F478920

General Info

Members Datasets Scaffolds Average Seq Length
747 300 1494 221

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10016244|Ga0307413_100162443
Length 249
Sequence VGDELLDSILFVAAESNGLGSPADIWNSILRDFSNIGEPAALAAFFQVLLIDLVLAGDNAIVVGALAAGLPPEQRKKVILIGVIAALVLRVAFALVVTQLLQIVGLILAGGLLLLWVAWRMWRELHHPAECSPGSEEIVGDERSGLYAAKSFAGAAWAVAVADVSMSLDNVLAVAGAAREHPGILIVGLIFAVALMGVAANLIARYIERYRWIGWGGLIVILWVAGKMIWDGYHDVAPVLGWPSAQVAA

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
171 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
172 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
183 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
189 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
190 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
195 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
202 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
203 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
221 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
230 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
231 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
232 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
233 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
234 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
240 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
241 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
242 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
243 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
244 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
245 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
246 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
247 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
248 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
249 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
250 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
251 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
252 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
253 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
254 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
255 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
256 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
257 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
258 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
259 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
260 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
263 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
264 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
265 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
268 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
269 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
270 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
271 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
272 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
273 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
274 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
275 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
276 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
277 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
278 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
279 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
280 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
281 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
282 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
283 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
284 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
285 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
286 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
287 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
288 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
289 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
290 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
291 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
292 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
293 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
294 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
295 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
296 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
297 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
298 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
299 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
300 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0.27
Isolates 1.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.49
Nodule 0
Rhizoplane 3.88
Rhizosphere 86.61
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10016244 3300031824 Bacteria 3840
2 SwRhRL2b_contig_1541095 2162886007 Bacteria 1891
3 SwRhRL2b_contig_2839406 2162886007 Bacteria 822
4 JGI24741J21665_1007797 3300001915 Bacteria 2056
5 JGI24752J21851_1000120 3300001976 Bacteria 10691
6 JGI24740J21852_10015008 3300001979 Bacteria 2840
7 JGI24743J22301_10007244 3300001991 Bacteria 1917
8 JGI24735J21928_10009677 3300002067 Bacteria 3087
9 JGI24735J21928_10011729 3300002067 Bacteria 2776
10 JGI24735J21928_10017325 3300002067 Bacteria 2229
11 JGI24735J21928_10031086 3300002067 Bacteria 1583
12 JGI24735J21928_10059551 3300002067 Bacteria 1098
13 JGI24738J21930_10002799 3300002075 Bacteria 4470
14 JGI24749J21850_1001666 3300002076 Bacteria 3150
15 JGI24744J21845_10000743 3300002077 Bacteria 6054
16 JGI24034J26672_10037944 3300002239 Bacteria 802
17 JGI24751J29686_10000572 3300002459 Bacteria 9962
18 Ga0065704_10071035 3300005289 Bacteria 13600
19 Ga0065712_10100809 3300005290 Bacteria 2035
20 Ga0065715_10009136 3300005293 Bacteria 4572
21 Ga0065707_10081714 3300005295 Bacteria 75872
22 Ga0065707_10098210 3300005295 Bacteria 3104
23 Ga0065707_10159454 3300005295 Bacteria 1577
24 Ga0070658_10006658 3300005327 Bacteria 9363
25 Ga0070658_10010494 3300005327 Bacteria 7426
26 Ga0070658_10031068 3300005327 Bacteria 4288
27 Ga0070658_10043164 3300005327 Bacteria 3643
28 Ga0070658_10107071 3300005327 Bacteria 2313
29 Ga0070658_10168792 3300005327 Bacteria 1838
30 Ga0070683_100002630 3300005329 Bacteria 14354
31 Ga0070683_100327491 3300005329 Bacteria 1458
32 Ga0070670_100000027 3300005331 Bacteria 186072
33 Ga0070670_100000158 3300005331 Bacteria 62049
34 Ga0070670_100001577 3300005331 Bacteria 18383
35 Ga0070670_100066891 3300005331 Bacteria 3084
36 Ga0070670_100143189 3300005331 Bacteria 2067
37 Ga0070670_100341242 3300005331 Bacteria 1315
38 Ga0070677_10046151 3300005333 Bacteria 1741
39 Ga0070677_10076718 3300005333 Bacteria 1420
40 Ga0068869_100159085 3300005334 Bacteria 1757
41 Ga0070666_10004846 3300005335 Bacteria 8225
42 Ga0070666_10010045 3300005335 Bacteria 5909
43 Ga0070666_10069350 3300005335 Bacteria 2397
44 Ga0070666_10550561 3300005335 Bacteria 839
45 Ga0070680_100022573 3300005336 Bacteria 5014
46 Ga0070680_100109837 3300005336 Bacteria 2295
47 Ga0070680_100761019 3300005336 Bacteria 834
48 Ga0070682_100102499 3300005337 Bacteria 1892
49 Ga0070682_100227008 3300005337 Bacteria 1333
50 Ga0068868_100052808 3300005338 Bacteria 3200
51 Ga0068868_100187351 3300005338 Bacteria 1720
52 Ga0070660_100103815 3300005339 Bacteria 2254
53 Ga0070660_100139721 3300005339 Bacteria 1943
54 Ga0070660_100145303 3300005339 Bacteria 1905
55 Ga0070660_100162281 3300005339 Bacteria 1801
56 Ga0070660_100344244 3300005339 Bacteria 1227
57 Ga0070691_10004686 3300005341 Bacteria 6220
58 Ga0070661_100016040 3300005344 Bacteria 5288
59 Ga0070661_100016791 3300005344 Bacteria 5182
60 Ga0070661_100049168 3300005344 Bacteria 3087
61 Ga0070661_100084279 3300005344 Bacteria 2348
62 Ga0070668_100000001 3300005347 Bacteria 275905
63 Ga0070668_100000007 3300005347 Bacteria 150621
64 Ga0070668_100000050 3300005347 Bacteria 73885
65 Ga0070668_100015522 3300005347 Bacteria 5694
66 Ga0070668_100070133 3300005347 Bacteria 2728
67 Ga0070668_100140639 3300005347 Bacteria 1945
68 Ga0070669_100000031 3300005353 Bacteria 154042
69 Ga0070669_100010183 3300005353 Bacteria 6683
70 Ga0070669_100010508 3300005353 Bacteria 6575
71 Ga0070669_100166132 3300005353 Bacteria 1718
72 Ga0070669_100276279 3300005353 Bacteria 1345
73 Ga0070675_100045528 3300005354 Bacteria 3590
74 Ga0070675_100054675 3300005354 Bacteria 3285
75 Ga0070675_100132190 3300005354 Bacteria 2127
76 Ga0070675_100281466 3300005354 Bacteria 1462
77 Ga0070671_100000046 3300005355 Bacteria 84967
78 Ga0070671_100007774 3300005355 Bacteria 8564
79 Ga0070671_100009075 3300005355 Bacteria 7981
80 Ga0070671_100009667 3300005355 Bacteria 7748
81 Ga0070671_100012142 3300005355 Bacteria 6931
82 Ga0070674_100054948 3300005356 Bacteria 2756
83 Ga0070673_100001256 3300005364 Bacteria 14726
84 Ga0070659_100007101 3300005366 Bacteria 8122
85 Ga0070659_100028333 3300005366 Bacteria 4324
86 Ga0070659_100108507 3300005366 Bacteria 2239
87 Ga0070659_100114955 3300005366 Bacteria 2175
88 Ga0070659_100163740 3300005366 Bacteria 1819
89 Ga0070659_100627578 3300005366 Bacteria 925
90 Ga0070659_100658669 3300005366 Bacteria 903
91 Ga0070667_100000006 3300005367 Bacteria 336732
92 Ga0070667_100000025 3300005367 Bacteria 190744
93 Ga0070667_100000066 3300005367 Bacteria 134529
94 Ga0070667_100000280 3300005367 Bacteria 58186
95 Ga0070667_100003426 3300005367 Bacteria 13510
96 Ga0070667_100004443 3300005367 Bacteria 11824
97 Ga0070667_100161512 3300005367 Bacteria 1974
98 Ga0070663_100012849 3300005455 Bacteria 5314
99 Ga0070663_100017610 3300005455 Bacteria 4666
100 Ga0070663_100058057 3300005455 Bacteria 2778
101 Ga0070663_100139003 3300005455 Bacteria 1852
102 Ga0070663_100143928 3300005455 Bacteria 1822
103 Ga0070678_100042297 3300005456 Bacteria 3238
104 Ga0070662_100007991 3300005457 Bacteria 6882
105 Ga0070662_100100838 3300005457 Bacteria 2185
106 Ga0070662_100460403 3300005457 Bacteria 1057
107 Ga0070685_10445240 3300005466 Bacteria 906
108 Ga0070679_100101608 3300005530 Bacteria 2862
109 Ga0070679_100115718 3300005530 Bacteria 2667
110 Ga0070679_100244775 3300005530 Bacteria 1750
111 Ga0070684_100065047 3300005535 Bacteria 3200
112 Ga0068853_100007532 3300005539 Bacteria 8712
113 Ga0068853_100026965 3300005539 Bacteria 4828
114 Ga0068853_100033828 3300005539 Bacteria 4336
115 Ga0068853_100202154 3300005539 Bacteria 1808
116 Ga0068853_100600483 3300005539 Bacteria 1045
117 Ga0070672_100039917 3300005543 Bacteria 3598
118 Ga0070672_100239645 3300005543 Bacteria 1525
119 Ga0070672_100994301 3300005543 Bacteria 743
120 Ga0070686_100365793 3300005544 Bacteria 1088
121 Ga0070696_100095008 3300005546 Bacteria 2128
122 Ga0070693_100159878 3300005547 Bacteria 1434
123 Ga0070665_100006222 3300005548 Bacteria 12212
124 Ga0070665_100872060 3300005548 Bacteria 913
125 Ga0070665_101201633 3300005548 Bacteria 769
126 Ga0068855_100000504 3300005563 Bacteria 48297
127 Ga0068855_100068939 3300005563 Bacteria 4116
128 Ga0068855_100073861 3300005563 Bacteria 3961
129 Ga0068855_100105036 3300005563 Bacteria 3248
130 Ga0068855_100313210 3300005563 Bacteria 1736
131 Ga0068855_100337176 3300005563 Bacteria 1663
132 Ga0070664_100002992 3300005564 Bacteria 13677
133 Ga0070664_100032223 3300005564 Bacteria 4383
134 Ga0070664_100057349 3300005564 Bacteria 3310
135 Ga0070664_100209566 3300005564 Bacteria 1741
136 Ga0070664_100448492 3300005564 Bacteria 1184
137 Ga0070664_100609302 3300005564 Bacteria 1013
138 Ga0068857_100006021 3300005577 Bacteria 10357
139 Ga0068857_100021660 3300005577 Bacteria 5656
140 Ga0068857_100023804 3300005577 Bacteria 5392
141 Ga0068857_100060599 3300005577 Bacteria 3361
142 Ga0068857_100062308 3300005577 Bacteria 3315
143 Ga0068857_100195118 3300005577 Bacteria 1845
144 Ga0068857_100242528 3300005577 Bacteria 1650
145 Ga0068857_100771618 3300005577 Bacteria 917
146 Ga0068854_100000118 3300005578 Bacteria 54862
147 Ga0068854_100002621 3300005578 Bacteria 11149
148 Ga0068854_100005349 3300005578 Bacteria 8105
149 Ga0068854_100006507 3300005578 Bacteria 7435
150 Ga0068854_100058463 3300005578 Bacteria 2783
151 Ga0068854_100125823 3300005578 Bacteria 1952
152 Ga0068856_100022199 3300005614 Bacteria 6171
153 Ga0068856_100047725 3300005614 Bacteria 4219
154 Ga0068856_100106593 3300005614 Bacteria 2797
155 Ga0068856_100210540 3300005614 Bacteria 1959
156 Ga0070702_100439789 3300005615 Bacteria 943
157 Ga0068852_100000052 3300005616 Bacteria 80329
158 Ga0068852_100053740 3300005616 Bacteria 3469
159 Ga0068852_100105941 3300005616 Bacteria 2548
160 Ga0068852_100109226 3300005616 Bacteria 2511
161 Ga0068859_100006032 3300005617 Bacteria 12307
162 Ga0068859_100033839 3300005617 Bacteria 5131
163 Ga0068859_100086017 3300005617 Bacteria 3190
164 Ga0068859_100170665 3300005617 Bacteria 2256
165 Ga0068859_100210647 3300005617 Bacteria 2030
166 Ga0068864_100000083 3300005618 Bacteria 100972
167 Ga0068864_100000123 3300005618 Bacteria 75407
168 Ga0068864_100011209 3300005618 Bacteria 7410
169 Ga0068864_100034743 3300005618 Bacteria 4289
170 Ga0068864_100117982 3300005618 Bacteria 2369
171 Ga0068861_100182307 3300005719 Bacteria 1749
172 Ga0068851_10036226 3300005834 Bacteria 2470
173 Ga0068851_10040440 3300005834 Bacteria 2343
174 Ga0068851_10123168 3300005834 Bacteria 1395
175 Ga0068870_10066164 3300005840 Bacteria 1957
176 Ga0068863_100000025 3300005841 Bacteria 186072
177 Ga0068863_100000027 3300005841 Bacteria 181884
178 Ga0068863_100000187 3300005841 Bacteria 65873
179 Ga0068863_100004111 3300005841 Bacteria 14383
180 Ga0068863_100008301 3300005841 Bacteria 10148
181 Ga0068863_100064584 3300005841 Bacteria 3461
182 Ga0068858_100000348 3300005842 Bacteria 48656
183 Ga0068858_100042738 3300005842 Bacteria 4202
184 Ga0068858_100672451 3300005842 Bacteria 1007
185 Ga0068860_100000013 3300005843 Bacteria 323055
186 Ga0068860_100000074 3300005843 Bacteria 173022
187 Ga0068860_100005297 3300005843 Bacteria 13095
188 Ga0068860_100200545 3300005843 Bacteria 1933
189 Ga0068862_100000027 3300005844 Bacteria 186072
190 Ga0068862_100000043 3300005844 Bacteria 164356
191 Ga0068862_100000898 3300005844 Bacteria 28838
192 Ga0068862_100156340 3300005844 Bacteria 2033
193 Ga0081539_10014878 3300005985 Bacteria 5709
194 Ga0070717_10125053 3300006028 Bacteria 2207
195 Ga0075364_10250780 3300006051 Bacteria 1203
196 Ga0075367_10000313 3300006178 Bacteria 17087
197 Ga0075366_10026237 3300006195 Bacteria 3411
198 Ga0097621_100025235 3300006237 Bacteria 4648
199 Ga0097621_100082490 3300006237 Bacteria 2677
200 Ga0075370_10056690 3300006353 Bacteria 2227
201 Ga0075370_10205225 3300006353 Bacteria 1163
202 Ga0068871_100002746 3300006358 Bacteria 12022
203 Ga0068871_100094687 3300006358 Bacteria 2493
204 Ga0068871_100140821 3300006358 Bacteria 2051
205 Ga0075428_100660370 3300006844 Bacteria 1115
206 Ga0097620_100006032 3300006931 Bacteria 12307
207 Ga0097620_100033839 3300006931 Bacteria 5131
208 Ga0097620_100086014 3300006931 Bacteria 3190
209 Ga0097620_100170672 3300006931 Bacteria 2256
210 Ga0097620_100210638 3300006931 Bacteria 2030
211 Ga0105251_10000138 3300009011 Bacteria 74430
212 Ga0105251_10005727 3300009011 Bacteria 8060
213 Ga0105251_10153270 3300009011 Bacteria 1040
214 Ga0105240_10046015 3300009093 Bacteria 5532
215 Ga0105240_10167483 3300009093 Bacteria 2605
216 Ga0105247_10009207 3300009101 Bacteria 6006
217 Ga0114129_10037190 3300009147 Bacteria 6874
218 Ga0105241_10002991 3300009174 Bacteria 12620
219 Ga0105241_10223978 3300009174 Bacteria 1582
220 Ga0105241_10228893 3300009174 Bacteria 1566
221 Ga0105241_10451543 3300009174 Bacteria 1137
222 Ga0105248_10000026 3300009177 Bacteria 257155
223 Ga0105248_10000081 3300009177 Bacteria 111105
224 Ga0105248_10002631 3300009177 Bacteria 19969
225 Ga0105248_10107765 3300009177 Bacteria 3142
226 Ga0105248_10317655 3300009177 Bacteria 1754
227 Ga0105248_10619345 3300009177 Bacteria 1221
228 Ga0105237_10080858 3300009545 Bacteria 3240
229 Ga0105237_10108279 3300009545 Bacteria 2770
230 Ga0105238_10031912 3300009551 Bacteria 5360
231 Ga0105238_10320405 3300009551 Bacteria 1536
232 Ga0105249_10000123 3300009553 Bacteria 104747
233 Ga0105249_10040455 3300009553 Bacteria 4234
234 Ga0105249_10141982 3300009553 Bacteria 2304
235 Ga0105249_10923058 3300009553 Bacteria 940
236 Ga0105148_100012 3300009978 Bacteria 29563
237 Ga0105239_10026961 3300010375 Bacteria 6324
238 Ga0105239_10117846 3300010375 Bacteria 2947
239 Ga0105239_10351827 3300010375 Bacteria 1663
240 Ga0157326_1002462 3300012513 Bacteria 1981
241 Ga0157373_10016855 3300013100 Bacteria 5327
242 Ga0157373_10037566 3300013100 Bacteria 3471
243 Ga0157373_10043083 3300013100 Bacteria 3224
244 Ga0157373_10049288 3300013100 Bacteria 3001
245 Ga0157373_10074175 3300013100 Bacteria 2400
246 Ga0157373_10078903 3300013100 Bacteria 2322
247 Ga0157371_10000443 3300013102 Bacteria 50736
248 Ga0157371_10019219 3300013102 Bacteria 5041
249 Ga0157371_10112157 3300013102 Bacteria 1936
250 Ga0157371_10141302 3300013102 Bacteria 1715
251 Ga0157371_10194077 3300013102 Bacteria 1454
252 Ga0157370_10117796 3300013104 Bacteria 2481
253 Ga0157369_10265506 3300013105 Bacteria 1790
254 Ga0157369_10388742 3300013105 Bacteria 1448
255 Ga0157374_10048125 3300013296 Bacteria 3956
256 Ga0157374_10179025 3300013296 Bacteria 2070
257 Ga0163162_10009122 3300013306 Bacteria 9645
258 Ga0163162_10009714 3300013306 Bacteria 9363
259 Ga0163162_10503218 3300013306 Bacteria 1342
260 Ga0157372_10079810 3300013307 Bacteria 3702
261 Ga0157372_10232500 3300013307 Bacteria 2137
262 Ga0157372_10281457 3300013307 Bacteria 1934
263 Ga0157372_10512724 3300013307 Bacteria 1398
264 Ga0157372_10713325 3300013307 Bacteria 1167
265 Ga0157375_10090648 3300013308 Bacteria 3116
266 Ga0163163_10031019 3300014325 Bacteria 5155
267 Ga0163163_10132098 3300014325 Bacteria 2537
268 Ga0157380_10000040 3300014326 Bacteria 76401
269 Ga0157380_10000292 3300014326 Bacteria 30110
270 Ga0157380_10015187 3300014326 Bacteria 5655
271 Ga0182008_10008650 3300014497 Bacteria 5540
272 Ga0157379_10034586 3300014968 Bacteria 4505
273 Ga0163161_10000412 3300017792 Bacteria 35877
274 Ga0163161_10027290 3300017792 Bacteria 4050
275 Ga0163161_10037774 3300017792 Bacteria 3462
276 Ga0163161_10082540 3300017792 Bacteria 2368
277 Ga0163161_10227338 3300017792 Bacteria 1447
278 Ga0209147_101548 3300025229 Bacteria 7916
279 Ga0209148_1000146 3300025254 Bacteria 160734
280 Ga0209455_1015932 3300025272 Bacteria 1632
281 Ga0207697_10175116 3300025315 Bacteria 939
282 Ga0207656_10071158 3300025321 Bacteria 1546
283 Ga0207656_10074328 3300025321 Bacteria 1516
284 Ga0207656_10191920 3300025321 Bacteria 984
285 Ga0207713_1002556 3300025735 Bacteria 13146
286 Ga0207713_1101619 3300025735 Bacteria 991
287 Ga0207682_10275375 3300025893 Bacteria 786
288 Ga0207710_10013376 3300025900 Bacteria 3454
289 Ga0207680_10039475 3300025903 Bacteria 2740
290 Ga0207680_10156751 3300025903 Bacteria 1523
291 Ga0207680_10446646 3300025903 Bacteria 918
292 Ga0207647_10001917 3300025904 Bacteria 15905
293 Ga0207647_10034886 3300025904 Bacteria 3209
294 Ga0207647_10043127 3300025904 Bacteria 2824
295 Ga0207647_10089867 3300025904 Bacteria 1833
296 Ga0207647_10097527 3300025904 Bacteria 1748
297 Ga0207645_10102794 3300025907 Bacteria 1845
298 Ga0207705_10005022 3300025909 Bacteria 9923
299 Ga0207705_10009903 3300025909 Bacteria 6940
300 Ga0207705_10015837 3300025909 Bacteria 5416
301 Ga0207705_10025919 3300025909 Bacteria 4184
302 Ga0207705_10167257 3300025909 Bacteria 1654
303 Ga0207705_10281737 3300025909 Bacteria 1273
304 Ga0207705_10318821 3300025909 Bacteria 1194
305 Ga0207654_10018033 3300025911 Bacteria 3701
306 Ga0207654_10048487 3300025911 Bacteria 2431
307 Ga0207654_10355546 3300025911 Bacteria 1009
308 Ga0207654_10624970 3300025911 Bacteria 770
309 Ga0207695_10009667 3300025913 Bacteria 11881
310 Ga0207695_10060670 3300025913 Bacteria 3913
311 Ga0207671_10129520 3300025914 Bacteria 1936
312 Ga0207671_10261098 3300025914 Bacteria 1363
313 Ga0207660_10255504 3300025917 Bacteria 1384
314 Ga0207660_10650562 3300025917 Bacteria 859
315 Ga0207657_10001846 3300025919 Bacteria 22883
316 Ga0207657_10003176 3300025919 Bacteria 17576
317 Ga0207657_10050871 3300025919 Bacteria 3603
318 Ga0207657_10062112 3300025919 Bacteria 3200
319 Ga0207657_10555387 3300025919 Bacteria 898
320 Ga0207649_10019927 3300025920 Bacteria 3840
321 Ga0207649_10036156 3300025920 Bacteria 2973
322 Ga0207649_10053637 3300025920 Bacteria 2506
323 Ga0207652_10309760 3300025921 Bacteria 1425
324 Ga0207652_10892951 3300025921 Bacteria 785
325 Ga0207681_10000014 3300025923 Bacteria 353422
326 Ga0207681_10020510 3300025923 Bacteria 4190
327 Ga0207681_10051027 3300025923 Bacteria 2801
328 Ga0207681_10106059 3300025923 Bacteria 2035
329 Ga0207681_10135294 3300025923 Bacteria 1828
330 Ga0207694_10017967 3300025924 Bacteria 5345
331 Ga0207694_10044052 3300025924 Bacteria 3445
332 Ga0207650_10000015 3300025925 Bacteria 369173
333 Ga0207650_10000056 3300025925 Bacteria 157972
334 Ga0207650_10005400 3300025925 Bacteria 8722
335 Ga0207650_10051127 3300025925 Bacteria 3057
336 Ga0207650_10098130 3300025925 Bacteria 2250
337 Ga0207650_10167350 3300025925 Bacteria 1745
338 Ga0207659_10096942 3300025926 Bacteria 2214
339 Ga0207659_10133990 3300025926 Bacteria 1916
340 Ga0207659_10374311 3300025926 Bacteria 1186
341 Ga0207644_10000111 3300025931 Bacteria 60737
342 Ga0207644_10001037 3300025931 Bacteria 17807
343 Ga0207644_10001637 3300025931 Bacteria 14428
344 Ga0207644_10011383 3300025931 Bacteria 5884
345 Ga0207644_10212986 3300025931 Bacteria 1528
346 Ga0207690_10012477 3300025932 Bacteria 5083
347 Ga0207690_10028105 3300025932 Bacteria 3562
348 Ga0207690_10108879 3300025932 Bacteria 1992
349 Ga0207690_10389674 3300025932 Bacteria 1109
350 Ga0207706_10000222 3300025933 Bacteria 62279
351 Ga0207706_10023396 3300025933 Bacteria 5549
352 Ga0207706_10029763 3300025933 Bacteria 4873
353 Ga0207706_10033152 3300025933 Bacteria 4598
354 Ga0207706_10117563 3300025933 Bacteria 2338
355 Ga0207706_10351977 3300025933 Bacteria 1281
356 Ga0207669_10008141 3300025937 Bacteria 4906
357 Ga0207691_10043801 3300025940 Bacteria 4123
358 Ga0207691_10062985 3300025940 Bacteria 3364
359 Ga0207691_10115654 3300025940 Bacteria 2382
360 Ga0207711_10000004 3300025941 Bacteria 870636
361 Ga0207711_10001014 3300025941 Bacteria 26941
362 Ga0207711_10013963 3300025941 Bacteria 6671
363 Ga0207711_10505843 3300025941 Bacteria 1126
364 Ga0207661_10188316 3300025944 Bacteria 1807
365 Ga0207661_10516934 3300025944 Bacteria 1092
366 Ga0207661_10699886 3300025944 Bacteria 932
367 Ga0207679_10013540 3300025945 Bacteria 5346
368 Ga0207679_10051130 3300025945 Bacteria 3024
369 Ga0207679_10059864 3300025945 Bacteria 2827
370 Ga0207667_10000017 3300025949 Bacteria 390654
371 Ga0207667_10023817 3300025949 Bacteria 6737
372 Ga0207667_10038088 3300025949 Bacteria 5137
373 Ga0207667_10107671 3300025949 Bacteria 2876
374 Ga0207667_10153576 3300025949 Bacteria 2369
375 Ga0207667_10829690 3300025949 Bacteria 920
376 Ga0207651_10018184 3300025960 Bacteria 4175
377 Ga0207651_10346194 3300025960 Bacteria 1250
378 Ga0207712_10000102 3300025961 Bacteria 96444
379 Ga0207712_10009460 3300025961 Bacteria 6164
380 Ga0207712_10082213 3300025961 Bacteria 2347
381 Ga0207712_10418366 3300025961 Bacteria 1130
382 Ga0207668_10000009 3300025972 Bacteria 188071
383 Ga0207668_10000054 3300025972 Bacteria 95426
384 Ga0207668_10000094 3300025972 Bacteria 63810
385 Ga0207668_10035386 3300025972 Bacteria 3324
386 Ga0207668_10267746 3300025972 Bacteria 1395
387 Ga0207640_10000085 3300025981 Bacteria 73838
388 Ga0207640_10020249 3300025981 Bacteria 3948
389 Ga0207640_10048927 3300025981 Bacteria 2735
390 Ga0207640_10069390 3300025981 Bacteria 2366
391 Ga0207640_10073459 3300025981 Bacteria 2311
392 Ga0207658_10000010 3300025986 Bacteria 240224
393 Ga0207658_10000023 3300025986 Bacteria 190806
394 Ga0207658_10000132 3300025986 Bacteria 80078
395 Ga0207658_10000712 3300025986 Bacteria 28818
396 Ga0207658_10001234 3300025986 Bacteria 20208
397 Ga0207658_10015979 3300025986 Bacteria 5156
398 Ga0207658_10054972 3300025986 Bacteria 2948
399 Ga0207677_10150373 3300026023 Bacteria 1795
400 Ga0207677_10209751 3300026023 Bacteria 1555
401 Ga0207703_10000368 3300026035 Bacteria 48197
402 Ga0207639_10000834 3300026041 Bacteria 20903
403 Ga0207639_10001595 3300026041 Bacteria 15239
404 Ga0207639_10003170 3300026041 Bacteria 11066
405 Ga0207639_10282601 3300026041 Bacteria 1460
406 Ga0207678_10000025 3300026067 Bacteria 119139
407 Ga0207678_10011518 3300026067 Bacteria 7769
408 Ga0207678_10030575 3300026067 Bacteria 4700
409 Ga0207678_10055443 3300026067 Bacteria 3414
410 Ga0207678_10064398 3300026067 Bacteria 3149
411 Ga0207702_10005813 3300026078 Bacteria 10730
412 Ga0207702_10007661 3300026078 Bacteria 9180
413 Ga0207702_10013135 3300026078 Bacteria 6886
414 Ga0207702_10063313 3300026078 Bacteria 3162
415 Ga0207702_10124583 3300026078 Bacteria 2311
416 Ga0207702_10137663 3300026078 Bacteria 2205
417 Ga0207702_10226535 3300026078 Bacteria 1745
418 Ga0207641_10000018 3300026088 Bacteria 298209
419 Ga0207641_10000045 3300026088 Bacteria 181882
420 Ga0207641_10000269 3300026088 Bacteria 66008
421 Ga0207641_10000584 3300026088 Bacteria 40125
422 Ga0207641_10001281 3300026088 Bacteria 25019
423 Ga0207641_10041379 3300026088 Bacteria 3861
424 Ga0207641_10201908 3300026088 Bacteria 1833
425 Ga0207676_10000021 3300026095 Bacteria 296572
426 Ga0207676_10000027 3300026095 Bacteria 245868
427 Ga0207676_10001450 3300026095 Bacteria 17632
428 Ga0207676_10031654 3300026095 Bacteria 3979
429 Ga0207674_10003093 3300026116 Bacteria 20563
430 Ga0207674_10003762 3300026116 Bacteria 18513
431 Ga0207674_10005773 3300026116 Bacteria 14684
432 Ga0207674_10006584 3300026116 Bacteria 13654
433 Ga0207674_10017740 3300026116 Bacteria 7758
434 Ga0207674_10022193 3300026116 Bacteria 6822
435 Ga0207674_10029944 3300026116 Bacteria 5726
436 Ga0207674_10152809 3300026116 Bacteria 2265
437 Ga0207674_10157832 3300026116 Bacteria 2223
438 Ga0207674_10599886 3300026116 Bacteria 1064
439 Ga0207675_100013637 3300026118 Bacteria 7586
440 Ga0207675_100195062 3300026118 Bacteria 1944
441 Ga0207683_10075146 3300026121 Bacteria 2991
442 Ga0207698_10000198 3300026142 Bacteria 37741
443 Ga0207698_10004461 3300026142 Bacteria 8537
444 Ga0207698_10038669 3300026142 Bacteria 3527
445 Ga0207698_10611602 3300026142 Bacteria 1075
446 Ga0209813_10000029 3300027866 Bacteria 68229
447 Ga0268266_10131285 3300028379 Bacteria 2240
448 Ga0268266_10374214 3300028379 Bacteria 1342
449 Ga0268265_10000013 3300028380 Bacteria 341536
450 Ga0268265_10000042 3300028380 Bacteria 186086
451 Ga0268265_10000803 3300028380 Bacteria 29861
452 Ga0268265_10105917 3300028380 Bacteria 2283
453 Ga0268264_10000039 3300028381 Bacteria 376641
454 Ga0268264_10000070 3300028381 Bacteria 268524
455 Ga0268264_10002547 3300028381 Bacteria 15981
456 Ga0268264_10014994 3300028381 Bacteria 6360
457 Ga0268264_10119524 3300028381 Bacteria 2321
458 Ga0268264_11241948 3300028381 Bacteria 755
459 Ga0316182_1217173 3300030745 Bacteria 1131
460 Ga0307513_10437139 3300031456 Bacteria 1035
461 Ga0307408_100007308 3300031548 Bacteria 7307
462 Ga0307408_100366971 3300031548 Bacteria 1226
463 Ga0307408_100523817 3300031548 Bacteria 1041
464 Ga0307405_10042772 3300031731 Bacteria 2759
465 Ga0307405_10131789 3300031731 Bacteria 1728
466 Ga0307405_10232274 3300031731 Bacteria 1360
467 Ga0307405_10258506 3300031731 Bacteria 1299
468 Ga0307405_10504326 3300031731 Bacteria 970
469 Ga0307413_10020897 3300031824 Bacteria 3493
470 Ga0307413_10211788 3300031824 Bacteria 1408
471 Ga0307413_10224511 3300031824 Bacteria 1374
472 Ga0307410_10067930 3300031852 Bacteria 2460
473 Ga0307410_10124410 3300031852 Bacteria 1885
474 Ga0307410_10162421 3300031852 Bacteria 1675
475 Ga0307406_10010473 3300031901 Bacteria 5231
476 Ga0307406_10024111 3300031901 Bacteria 3629
477 Ga0307406_10034986 3300031901 Bacteria 3085
478 Ga0307406_10214288 3300031901 Bacteria 1427
479 Ga0307406_10356088 3300031901 Bacteria 1145
480 Ga0307406_10362624 3300031901 Bacteria 1136
481 Ga0307407_10037438 3300031903 Bacteria 2680
482 Ga0307407_10123314 3300031903 Bacteria 1646
483 Ga0307407_10373154 3300031903 Bacteria 1016
484 Ga0307412_10002333 3300031911 Bacteria 10511
485 Ga0307412_10062262 3300031911 Bacteria 2511
486 Ga0307412_10144337 3300031911 Bacteria 1747
487 Ga0307412_10333307 3300031911 Bacteria 1212
488 Ga0307412_10438182 3300031911 Bacteria 1073
489 Ga0307412_10464343 3300031911 Bacteria 1046
490 Ga0307412_10466053 3300031911 Bacteria 1044
491 Ga0307409_100066563 3300031995 Bacteria 2842
492 Ga0307409_100104881 3300031995 Bacteria 2355
493 Ga0307409_100157928 3300031995 Bacteria 1979
494 Ga0307409_100523830 3300031995 Bacteria 1158
495 Ga0307416_100000260 3300032002 Bacteria 28062
496 Ga0307416_100006944 3300032002 Bacteria 7137
497 Ga0307416_100115578 3300032002 Bacteria 2376
498 Ga0307416_100345249 3300032002 Bacteria 1503
499 Ga0307416_100359310 3300032002 Bacteria 1478
500 Ga0307414_10012695 3300032004 Bacteria 4993
501 Ga0307414_10072818 3300032004 Bacteria 2483
502 Ga0307414_10113203 3300032004 Bacteria 2070
503 Ga0307414_10174663 3300032004 Bacteria 1721
504 Ga0307414_10506530 3300032004 Bacteria 1069
505 Ga0307414_10686957 3300032004 Bacteria 925
506 Ga0307411_10017801 3300032005 Bacteria 4061
507 Ga0307411_10021194 3300032005 Bacteria 3797
508 Ga0307411_10160682 3300032005 Bacteria 1682
509 Ga0307411_10490505 3300032005 Bacteria 1036
510 Ga0307415_100045291 3300032126 Bacteria 2948
511 Ga0307415_100247356 3300032126 Bacteria 1446
512 Ga0307415_100290915 3300032126 Bacteria 1348
513 Ga0307415_100368471 3300032126 Bacteria 1215
514 Ga0307415_100408516 3300032126 Bacteria 1161
515 Ga0307415_100980123 3300032126 Bacteria 784
516 Ga0395899_0003036 3300037312 Bacteria 13401
517 Ga0395899_0024581 3300037312 Bacteria 4554
518 Ga0395899_0057326 3300037312 Bacteria 2876
519 Ga0395899_0216742 3300037312 Bacteria 1327
520 Ga0395899_0236317 3300037312 Bacteria 1259
521 Ga0395899_0319849 3300037312 Bacteria 1045
522 Ga0395900_0017810 3300037418 Bacteria 7251
523 Ga0395900_0086864 3300037418 Bacteria 3214
524 Ga0395900_0143914 3300037418 Bacteria 2439
525 Ga0395900_0150332 3300037418 Bacteria 2379
526 Ga0395900_0343106 3300037418 Bacteria 1468
527 Ga0395900_0385087 3300037418 Bacteria 1369
528 Ga0395900_0385099 3300037418 Bacteria 1369
529 Ga0395900_0392759 3300037418 Bacteria 1353
530 Ga0395898_0038169 3300037466 Bacteria 4762
531 Ga0395898_0074732 3300037466 Bacteria 3273
532 Ga0395898_0128890 3300037466 Bacteria 2423
533 Ga0395898_0293237 3300037466 Unclassified 1552
534 Ga0395898_0332160 3300037466 Bacteria 1449
535 Ga0395905_0000464 3300037471 Bacteria 56406
536 Ga0395905_0000606 3300037471 Bacteria 48007
537 Ga0395905_0018897 3300037471 Bacteria 6536
538 Ga0395905_0025840 3300037471 Bacteria 5534
539 Ga0395905_0030067 3300037471 Bacteria 5120
540 Ga0395905_0058365 3300037471 Bacteria 3608
541 Ga0395905_0125925 3300037471 Bacteria 2409
542 Ga0395905_0135681 3300037471 Bacteria 2314
543 Ga0395905_0161691 3300037471 Bacteria 2104
544 Ga0395905_0269277 3300037471 Bacteria 1589
545 Ga0395905_0513882 3300037471 Bacteria 1098
546 Ga0395905_0640859 3300037471 Bacteria 964
547 Ga0395901_0010520 3300038443 Bacteria 9370
548 Ga0395901_0113802 3300038443 Bacteria 2841
549 Ga0395901_0134683 3300038443 Bacteria 2596
550 Ga0395901_0238670 3300038443 Bacteria 1896
551 Ga0395901_0255333 3300038443 Bacteria 1825
552 Ga0395901_0459846 3300038443 Bacteria 1300
553 Ga0395901_0473999 3300038443 Bacteria 1277
554 Ga0395901_0489758 3300038443 Bacteria 1253
555 Ga0395901_0490687 3300038443 Bacteria 1251
556 Ga0395901_0835146 3300038443 Bacteria 908
557 Ga0237819_06133 3300038705 Bacteria 1828
558 Ga0439439_0029635 3300041406 Bacteria 1389
559 Ga0439443_000920 3300042003 Bacteria 2991
560 Ga0439448_0100492 3300042005 Bacteria 983
561 Ga0439458_0023309 3300042157 Bacteria 1443
562 Ga0439434_0097109 3300042435 Bacteria 947
563 Ga0466961_0112497 3300044693 Bacteria 1712
564 Ga0466963_0006453 3300044694 Bacteria 6938
565 Ga0466971_0006898 3300044719 Bacteria 4937
566 Ga0466970_0131497 3300044765 Bacteria 1375
567 Ga0466957_0401723 3300044842 Bacteria 937
568 Ga0466967_0024421 3300045976 Bacteria 4969
569 Ga0466967_0283602 3300045976 Bacteria 1590
570 Ga0495617_016493 3300046452 Bacteria 2498
571 Ga0495627_000171 3300046453 Bacteria 74013
572 Ga0495627_014225 3300046453 Bacteria 2782
573 Ga0495638_0000068 3300046460 Bacteria 167596
574 Ga0495638_0160866 3300046460 Bacteria 1295
575 Ga0495650_0001420 3300046471 Bacteria 23288
576 Ga0495583_0000269 3300046506 Bacteria 85380
577 Ga0495606_0112220 3300046507 Bacteria 1643
578 Ga0495610_0000199 3300046512 Bacteria 67146
579 Ga0495610_0019694 3300046512 Bacteria 3766
580 Ga0495616_0000010 3300046513 Bacteria 224378
581 Ga0495631_0150199 3300046518 Bacteria 1000
582 Ga0495632_0001120 3300046519 Bacteria 22955
583 Ga0495632_0150736 3300046519 Bacteria 1075
584 Ga0495637_0002880 3300046520 Bacteria 9325
585 Ga0495643_0153091 3300046522 Bacteria 1140
586 Ga0495648_0000046 3300046524 Bacteria 167725
587 Ga0495648_0040820 3300046524 Bacteria 2937
588 Ga0495648_0273570 3300046524 Unclassified 804
589 Ga0495597_0002079 3300046542 Bacteria 13347
590 Ga0495633_0027386 3300046558 Bacteria 2786
591 Ga0495668_0007104 3300046616 Bacteria 7210
592 Ga0495668_0015416 3300046616 Bacteria 4464
593 Ga0495668_0025350 3300046616 Bacteria 3370
594 Ga0495668_0156117 3300046616 Bacteria 1250
595 Ga0495668_0307392 3300046616 Bacteria 869
596 Ga0495625_0008016 3300046660 Bacteria 9067
597 Ga0495625_0165576 3300046660 Bacteria 1478
598 Ga0495661_0141381 3300046665 Bacteria 1309
599 Ga0495669_0017781 3300046684 Bacteria 3052
600 Ga0495671_0000057 3300046692 Bacteria 114166
601 Ga0495671_0023658 3300046692 Bacteria 3208
602 Ga0495673_0000110 3300047469 Bacteria 166127
603 Ga0495673_0065762 3300047469 Bacteria 1539
604 Ga0495681_0000038 3300047470 Bacteria 121100
605 Ga0495686_0120134 3300047472 Bacteria 1567
606 Ga0495686_0353594 3300047472 Bacteria 798
607 Ga0496100_0261459 3300048903 Bacteria 1284
608 Ga0496100_0696030 3300048903 Bacteria 793
609 Ga0496101_0047252 3300048904 Bacteria 3089
610 Ga0496101_0090634 3300048904 Bacteria 2274
611 Ga0496102_0000010 3300048905 Bacteria 324617
612 Ga0496102_0171695 3300048905 Bacteria 2041
613 Ga0496102_0787667 3300048905 Bacteria 873
614 Ga0496103_0000082 3300048906 Bacteria 109451
615 Ga0496103_0205904 3300048906 Bacteria 1265
616 Ga0496104_0796025 3300048907 Bacteria 852
617 Ga0496105_0152762 3300048908 Bacteria 1897
618 Ga0496106_0036350 3300048909 Bacteria 3685
619 Ga0496107_0066600 3300048910 Bacteria 2611
620 Ga0496108_0000725 3300048911 Bacteria 25619
621 Ga0496108_0002601 3300048911 Bacteria 14453
622 Ga0496108_0256428 3300048911 Bacteria 1522
623 Ga0496109_0007321 3300048912 Bacteria 9332
624 Ga0496109_0098341 3300048912 Bacteria 2713
625 Ga0496109_0734721 3300048912 Bacteria 925
626 Ga0496110_0050469 3300048913 Bacteria 3653
627 Ga0496110_0050881 3300048913 Bacteria 3639
628 Ga0496110_0212693 3300048913 Bacteria 1758
629 Ga0496110_0218702 3300048913 Bacteria 1732
630 Ga0496110_0331089 3300048913 Bacteria 1387
631 Ga0496111_0087478 3300048914 Bacteria 2280
632 Ga0496112_0060810 3300048915 Bacteria 3722
633 Ga0496113_0000874 3300048916 Bacteria 15805
634 Ga0496113_0011203 3300048916 Bacteria 5969
635 Ga0496113_0378683 3300048916 Bacteria 1136
636 Ga0496116_0089287 3300048919 Bacteria 1880
637 Ga0496116_0300558 3300048919 Bacteria 764
638 Ga0496117_0000037 3300048920 Bacteria 324960
639 Ga0496117_0034518 3300048920 Bacteria 3810
640 Ga0496118_0000034 3300048921 Bacteria 322764
641 Ga0496118_0000262 3300048921 Bacteria 92154
642 Ga0496118_0004003 3300048921 Bacteria 17936
643 Ga0496118_0151294 3300048921 Bacteria 1452
644 Ga0496119_0080716 3300048922 Bacteria 1875
645 Ga0496119_0104749 3300048922 Bacteria 1581
646 Ga0496119_0130350 3300048922 Bacteria 1371
647 Ga0496121_0017781 3300048924 Bacteria 7228
648 Ga0496122_0210317 3300048925 Bacteria 1127
649 Ga0496123_0088217 3300048926 Bacteria 1853
650 Ga0496124_0000033 3300048927 Bacteria 330586
651 Ga0496124_0015646 3300048927 Bacteria 7260
652 Ga0496124_0064231 3300048927 Bacteria 3065
653 Ga0496125_0031068 3300048928 Bacteria 4767
654 Ga0496125_0040712 3300048928 Bacteria 3982
655 Ga0496125_0093230 3300048928 Bacteria 2248
656 Ga0496125_0153366 3300048928 Bacteria 1578
657 Ga0496125_0204532 3300048928 Bacteria 1289
658 Ga0496125_0276389 3300048928 Bacteria 1043
659 Ga0496126_0249547 3300048929 Bacteria 1479
660 Ga0496126_0257797 3300048929 Bacteria 1451
661 Ga0496126_0451251 3300048929 Bacteria 1035
662 Ga0501290_000477 3300049513 Bacteria 6226
663 Ga0501292_000012 3300049515 Bacteria 69398
664 Ga0501294_000630 3300049517 Bacteria 3984
665 Ga0501297_009629 3300049520 Bacteria 1083
666 Ga0501300_012666 3300049523 Bacteria 1228
667 Ga0501314_002572 3300049530 Bacteria 1412
668 Ga0501315_012137 3300049531 Bacteria 1061
669 Ga0501034_0014682 3300049571 Bacteria 8065
670 Ga0501038_0169045 3300049574 Bacteria 1771
671 Ga0501067_0080726 3300049583 Bacteria 1803
672 Ga0501067_0108556 3300049583 Bacteria 1543
673 Ga0501206_002761 3300049653 Bacteria 2210
674 Ga0501207_016446 3300049654 Bacteria 1147
675 Ga0501222_000613 3300049662 Bacteria 5228
676 Ga0501223_000016 3300049663 Bacteria 68443
677 Ga0501223_000058 3300049663 Bacteria 36525
678 Ga0501223_010805 3300049663 Bacteria 1833
679 Ga0501224_000021 3300049664 Bacteria 68878
680 Ga0501224_001490 3300049664 Bacteria 3107
681 Ga0501233_014075 3300049668 Bacteria 1630
682 Ga0501233_040861 3300049668 Bacteria 1089
683 Ga0501235_013751 3300049669 Bacteria 1783
684 Ga0501257_038923 3300049686 Bacteria 1164
685 Ga0501259_002107 3300049688 Bacteria 3276
686 Ga0501261_000115 3300049690 Bacteria 12129
687 Ga0501221_005448 3300049704 Bacteria 2126
688 Ga0501225_0000013 3300049705 Bacteria 71839
689 Ga0501225_0000022 3300049705 Bacteria 55780
690 Ga0501225_0010525 3300049705 Bacteria 2618
691 Ga0501225_0010651 3300049705 Bacteria 2602
692 Ga0501234_002319 3300049707 Bacteria 2999
693 Ga0501245_004307 3300049708 Bacteria 1950
694 Ga0501264_000869 3300049761 Bacteria 3876
695 Ga0501276_001508 3300049773 Bacteria 1585
696 Ga0501278_012269 3300049774 Bacteria 705
697 Ga0501279_000004 3300049775 Bacteria 175612
698 Ga0501280_000056 3300049776 Bacteria 32356
699 Ga0501281_00433 3300049777 Bacteria 4105
700 Ga0501282_001657 3300049778 Bacteria 2453
701 Ga0501283_001651 3300049779 Bacteria 2905
702 Ga0501035_0254338 3300049822 Bacteria 1491
703 Ga0501226_000031 3300049853 Bacteria 74305
704 nmdc:mga06z11_18_c1 3300050494 Bacteria 78477
705 nmdc:mga04h51_797_c1 3300050495 Bacteria 7330
706 nmdc:mga07m45_188192_c1 3300050496 Bacteria 1200
707 nmdc:mga07m45_40999_c1 3300050496 Bacteria 2114
708 nmdc:mga09592_282720_c1 3300050508 Bacteria 1439
709 Ga0500643_000044 3300053087 Bacteria 155319
710 Ga0500643_000336 3300053087 Bacteria 37374
711 Ga0500643_005818 3300053087 Bacteria 5249
712 Ga0500643_015644 3300053087 Bacteria 2593
713 Ga0500651_0139139 3300053093 Bacteria 1464
714 Ga0500566_0006266 3300053094 Bacteria 7067
715 Ga0500556_0000217 3300053104 Bacteria 46762
716 Ga0500592_001428 3300053116 Bacteria 3871
717 Ga0500594_0000636 3300053118 Bacteria 7492
718 Ga0500608_049014 3300053122 Bacteria 2030
719 Ga0500614_012441 3300053123 Bacteria 1857
720 Ga0500642_0000001 3300053130 Bacteria 1468402
721 Ga0500655_007967 3300053133 Bacteria 1907
722 Ga0500658_0079602 3300053134 Bacteria 1399
723 Ga0500559_0001036 3300053136 Bacteria 16988
724 Ga0500568_0018813 3300053139 Bacteria 3013
725 Ga0500568_0053602 3300053139 Bacteria 1580
726 Ga0500577_0017994 3300053142 Bacteria 2263
727 Ga0500590_016080 3300053148 Bacteria 3865
728 Ga0500622_0012518 3300053156 Bacteria 4592
729 Ga0500624_000011 3300053157 Bacteria 168125
730 Ga0500627_0000204 3300053158 Bacteria 17192
731 Ga0500639_009649 3300053163 Bacteria 5049
732 Ga0500636_0272887 3300053177 Bacteria 849
733 Ga0500570_023592 3300053724 Bacteria 3403
734 Ga0500645_000186 3300053730 Bacteria 48110
735 Ga0500645_020199 3300053730 Bacteria 2066
736 Ga0500661_010006 3300055283 Bacteria 1728
737 Ga0466962_0006199 3300061719 Bacteria 5744
738 2512641662 2512564014 Bacteria 4639632
739 2585261811 2582581305 Bacteria 4895574
740 2644040300 2643221605 Bacteria 4772303
741 2778125625 2775507255 Bacteria 3945731
742 2809063522 2808606401 Bacteria 4586670
743 2809079507 2808606404 Bacteria 4652788
744 2809083855 2808606405 Bacteria 4586632
745 2880521030 2880518877 Bacteria 5012590
746 2896431803 2896429255 Bacteria 2557483
747 2919711983 2919709256 Bacteria 4318106
748 Ga0307413_10016244
749 SwRhRL2b_contig_1541095
750 SwRhRL2b_contig_2839406
751 JGI24741J21665_1007797
752 JGI24752J21851_1000120
753 JGI24740J21852_10015008
754 JGI24743J22301_10007244
755 JGI24735J21928_10009677
756 JGI24735J21928_10011729
757 JGI24735J21928_10017325
758 JGI24735J21928_10031086
759 JGI24735J21928_10059551
760 JGI24738J21930_10002799
761 JGI24749J21850_1001666
762 JGI24744J21845_10000743
763 JGI24034J26672_10037944
764 JGI24751J29686_10000572
765 Ga0065704_10071035
766 Ga0065712_10100809
767 Ga0065715_10009136
768 Ga0065707_10081714
769 Ga0065707_10098210
770 Ga0065707_10159454
771 Ga0070658_10006658
772 Ga0070658_10010494
773 Ga0070658_10031068
774 Ga0070658_10043164
775 Ga0070658_10107071
776 Ga0070658_10168792
777 Ga0070683_100002630
778 Ga0070683_100327491
779 Ga0070670_100000027
780 Ga0070670_100000158
781 Ga0070670_100001577
782 Ga0070670_100066891
783 Ga0070670_100143189
784 Ga0070670_100341242
785 Ga0070677_10046151
786 Ga0070677_10076718
787 Ga0068869_100159085
788 Ga0070666_10004846
789 Ga0070666_10010045
790 Ga0070666_10069350
791 Ga0070666_10550561
792 Ga0070680_100022573
793 Ga0070680_100109837
794 Ga0070680_100761019
795 Ga0070682_100102499
796 Ga0070682_100227008
797 Ga0068868_100052808
798 Ga0068868_100187351
799 Ga0070660_100103815
800 Ga0070660_100139721
801 Ga0070660_100145303
802 Ga0070660_100162281
803 Ga0070660_100344244
804 Ga0070691_10004686
805 Ga0070661_100016040
806 Ga0070661_100016791
807 Ga0070661_100049168
808 Ga0070661_100084279
809 Ga0070668_100000001
810 Ga0070668_100000007
811 Ga0070668_100000050
812 Ga0070668_100015522
813 Ga0070668_100070133
814 Ga0070668_100140639
815 Ga0070669_100000031
816 Ga0070669_100010183
817 Ga0070669_100010508
818 Ga0070669_100166132
819 Ga0070669_100276279
820 Ga0070675_100045528
821 Ga0070675_100054675
822 Ga0070675_100132190
823 Ga0070675_100281466
824 Ga0070671_100000046
825 Ga0070671_100007774
826 Ga0070671_100009075
827 Ga0070671_100009667
828 Ga0070671_100012142
829 Ga0070674_100054948
830 Ga0070673_100001256
831 Ga0070659_100007101
832 Ga0070659_100028333
833 Ga0070659_100108507
834 Ga0070659_100114955
835 Ga0070659_100163740
836 Ga0070659_100627578
837 Ga0070659_100658669
838 Ga0070667_100000006
839 Ga0070667_100000025
840 Ga0070667_100000066
841 Ga0070667_100000280
842 Ga0070667_100003426
843 Ga0070667_100004443
844 Ga0070667_100161512
845 Ga0070663_100012849
846 Ga0070663_100017610
847 Ga0070663_100058057
848 Ga0070663_100139003
849 Ga0070663_100143928
850 Ga0070678_100042297
851 Ga0070662_100007991
852 Ga0070662_100100838
853 Ga0070662_100460403
854 Ga0070685_10445240
855 Ga0070679_100101608
856 Ga0070679_100115718
857 Ga0070679_100244775
858 Ga0070684_100065047
859 Ga0068853_100007532
860 Ga0068853_100026965
861 Ga0068853_100033828
862 Ga0068853_100202154
863 Ga0068853_100600483
864 Ga0070672_100039917
865 Ga0070672_100239645
866 Ga0070672_100994301
867 Ga0070686_100365793
868 Ga0070696_100095008
869 Ga0070693_100159878
870 Ga0070665_100006222
871 Ga0070665_100872060
872 Ga0070665_101201633
873 Ga0068855_100000504
874 Ga0068855_100068939
875 Ga0068855_100073861
876 Ga0068855_100105036
877 Ga0068855_100313210
878 Ga0068855_100337176
879 Ga0070664_100002992
880 Ga0070664_100032223
881 Ga0070664_100057349
882 Ga0070664_100209566
883 Ga0070664_100448492
884 Ga0070664_100609302
885 Ga0068857_100006021
886 Ga0068857_100021660
887 Ga0068857_100023804
888 Ga0068857_100060599
889 Ga0068857_100062308
890 Ga0068857_100195118
891 Ga0068857_100242528
892 Ga0068857_100771618
893 Ga0068854_100000118
894 Ga0068854_100002621
895 Ga0068854_100005349
896 Ga0068854_100006507
897 Ga0068854_100058463
898 Ga0068854_100125823
899 Ga0068856_100022199
900 Ga0068856_100047725
901 Ga0068856_100106593
902 Ga0068856_100210540
903 Ga0070702_100439789
904 Ga0068852_100000052
905 Ga0068852_100053740
906 Ga0068852_100105941
907 Ga0068852_100109226
908 Ga0068859_100006032
909 Ga0068859_100033839
910 Ga0068859_100086017
911 Ga0068859_100170665
912 Ga0068859_100210647
913 Ga0068864_100000083
914 Ga0068864_100000123
915 Ga0068864_100011209
916 Ga0068864_100034743
917 Ga0068864_100117982
918 Ga0068861_100182307
919 Ga0068851_10036226
920 Ga0068851_10040440
921 Ga0068851_10123168
922 Ga0068870_10066164
923 Ga0068863_100000025
924 Ga0068863_100000027
925 Ga0068863_100000187
926 Ga0068863_100004111
927 Ga0068863_100008301
928 Ga0068863_100064584
929 Ga0068858_100000348
930 Ga0068858_100042738
931 Ga0068858_100672451
932 Ga0068860_100000013
933 Ga0068860_100000074
934 Ga0068860_100005297
935 Ga0068860_100200545
936 Ga0068862_100000027
937 Ga0068862_100000043
938 Ga0068862_100000898
939 Ga0068862_100156340
940 Ga0081539_10014878
941 Ga0070717_10125053
942 Ga0075364_10250780
943 Ga0075367_10000313
944 Ga0075366_10026237
945 Ga0097621_100025235
946 Ga0097621_100082490
947 Ga0075370_10056690
948 Ga0075370_10205225
949 Ga0068871_100002746
950 Ga0068871_100094687
951 Ga0068871_100140821
952 Ga0075428_100660370
953 Ga0097620_100006032
954 Ga0097620_100033839
955 Ga0097620_100086014
956 Ga0097620_100170672
957 Ga0097620_100210638
958 Ga0105251_10000138
959 Ga0105251_10005727
960 Ga0105251_10153270
961 Ga0105240_10046015
962 Ga0105240_10167483
963 Ga0105247_10009207
964 Ga0114129_10037190
965 Ga0105241_10002991
966 Ga0105241_10223978
967 Ga0105241_10228893
968 Ga0105241_10451543
969 Ga0105248_10000026
970 Ga0105248_10000081
971 Ga0105248_10002631
972 Ga0105248_10107765
973 Ga0105248_10317655
974 Ga0105248_10619345
975 Ga0105237_10080858
976 Ga0105237_10108279
977 Ga0105238_10031912
978 Ga0105238_10320405
979 Ga0105249_10000123
980 Ga0105249_10040455
981 Ga0105249_10141982
982 Ga0105249_10923058
983 Ga0105148_100012
984 Ga0105239_10026961
985 Ga0105239_10117846
986 Ga0105239_10351827
987 Ga0157326_1002462
988 Ga0157373_10016855
989 Ga0157373_10037566
990 Ga0157373_10043083
991 Ga0157373_10049288
992 Ga0157373_10074175
993 Ga0157373_10078903
994 Ga0157371_10000443
995 Ga0157371_10019219
996 Ga0157371_10112157
997 Ga0157371_10141302
998 Ga0157371_10194077
999 Ga0157370_10117796
1000 Ga0157369_10265506
1001 Ga0157369_10388742
1002 Ga0157374_10048125
1003 Ga0157374_10179025
1004 Ga0163162_10009122
1005 Ga0163162_10009714
1006 Ga0163162_10503218
1007 Ga0157372_10079810
1008 Ga0157372_10232500
1009 Ga0157372_10281457
1010 Ga0157372_10512724
1011 Ga0157372_10713325
1012 Ga0157375_10090648
1013 Ga0163163_10031019
1014 Ga0163163_10132098
1015 Ga0157380_10000040
1016 Ga0157380_10000292
1017 Ga0157380_10015187
1018 Ga0182008_10008650
1019 Ga0157379_10034586
1020 Ga0163161_10000412
1021 Ga0163161_10027290
1022 Ga0163161_10037774
1023 Ga0163161_10082540
1024 Ga0163161_10227338
1025 Ga0209147_101548
1026 Ga0209148_1000146
1027 Ga0209455_1015932
1028 Ga0207697_10175116
1029 Ga0207656_10071158
1030 Ga0207656_10074328
1031 Ga0207656_10191920
1032 Ga0207713_1002556
1033 Ga0207713_1101619
1034 Ga0207682_10275375
1035 Ga0207710_10013376
1036 Ga0207680_10039475
1037 Ga0207680_10156751
1038 Ga0207680_10446646
1039 Ga0207647_10001917
1040 Ga0207647_10034886
1041 Ga0207647_10043127
1042 Ga0207647_10089867
1043 Ga0207647_10097527
1044 Ga0207645_10102794
1045 Ga0207705_10005022
1046 Ga0207705_10009903
1047 Ga0207705_10015837
1048 Ga0207705_10025919
1049 Ga0207705_10167257
1050 Ga0207705_10281737
1051 Ga0207705_10318821
1052 Ga0207654_10018033
1053 Ga0207654_10048487
1054 Ga0207654_10355546
1055 Ga0207654_10624970
1056 Ga0207695_10009667
1057 Ga0207695_10060670
1058 Ga0207671_10129520
1059 Ga0207671_10261098
1060 Ga0207660_10255504
1061 Ga0207660_10650562
1062 Ga0207657_10001846
1063 Ga0207657_10003176
1064 Ga0207657_10050871
1065 Ga0207657_10062112
1066 Ga0207657_10555387
1067 Ga0207649_10019927
1068 Ga0207649_10036156
1069 Ga0207649_10053637
1070 Ga0207652_10309760
1071 Ga0207652_10892951
1072 Ga0207681_10000014
1073 Ga0207681_10020510
1074 Ga0207681_10051027
1075 Ga0207681_10106059
1076 Ga0207681_10135294
1077 Ga0207694_10017967
1078 Ga0207694_10044052
1079 Ga0207650_10000015
1080 Ga0207650_10000056
1081 Ga0207650_10005400
1082 Ga0207650_10051127
1083 Ga0207650_10098130
1084 Ga0207650_10167350
1085 Ga0207659_10096942
1086 Ga0207659_10133990
1087 Ga0207659_10374311
1088 Ga0207644_10000111
1089 Ga0207644_10001037
1090 Ga0207644_10001637
1091 Ga0207644_10011383
1092 Ga0207644_10212986
1093 Ga0207690_10012477
1094 Ga0207690_10028105
1095 Ga0207690_10108879
1096 Ga0207690_10389674
1097 Ga0207706_10000222
1098 Ga0207706_10023396
1099 Ga0207706_10029763
1100 Ga0207706_10033152
1101 Ga0207706_10117563
1102 Ga0207706_10351977
1103 Ga0207669_10008141
1104 Ga0207691_10043801
1105 Ga0207691_10062985
1106 Ga0207691_10115654
1107 Ga0207711_10000004
1108 Ga0207711_10001014
1109 Ga0207711_10013963
1110 Ga0207711_10505843
1111 Ga0207661_10188316
1112 Ga0207661_10516934
1113 Ga0207661_10699886
1114 Ga0207679_10013540
1115 Ga0207679_10051130
1116 Ga0207679_10059864
1117 Ga0207667_10000017
1118 Ga0207667_10023817
1119 Ga0207667_10038088
1120 Ga0207667_10107671
1121 Ga0207667_10153576
1122 Ga0207667_10829690
1123 Ga0207651_10018184
1124 Ga0207651_10346194
1125 Ga0207712_10000102
1126 Ga0207712_10009460
1127 Ga0207712_10082213
1128 Ga0207712_10418366
1129 Ga0207668_10000009
1130 Ga0207668_10000054
1131 Ga0207668_10000094
1132 Ga0207668_10035386
1133 Ga0207668_10267746
1134 Ga0207640_10000085
1135 Ga0207640_10020249
1136 Ga0207640_10048927
1137 Ga0207640_10069390
1138 Ga0207640_10073459
1139 Ga0207658_10000010
1140 Ga0207658_10000023
1141 Ga0207658_10000132
1142 Ga0207658_10000712
1143 Ga0207658_10001234
1144 Ga0207658_10015979
1145 Ga0207658_10054972
1146 Ga0207677_10150373
1147 Ga0207677_10209751
1148 Ga0207703_10000368
1149 Ga0207639_10000834
1150 Ga0207639_10001595
1151 Ga0207639_10003170
1152 Ga0207639_10282601
1153 Ga0207678_10000025
1154 Ga0207678_10011518
1155 Ga0207678_10030575
1156 Ga0207678_10055443
1157 Ga0207678_10064398
1158 Ga0207702_10005813
1159 Ga0207702_10007661
1160 Ga0207702_10013135
1161 Ga0207702_10063313
1162 Ga0207702_10124583
1163 Ga0207702_10137663
1164 Ga0207702_10226535
1165 Ga0207641_10000018
1166 Ga0207641_10000045
1167 Ga0207641_10000269
1168 Ga0207641_10000584
1169 Ga0207641_10001281
1170 Ga0207641_10041379
1171 Ga0207641_10201908
1172 Ga0207676_10000021
1173 Ga0207676_10000027
1174 Ga0207676_10001450
1175 Ga0207676_10031654
1176 Ga0207674_10003093
1177 Ga0207674_10003762
1178 Ga0207674_10005773
1179 Ga0207674_10006584
1180 Ga0207674_10017740
1181 Ga0207674_10022193
1182 Ga0207674_10029944
1183 Ga0207674_10152809
1184 Ga0207674_10157832
1185 Ga0207674_10599886
1186 Ga0207675_100013637
1187 Ga0207675_100195062
1188 Ga0207683_10075146
1189 Ga0207698_10000198
1190 Ga0207698_10004461
1191 Ga0207698_10038669
1192 Ga0207698_10611602
1193 Ga0209813_10000029
1194 Ga0268266_10131285
1195 Ga0268266_10374214
1196 Ga0268265_10000013
1197 Ga0268265_10000042
1198 Ga0268265_10000803
1199 Ga0268265_10105917
1200 Ga0268264_10000039
1201 Ga0268264_10000070
1202 Ga0268264_10002547
1203 Ga0268264_10014994
1204 Ga0268264_10119524
1205 Ga0268264_11241948
1206 Ga0316182_1217173
1207 Ga0307513_10437139
1208 Ga0307408_100007308
1209 Ga0307408_100366971
1210 Ga0307408_100523817
1211 Ga0307405_10042772
1212 Ga0307405_10131789
1213 Ga0307405_10232274
1214 Ga0307405_10258506
1215 Ga0307405_10504326
1216 Ga0307413_10020897
1217 Ga0307413_10211788
1218 Ga0307413_10224511
1219 Ga0307410_10067930
1220 Ga0307410_10124410
1221 Ga0307410_10162421
1222 Ga0307406_10010473
1223 Ga0307406_10024111
1224 Ga0307406_10034986
1225 Ga0307406_10214288
1226 Ga0307406_10356088
1227 Ga0307406_10362624
1228 Ga0307407_10037438
1229 Ga0307407_10123314
1230 Ga0307407_10373154
1231 Ga0307412_10002333
1232 Ga0307412_10062262
1233 Ga0307412_10144337
1234 Ga0307412_10333307
1235 Ga0307412_10438182
1236 Ga0307412_10464343
1237 Ga0307412_10466053
1238 Ga0307409_100066563
1239 Ga0307409_100104881
1240 Ga0307409_100157928
1241 Ga0307409_100523830
1242 Ga0307416_100000260
1243 Ga0307416_100006944
1244 Ga0307416_100115578
1245 Ga0307416_100345249
1246 Ga0307416_100359310
1247 Ga0307414_10012695
1248 Ga0307414_10072818
1249 Ga0307414_10113203
1250 Ga0307414_10174663
1251 Ga0307414_10506530
1252 Ga0307414_10686957
1253 Ga0307411_10017801
1254 Ga0307411_10021194
1255 Ga0307411_10160682
1256 Ga0307411_10490505
1257 Ga0307415_100045291
1258 Ga0307415_100247356
1259 Ga0307415_100290915
1260 Ga0307415_100368471
1261 Ga0307415_100408516
1262 Ga0307415_100980123
1263 Ga0395899_0003036
1264 Ga0395899_0024581
1265 Ga0395899_0057326
1266 Ga0395899_0216742
1267 Ga0395899_0236317
1268 Ga0395899_0319849
1269 Ga0395900_0017810
1270 Ga0395900_0086864
1271 Ga0395900_0143914
1272 Ga0395900_0150332
1273 Ga0395900_0343106
1274 Ga0395900_0385087
1275 Ga0395900_0385099
1276 Ga0395900_0392759
1277 Ga0395898_0038169
1278 Ga0395898_0074732
1279 Ga0395898_0128890
1280 Ga0395898_0293237
1281 Ga0395898_0332160
1282 Ga0395905_0000464
1283 Ga0395905_0000606
1284 Ga0395905_0018897
1285 Ga0395905_0025840
1286 Ga0395905_0030067
1287 Ga0395905_0058365
1288 Ga0395905_0125925
1289 Ga0395905_0135681
1290 Ga0395905_0161691
1291 Ga0395905_0269277
1292 Ga0395905_0513882
1293 Ga0395905_0640859
1294 Ga0395901_0010520
1295 Ga0395901_0113802
1296 Ga0395901_0134683
1297 Ga0395901_0238670
1298 Ga0395901_0255333
1299 Ga0395901_0459846
1300 Ga0395901_0473999
1301 Ga0395901_0489758
1302 Ga0395901_0490687
1303 Ga0395901_0835146
1304 Ga0237819_06133
1305 Ga0439439_0029635
1306 Ga0439443_000920
1307 Ga0439448_0100492
1308 Ga0439458_0023309
1309 Ga0439434_0097109
1310 Ga0466961_0112497
1311 Ga0466963_0006453
1312 Ga0466971_0006898
1313 Ga0466970_0131497
1314 Ga0466957_0401723
1315 Ga0466967_0024421
1316 Ga0466967_0283602
1317 Ga0495617_016493
1318 Ga0495627_000171
1319 Ga0495627_014225
1320 Ga0495638_0000068
1321 Ga0495638_0160866
1322 Ga0495650_0001420
1323 Ga0495583_0000269
1324 Ga0495606_0112220
1325 Ga0495610_0000199
1326 Ga0495610_0019694
1327 Ga0495616_0000010
1328 Ga0495631_0150199
1329 Ga0495632_0001120
1330 Ga0495632_0150736
1331 Ga0495637_0002880
1332 Ga0495643_0153091
1333 Ga0495648_0000046
1334 Ga0495648_0040820
1335 Ga0495648_0273570
1336 Ga0495597_0002079
1337 Ga0495633_0027386
1338 Ga0495668_0007104
1339 Ga0495668_0015416
1340 Ga0495668_0025350
1341 Ga0495668_0156117
1342 Ga0495668_0307392
1343 Ga0495625_0008016
1344 Ga0495625_0165576
1345 Ga0495661_0141381
1346 Ga0495669_0017781
1347 Ga0495671_0000057
1348 Ga0495671_0023658
1349 Ga0495673_0000110
1350 Ga0495673_0065762
1351 Ga0495681_0000038
1352 Ga0495686_0120134
1353 Ga0495686_0353594
1354 Ga0496100_0261459
1355 Ga0496100_0696030
1356 Ga0496101_0047252
1357 Ga0496101_0090634
1358 Ga0496102_0000010
1359 Ga0496102_0171695
1360 Ga0496102_0787667
1361 Ga0496103_0000082
1362 Ga0496103_0205904
1363 Ga0496104_0796025
1364 Ga0496105_0152762
1365 Ga0496106_0036350
1366 Ga0496107_0066600
1367 Ga0496108_0000725
1368 Ga0496108_0002601
1369 Ga0496108_0256428
1370 Ga0496109_0007321
1371 Ga0496109_0098341
1372 Ga0496109_0734721
1373 Ga0496110_0050469
1374 Ga0496110_0050881
1375 Ga0496110_0212693
1376 Ga0496110_0218702
1377 Ga0496110_0331089
1378 Ga0496111_0087478
1379 Ga0496112_0060810
1380 Ga0496113_0000874
1381 Ga0496113_0011203
1382 Ga0496113_0378683
1383 Ga0496116_0089287
1384 Ga0496116_0300558
1385 Ga0496117_0000037
1386 Ga0496117_0034518
1387 Ga0496118_0000034
1388 Ga0496118_0000262
1389 Ga0496118_0004003
1390 Ga0496118_0151294
1391 Ga0496119_0080716
1392 Ga0496119_0104749
1393 Ga0496119_0130350
1394 Ga0496121_0017781
1395 Ga0496122_0210317
1396 Ga0496123_0088217
1397 Ga0496124_0000033
1398 Ga0496124_0015646
1399 Ga0496124_0064231
1400 Ga0496125_0031068
1401 Ga0496125_0040712
1402 Ga0496125_0093230
1403 Ga0496125_0153366
1404 Ga0496125_0204532
1405 Ga0496125_0276389
1406 Ga0496126_0249547
1407 Ga0496126_0257797
1408 Ga0496126_0451251
1409 Ga0501290_000477
1410 Ga0501292_000012
1411 Ga0501294_000630
1412 Ga0501297_009629
1413 Ga0501300_012666
1414 Ga0501314_002572
1415 Ga0501315_012137
1416 Ga0501034_0014682
1417 Ga0501038_0169045
1418 Ga0501067_0080726
1419 Ga0501067_0108556
1420 Ga0501206_002761
1421 Ga0501207_016446
1422 Ga0501222_000613
1423 Ga0501223_000016
1424 Ga0501223_000058
1425 Ga0501223_010805
1426 Ga0501224_000021
1427 Ga0501224_001490
1428 Ga0501233_014075
1429 Ga0501233_040861
1430 Ga0501235_013751
1431 Ga0501257_038923
1432 Ga0501259_002107
1433 Ga0501261_000115
1434 Ga0501221_005448
1435 Ga0501225_0000013
1436 Ga0501225_0000022
1437 Ga0501225_0010525
1438 Ga0501225_0010651
1439 Ga0501234_002319
1440 Ga0501245_004307
1441 Ga0501264_000869
1442 Ga0501276_001508
1443 Ga0501278_012269
1444 Ga0501279_000004
1445 Ga0501280_000056
1446 Ga0501281_00433
1447 Ga0501282_001657
1448 Ga0501283_001651
1449 Ga0501035_0254338
1450 Ga0501226_000031
1451 nmdc:mga06z11_18_c1
1452 nmdc:mga04h51_797_c1
1453 nmdc:mga07m45_188192_c1
1454 nmdc:mga07m45_40999_c1
1455 nmdc:mga09592_282720_c1
1456 Ga0500643_000044
1457 Ga0500643_000336
1458 Ga0500643_005818
1459 Ga0500643_015644
1460 Ga0500651_0139139
1461 Ga0500566_0006266
1462 Ga0500556_0000217
1463 Ga0500592_001428
1464 Ga0500594_0000636
1465 Ga0500608_049014
1466 Ga0500614_012441
1467 Ga0500642_0000001
1468 Ga0500655_007967
1469 Ga0500658_0079602
1470 Ga0500559_0001036
1471 Ga0500568_0018813
1472 Ga0500568_0053602
1473 Ga0500577_0017994
1474 Ga0500590_016080
1475 Ga0500622_0012518
1476 Ga0500624_000011
1477 Ga0500627_0000204
1478 Ga0500639_009649
1479 Ga0500636_0272887
1480 Ga0500570_023592
1481 Ga0500645_000186
1482 Ga0500645_020199
1483 Ga0500661_010006
1484 Ga0466962_0006199
1485 2512641662
1486 2585261811
1487 2644040300
1488 2778125625
1489 2809063522
1490 2809079507
1491 2809083855
1492 2880521030
1493 2896431803
1494 2919711983

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03741

TerC

Integral membrane protein TerC family

46

232

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g9x-assembly1.cif.gz_A crystal structure of a mfs transporter at 2.54 angstroem resolution 0.516 40 226
6g9x-assembly2.cif.gz_B crystal structure of a mfs transporter at 2.54 angstroem resolution 0.511 39 225
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.5089 40 227
4iu9-assembly2.cif.gz_A crystal structure of a membrane transporter 0.5086 44 231
4u4v-assembly1.cif.gz_A structure of a nitrate/nitrite antiporter nark in apo inward-open state 0.5033 34 232
ID Description Score Start End Superfamily
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7325 42 226 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7157 42 226 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6584 43 226 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6003 43 226 1.20.1250.20
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5462 41 226 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A015L0V5-F1-model_v4 deleted 0.8392 38 226
AF-A0A6M1LG30-F1-model_v4 TerC family protein 0.8354 39 240 GO:0016020
AF-A0A7W8DK91-F1-model_v4 YkoY family integral membrane protein 0.8275 28 232 GO:0016020
AF-A0A4R0YDB5-F1-model_v4 TerC family protein 0.817 38 239 GO:0016020
AF-A0A4P7WBI9-F1-model_v4 TerC family protein 0.8133 26 239 GO:0016020

Map