGLGSPADIWNSILRDFSNIGEPAALAAFFQVLLIDLVLAGDNAIVVGALAAGLPPEQRKKVILIGVIAALVLRVAFALVVTQLLQIVGLILAGGLLLLWVAWRMWRELHHPAECSPGSEEIVGDERSGLYAAKSFAGAAWAVAVADVSMSLDNVLAVAGAAREHPGILIVGLIFAVALMGVAANLIARYIERYRWIGWGGLIVILWVAGKMIWDGYHDVAPVLGWPSAQVAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 153 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 159 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 165 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 166 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 167 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 168 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 171 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 172 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 173 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 174 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 175 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 176 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 177 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 178 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 179 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 180 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 181 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 182 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 213 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 216 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 217 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 218 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 219 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 220 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 221 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 222 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 223 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 224 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 225 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 226 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 227 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 228 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 229 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 230 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 231 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 232 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 233 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 234 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 240 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 241 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 242 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 243 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 244 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 245 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 247 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 248 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 249 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 250 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 251 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 253 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 254 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 255 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 256 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 257 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 258 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 259 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 260 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 261 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 263 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 264 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 265 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 266 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 268 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 269 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 270 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 271 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 272 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 273 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 274 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 275 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 276 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 277 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 278 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 279 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 280 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 281 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 282 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 283 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 284 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 285 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 286 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 287 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 288 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 289 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 290 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 291 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 292 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 293 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 294 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 295 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 296 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 297 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 298 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 299 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 300 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.39 |
| Metatranscriptomes | 0.27 |
| Isolates | 1.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.49 |
| Nodule | 0 |
| Rhizoplane | 3.88 |
| Rhizosphere | 86.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307413_10016244 | 3300031824 | Bacteria | 3840 |
| 2 | SwRhRL2b_contig_1541095 | 2162886007 | Bacteria | 1891 |
| 3 | SwRhRL2b_contig_2839406 | 2162886007 | Bacteria | 822 |
| 4 | JGI24741J21665_1007797 | 3300001915 | Bacteria | 2056 |
| 5 | JGI24752J21851_1000120 | 3300001976 | Bacteria | 10691 |
| 6 | JGI24740J21852_10015008 | 3300001979 | Bacteria | 2840 |
| 7 | JGI24743J22301_10007244 | 3300001991 | Bacteria | 1917 |
| 8 | JGI24735J21928_10009677 | 3300002067 | Bacteria | 3087 |
| 9 | JGI24735J21928_10011729 | 3300002067 | Bacteria | 2776 |
| 10 | JGI24735J21928_10017325 | 3300002067 | Bacteria | 2229 |
| 11 | JGI24735J21928_10031086 | 3300002067 | Bacteria | 1583 |
| 12 | JGI24735J21928_10059551 | 3300002067 | Bacteria | 1098 |
| 13 | JGI24738J21930_10002799 | 3300002075 | Bacteria | 4470 |
| 14 | JGI24749J21850_1001666 | 3300002076 | Bacteria | 3150 |
| 15 | JGI24744J21845_10000743 | 3300002077 | Bacteria | 6054 |
| 16 | JGI24034J26672_10037944 | 3300002239 | Bacteria | 802 |
| 17 | JGI24751J29686_10000572 | 3300002459 | Bacteria | 9962 |
| 18 | Ga0065704_10071035 | 3300005289 | Bacteria | 13600 |
| 19 | Ga0065712_10100809 | 3300005290 | Bacteria | 2035 |
| 20 | Ga0065715_10009136 | 3300005293 | Bacteria | 4572 |
| 21 | Ga0065707_10081714 | 3300005295 | Bacteria | 75872 |
| 22 | Ga0065707_10098210 | 3300005295 | Bacteria | 3104 |
| 23 | Ga0065707_10159454 | 3300005295 | Bacteria | 1577 |
| 24 | Ga0070658_10006658 | 3300005327 | Bacteria | 9363 |
| 25 | Ga0070658_10010494 | 3300005327 | Bacteria | 7426 |
| 26 | Ga0070658_10031068 | 3300005327 | Bacteria | 4288 |
| 27 | Ga0070658_10043164 | 3300005327 | Bacteria | 3643 |
| 28 | Ga0070658_10107071 | 3300005327 | Bacteria | 2313 |
| 29 | Ga0070658_10168792 | 3300005327 | Bacteria | 1838 |
| 30 | Ga0070683_100002630 | 3300005329 | Bacteria | 14354 |
| 31 | Ga0070683_100327491 | 3300005329 | Bacteria | 1458 |
| 32 | Ga0070670_100000027 | 3300005331 | Bacteria | 186072 |
| 33 | Ga0070670_100000158 | 3300005331 | Bacteria | 62049 |
| 34 | Ga0070670_100001577 | 3300005331 | Bacteria | 18383 |
| 35 | Ga0070670_100066891 | 3300005331 | Bacteria | 3084 |
| 36 | Ga0070670_100143189 | 3300005331 | Bacteria | 2067 |
| 37 | Ga0070670_100341242 | 3300005331 | Bacteria | 1315 |
| 38 | Ga0070677_10046151 | 3300005333 | Bacteria | 1741 |
| 39 | Ga0070677_10076718 | 3300005333 | Bacteria | 1420 |
| 40 | Ga0068869_100159085 | 3300005334 | Bacteria | 1757 |
| 41 | Ga0070666_10004846 | 3300005335 | Bacteria | 8225 |
| 42 | Ga0070666_10010045 | 3300005335 | Bacteria | 5909 |
| 43 | Ga0070666_10069350 | 3300005335 | Bacteria | 2397 |
| 44 | Ga0070666_10550561 | 3300005335 | Bacteria | 839 |
| 45 | Ga0070680_100022573 | 3300005336 | Bacteria | 5014 |
| 46 | Ga0070680_100109837 | 3300005336 | Bacteria | 2295 |
| 47 | Ga0070680_100761019 | 3300005336 | Bacteria | 834 |
| 48 | Ga0070682_100102499 | 3300005337 | Bacteria | 1892 |
| 49 | Ga0070682_100227008 | 3300005337 | Bacteria | 1333 |
| 50 | Ga0068868_100052808 | 3300005338 | Bacteria | 3200 |
| 51 | Ga0068868_100187351 | 3300005338 | Bacteria | 1720 |
| 52 | Ga0070660_100103815 | 3300005339 | Bacteria | 2254 |
| 53 | Ga0070660_100139721 | 3300005339 | Bacteria | 1943 |
| 54 | Ga0070660_100145303 | 3300005339 | Bacteria | 1905 |
| 55 | Ga0070660_100162281 | 3300005339 | Bacteria | 1801 |
| 56 | Ga0070660_100344244 | 3300005339 | Bacteria | 1227 |
| 57 | Ga0070691_10004686 | 3300005341 | Bacteria | 6220 |
| 58 | Ga0070661_100016040 | 3300005344 | Bacteria | 5288 |
| 59 | Ga0070661_100016791 | 3300005344 | Bacteria | 5182 |
| 60 | Ga0070661_100049168 | 3300005344 | Bacteria | 3087 |
| 61 | Ga0070661_100084279 | 3300005344 | Bacteria | 2348 |
| 62 | Ga0070668_100000001 | 3300005347 | Bacteria | 275905 |
| 63 | Ga0070668_100000007 | 3300005347 | Bacteria | 150621 |
| 64 | Ga0070668_100000050 | 3300005347 | Bacteria | 73885 |
| 65 | Ga0070668_100015522 | 3300005347 | Bacteria | 5694 |
| 66 | Ga0070668_100070133 | 3300005347 | Bacteria | 2728 |
| 67 | Ga0070668_100140639 | 3300005347 | Bacteria | 1945 |
| 68 | Ga0070669_100000031 | 3300005353 | Bacteria | 154042 |
| 69 | Ga0070669_100010183 | 3300005353 | Bacteria | 6683 |
| 70 | Ga0070669_100010508 | 3300005353 | Bacteria | 6575 |
| 71 | Ga0070669_100166132 | 3300005353 | Bacteria | 1718 |
| 72 | Ga0070669_100276279 | 3300005353 | Bacteria | 1345 |
| 73 | Ga0070675_100045528 | 3300005354 | Bacteria | 3590 |
| 74 | Ga0070675_100054675 | 3300005354 | Bacteria | 3285 |
| 75 | Ga0070675_100132190 | 3300005354 | Bacteria | 2127 |
| 76 | Ga0070675_100281466 | 3300005354 | Bacteria | 1462 |
| 77 | Ga0070671_100000046 | 3300005355 | Bacteria | 84967 |
| 78 | Ga0070671_100007774 | 3300005355 | Bacteria | 8564 |
| 79 | Ga0070671_100009075 | 3300005355 | Bacteria | 7981 |
| 80 | Ga0070671_100009667 | 3300005355 | Bacteria | 7748 |
| 81 | Ga0070671_100012142 | 3300005355 | Bacteria | 6931 |
| 82 | Ga0070674_100054948 | 3300005356 | Bacteria | 2756 |
| 83 | Ga0070673_100001256 | 3300005364 | Bacteria | 14726 |
| 84 | Ga0070659_100007101 | 3300005366 | Bacteria | 8122 |
| 85 | Ga0070659_100028333 | 3300005366 | Bacteria | 4324 |
| 86 | Ga0070659_100108507 | 3300005366 | Bacteria | 2239 |
| 87 | Ga0070659_100114955 | 3300005366 | Bacteria | 2175 |
| 88 | Ga0070659_100163740 | 3300005366 | Bacteria | 1819 |
| 89 | Ga0070659_100627578 | 3300005366 | Bacteria | 925 |
| 90 | Ga0070659_100658669 | 3300005366 | Bacteria | 903 |
| 91 | Ga0070667_100000006 | 3300005367 | Bacteria | 336732 |
| 92 | Ga0070667_100000025 | 3300005367 | Bacteria | 190744 |
| 93 | Ga0070667_100000066 | 3300005367 | Bacteria | 134529 |
| 94 | Ga0070667_100000280 | 3300005367 | Bacteria | 58186 |
| 95 | Ga0070667_100003426 | 3300005367 | Bacteria | 13510 |
| 96 | Ga0070667_100004443 | 3300005367 | Bacteria | 11824 |
| 97 | Ga0070667_100161512 | 3300005367 | Bacteria | 1974 |
| 98 | Ga0070663_100012849 | 3300005455 | Bacteria | 5314 |
| 99 | Ga0070663_100017610 | 3300005455 | Bacteria | 4666 |
| 100 | Ga0070663_100058057 | 3300005455 | Bacteria | 2778 |
| 101 | Ga0070663_100139003 | 3300005455 | Bacteria | 1852 |
| 102 | Ga0070663_100143928 | 3300005455 | Bacteria | 1822 |
| 103 | Ga0070678_100042297 | 3300005456 | Bacteria | 3238 |
| 104 | Ga0070662_100007991 | 3300005457 | Bacteria | 6882 |
| 105 | Ga0070662_100100838 | 3300005457 | Bacteria | 2185 |
| 106 | Ga0070662_100460403 | 3300005457 | Bacteria | 1057 |
| 107 | Ga0070685_10445240 | 3300005466 | Bacteria | 906 |
| 108 | Ga0070679_100101608 | 3300005530 | Bacteria | 2862 |
| 109 | Ga0070679_100115718 | 3300005530 | Bacteria | 2667 |
| 110 | Ga0070679_100244775 | 3300005530 | Bacteria | 1750 |
| 111 | Ga0070684_100065047 | 3300005535 | Bacteria | 3200 |
| 112 | Ga0068853_100007532 | 3300005539 | Bacteria | 8712 |
| 113 | Ga0068853_100026965 | 3300005539 | Bacteria | 4828 |
| 114 | Ga0068853_100033828 | 3300005539 | Bacteria | 4336 |
| 115 | Ga0068853_100202154 | 3300005539 | Bacteria | 1808 |
| 116 | Ga0068853_100600483 | 3300005539 | Bacteria | 1045 |
| 117 | Ga0070672_100039917 | 3300005543 | Bacteria | 3598 |
| 118 | Ga0070672_100239645 | 3300005543 | Bacteria | 1525 |
| 119 | Ga0070672_100994301 | 3300005543 | Bacteria | 743 |
| 120 | Ga0070686_100365793 | 3300005544 | Bacteria | 1088 |
| 121 | Ga0070696_100095008 | 3300005546 | Bacteria | 2128 |
| 122 | Ga0070693_100159878 | 3300005547 | Bacteria | 1434 |
| 123 | Ga0070665_100006222 | 3300005548 | Bacteria | 12212 |
| 124 | Ga0070665_100872060 | 3300005548 | Bacteria | 913 |
| 125 | Ga0070665_101201633 | 3300005548 | Bacteria | 769 |
| 126 | Ga0068855_100000504 | 3300005563 | Bacteria | 48297 |
| 127 | Ga0068855_100068939 | 3300005563 | Bacteria | 4116 |
| 128 | Ga0068855_100073861 | 3300005563 | Bacteria | 3961 |
| 129 | Ga0068855_100105036 | 3300005563 | Bacteria | 3248 |
| 130 | Ga0068855_100313210 | 3300005563 | Bacteria | 1736 |
| 131 | Ga0068855_100337176 | 3300005563 | Bacteria | 1663 |
| 132 | Ga0070664_100002992 | 3300005564 | Bacteria | 13677 |
| 133 | Ga0070664_100032223 | 3300005564 | Bacteria | 4383 |
| 134 | Ga0070664_100057349 | 3300005564 | Bacteria | 3310 |
| 135 | Ga0070664_100209566 | 3300005564 | Bacteria | 1741 |
| 136 | Ga0070664_100448492 | 3300005564 | Bacteria | 1184 |
| 137 | Ga0070664_100609302 | 3300005564 | Bacteria | 1013 |
| 138 | Ga0068857_100006021 | 3300005577 | Bacteria | 10357 |
| 139 | Ga0068857_100021660 | 3300005577 | Bacteria | 5656 |
| 140 | Ga0068857_100023804 | 3300005577 | Bacteria | 5392 |
| 141 | Ga0068857_100060599 | 3300005577 | Bacteria | 3361 |
| 142 | Ga0068857_100062308 | 3300005577 | Bacteria | 3315 |
| 143 | Ga0068857_100195118 | 3300005577 | Bacteria | 1845 |
| 144 | Ga0068857_100242528 | 3300005577 | Bacteria | 1650 |
| 145 | Ga0068857_100771618 | 3300005577 | Bacteria | 917 |
| 146 | Ga0068854_100000118 | 3300005578 | Bacteria | 54862 |
| 147 | Ga0068854_100002621 | 3300005578 | Bacteria | 11149 |
| 148 | Ga0068854_100005349 | 3300005578 | Bacteria | 8105 |
| 149 | Ga0068854_100006507 | 3300005578 | Bacteria | 7435 |
| 150 | Ga0068854_100058463 | 3300005578 | Bacteria | 2783 |
| 151 | Ga0068854_100125823 | 3300005578 | Bacteria | 1952 |
| 152 | Ga0068856_100022199 | 3300005614 | Bacteria | 6171 |
| 153 | Ga0068856_100047725 | 3300005614 | Bacteria | 4219 |
| 154 | Ga0068856_100106593 | 3300005614 | Bacteria | 2797 |
| 155 | Ga0068856_100210540 | 3300005614 | Bacteria | 1959 |
| 156 | Ga0070702_100439789 | 3300005615 | Bacteria | 943 |
| 157 | Ga0068852_100000052 | 3300005616 | Bacteria | 80329 |
| 158 | Ga0068852_100053740 | 3300005616 | Bacteria | 3469 |
| 159 | Ga0068852_100105941 | 3300005616 | Bacteria | 2548 |
| 160 | Ga0068852_100109226 | 3300005616 | Bacteria | 2511 |
| 161 | Ga0068859_100006032 | 3300005617 | Bacteria | 12307 |
| 162 | Ga0068859_100033839 | 3300005617 | Bacteria | 5131 |
| 163 | Ga0068859_100086017 | 3300005617 | Bacteria | 3190 |
| 164 | Ga0068859_100170665 | 3300005617 | Bacteria | 2256 |
| 165 | Ga0068859_100210647 | 3300005617 | Bacteria | 2030 |
| 166 | Ga0068864_100000083 | 3300005618 | Bacteria | 100972 |
| 167 | Ga0068864_100000123 | 3300005618 | Bacteria | 75407 |
| 168 | Ga0068864_100011209 | 3300005618 | Bacteria | 7410 |
| 169 | Ga0068864_100034743 | 3300005618 | Bacteria | 4289 |
| 170 | Ga0068864_100117982 | 3300005618 | Bacteria | 2369 |
| 171 | Ga0068861_100182307 | 3300005719 | Bacteria | 1749 |
| 172 | Ga0068851_10036226 | 3300005834 | Bacteria | 2470 |
| 173 | Ga0068851_10040440 | 3300005834 | Bacteria | 2343 |
| 174 | Ga0068851_10123168 | 3300005834 | Bacteria | 1395 |
| 175 | Ga0068870_10066164 | 3300005840 | Bacteria | 1957 |
| 176 | Ga0068863_100000025 | 3300005841 | Bacteria | 186072 |
| 177 | Ga0068863_100000027 | 3300005841 | Bacteria | 181884 |
| 178 | Ga0068863_100000187 | 3300005841 | Bacteria | 65873 |
| 179 | Ga0068863_100004111 | 3300005841 | Bacteria | 14383 |
| 180 | Ga0068863_100008301 | 3300005841 | Bacteria | 10148 |
| 181 | Ga0068863_100064584 | 3300005841 | Bacteria | 3461 |
| 182 | Ga0068858_100000348 | 3300005842 | Bacteria | 48656 |
| 183 | Ga0068858_100042738 | 3300005842 | Bacteria | 4202 |
| 184 | Ga0068858_100672451 | 3300005842 | Bacteria | 1007 |
| 185 | Ga0068860_100000013 | 3300005843 | Bacteria | 323055 |
| 186 | Ga0068860_100000074 | 3300005843 | Bacteria | 173022 |
| 187 | Ga0068860_100005297 | 3300005843 | Bacteria | 13095 |
| 188 | Ga0068860_100200545 | 3300005843 | Bacteria | 1933 |
| 189 | Ga0068862_100000027 | 3300005844 | Bacteria | 186072 |
| 190 | Ga0068862_100000043 | 3300005844 | Bacteria | 164356 |
| 191 | Ga0068862_100000898 | 3300005844 | Bacteria | 28838 |
| 192 | Ga0068862_100156340 | 3300005844 | Bacteria | 2033 |
| 193 | Ga0081539_10014878 | 3300005985 | Bacteria | 5709 |
| 194 | Ga0070717_10125053 | 3300006028 | Bacteria | 2207 |
| 195 | Ga0075364_10250780 | 3300006051 | Bacteria | 1203 |
| 196 | Ga0075367_10000313 | 3300006178 | Bacteria | 17087 |
| 197 | Ga0075366_10026237 | 3300006195 | Bacteria | 3411 |
| 198 | Ga0097621_100025235 | 3300006237 | Bacteria | 4648 |
| 199 | Ga0097621_100082490 | 3300006237 | Bacteria | 2677 |
| 200 | Ga0075370_10056690 | 3300006353 | Bacteria | 2227 |
| 201 | Ga0075370_10205225 | 3300006353 | Bacteria | 1163 |
| 202 | Ga0068871_100002746 | 3300006358 | Bacteria | 12022 |
| 203 | Ga0068871_100094687 | 3300006358 | Bacteria | 2493 |
| 204 | Ga0068871_100140821 | 3300006358 | Bacteria | 2051 |
| 205 | Ga0075428_100660370 | 3300006844 | Bacteria | 1115 |
| 206 | Ga0097620_100006032 | 3300006931 | Bacteria | 12307 |
| 207 | Ga0097620_100033839 | 3300006931 | Bacteria | 5131 |
| 208 | Ga0097620_100086014 | 3300006931 | Bacteria | 3190 |
| 209 | Ga0097620_100170672 | 3300006931 | Bacteria | 2256 |
| 210 | Ga0097620_100210638 | 3300006931 | Bacteria | 2030 |
| 211 | Ga0105251_10000138 | 3300009011 | Bacteria | 74430 |
| 212 | Ga0105251_10005727 | 3300009011 | Bacteria | 8060 |
| 213 | Ga0105251_10153270 | 3300009011 | Bacteria | 1040 |
| 214 | Ga0105240_10046015 | 3300009093 | Bacteria | 5532 |
| 215 | Ga0105240_10167483 | 3300009093 | Bacteria | 2605 |
| 216 | Ga0105247_10009207 | 3300009101 | Bacteria | 6006 |
| 217 | Ga0114129_10037190 | 3300009147 | Bacteria | 6874 |
| 218 | Ga0105241_10002991 | 3300009174 | Bacteria | 12620 |
| 219 | Ga0105241_10223978 | 3300009174 | Bacteria | 1582 |
| 220 | Ga0105241_10228893 | 3300009174 | Bacteria | 1566 |
| 221 | Ga0105241_10451543 | 3300009174 | Bacteria | 1137 |
| 222 | Ga0105248_10000026 | 3300009177 | Bacteria | 257155 |
| 223 | Ga0105248_10000081 | 3300009177 | Bacteria | 111105 |
| 224 | Ga0105248_10002631 | 3300009177 | Bacteria | 19969 |
| 225 | Ga0105248_10107765 | 3300009177 | Bacteria | 3142 |
| 226 | Ga0105248_10317655 | 3300009177 | Bacteria | 1754 |
| 227 | Ga0105248_10619345 | 3300009177 | Bacteria | 1221 |
| 228 | Ga0105237_10080858 | 3300009545 | Bacteria | 3240 |
| 229 | Ga0105237_10108279 | 3300009545 | Bacteria | 2770 |
| 230 | Ga0105238_10031912 | 3300009551 | Bacteria | 5360 |
| 231 | Ga0105238_10320405 | 3300009551 | Bacteria | 1536 |
| 232 | Ga0105249_10000123 | 3300009553 | Bacteria | 104747 |
| 233 | Ga0105249_10040455 | 3300009553 | Bacteria | 4234 |
| 234 | Ga0105249_10141982 | 3300009553 | Bacteria | 2304 |
| 235 | Ga0105249_10923058 | 3300009553 | Bacteria | 940 |
| 236 | Ga0105148_100012 | 3300009978 | Bacteria | 29563 |
| 237 | Ga0105239_10026961 | 3300010375 | Bacteria | 6324 |
| 238 | Ga0105239_10117846 | 3300010375 | Bacteria | 2947 |
| 239 | Ga0105239_10351827 | 3300010375 | Bacteria | 1663 |
| 240 | Ga0157326_1002462 | 3300012513 | Bacteria | 1981 |
| 241 | Ga0157373_10016855 | 3300013100 | Bacteria | 5327 |
| 242 | Ga0157373_10037566 | 3300013100 | Bacteria | 3471 |
| 243 | Ga0157373_10043083 | 3300013100 | Bacteria | 3224 |
| 244 | Ga0157373_10049288 | 3300013100 | Bacteria | 3001 |
| 245 | Ga0157373_10074175 | 3300013100 | Bacteria | 2400 |
| 246 | Ga0157373_10078903 | 3300013100 | Bacteria | 2322 |
| 247 | Ga0157371_10000443 | 3300013102 | Bacteria | 50736 |
| 248 | Ga0157371_10019219 | 3300013102 | Bacteria | 5041 |
| 249 | Ga0157371_10112157 | 3300013102 | Bacteria | 1936 |
| 250 | Ga0157371_10141302 | 3300013102 | Bacteria | 1715 |
| 251 | Ga0157371_10194077 | 3300013102 | Bacteria | 1454 |
| 252 | Ga0157370_10117796 | 3300013104 | Bacteria | 2481 |
| 253 | Ga0157369_10265506 | 3300013105 | Bacteria | 1790 |
| 254 | Ga0157369_10388742 | 3300013105 | Bacteria | 1448 |
| 255 | Ga0157374_10048125 | 3300013296 | Bacteria | 3956 |
| 256 | Ga0157374_10179025 | 3300013296 | Bacteria | 2070 |
| 257 | Ga0163162_10009122 | 3300013306 | Bacteria | 9645 |
| 258 | Ga0163162_10009714 | 3300013306 | Bacteria | 9363 |
| 259 | Ga0163162_10503218 | 3300013306 | Bacteria | 1342 |
| 260 | Ga0157372_10079810 | 3300013307 | Bacteria | 3702 |
| 261 | Ga0157372_10232500 | 3300013307 | Bacteria | 2137 |
| 262 | Ga0157372_10281457 | 3300013307 | Bacteria | 1934 |
| 263 | Ga0157372_10512724 | 3300013307 | Bacteria | 1398 |
| 264 | Ga0157372_10713325 | 3300013307 | Bacteria | 1167 |
| 265 | Ga0157375_10090648 | 3300013308 | Bacteria | 3116 |
| 266 | Ga0163163_10031019 | 3300014325 | Bacteria | 5155 |
| 267 | Ga0163163_10132098 | 3300014325 | Bacteria | 2537 |
| 268 | Ga0157380_10000040 | 3300014326 | Bacteria | 76401 |
| 269 | Ga0157380_10000292 | 3300014326 | Bacteria | 30110 |
| 270 | Ga0157380_10015187 | 3300014326 | Bacteria | 5655 |
| 271 | Ga0182008_10008650 | 3300014497 | Bacteria | 5540 |
| 272 | Ga0157379_10034586 | 3300014968 | Bacteria | 4505 |
| 273 | Ga0163161_10000412 | 3300017792 | Bacteria | 35877 |
| 274 | Ga0163161_10027290 | 3300017792 | Bacteria | 4050 |
| 275 | Ga0163161_10037774 | 3300017792 | Bacteria | 3462 |
| 276 | Ga0163161_10082540 | 3300017792 | Bacteria | 2368 |
| 277 | Ga0163161_10227338 | 3300017792 | Bacteria | 1447 |
| 278 | Ga0209147_101548 | 3300025229 | Bacteria | 7916 |
| 279 | Ga0209148_1000146 | 3300025254 | Bacteria | 160734 |
| 280 | Ga0209455_1015932 | 3300025272 | Bacteria | 1632 |
| 281 | Ga0207697_10175116 | 3300025315 | Bacteria | 939 |
| 282 | Ga0207656_10071158 | 3300025321 | Bacteria | 1546 |
| 283 | Ga0207656_10074328 | 3300025321 | Bacteria | 1516 |
| 284 | Ga0207656_10191920 | 3300025321 | Bacteria | 984 |
| 285 | Ga0207713_1002556 | 3300025735 | Bacteria | 13146 |
| 286 | Ga0207713_1101619 | 3300025735 | Bacteria | 991 |
| 287 | Ga0207682_10275375 | 3300025893 | Bacteria | 786 |
| 288 | Ga0207710_10013376 | 3300025900 | Bacteria | 3454 |
| 289 | Ga0207680_10039475 | 3300025903 | Bacteria | 2740 |
| 290 | Ga0207680_10156751 | 3300025903 | Bacteria | 1523 |
| 291 | Ga0207680_10446646 | 3300025903 | Bacteria | 918 |
| 292 | Ga0207647_10001917 | 3300025904 | Bacteria | 15905 |
| 293 | Ga0207647_10034886 | 3300025904 | Bacteria | 3209 |
| 294 | Ga0207647_10043127 | 3300025904 | Bacteria | 2824 |
| 295 | Ga0207647_10089867 | 3300025904 | Bacteria | 1833 |
| 296 | Ga0207647_10097527 | 3300025904 | Bacteria | 1748 |
| 297 | Ga0207645_10102794 | 3300025907 | Bacteria | 1845 |
| 298 | Ga0207705_10005022 | 3300025909 | Bacteria | 9923 |
| 299 | Ga0207705_10009903 | 3300025909 | Bacteria | 6940 |
| 300 | Ga0207705_10015837 | 3300025909 | Bacteria | 5416 |
| 301 | Ga0207705_10025919 | 3300025909 | Bacteria | 4184 |
| 302 | Ga0207705_10167257 | 3300025909 | Bacteria | 1654 |
| 303 | Ga0207705_10281737 | 3300025909 | Bacteria | 1273 |
| 304 | Ga0207705_10318821 | 3300025909 | Bacteria | 1194 |
| 305 | Ga0207654_10018033 | 3300025911 | Bacteria | 3701 |
| 306 | Ga0207654_10048487 | 3300025911 | Bacteria | 2431 |
| 307 | Ga0207654_10355546 | 3300025911 | Bacteria | 1009 |
| 308 | Ga0207654_10624970 | 3300025911 | Bacteria | 770 |
| 309 | Ga0207695_10009667 | 3300025913 | Bacteria | 11881 |
| 310 | Ga0207695_10060670 | 3300025913 | Bacteria | 3913 |
| 311 | Ga0207671_10129520 | 3300025914 | Bacteria | 1936 |
| 312 | Ga0207671_10261098 | 3300025914 | Bacteria | 1363 |
| 313 | Ga0207660_10255504 | 3300025917 | Bacteria | 1384 |
| 314 | Ga0207660_10650562 | 3300025917 | Bacteria | 859 |
| 315 | Ga0207657_10001846 | 3300025919 | Bacteria | 22883 |
| 316 | Ga0207657_10003176 | 3300025919 | Bacteria | 17576 |
| 317 | Ga0207657_10050871 | 3300025919 | Bacteria | 3603 |
| 318 | Ga0207657_10062112 | 3300025919 | Bacteria | 3200 |
| 319 | Ga0207657_10555387 | 3300025919 | Bacteria | 898 |
| 320 | Ga0207649_10019927 | 3300025920 | Bacteria | 3840 |
| 321 | Ga0207649_10036156 | 3300025920 | Bacteria | 2973 |
| 322 | Ga0207649_10053637 | 3300025920 | Bacteria | 2506 |
| 323 | Ga0207652_10309760 | 3300025921 | Bacteria | 1425 |
| 324 | Ga0207652_10892951 | 3300025921 | Bacteria | 785 |
| 325 | Ga0207681_10000014 | 3300025923 | Bacteria | 353422 |
| 326 | Ga0207681_10020510 | 3300025923 | Bacteria | 4190 |
| 327 | Ga0207681_10051027 | 3300025923 | Bacteria | 2801 |
| 328 | Ga0207681_10106059 | 3300025923 | Bacteria | 2035 |
| 329 | Ga0207681_10135294 | 3300025923 | Bacteria | 1828 |
| 330 | Ga0207694_10017967 | 3300025924 | Bacteria | 5345 |
| 331 | Ga0207694_10044052 | 3300025924 | Bacteria | 3445 |
| 332 | Ga0207650_10000015 | 3300025925 | Bacteria | 369173 |
| 333 | Ga0207650_10000056 | 3300025925 | Bacteria | 157972 |
| 334 | Ga0207650_10005400 | 3300025925 | Bacteria | 8722 |
| 335 | Ga0207650_10051127 | 3300025925 | Bacteria | 3057 |
| 336 | Ga0207650_10098130 | 3300025925 | Bacteria | 2250 |
| 337 | Ga0207650_10167350 | 3300025925 | Bacteria | 1745 |
| 338 | Ga0207659_10096942 | 3300025926 | Bacteria | 2214 |
| 339 | Ga0207659_10133990 | 3300025926 | Bacteria | 1916 |
| 340 | Ga0207659_10374311 | 3300025926 | Bacteria | 1186 |
| 341 | Ga0207644_10000111 | 3300025931 | Bacteria | 60737 |
| 342 | Ga0207644_10001037 | 3300025931 | Bacteria | 17807 |
| 343 | Ga0207644_10001637 | 3300025931 | Bacteria | 14428 |
| 344 | Ga0207644_10011383 | 3300025931 | Bacteria | 5884 |
| 345 | Ga0207644_10212986 | 3300025931 | Bacteria | 1528 |
| 346 | Ga0207690_10012477 | 3300025932 | Bacteria | 5083 |
| 347 | Ga0207690_10028105 | 3300025932 | Bacteria | 3562 |
| 348 | Ga0207690_10108879 | 3300025932 | Bacteria | 1992 |
| 349 | Ga0207690_10389674 | 3300025932 | Bacteria | 1109 |
| 350 | Ga0207706_10000222 | 3300025933 | Bacteria | 62279 |
| 351 | Ga0207706_10023396 | 3300025933 | Bacteria | 5549 |
| 352 | Ga0207706_10029763 | 3300025933 | Bacteria | 4873 |
| 353 | Ga0207706_10033152 | 3300025933 | Bacteria | 4598 |
| 354 | Ga0207706_10117563 | 3300025933 | Bacteria | 2338 |
| 355 | Ga0207706_10351977 | 3300025933 | Bacteria | 1281 |
| 356 | Ga0207669_10008141 | 3300025937 | Bacteria | 4906 |
| 357 | Ga0207691_10043801 | 3300025940 | Bacteria | 4123 |
| 358 | Ga0207691_10062985 | 3300025940 | Bacteria | 3364 |
| 359 | Ga0207691_10115654 | 3300025940 | Bacteria | 2382 |
| 360 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 361 | Ga0207711_10001014 | 3300025941 | Bacteria | 26941 |
| 362 | Ga0207711_10013963 | 3300025941 | Bacteria | 6671 |
| 363 | Ga0207711_10505843 | 3300025941 | Bacteria | 1126 |
| 364 | Ga0207661_10188316 | 3300025944 | Bacteria | 1807 |
| 365 | Ga0207661_10516934 | 3300025944 | Bacteria | 1092 |
| 366 | Ga0207661_10699886 | 3300025944 | Bacteria | 932 |
| 367 | Ga0207679_10013540 | 3300025945 | Bacteria | 5346 |
| 368 | Ga0207679_10051130 | 3300025945 | Bacteria | 3024 |
| 369 | Ga0207679_10059864 | 3300025945 | Bacteria | 2827 |
| 370 | Ga0207667_10000017 | 3300025949 | Bacteria | 390654 |
| 371 | Ga0207667_10023817 | 3300025949 | Bacteria | 6737 |
| 372 | Ga0207667_10038088 | 3300025949 | Bacteria | 5137 |
| 373 | Ga0207667_10107671 | 3300025949 | Bacteria | 2876 |
| 374 | Ga0207667_10153576 | 3300025949 | Bacteria | 2369 |
| 375 | Ga0207667_10829690 | 3300025949 | Bacteria | 920 |
| 376 | Ga0207651_10018184 | 3300025960 | Bacteria | 4175 |
| 377 | Ga0207651_10346194 | 3300025960 | Bacteria | 1250 |
| 378 | Ga0207712_10000102 | 3300025961 | Bacteria | 96444 |
| 379 | Ga0207712_10009460 | 3300025961 | Bacteria | 6164 |
| 380 | Ga0207712_10082213 | 3300025961 | Bacteria | 2347 |
| 381 | Ga0207712_10418366 | 3300025961 | Bacteria | 1130 |
| 382 | Ga0207668_10000009 | 3300025972 | Bacteria | 188071 |
| 383 | Ga0207668_10000054 | 3300025972 | Bacteria | 95426 |
| 384 | Ga0207668_10000094 | 3300025972 | Bacteria | 63810 |
| 385 | Ga0207668_10035386 | 3300025972 | Bacteria | 3324 |
| 386 | Ga0207668_10267746 | 3300025972 | Bacteria | 1395 |
| 387 | Ga0207640_10000085 | 3300025981 | Bacteria | 73838 |
| 388 | Ga0207640_10020249 | 3300025981 | Bacteria | 3948 |
| 389 | Ga0207640_10048927 | 3300025981 | Bacteria | 2735 |
| 390 | Ga0207640_10069390 | 3300025981 | Bacteria | 2366 |
| 391 | Ga0207640_10073459 | 3300025981 | Bacteria | 2311 |
| 392 | Ga0207658_10000010 | 3300025986 | Bacteria | 240224 |
| 393 | Ga0207658_10000023 | 3300025986 | Bacteria | 190806 |
| 394 | Ga0207658_10000132 | 3300025986 | Bacteria | 80078 |
| 395 | Ga0207658_10000712 | 3300025986 | Bacteria | 28818 |
| 396 | Ga0207658_10001234 | 3300025986 | Bacteria | 20208 |
| 397 | Ga0207658_10015979 | 3300025986 | Bacteria | 5156 |
| 398 | Ga0207658_10054972 | 3300025986 | Bacteria | 2948 |
| 399 | Ga0207677_10150373 | 3300026023 | Bacteria | 1795 |
| 400 | Ga0207677_10209751 | 3300026023 | Bacteria | 1555 |
| 401 | Ga0207703_10000368 | 3300026035 | Bacteria | 48197 |
| 402 | Ga0207639_10000834 | 3300026041 | Bacteria | 20903 |
| 403 | Ga0207639_10001595 | 3300026041 | Bacteria | 15239 |
| 404 | Ga0207639_10003170 | 3300026041 | Bacteria | 11066 |
| 405 | Ga0207639_10282601 | 3300026041 | Bacteria | 1460 |
| 406 | Ga0207678_10000025 | 3300026067 | Bacteria | 119139 |
| 407 | Ga0207678_10011518 | 3300026067 | Bacteria | 7769 |
| 408 | Ga0207678_10030575 | 3300026067 | Bacteria | 4700 |
| 409 | Ga0207678_10055443 | 3300026067 | Bacteria | 3414 |
| 410 | Ga0207678_10064398 | 3300026067 | Bacteria | 3149 |
| 411 | Ga0207702_10005813 | 3300026078 | Bacteria | 10730 |
| 412 | Ga0207702_10007661 | 3300026078 | Bacteria | 9180 |
| 413 | Ga0207702_10013135 | 3300026078 | Bacteria | 6886 |
| 414 | Ga0207702_10063313 | 3300026078 | Bacteria | 3162 |
| 415 | Ga0207702_10124583 | 3300026078 | Bacteria | 2311 |
| 416 | Ga0207702_10137663 | 3300026078 | Bacteria | 2205 |
| 417 | Ga0207702_10226535 | 3300026078 | Bacteria | 1745 |
| 418 | Ga0207641_10000018 | 3300026088 | Bacteria | 298209 |
| 419 | Ga0207641_10000045 | 3300026088 | Bacteria | 181882 |
| 420 | Ga0207641_10000269 | 3300026088 | Bacteria | 66008 |
| 421 | Ga0207641_10000584 | 3300026088 | Bacteria | 40125 |
| 422 | Ga0207641_10001281 | 3300026088 | Bacteria | 25019 |
| 423 | Ga0207641_10041379 | 3300026088 | Bacteria | 3861 |
| 424 | Ga0207641_10201908 | 3300026088 | Bacteria | 1833 |
| 425 | Ga0207676_10000021 | 3300026095 | Bacteria | 296572 |
| 426 | Ga0207676_10000027 | 3300026095 | Bacteria | 245868 |
| 427 | Ga0207676_10001450 | 3300026095 | Bacteria | 17632 |
| 428 | Ga0207676_10031654 | 3300026095 | Bacteria | 3979 |
| 429 | Ga0207674_10003093 | 3300026116 | Bacteria | 20563 |
| 430 | Ga0207674_10003762 | 3300026116 | Bacteria | 18513 |
| 431 | Ga0207674_10005773 | 3300026116 | Bacteria | 14684 |
| 432 | Ga0207674_10006584 | 3300026116 | Bacteria | 13654 |
| 433 | Ga0207674_10017740 | 3300026116 | Bacteria | 7758 |
| 434 | Ga0207674_10022193 | 3300026116 | Bacteria | 6822 |
| 435 | Ga0207674_10029944 | 3300026116 | Bacteria | 5726 |
| 436 | Ga0207674_10152809 | 3300026116 | Bacteria | 2265 |
| 437 | Ga0207674_10157832 | 3300026116 | Bacteria | 2223 |
| 438 | Ga0207674_10599886 | 3300026116 | Bacteria | 1064 |
| 439 | Ga0207675_100013637 | 3300026118 | Bacteria | 7586 |
| 440 | Ga0207675_100195062 | 3300026118 | Bacteria | 1944 |
| 441 | Ga0207683_10075146 | 3300026121 | Bacteria | 2991 |
| 442 | Ga0207698_10000198 | 3300026142 | Bacteria | 37741 |
| 443 | Ga0207698_10004461 | 3300026142 | Bacteria | 8537 |
| 444 | Ga0207698_10038669 | 3300026142 | Bacteria | 3527 |
| 445 | Ga0207698_10611602 | 3300026142 | Bacteria | 1075 |
| 446 | Ga0209813_10000029 | 3300027866 | Bacteria | 68229 |
| 447 | Ga0268266_10131285 | 3300028379 | Bacteria | 2240 |
| 448 | Ga0268266_10374214 | 3300028379 | Bacteria | 1342 |
| 449 | Ga0268265_10000013 | 3300028380 | Bacteria | 341536 |
| 450 | Ga0268265_10000042 | 3300028380 | Bacteria | 186086 |
| 451 | Ga0268265_10000803 | 3300028380 | Bacteria | 29861 |
| 452 | Ga0268265_10105917 | 3300028380 | Bacteria | 2283 |
| 453 | Ga0268264_10000039 | 3300028381 | Bacteria | 376641 |
| 454 | Ga0268264_10000070 | 3300028381 | Bacteria | 268524 |
| 455 | Ga0268264_10002547 | 3300028381 | Bacteria | 15981 |
| 456 | Ga0268264_10014994 | 3300028381 | Bacteria | 6360 |
| 457 | Ga0268264_10119524 | 3300028381 | Bacteria | 2321 |
| 458 | Ga0268264_11241948 | 3300028381 | Bacteria | 755 |
| 459 | Ga0316182_1217173 | 3300030745 | Bacteria | 1131 |
| 460 | Ga0307513_10437139 | 3300031456 | Bacteria | 1035 |
| 461 | Ga0307408_100007308 | 3300031548 | Bacteria | 7307 |
| 462 | Ga0307408_100366971 | 3300031548 | Bacteria | 1226 |
| 463 | Ga0307408_100523817 | 3300031548 | Bacteria | 1041 |
| 464 | Ga0307405_10042772 | 3300031731 | Bacteria | 2759 |
| 465 | Ga0307405_10131789 | 3300031731 | Bacteria | 1728 |
| 466 | Ga0307405_10232274 | 3300031731 | Bacteria | 1360 |
| 467 | Ga0307405_10258506 | 3300031731 | Bacteria | 1299 |
| 468 | Ga0307405_10504326 | 3300031731 | Bacteria | 970 |
| 469 | Ga0307413_10020897 | 3300031824 | Bacteria | 3493 |
| 470 | Ga0307413_10211788 | 3300031824 | Bacteria | 1408 |
| 471 | Ga0307413_10224511 | 3300031824 | Bacteria | 1374 |
| 472 | Ga0307410_10067930 | 3300031852 | Bacteria | 2460 |
| 473 | Ga0307410_10124410 | 3300031852 | Bacteria | 1885 |
| 474 | Ga0307410_10162421 | 3300031852 | Bacteria | 1675 |
| 475 | Ga0307406_10010473 | 3300031901 | Bacteria | 5231 |
| 476 | Ga0307406_10024111 | 3300031901 | Bacteria | 3629 |
| 477 | Ga0307406_10034986 | 3300031901 | Bacteria | 3085 |
| 478 | Ga0307406_10214288 | 3300031901 | Bacteria | 1427 |
| 479 | Ga0307406_10356088 | 3300031901 | Bacteria | 1145 |
| 480 | Ga0307406_10362624 | 3300031901 | Bacteria | 1136 |
| 481 | Ga0307407_10037438 | 3300031903 | Bacteria | 2680 |
| 482 | Ga0307407_10123314 | 3300031903 | Bacteria | 1646 |
| 483 | Ga0307407_10373154 | 3300031903 | Bacteria | 1016 |
| 484 | Ga0307412_10002333 | 3300031911 | Bacteria | 10511 |
| 485 | Ga0307412_10062262 | 3300031911 | Bacteria | 2511 |
| 486 | Ga0307412_10144337 | 3300031911 | Bacteria | 1747 |
| 487 | Ga0307412_10333307 | 3300031911 | Bacteria | 1212 |
| 488 | Ga0307412_10438182 | 3300031911 | Bacteria | 1073 |
| 489 | Ga0307412_10464343 | 3300031911 | Bacteria | 1046 |
| 490 | Ga0307412_10466053 | 3300031911 | Bacteria | 1044 |
| 491 | Ga0307409_100066563 | 3300031995 | Bacteria | 2842 |
| 492 | Ga0307409_100104881 | 3300031995 | Bacteria | 2355 |
| 493 | Ga0307409_100157928 | 3300031995 | Bacteria | 1979 |
| 494 | Ga0307409_100523830 | 3300031995 | Bacteria | 1158 |
| 495 | Ga0307416_100000260 | 3300032002 | Bacteria | 28062 |
| 496 | Ga0307416_100006944 | 3300032002 | Bacteria | 7137 |
| 497 | Ga0307416_100115578 | 3300032002 | Bacteria | 2376 |
| 498 | Ga0307416_100345249 | 3300032002 | Bacteria | 1503 |
| 499 | Ga0307416_100359310 | 3300032002 | Bacteria | 1478 |
| 500 | Ga0307414_10012695 | 3300032004 | Bacteria | 4993 |
| 501 | Ga0307414_10072818 | 3300032004 | Bacteria | 2483 |
| 502 | Ga0307414_10113203 | 3300032004 | Bacteria | 2070 |
| 503 | Ga0307414_10174663 | 3300032004 | Bacteria | 1721 |
| 504 | Ga0307414_10506530 | 3300032004 | Bacteria | 1069 |
| 505 | Ga0307414_10686957 | 3300032004 | Bacteria | 925 |
| 506 | Ga0307411_10017801 | 3300032005 | Bacteria | 4061 |
| 507 | Ga0307411_10021194 | 3300032005 | Bacteria | 3797 |
| 508 | Ga0307411_10160682 | 3300032005 | Bacteria | 1682 |
| 509 | Ga0307411_10490505 | 3300032005 | Bacteria | 1036 |
| 510 | Ga0307415_100045291 | 3300032126 | Bacteria | 2948 |
| 511 | Ga0307415_100247356 | 3300032126 | Bacteria | 1446 |
| 512 | Ga0307415_100290915 | 3300032126 | Bacteria | 1348 |
| 513 | Ga0307415_100368471 | 3300032126 | Bacteria | 1215 |
| 514 | Ga0307415_100408516 | 3300032126 | Bacteria | 1161 |
| 515 | Ga0307415_100980123 | 3300032126 | Bacteria | 784 |
| 516 | Ga0395899_0003036 | 3300037312 | Bacteria | 13401 |
| 517 | Ga0395899_0024581 | 3300037312 | Bacteria | 4554 |
| 518 | Ga0395899_0057326 | 3300037312 | Bacteria | 2876 |
| 519 | Ga0395899_0216742 | 3300037312 | Bacteria | 1327 |
| 520 | Ga0395899_0236317 | 3300037312 | Bacteria | 1259 |
| 521 | Ga0395899_0319849 | 3300037312 | Bacteria | 1045 |
| 522 | Ga0395900_0017810 | 3300037418 | Bacteria | 7251 |
| 523 | Ga0395900_0086864 | 3300037418 | Bacteria | 3214 |
| 524 | Ga0395900_0143914 | 3300037418 | Bacteria | 2439 |
| 525 | Ga0395900_0150332 | 3300037418 | Bacteria | 2379 |
| 526 | Ga0395900_0343106 | 3300037418 | Bacteria | 1468 |
| 527 | Ga0395900_0385087 | 3300037418 | Bacteria | 1369 |
| 528 | Ga0395900_0385099 | 3300037418 | Bacteria | 1369 |
| 529 | Ga0395900_0392759 | 3300037418 | Bacteria | 1353 |
| 530 | Ga0395898_0038169 | 3300037466 | Bacteria | 4762 |
| 531 | Ga0395898_0074732 | 3300037466 | Bacteria | 3273 |
| 532 | Ga0395898_0128890 | 3300037466 | Bacteria | 2423 |
| 533 | Ga0395898_0293237 | 3300037466 | Unclassified | 1552 |
| 534 | Ga0395898_0332160 | 3300037466 | Bacteria | 1449 |
| 535 | Ga0395905_0000464 | 3300037471 | Bacteria | 56406 |
| 536 | Ga0395905_0000606 | 3300037471 | Bacteria | 48007 |
| 537 | Ga0395905_0018897 | 3300037471 | Bacteria | 6536 |
| 538 | Ga0395905_0025840 | 3300037471 | Bacteria | 5534 |
| 539 | Ga0395905_0030067 | 3300037471 | Bacteria | 5120 |
| 540 | Ga0395905_0058365 | 3300037471 | Bacteria | 3608 |
| 541 | Ga0395905_0125925 | 3300037471 | Bacteria | 2409 |
| 542 | Ga0395905_0135681 | 3300037471 | Bacteria | 2314 |
| 543 | Ga0395905_0161691 | 3300037471 | Bacteria | 2104 |
| 544 | Ga0395905_0269277 | 3300037471 | Bacteria | 1589 |
| 545 | Ga0395905_0513882 | 3300037471 | Bacteria | 1098 |
| 546 | Ga0395905_0640859 | 3300037471 | Bacteria | 964 |
| 547 | Ga0395901_0010520 | 3300038443 | Bacteria | 9370 |
| 548 | Ga0395901_0113802 | 3300038443 | Bacteria | 2841 |
| 549 | Ga0395901_0134683 | 3300038443 | Bacteria | 2596 |
| 550 | Ga0395901_0238670 | 3300038443 | Bacteria | 1896 |
| 551 | Ga0395901_0255333 | 3300038443 | Bacteria | 1825 |
| 552 | Ga0395901_0459846 | 3300038443 | Bacteria | 1300 |
| 553 | Ga0395901_0473999 | 3300038443 | Bacteria | 1277 |
| 554 | Ga0395901_0489758 | 3300038443 | Bacteria | 1253 |
| 555 | Ga0395901_0490687 | 3300038443 | Bacteria | 1251 |
| 556 | Ga0395901_0835146 | 3300038443 | Bacteria | 908 |
| 557 | Ga0237819_06133 | 3300038705 | Bacteria | 1828 |
| 558 | Ga0439439_0029635 | 3300041406 | Bacteria | 1389 |
| 559 | Ga0439443_000920 | 3300042003 | Bacteria | 2991 |
| 560 | Ga0439448_0100492 | 3300042005 | Bacteria | 983 |
| 561 | Ga0439458_0023309 | 3300042157 | Bacteria | 1443 |
| 562 | Ga0439434_0097109 | 3300042435 | Bacteria | 947 |
| 563 | Ga0466961_0112497 | 3300044693 | Bacteria | 1712 |
| 564 | Ga0466963_0006453 | 3300044694 | Bacteria | 6938 |
| 565 | Ga0466971_0006898 | 3300044719 | Bacteria | 4937 |
| 566 | Ga0466970_0131497 | 3300044765 | Bacteria | 1375 |
| 567 | Ga0466957_0401723 | 3300044842 | Bacteria | 937 |
| 568 | Ga0466967_0024421 | 3300045976 | Bacteria | 4969 |
| 569 | Ga0466967_0283602 | 3300045976 | Bacteria | 1590 |
| 570 | Ga0495617_016493 | 3300046452 | Bacteria | 2498 |
| 571 | Ga0495627_000171 | 3300046453 | Bacteria | 74013 |
| 572 | Ga0495627_014225 | 3300046453 | Bacteria | 2782 |
| 573 | Ga0495638_0000068 | 3300046460 | Bacteria | 167596 |
| 574 | Ga0495638_0160866 | 3300046460 | Bacteria | 1295 |
| 575 | Ga0495650_0001420 | 3300046471 | Bacteria | 23288 |
| 576 | Ga0495583_0000269 | 3300046506 | Bacteria | 85380 |
| 577 | Ga0495606_0112220 | 3300046507 | Bacteria | 1643 |
| 578 | Ga0495610_0000199 | 3300046512 | Bacteria | 67146 |
| 579 | Ga0495610_0019694 | 3300046512 | Bacteria | 3766 |
| 580 | Ga0495616_0000010 | 3300046513 | Bacteria | 224378 |
| 581 | Ga0495631_0150199 | 3300046518 | Bacteria | 1000 |
| 582 | Ga0495632_0001120 | 3300046519 | Bacteria | 22955 |
| 583 | Ga0495632_0150736 | 3300046519 | Bacteria | 1075 |
| 584 | Ga0495637_0002880 | 3300046520 | Bacteria | 9325 |
| 585 | Ga0495643_0153091 | 3300046522 | Bacteria | 1140 |
| 586 | Ga0495648_0000046 | 3300046524 | Bacteria | 167725 |
| 587 | Ga0495648_0040820 | 3300046524 | Bacteria | 2937 |
| 588 | Ga0495648_0273570 | 3300046524 | Unclassified | 804 |
| 589 | Ga0495597_0002079 | 3300046542 | Bacteria | 13347 |
| 590 | Ga0495633_0027386 | 3300046558 | Bacteria | 2786 |
| 591 | Ga0495668_0007104 | 3300046616 | Bacteria | 7210 |
| 592 | Ga0495668_0015416 | 3300046616 | Bacteria | 4464 |
| 593 | Ga0495668_0025350 | 3300046616 | Bacteria | 3370 |
| 594 | Ga0495668_0156117 | 3300046616 | Bacteria | 1250 |
| 595 | Ga0495668_0307392 | 3300046616 | Bacteria | 869 |
| 596 | Ga0495625_0008016 | 3300046660 | Bacteria | 9067 |
| 597 | Ga0495625_0165576 | 3300046660 | Bacteria | 1478 |
| 598 | Ga0495661_0141381 | 3300046665 | Bacteria | 1309 |
| 599 | Ga0495669_0017781 | 3300046684 | Bacteria | 3052 |
| 600 | Ga0495671_0000057 | 3300046692 | Bacteria | 114166 |
| 601 | Ga0495671_0023658 | 3300046692 | Bacteria | 3208 |
| 602 | Ga0495673_0000110 | 3300047469 | Bacteria | 166127 |
| 603 | Ga0495673_0065762 | 3300047469 | Bacteria | 1539 |
| 604 | Ga0495681_0000038 | 3300047470 | Bacteria | 121100 |
| 605 | Ga0495686_0120134 | 3300047472 | Bacteria | 1567 |
| 606 | Ga0495686_0353594 | 3300047472 | Bacteria | 798 |
| 607 | Ga0496100_0261459 | 3300048903 | Bacteria | 1284 |
| 608 | Ga0496100_0696030 | 3300048903 | Bacteria | 793 |
| 609 | Ga0496101_0047252 | 3300048904 | Bacteria | 3089 |
| 610 | Ga0496101_0090634 | 3300048904 | Bacteria | 2274 |
| 611 | Ga0496102_0000010 | 3300048905 | Bacteria | 324617 |
| 612 | Ga0496102_0171695 | 3300048905 | Bacteria | 2041 |
| 613 | Ga0496102_0787667 | 3300048905 | Bacteria | 873 |
| 614 | Ga0496103_0000082 | 3300048906 | Bacteria | 109451 |
| 615 | Ga0496103_0205904 | 3300048906 | Bacteria | 1265 |
| 616 | Ga0496104_0796025 | 3300048907 | Bacteria | 852 |
| 617 | Ga0496105_0152762 | 3300048908 | Bacteria | 1897 |
| 618 | Ga0496106_0036350 | 3300048909 | Bacteria | 3685 |
| 619 | Ga0496107_0066600 | 3300048910 | Bacteria | 2611 |
| 620 | Ga0496108_0000725 | 3300048911 | Bacteria | 25619 |
| 621 | Ga0496108_0002601 | 3300048911 | Bacteria | 14453 |
| 622 | Ga0496108_0256428 | 3300048911 | Bacteria | 1522 |
| 623 | Ga0496109_0007321 | 3300048912 | Bacteria | 9332 |
| 624 | Ga0496109_0098341 | 3300048912 | Bacteria | 2713 |
| 625 | Ga0496109_0734721 | 3300048912 | Bacteria | 925 |
| 626 | Ga0496110_0050469 | 3300048913 | Bacteria | 3653 |
| 627 | Ga0496110_0050881 | 3300048913 | Bacteria | 3639 |
| 628 | Ga0496110_0212693 | 3300048913 | Bacteria | 1758 |
| 629 | Ga0496110_0218702 | 3300048913 | Bacteria | 1732 |
| 630 | Ga0496110_0331089 | 3300048913 | Bacteria | 1387 |
| 631 | Ga0496111_0087478 | 3300048914 | Bacteria | 2280 |
| 632 | Ga0496112_0060810 | 3300048915 | Bacteria | 3722 |
| 633 | Ga0496113_0000874 | 3300048916 | Bacteria | 15805 |
| 634 | Ga0496113_0011203 | 3300048916 | Bacteria | 5969 |
| 635 | Ga0496113_0378683 | 3300048916 | Bacteria | 1136 |
| 636 | Ga0496116_0089287 | 3300048919 | Bacteria | 1880 |
| 637 | Ga0496116_0300558 | 3300048919 | Bacteria | 764 |
| 638 | Ga0496117_0000037 | 3300048920 | Bacteria | 324960 |
| 639 | Ga0496117_0034518 | 3300048920 | Bacteria | 3810 |
| 640 | Ga0496118_0000034 | 3300048921 | Bacteria | 322764 |
| 641 | Ga0496118_0000262 | 3300048921 | Bacteria | 92154 |
| 642 | Ga0496118_0004003 | 3300048921 | Bacteria | 17936 |
| 643 | Ga0496118_0151294 | 3300048921 | Bacteria | 1452 |
| 644 | Ga0496119_0080716 | 3300048922 | Bacteria | 1875 |
| 645 | Ga0496119_0104749 | 3300048922 | Bacteria | 1581 |
| 646 | Ga0496119_0130350 | 3300048922 | Bacteria | 1371 |
| 647 | Ga0496121_0017781 | 3300048924 | Bacteria | 7228 |
| 648 | Ga0496122_0210317 | 3300048925 | Bacteria | 1127 |
| 649 | Ga0496123_0088217 | 3300048926 | Bacteria | 1853 |
| 650 | Ga0496124_0000033 | 3300048927 | Bacteria | 330586 |
| 651 | Ga0496124_0015646 | 3300048927 | Bacteria | 7260 |
| 652 | Ga0496124_0064231 | 3300048927 | Bacteria | 3065 |
| 653 | Ga0496125_0031068 | 3300048928 | Bacteria | 4767 |
| 654 | Ga0496125_0040712 | 3300048928 | Bacteria | 3982 |
| 655 | Ga0496125_0093230 | 3300048928 | Bacteria | 2248 |
| 656 | Ga0496125_0153366 | 3300048928 | Bacteria | 1578 |
| 657 | Ga0496125_0204532 | 3300048928 | Bacteria | 1289 |
| 658 | Ga0496125_0276389 | 3300048928 | Bacteria | 1043 |
| 659 | Ga0496126_0249547 | 3300048929 | Bacteria | 1479 |
| 660 | Ga0496126_0257797 | 3300048929 | Bacteria | 1451 |
| 661 | Ga0496126_0451251 | 3300048929 | Bacteria | 1035 |
| 662 | Ga0501290_000477 | 3300049513 | Bacteria | 6226 |
| 663 | Ga0501292_000012 | 3300049515 | Bacteria | 69398 |
| 664 | Ga0501294_000630 | 3300049517 | Bacteria | 3984 |
| 665 | Ga0501297_009629 | 3300049520 | Bacteria | 1083 |
| 666 | Ga0501300_012666 | 3300049523 | Bacteria | 1228 |
| 667 | Ga0501314_002572 | 3300049530 | Bacteria | 1412 |
| 668 | Ga0501315_012137 | 3300049531 | Bacteria | 1061 |
| 669 | Ga0501034_0014682 | 3300049571 | Bacteria | 8065 |
| 670 | Ga0501038_0169045 | 3300049574 | Bacteria | 1771 |
| 671 | Ga0501067_0080726 | 3300049583 | Bacteria | 1803 |
| 672 | Ga0501067_0108556 | 3300049583 | Bacteria | 1543 |
| 673 | Ga0501206_002761 | 3300049653 | Bacteria | 2210 |
| 674 | Ga0501207_016446 | 3300049654 | Bacteria | 1147 |
| 675 | Ga0501222_000613 | 3300049662 | Bacteria | 5228 |
| 676 | Ga0501223_000016 | 3300049663 | Bacteria | 68443 |
| 677 | Ga0501223_000058 | 3300049663 | Bacteria | 36525 |
| 678 | Ga0501223_010805 | 3300049663 | Bacteria | 1833 |
| 679 | Ga0501224_000021 | 3300049664 | Bacteria | 68878 |
| 680 | Ga0501224_001490 | 3300049664 | Bacteria | 3107 |
| 681 | Ga0501233_014075 | 3300049668 | Bacteria | 1630 |
| 682 | Ga0501233_040861 | 3300049668 | Bacteria | 1089 |
| 683 | Ga0501235_013751 | 3300049669 | Bacteria | 1783 |
| 684 | Ga0501257_038923 | 3300049686 | Bacteria | 1164 |
| 685 | Ga0501259_002107 | 3300049688 | Bacteria | 3276 |
| 686 | Ga0501261_000115 | 3300049690 | Bacteria | 12129 |
| 687 | Ga0501221_005448 | 3300049704 | Bacteria | 2126 |
| 688 | Ga0501225_0000013 | 3300049705 | Bacteria | 71839 |
| 689 | Ga0501225_0000022 | 3300049705 | Bacteria | 55780 |
| 690 | Ga0501225_0010525 | 3300049705 | Bacteria | 2618 |
| 691 | Ga0501225_0010651 | 3300049705 | Bacteria | 2602 |
| 692 | Ga0501234_002319 | 3300049707 | Bacteria | 2999 |
| 693 | Ga0501245_004307 | 3300049708 | Bacteria | 1950 |
| 694 | Ga0501264_000869 | 3300049761 | Bacteria | 3876 |
| 695 | Ga0501276_001508 | 3300049773 | Bacteria | 1585 |
| 696 | Ga0501278_012269 | 3300049774 | Bacteria | 705 |
| 697 | Ga0501279_000004 | 3300049775 | Bacteria | 175612 |
| 698 | Ga0501280_000056 | 3300049776 | Bacteria | 32356 |
| 699 | Ga0501281_00433 | 3300049777 | Bacteria | 4105 |
| 700 | Ga0501282_001657 | 3300049778 | Bacteria | 2453 |
| 701 | Ga0501283_001651 | 3300049779 | Bacteria | 2905 |
| 702 | Ga0501035_0254338 | 3300049822 | Bacteria | 1491 |
| 703 | Ga0501226_000031 | 3300049853 | Bacteria | 74305 |
| 704 | nmdc:mga06z11_18_c1 | 3300050494 | Bacteria | 78477 |
| 705 | nmdc:mga04h51_797_c1 | 3300050495 | Bacteria | 7330 |
| 706 | nmdc:mga07m45_188192_c1 | 3300050496 | Bacteria | 1200 |
| 707 | nmdc:mga07m45_40999_c1 | 3300050496 | Bacteria | 2114 |
| 708 | nmdc:mga09592_282720_c1 | 3300050508 | Bacteria | 1439 |
| 709 | Ga0500643_000044 | 3300053087 | Bacteria | 155319 |
| 710 | Ga0500643_000336 | 3300053087 | Bacteria | 37374 |
| 711 | Ga0500643_005818 | 3300053087 | Bacteria | 5249 |
| 712 | Ga0500643_015644 | 3300053087 | Bacteria | 2593 |
| 713 | Ga0500651_0139139 | 3300053093 | Bacteria | 1464 |
| 714 | Ga0500566_0006266 | 3300053094 | Bacteria | 7067 |
| 715 | Ga0500556_0000217 | 3300053104 | Bacteria | 46762 |
| 716 | Ga0500592_001428 | 3300053116 | Bacteria | 3871 |
| 717 | Ga0500594_0000636 | 3300053118 | Bacteria | 7492 |
| 718 | Ga0500608_049014 | 3300053122 | Bacteria | 2030 |
| 719 | Ga0500614_012441 | 3300053123 | Bacteria | 1857 |
| 720 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 721 | Ga0500655_007967 | 3300053133 | Bacteria | 1907 |
| 722 | Ga0500658_0079602 | 3300053134 | Bacteria | 1399 |
| 723 | Ga0500559_0001036 | 3300053136 | Bacteria | 16988 |
| 724 | Ga0500568_0018813 | 3300053139 | Bacteria | 3013 |
| 725 | Ga0500568_0053602 | 3300053139 | Bacteria | 1580 |
| 726 | Ga0500577_0017994 | 3300053142 | Bacteria | 2263 |
| 727 | Ga0500590_016080 | 3300053148 | Bacteria | 3865 |
| 728 | Ga0500622_0012518 | 3300053156 | Bacteria | 4592 |
| 729 | Ga0500624_000011 | 3300053157 | Bacteria | 168125 |
| 730 | Ga0500627_0000204 | 3300053158 | Bacteria | 17192 |
| 731 | Ga0500639_009649 | 3300053163 | Bacteria | 5049 |
| 732 | Ga0500636_0272887 | 3300053177 | Bacteria | 849 |
| 733 | Ga0500570_023592 | 3300053724 | Bacteria | 3403 |
| 734 | Ga0500645_000186 | 3300053730 | Bacteria | 48110 |
| 735 | Ga0500645_020199 | 3300053730 | Bacteria | 2066 |
| 736 | Ga0500661_010006 | 3300055283 | Bacteria | 1728 |
| 737 | Ga0466962_0006199 | 3300061719 | Bacteria | 5744 |
| 738 | 2512641662 | 2512564014 | Bacteria | 4639632 |
| 739 | 2585261811 | 2582581305 | Bacteria | 4895574 |
| 740 | 2644040300 | 2643221605 | Bacteria | 4772303 |
| 741 | 2778125625 | 2775507255 | Bacteria | 3945731 |
| 742 | 2809063522 | 2808606401 | Bacteria | 4586670 |
| 743 | 2809079507 | 2808606404 | Bacteria | 4652788 |
| 744 | 2809083855 | 2808606405 | Bacteria | 4586632 |
| 745 | 2880521030 | 2880518877 | Bacteria | 5012590 |
| 746 | 2896431803 | 2896429255 | Bacteria | 2557483 |
| 747 | 2919711983 | 2919709256 | Bacteria | 4318106 |
| 748 | Ga0307413_10016244 | |||
| 749 | SwRhRL2b_contig_1541095 | |||
| 750 | SwRhRL2b_contig_2839406 | |||
| 751 | JGI24741J21665_1007797 | |||
| 752 | JGI24752J21851_1000120 | |||
| 753 | JGI24740J21852_10015008 | |||
| 754 | JGI24743J22301_10007244 | |||
| 755 | JGI24735J21928_10009677 | |||
| 756 | JGI24735J21928_10011729 | |||
| 757 | JGI24735J21928_10017325 | |||
| 758 | JGI24735J21928_10031086 | |||
| 759 | JGI24735J21928_10059551 | |||
| 760 | JGI24738J21930_10002799 | |||
| 761 | JGI24749J21850_1001666 | |||
| 762 | JGI24744J21845_10000743 | |||
| 763 | JGI24034J26672_10037944 | |||
| 764 | JGI24751J29686_10000572 | |||
| 765 | Ga0065704_10071035 | |||
| 766 | Ga0065712_10100809 | |||
| 767 | Ga0065715_10009136 | |||
| 768 | Ga0065707_10081714 | |||
| 769 | Ga0065707_10098210 | |||
| 770 | Ga0065707_10159454 | |||
| 771 | Ga0070658_10006658 | |||
| 772 | Ga0070658_10010494 | |||
| 773 | Ga0070658_10031068 | |||
| 774 | Ga0070658_10043164 | |||
| 775 | Ga0070658_10107071 | |||
| 776 | Ga0070658_10168792 | |||
| 777 | Ga0070683_100002630 | |||
| 778 | Ga0070683_100327491 | |||
| 779 | Ga0070670_100000027 | |||
| 780 | Ga0070670_100000158 | |||
| 781 | Ga0070670_100001577 | |||
| 782 | Ga0070670_100066891 | |||
| 783 | Ga0070670_100143189 | |||
| 784 | Ga0070670_100341242 | |||
| 785 | Ga0070677_10046151 | |||
| 786 | Ga0070677_10076718 | |||
| 787 | Ga0068869_100159085 | |||
| 788 | Ga0070666_10004846 | |||
| 789 | Ga0070666_10010045 | |||
| 790 | Ga0070666_10069350 | |||
| 791 | Ga0070666_10550561 | |||
| 792 | Ga0070680_100022573 | |||
| 793 | Ga0070680_100109837 | |||
| 794 | Ga0070680_100761019 | |||
| 795 | Ga0070682_100102499 | |||
| 796 | Ga0070682_100227008 | |||
| 797 | Ga0068868_100052808 | |||
| 798 | Ga0068868_100187351 | |||
| 799 | Ga0070660_100103815 | |||
| 800 | Ga0070660_100139721 | |||
| 801 | Ga0070660_100145303 | |||
| 802 | Ga0070660_100162281 | |||
| 803 | Ga0070660_100344244 | |||
| 804 | Ga0070691_10004686 | |||
| 805 | Ga0070661_100016040 | |||
| 806 | Ga0070661_100016791 | |||
| 807 | Ga0070661_100049168 | |||
| 808 | Ga0070661_100084279 | |||
| 809 | Ga0070668_100000001 | |||
| 810 | Ga0070668_100000007 | |||
| 811 | Ga0070668_100000050 | |||
| 812 | Ga0070668_100015522 | |||
| 813 | Ga0070668_100070133 | |||
| 814 | Ga0070668_100140639 | |||
| 815 | Ga0070669_100000031 | |||
| 816 | Ga0070669_100010183 | |||
| 817 | Ga0070669_100010508 | |||
| 818 | Ga0070669_100166132 | |||
| 819 | Ga0070669_100276279 | |||
| 820 | Ga0070675_100045528 | |||
| 821 | Ga0070675_100054675 | |||
| 822 | Ga0070675_100132190 | |||
| 823 | Ga0070675_100281466 | |||
| 824 | Ga0070671_100000046 | |||
| 825 | Ga0070671_100007774 | |||
| 826 | Ga0070671_100009075 | |||
| 827 | Ga0070671_100009667 | |||
| 828 | Ga0070671_100012142 | |||
| 829 | Ga0070674_100054948 | |||
| 830 | Ga0070673_100001256 | |||
| 831 | Ga0070659_100007101 | |||
| 832 | Ga0070659_100028333 | |||
| 833 | Ga0070659_100108507 | |||
| 834 | Ga0070659_100114955 | |||
| 835 | Ga0070659_100163740 | |||
| 836 | Ga0070659_100627578 | |||
| 837 | Ga0070659_100658669 | |||
| 838 | Ga0070667_100000006 | |||
| 839 | Ga0070667_100000025 | |||
| 840 | Ga0070667_100000066 | |||
| 841 | Ga0070667_100000280 | |||
| 842 | Ga0070667_100003426 | |||
| 843 | Ga0070667_100004443 | |||
| 844 | Ga0070667_100161512 | |||
| 845 | Ga0070663_100012849 | |||
| 846 | Ga0070663_100017610 | |||
| 847 | Ga0070663_100058057 | |||
| 848 | Ga0070663_100139003 | |||
| 849 | Ga0070663_100143928 | |||
| 850 | Ga0070678_100042297 | |||
| 851 | Ga0070662_100007991 | |||
| 852 | Ga0070662_100100838 | |||
| 853 | Ga0070662_100460403 | |||
| 854 | Ga0070685_10445240 | |||
| 855 | Ga0070679_100101608 | |||
| 856 | Ga0070679_100115718 | |||
| 857 | Ga0070679_100244775 | |||
| 858 | Ga0070684_100065047 | |||
| 859 | Ga0068853_100007532 | |||
| 860 | Ga0068853_100026965 | |||
| 861 | Ga0068853_100033828 | |||
| 862 | Ga0068853_100202154 | |||
| 863 | Ga0068853_100600483 | |||
| 864 | Ga0070672_100039917 | |||
| 865 | Ga0070672_100239645 | |||
| 866 | Ga0070672_100994301 | |||
| 867 | Ga0070686_100365793 | |||
| 868 | Ga0070696_100095008 | |||
| 869 | Ga0070693_100159878 | |||
| 870 | Ga0070665_100006222 | |||
| 871 | Ga0070665_100872060 | |||
| 872 | Ga0070665_101201633 | |||
| 873 | Ga0068855_100000504 | |||
| 874 | Ga0068855_100068939 | |||
| 875 | Ga0068855_100073861 | |||
| 876 | Ga0068855_100105036 | |||
| 877 | Ga0068855_100313210 | |||
| 878 | Ga0068855_100337176 | |||
| 879 | Ga0070664_100002992 | |||
| 880 | Ga0070664_100032223 | |||
| 881 | Ga0070664_100057349 | |||
| 882 | Ga0070664_100209566 | |||
| 883 | Ga0070664_100448492 | |||
| 884 | Ga0070664_100609302 | |||
| 885 | Ga0068857_100006021 | |||
| 886 | Ga0068857_100021660 | |||
| 887 | Ga0068857_100023804 | |||
| 888 | Ga0068857_100060599 | |||
| 889 | Ga0068857_100062308 | |||
| 890 | Ga0068857_100195118 | |||
| 891 | Ga0068857_100242528 | |||
| 892 | Ga0068857_100771618 | |||
| 893 | Ga0068854_100000118 | |||
| 894 | Ga0068854_100002621 | |||
| 895 | Ga0068854_100005349 | |||
| 896 | Ga0068854_100006507 | |||
| 897 | Ga0068854_100058463 | |||
| 898 | Ga0068854_100125823 | |||
| 899 | Ga0068856_100022199 | |||
| 900 | Ga0068856_100047725 | |||
| 901 | Ga0068856_100106593 | |||
| 902 | Ga0068856_100210540 | |||
| 903 | Ga0070702_100439789 | |||
| 904 | Ga0068852_100000052 | |||
| 905 | Ga0068852_100053740 | |||
| 906 | Ga0068852_100105941 | |||
| 907 | Ga0068852_100109226 | |||
| 908 | Ga0068859_100006032 | |||
| 909 | Ga0068859_100033839 | |||
| 910 | Ga0068859_100086017 | |||
| 911 | Ga0068859_100170665 | |||
| 912 | Ga0068859_100210647 | |||
| 913 | Ga0068864_100000083 | |||
| 914 | Ga0068864_100000123 | |||
| 915 | Ga0068864_100011209 | |||
| 916 | Ga0068864_100034743 | |||
| 917 | Ga0068864_100117982 | |||
| 918 | Ga0068861_100182307 | |||
| 919 | Ga0068851_10036226 | |||
| 920 | Ga0068851_10040440 | |||
| 921 | Ga0068851_10123168 | |||
| 922 | Ga0068870_10066164 | |||
| 923 | Ga0068863_100000025 | |||
| 924 | Ga0068863_100000027 | |||
| 925 | Ga0068863_100000187 | |||
| 926 | Ga0068863_100004111 | |||
| 927 | Ga0068863_100008301 | |||
| 928 | Ga0068863_100064584 | |||
| 929 | Ga0068858_100000348 | |||
| 930 | Ga0068858_100042738 | |||
| 931 | Ga0068858_100672451 | |||
| 932 | Ga0068860_100000013 | |||
| 933 | Ga0068860_100000074 | |||
| 934 | Ga0068860_100005297 | |||
| 935 | Ga0068860_100200545 | |||
| 936 | Ga0068862_100000027 | |||
| 937 | Ga0068862_100000043 | |||
| 938 | Ga0068862_100000898 | |||
| 939 | Ga0068862_100156340 | |||
| 940 | Ga0081539_10014878 | |||
| 941 | Ga0070717_10125053 | |||
| 942 | Ga0075364_10250780 | |||
| 943 | Ga0075367_10000313 | |||
| 944 | Ga0075366_10026237 | |||
| 945 | Ga0097621_100025235 | |||
| 946 | Ga0097621_100082490 | |||
| 947 | Ga0075370_10056690 | |||
| 948 | Ga0075370_10205225 | |||
| 949 | Ga0068871_100002746 | |||
| 950 | Ga0068871_100094687 | |||
| 951 | Ga0068871_100140821 | |||
| 952 | Ga0075428_100660370 | |||
| 953 | Ga0097620_100006032 | |||
| 954 | Ga0097620_100033839 | |||
| 955 | Ga0097620_100086014 | |||
| 956 | Ga0097620_100170672 | |||
| 957 | Ga0097620_100210638 | |||
| 958 | Ga0105251_10000138 | |||
| 959 | Ga0105251_10005727 | |||
| 960 | Ga0105251_10153270 | |||
| 961 | Ga0105240_10046015 | |||
| 962 | Ga0105240_10167483 | |||
| 963 | Ga0105247_10009207 | |||
| 964 | Ga0114129_10037190 | |||
| 965 | Ga0105241_10002991 | |||
| 966 | Ga0105241_10223978 | |||
| 967 | Ga0105241_10228893 | |||
| 968 | Ga0105241_10451543 | |||
| 969 | Ga0105248_10000026 | |||
| 970 | Ga0105248_10000081 | |||
| 971 | Ga0105248_10002631 | |||
| 972 | Ga0105248_10107765 | |||
| 973 | Ga0105248_10317655 | |||
| 974 | Ga0105248_10619345 | |||
| 975 | Ga0105237_10080858 | |||
| 976 | Ga0105237_10108279 | |||
| 977 | Ga0105238_10031912 | |||
| 978 | Ga0105238_10320405 | |||
| 979 | Ga0105249_10000123 | |||
| 980 | Ga0105249_10040455 | |||
| 981 | Ga0105249_10141982 | |||
| 982 | Ga0105249_10923058 | |||
| 983 | Ga0105148_100012 | |||
| 984 | Ga0105239_10026961 | |||
| 985 | Ga0105239_10117846 | |||
| 986 | Ga0105239_10351827 | |||
| 987 | Ga0157326_1002462 | |||
| 988 | Ga0157373_10016855 | |||
| 989 | Ga0157373_10037566 | |||
| 990 | Ga0157373_10043083 | |||
| 991 | Ga0157373_10049288 | |||
| 992 | Ga0157373_10074175 | |||
| 993 | Ga0157373_10078903 | |||
| 994 | Ga0157371_10000443 | |||
| 995 | Ga0157371_10019219 | |||
| 996 | Ga0157371_10112157 | |||
| 997 | Ga0157371_10141302 | |||
| 998 | Ga0157371_10194077 | |||
| 999 | Ga0157370_10117796 | |||
| 1000 | Ga0157369_10265506 | |||
| 1001 | Ga0157369_10388742 | |||
| 1002 | Ga0157374_10048125 | |||
| 1003 | Ga0157374_10179025 | |||
| 1004 | Ga0163162_10009122 | |||
| 1005 | Ga0163162_10009714 | |||
| 1006 | Ga0163162_10503218 | |||
| 1007 | Ga0157372_10079810 | |||
| 1008 | Ga0157372_10232500 | |||
| 1009 | Ga0157372_10281457 | |||
| 1010 | Ga0157372_10512724 | |||
| 1011 | Ga0157372_10713325 | |||
| 1012 | Ga0157375_10090648 | |||
| 1013 | Ga0163163_10031019 | |||
| 1014 | Ga0163163_10132098 | |||
| 1015 | Ga0157380_10000040 | |||
| 1016 | Ga0157380_10000292 | |||
| 1017 | Ga0157380_10015187 | |||
| 1018 | Ga0182008_10008650 | |||
| 1019 | Ga0157379_10034586 | |||
| 1020 | Ga0163161_10000412 | |||
| 1021 | Ga0163161_10027290 | |||
| 1022 | Ga0163161_10037774 | |||
| 1023 | Ga0163161_10082540 | |||
| 1024 | Ga0163161_10227338 | |||
| 1025 | Ga0209147_101548 | |||
| 1026 | Ga0209148_1000146 | |||
| 1027 | Ga0209455_1015932 | |||
| 1028 | Ga0207697_10175116 | |||
| 1029 | Ga0207656_10071158 | |||
| 1030 | Ga0207656_10074328 | |||
| 1031 | Ga0207656_10191920 | |||
| 1032 | Ga0207713_1002556 | |||
| 1033 | Ga0207713_1101619 | |||
| 1034 | Ga0207682_10275375 | |||
| 1035 | Ga0207710_10013376 | |||
| 1036 | Ga0207680_10039475 | |||
| 1037 | Ga0207680_10156751 | |||
| 1038 | Ga0207680_10446646 | |||
| 1039 | Ga0207647_10001917 | |||
| 1040 | Ga0207647_10034886 | |||
| 1041 | Ga0207647_10043127 | |||
| 1042 | Ga0207647_10089867 | |||
| 1043 | Ga0207647_10097527 | |||
| 1044 | Ga0207645_10102794 | |||
| 1045 | Ga0207705_10005022 | |||
| 1046 | Ga0207705_10009903 | |||
| 1047 | Ga0207705_10015837 | |||
| 1048 | Ga0207705_10025919 | |||
| 1049 | Ga0207705_10167257 | |||
| 1050 | Ga0207705_10281737 | |||
| 1051 | Ga0207705_10318821 | |||
| 1052 | Ga0207654_10018033 | |||
| 1053 | Ga0207654_10048487 | |||
| 1054 | Ga0207654_10355546 | |||
| 1055 | Ga0207654_10624970 | |||
| 1056 | Ga0207695_10009667 | |||
| 1057 | Ga0207695_10060670 | |||
| 1058 | Ga0207671_10129520 | |||
| 1059 | Ga0207671_10261098 | |||
| 1060 | Ga0207660_10255504 | |||
| 1061 | Ga0207660_10650562 | |||
| 1062 | Ga0207657_10001846 | |||
| 1063 | Ga0207657_10003176 | |||
| 1064 | Ga0207657_10050871 | |||
| 1065 | Ga0207657_10062112 | |||
| 1066 | Ga0207657_10555387 | |||
| 1067 | Ga0207649_10019927 | |||
| 1068 | Ga0207649_10036156 | |||
| 1069 | Ga0207649_10053637 | |||
| 1070 | Ga0207652_10309760 | |||
| 1071 | Ga0207652_10892951 | |||
| 1072 | Ga0207681_10000014 | |||
| 1073 | Ga0207681_10020510 | |||
| 1074 | Ga0207681_10051027 | |||
| 1075 | Ga0207681_10106059 | |||
| 1076 | Ga0207681_10135294 | |||
| 1077 | Ga0207694_10017967 | |||
| 1078 | Ga0207694_10044052 | |||
| 1079 | Ga0207650_10000015 | |||
| 1080 | Ga0207650_10000056 | |||
| 1081 | Ga0207650_10005400 | |||
| 1082 | Ga0207650_10051127 | |||
| 1083 | Ga0207650_10098130 | |||
| 1084 | Ga0207650_10167350 | |||
| 1085 | Ga0207659_10096942 | |||
| 1086 | Ga0207659_10133990 | |||
| 1087 | Ga0207659_10374311 | |||
| 1088 | Ga0207644_10000111 | |||
| 1089 | Ga0207644_10001037 | |||
| 1090 | Ga0207644_10001637 | |||
| 1091 | Ga0207644_10011383 | |||
| 1092 | Ga0207644_10212986 | |||
| 1093 | Ga0207690_10012477 | |||
| 1094 | Ga0207690_10028105 | |||
| 1095 | Ga0207690_10108879 | |||
| 1096 | Ga0207690_10389674 | |||
| 1097 | Ga0207706_10000222 | |||
| 1098 | Ga0207706_10023396 | |||
| 1099 | Ga0207706_10029763 | |||
| 1100 | Ga0207706_10033152 | |||
| 1101 | Ga0207706_10117563 | |||
| 1102 | Ga0207706_10351977 | |||
| 1103 | Ga0207669_10008141 | |||
| 1104 | Ga0207691_10043801 | |||
| 1105 | Ga0207691_10062985 | |||
| 1106 | Ga0207691_10115654 | |||
| 1107 | Ga0207711_10000004 | |||
| 1108 | Ga0207711_10001014 | |||
| 1109 | Ga0207711_10013963 | |||
| 1110 | Ga0207711_10505843 | |||
| 1111 | Ga0207661_10188316 | |||
| 1112 | Ga0207661_10516934 | |||
| 1113 | Ga0207661_10699886 | |||
| 1114 | Ga0207679_10013540 | |||
| 1115 | Ga0207679_10051130 | |||
| 1116 | Ga0207679_10059864 | |||
| 1117 | Ga0207667_10000017 | |||
| 1118 | Ga0207667_10023817 | |||
| 1119 | Ga0207667_10038088 | |||
| 1120 | Ga0207667_10107671 | |||
| 1121 | Ga0207667_10153576 | |||
| 1122 | Ga0207667_10829690 | |||
| 1123 | Ga0207651_10018184 | |||
| 1124 | Ga0207651_10346194 | |||
| 1125 | Ga0207712_10000102 | |||
| 1126 | Ga0207712_10009460 | |||
| 1127 | Ga0207712_10082213 | |||
| 1128 | Ga0207712_10418366 | |||
| 1129 | Ga0207668_10000009 | |||
| 1130 | Ga0207668_10000054 | |||
| 1131 | Ga0207668_10000094 | |||
| 1132 | Ga0207668_10035386 | |||
| 1133 | Ga0207668_10267746 | |||
| 1134 | Ga0207640_10000085 | |||
| 1135 | Ga0207640_10020249 | |||
| 1136 | Ga0207640_10048927 | |||
| 1137 | Ga0207640_10069390 | |||
| 1138 | Ga0207640_10073459 | |||
| 1139 | Ga0207658_10000010 | |||
| 1140 | Ga0207658_10000023 | |||
| 1141 | Ga0207658_10000132 | |||
| 1142 | Ga0207658_10000712 | |||
| 1143 | Ga0207658_10001234 | |||
| 1144 | Ga0207658_10015979 | |||
| 1145 | Ga0207658_10054972 | |||
| 1146 | Ga0207677_10150373 | |||
| 1147 | Ga0207677_10209751 | |||
| 1148 | Ga0207703_10000368 | |||
| 1149 | Ga0207639_10000834 | |||
| 1150 | Ga0207639_10001595 | |||
| 1151 | Ga0207639_10003170 | |||
| 1152 | Ga0207639_10282601 | |||
| 1153 | Ga0207678_10000025 | |||
| 1154 | Ga0207678_10011518 | |||
| 1155 | Ga0207678_10030575 | |||
| 1156 | Ga0207678_10055443 | |||
| 1157 | Ga0207678_10064398 | |||
| 1158 | Ga0207702_10005813 | |||
| 1159 | Ga0207702_10007661 | |||
| 1160 | Ga0207702_10013135 | |||
| 1161 | Ga0207702_10063313 | |||
| 1162 | Ga0207702_10124583 | |||
| 1163 | Ga0207702_10137663 | |||
| 1164 | Ga0207702_10226535 | |||
| 1165 | Ga0207641_10000018 | |||
| 1166 | Ga0207641_10000045 | |||
| 1167 | Ga0207641_10000269 | |||
| 1168 | Ga0207641_10000584 | |||
| 1169 | Ga0207641_10001281 | |||
| 1170 | Ga0207641_10041379 | |||
| 1171 | Ga0207641_10201908 | |||
| 1172 | Ga0207676_10000021 | |||
| 1173 | Ga0207676_10000027 | |||
| 1174 | Ga0207676_10001450 | |||
| 1175 | Ga0207676_10031654 | |||
| 1176 | Ga0207674_10003093 | |||
| 1177 | Ga0207674_10003762 | |||
| 1178 | Ga0207674_10005773 | |||
| 1179 | Ga0207674_10006584 | |||
| 1180 | Ga0207674_10017740 | |||
| 1181 | Ga0207674_10022193 | |||
| 1182 | Ga0207674_10029944 | |||
| 1183 | Ga0207674_10152809 | |||
| 1184 | Ga0207674_10157832 | |||
| 1185 | Ga0207674_10599886 | |||
| 1186 | Ga0207675_100013637 | |||
| 1187 | Ga0207675_100195062 | |||
| 1188 | Ga0207683_10075146 | |||
| 1189 | Ga0207698_10000198 | |||
| 1190 | Ga0207698_10004461 | |||
| 1191 | Ga0207698_10038669 | |||
| 1192 | Ga0207698_10611602 | |||
| 1193 | Ga0209813_10000029 | |||
| 1194 | Ga0268266_10131285 | |||
| 1195 | Ga0268266_10374214 | |||
| 1196 | Ga0268265_10000013 | |||
| 1197 | Ga0268265_10000042 | |||
| 1198 | Ga0268265_10000803 | |||
| 1199 | Ga0268265_10105917 | |||
| 1200 | Ga0268264_10000039 | |||
| 1201 | Ga0268264_10000070 | |||
| 1202 | Ga0268264_10002547 | |||
| 1203 | Ga0268264_10014994 | |||
| 1204 | Ga0268264_10119524 | |||
| 1205 | Ga0268264_11241948 | |||
| 1206 | Ga0316182_1217173 | |||
| 1207 | Ga0307513_10437139 | |||
| 1208 | Ga0307408_100007308 | |||
| 1209 | Ga0307408_100366971 | |||
| 1210 | Ga0307408_100523817 | |||
| 1211 | Ga0307405_10042772 | |||
| 1212 | Ga0307405_10131789 | |||
| 1213 | Ga0307405_10232274 | |||
| 1214 | Ga0307405_10258506 | |||
| 1215 | Ga0307405_10504326 | |||
| 1216 | Ga0307413_10020897 | |||
| 1217 | Ga0307413_10211788 | |||
| 1218 | Ga0307413_10224511 | |||
| 1219 | Ga0307410_10067930 | |||
| 1220 | Ga0307410_10124410 | |||
| 1221 | Ga0307410_10162421 | |||
| 1222 | Ga0307406_10010473 | |||
| 1223 | Ga0307406_10024111 | |||
| 1224 | Ga0307406_10034986 | |||
| 1225 | Ga0307406_10214288 | |||
| 1226 | Ga0307406_10356088 | |||
| 1227 | Ga0307406_10362624 | |||
| 1228 | Ga0307407_10037438 | |||
| 1229 | Ga0307407_10123314 | |||
| 1230 | Ga0307407_10373154 | |||
| 1231 | Ga0307412_10002333 | |||
| 1232 | Ga0307412_10062262 | |||
| 1233 | Ga0307412_10144337 | |||
| 1234 | Ga0307412_10333307 | |||
| 1235 | Ga0307412_10438182 | |||
| 1236 | Ga0307412_10464343 | |||
| 1237 | Ga0307412_10466053 | |||
| 1238 | Ga0307409_100066563 | |||
| 1239 | Ga0307409_100104881 | |||
| 1240 | Ga0307409_100157928 | |||
| 1241 | Ga0307409_100523830 | |||
| 1242 | Ga0307416_100000260 | |||
| 1243 | Ga0307416_100006944 | |||
| 1244 | Ga0307416_100115578 | |||
| 1245 | Ga0307416_100345249 | |||
| 1246 | Ga0307416_100359310 | |||
| 1247 | Ga0307414_10012695 | |||
| 1248 | Ga0307414_10072818 | |||
| 1249 | Ga0307414_10113203 | |||
| 1250 | Ga0307414_10174663 | |||
| 1251 | Ga0307414_10506530 | |||
| 1252 | Ga0307414_10686957 | |||
| 1253 | Ga0307411_10017801 | |||
| 1254 | Ga0307411_10021194 | |||
| 1255 | Ga0307411_10160682 | |||
| 1256 | Ga0307411_10490505 | |||
| 1257 | Ga0307415_100045291 | |||
| 1258 | Ga0307415_100247356 | |||
| 1259 | Ga0307415_100290915 | |||
| 1260 | Ga0307415_100368471 | |||
| 1261 | Ga0307415_100408516 | |||
| 1262 | Ga0307415_100980123 | |||
| 1263 | Ga0395899_0003036 | |||
| 1264 | Ga0395899_0024581 | |||
| 1265 | Ga0395899_0057326 | |||
| 1266 | Ga0395899_0216742 | |||
| 1267 | Ga0395899_0236317 | |||
| 1268 | Ga0395899_0319849 | |||
| 1269 | Ga0395900_0017810 | |||
| 1270 | Ga0395900_0086864 | |||
| 1271 | Ga0395900_0143914 | |||
| 1272 | Ga0395900_0150332 | |||
| 1273 | Ga0395900_0343106 | |||
| 1274 | Ga0395900_0385087 | |||
| 1275 | Ga0395900_0385099 | |||
| 1276 | Ga0395900_0392759 | |||
| 1277 | Ga0395898_0038169 | |||
| 1278 | Ga0395898_0074732 | |||
| 1279 | Ga0395898_0128890 | |||
| 1280 | Ga0395898_0293237 | |||
| 1281 | Ga0395898_0332160 | |||
| 1282 | Ga0395905_0000464 | |||
| 1283 | Ga0395905_0000606 | |||
| 1284 | Ga0395905_0018897 | |||
| 1285 | Ga0395905_0025840 | |||
| 1286 | Ga0395905_0030067 | |||
| 1287 | Ga0395905_0058365 | |||
| 1288 | Ga0395905_0125925 | |||
| 1289 | Ga0395905_0135681 | |||
| 1290 | Ga0395905_0161691 | |||
| 1291 | Ga0395905_0269277 | |||
| 1292 | Ga0395905_0513882 | |||
| 1293 | Ga0395905_0640859 | |||
| 1294 | Ga0395901_0010520 | |||
| 1295 | Ga0395901_0113802 | |||
| 1296 | Ga0395901_0134683 | |||
| 1297 | Ga0395901_0238670 | |||
| 1298 | Ga0395901_0255333 | |||
| 1299 | Ga0395901_0459846 | |||
| 1300 | Ga0395901_0473999 | |||
| 1301 | Ga0395901_0489758 | |||
| 1302 | Ga0395901_0490687 | |||
| 1303 | Ga0395901_0835146 | |||
| 1304 | Ga0237819_06133 | |||
| 1305 | Ga0439439_0029635 | |||
| 1306 | Ga0439443_000920 | |||
| 1307 | Ga0439448_0100492 | |||
| 1308 | Ga0439458_0023309 | |||
| 1309 | Ga0439434_0097109 | |||
| 1310 | Ga0466961_0112497 | |||
| 1311 | Ga0466963_0006453 | |||
| 1312 | Ga0466971_0006898 | |||
| 1313 | Ga0466970_0131497 | |||
| 1314 | Ga0466957_0401723 | |||
| 1315 | Ga0466967_0024421 | |||
| 1316 | Ga0466967_0283602 | |||
| 1317 | Ga0495617_016493 | |||
| 1318 | Ga0495627_000171 | |||
| 1319 | Ga0495627_014225 | |||
| 1320 | Ga0495638_0000068 | |||
| 1321 | Ga0495638_0160866 | |||
| 1322 | Ga0495650_0001420 | |||
| 1323 | Ga0495583_0000269 | |||
| 1324 | Ga0495606_0112220 | |||
| 1325 | Ga0495610_0000199 | |||
| 1326 | Ga0495610_0019694 | |||
| 1327 | Ga0495616_0000010 | |||
| 1328 | Ga0495631_0150199 | |||
| 1329 | Ga0495632_0001120 | |||
| 1330 | Ga0495632_0150736 | |||
| 1331 | Ga0495637_0002880 | |||
| 1332 | Ga0495643_0153091 | |||
| 1333 | Ga0495648_0000046 | |||
| 1334 | Ga0495648_0040820 | |||
| 1335 | Ga0495648_0273570 | |||
| 1336 | Ga0495597_0002079 | |||
| 1337 | Ga0495633_0027386 | |||
| 1338 | Ga0495668_0007104 | |||
| 1339 | Ga0495668_0015416 | |||
| 1340 | Ga0495668_0025350 | |||
| 1341 | Ga0495668_0156117 | |||
| 1342 | Ga0495668_0307392 | |||
| 1343 | Ga0495625_0008016 | |||
| 1344 | Ga0495625_0165576 | |||
| 1345 | Ga0495661_0141381 | |||
| 1346 | Ga0495669_0017781 | |||
| 1347 | Ga0495671_0000057 | |||
| 1348 | Ga0495671_0023658 | |||
| 1349 | Ga0495673_0000110 | |||
| 1350 | Ga0495673_0065762 | |||
| 1351 | Ga0495681_0000038 | |||
| 1352 | Ga0495686_0120134 | |||
| 1353 | Ga0495686_0353594 | |||
| 1354 | Ga0496100_0261459 | |||
| 1355 | Ga0496100_0696030 | |||
| 1356 | Ga0496101_0047252 | |||
| 1357 | Ga0496101_0090634 | |||
| 1358 | Ga0496102_0000010 | |||
| 1359 | Ga0496102_0171695 | |||
| 1360 | Ga0496102_0787667 | |||
| 1361 | Ga0496103_0000082 | |||
| 1362 | Ga0496103_0205904 | |||
| 1363 | Ga0496104_0796025 | |||
| 1364 | Ga0496105_0152762 | |||
| 1365 | Ga0496106_0036350 | |||
| 1366 | Ga0496107_0066600 | |||
| 1367 | Ga0496108_0000725 | |||
| 1368 | Ga0496108_0002601 | |||
| 1369 | Ga0496108_0256428 | |||
| 1370 | Ga0496109_0007321 | |||
| 1371 | Ga0496109_0098341 | |||
| 1372 | Ga0496109_0734721 | |||
| 1373 | Ga0496110_0050469 | |||
| 1374 | Ga0496110_0050881 | |||
| 1375 | Ga0496110_0212693 | |||
| 1376 | Ga0496110_0218702 | |||
| 1377 | Ga0496110_0331089 | |||
| 1378 | Ga0496111_0087478 | |||
| 1379 | Ga0496112_0060810 | |||
| 1380 | Ga0496113_0000874 | |||
| 1381 | Ga0496113_0011203 | |||
| 1382 | Ga0496113_0378683 | |||
| 1383 | Ga0496116_0089287 | |||
| 1384 | Ga0496116_0300558 | |||
| 1385 | Ga0496117_0000037 | |||
| 1386 | Ga0496117_0034518 | |||
| 1387 | Ga0496118_0000034 | |||
| 1388 | Ga0496118_0000262 | |||
| 1389 | Ga0496118_0004003 | |||
| 1390 | Ga0496118_0151294 | |||
| 1391 | Ga0496119_0080716 | |||
| 1392 | Ga0496119_0104749 | |||
| 1393 | Ga0496119_0130350 | |||
| 1394 | Ga0496121_0017781 | |||
| 1395 | Ga0496122_0210317 | |||
| 1396 | Ga0496123_0088217 | |||
| 1397 | Ga0496124_0000033 | |||
| 1398 | Ga0496124_0015646 | |||
| 1399 | Ga0496124_0064231 | |||
| 1400 | Ga0496125_0031068 | |||
| 1401 | Ga0496125_0040712 | |||
| 1402 | Ga0496125_0093230 | |||
| 1403 | Ga0496125_0153366 | |||
| 1404 | Ga0496125_0204532 | |||
| 1405 | Ga0496125_0276389 | |||
| 1406 | Ga0496126_0249547 | |||
| 1407 | Ga0496126_0257797 | |||
| 1408 | Ga0496126_0451251 | |||
| 1409 | Ga0501290_000477 | |||
| 1410 | Ga0501292_000012 | |||
| 1411 | Ga0501294_000630 | |||
| 1412 | Ga0501297_009629 | |||
| 1413 | Ga0501300_012666 | |||
| 1414 | Ga0501314_002572 | |||
| 1415 | Ga0501315_012137 | |||
| 1416 | Ga0501034_0014682 | |||
| 1417 | Ga0501038_0169045 | |||
| 1418 | Ga0501067_0080726 | |||
| 1419 | Ga0501067_0108556 | |||
| 1420 | Ga0501206_002761 | |||
| 1421 | Ga0501207_016446 | |||
| 1422 | Ga0501222_000613 | |||
| 1423 | Ga0501223_000016 | |||
| 1424 | Ga0501223_000058 | |||
| 1425 | Ga0501223_010805 | |||
| 1426 | Ga0501224_000021 | |||
| 1427 | Ga0501224_001490 | |||
| 1428 | Ga0501233_014075 | |||
| 1429 | Ga0501233_040861 | |||
| 1430 | Ga0501235_013751 | |||
| 1431 | Ga0501257_038923 | |||
| 1432 | Ga0501259_002107 | |||
| 1433 | Ga0501261_000115 | |||
| 1434 | Ga0501221_005448 | |||
| 1435 | Ga0501225_0000013 | |||
| 1436 | Ga0501225_0000022 | |||
| 1437 | Ga0501225_0010525 | |||
| 1438 | Ga0501225_0010651 | |||
| 1439 | Ga0501234_002319 | |||
| 1440 | Ga0501245_004307 | |||
| 1441 | Ga0501264_000869 | |||
| 1442 | Ga0501276_001508 | |||
| 1443 | Ga0501278_012269 | |||
| 1444 | Ga0501279_000004 | |||
| 1445 | Ga0501280_000056 | |||
| 1446 | Ga0501281_00433 | |||
| 1447 | Ga0501282_001657 | |||
| 1448 | Ga0501283_001651 | |||
| 1449 | Ga0501035_0254338 | |||
| 1450 | Ga0501226_000031 | |||
| 1451 | nmdc:mga06z11_18_c1 | |||
| 1452 | nmdc:mga04h51_797_c1 | |||
| 1453 | nmdc:mga07m45_188192_c1 | |||
| 1454 | nmdc:mga07m45_40999_c1 | |||
| 1455 | nmdc:mga09592_282720_c1 | |||
| 1456 | Ga0500643_000044 | |||
| 1457 | Ga0500643_000336 | |||
| 1458 | Ga0500643_005818 | |||
| 1459 | Ga0500643_015644 | |||
| 1460 | Ga0500651_0139139 | |||
| 1461 | Ga0500566_0006266 | |||
| 1462 | Ga0500556_0000217 | |||
| 1463 | Ga0500592_001428 | |||
| 1464 | Ga0500594_0000636 | |||
| 1465 | Ga0500608_049014 | |||
| 1466 | Ga0500614_012441 | |||
| 1467 | Ga0500642_0000001 | |||
| 1468 | Ga0500655_007967 | |||
| 1469 | Ga0500658_0079602 | |||
| 1470 | Ga0500559_0001036 | |||
| 1471 | Ga0500568_0018813 | |||
| 1472 | Ga0500568_0053602 | |||
| 1473 | Ga0500577_0017994 | |||
| 1474 | Ga0500590_016080 | |||
| 1475 | Ga0500622_0012518 | |||
| 1476 | Ga0500624_000011 | |||
| 1477 | Ga0500627_0000204 | |||
| 1478 | Ga0500639_009649 | |||
| 1479 | Ga0500636_0272887 | |||
| 1480 | Ga0500570_023592 | |||
| 1481 | Ga0500645_000186 | |||
| 1482 | Ga0500645_020199 | |||
| 1483 | Ga0500661_010006 | |||
| 1484 | Ga0466962_0006199 | |||
| 1485 | 2512641662 | |||
| 1486 | 2585261811 | |||
| 1487 | 2644040300 | |||
| 1488 | 2778125625 | |||
| 1489 | 2809063522 | |||
| 1490 | 2809079507 | |||
| 1491 | 2809083855 | |||
| 1492 | 2880521030 | |||
| 1493 | 2896431803 | |||
| 1494 | 2919711983 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6g9x-assembly1.cif.gz_A | crystal structure of a mfs transporter at 2.54 angstroem resolution | 0.516 | 40 | 226 |
| 6g9x-assembly2.cif.gz_B | crystal structure of a mfs transporter at 2.54 angstroem resolution | 0.511 | 39 | 225 |
| 6zgr-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution | 0.5089 | 40 | 227 |
| 4iu9-assembly2.cif.gz_A | crystal structure of a membrane transporter | 0.5086 | 44 | 231 |
| 4u4v-assembly1.cif.gz_A | structure of a nitrate/nitrite antiporter nark in apo inward-open state | 0.5033 | 34 | 232 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P67127_16_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.7325 | 42 | 226 | 1.20.1250.20 |
| af_P67127_16_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.7157 | 42 | 226 | 1.20.1250.20 |
| af_Q2FZP3_16_220_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6584 | 43 | 226 | 1.20.1250.20 |
| af_Q2FZP3_16_220_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6003 | 43 | 226 | 1.20.1250.20 |
| af_Q04301_34_211_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5462 | 41 | 226 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A015L0V5-F1-model_v4 | deleted | 0.8392 | 38 | 226 |
|
| AF-A0A6M1LG30-F1-model_v4 | TerC family protein | 0.8354 | 39 | 240 |
GO:0016020
|
| AF-A0A7W8DK91-F1-model_v4 | YkoY family integral membrane protein | 0.8275 | 28 | 232 |
GO:0016020
|
| AF-A0A4R0YDB5-F1-model_v4 | TerC family protein | 0.817 | 38 | 239 |
GO:0016020
|
| AF-A0A4P7WBI9-F1-model_v4 | TerC family protein | 0.8133 | 26 | 239 |
GO:0016020
|