F478507

General Info

Members Datasets Scaffolds Average Seq Length
740 354 716 259

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100138924|Ga0070680_1001389242
Length 292
Sequence MTGEGERARASRSPRAFRRPVRSTGNDPGTTTALMAAYDTQKVLTVHHWNESLFTFTCTRGKSLRFESGHFVMVGILVDGKPLMRAYSIASAHYEEHLEFFSIKVPNGPLTSRLQHIRVGEEVLVGNKPTGTLVLTDLLPGRFLYLFATGTGLAPFMSIIRDPDTYERFEKIVLVHGVRKVDELAYADLIAHDLPRHDHLGEQVREQLVYYPTVTREPFRNQGRLPDLIANGKLCSDIGFPQIDPKHDRAMICGGPAMLKDMRTILDGAGFRISAGVGQAGDYVIERAFVEK

Samples

Sample ID Description Type Environment
1 2511231008 Pseudomonas sp. GM21 Isolate Nodule
2 2534681786 Brucella suis 92/29 Isolate Unclassified
3 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
4 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
5 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
6 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
7 2854911287 Brucella lupini LUP21 Isolate Unclassified
8 2855730933 Achromobacter sp. HZ28 Isolate Nodule
9 2855767633 Achromobacter sp. HZ34 Isolate Nodule
10 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
11 2858950400 Achromobacter sp. K91 Isolate Unclassified
12 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
13 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
14 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
15 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
16 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
17 2941479691
18 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
121 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
187 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
188 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
192 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
193 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
197 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
198 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
208 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
219 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
220 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
221 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
222 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
223 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
224 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
225 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
226 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
227 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
243 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
244 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
245 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
248 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
249 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
252 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
253 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
254 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
255 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
258 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
267 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
268 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
269 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
270 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
271 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
272 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
273 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
274 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
278 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
279 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
280 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
281 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
282 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
285 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
286 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
299 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
300 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
301 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
302 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
303 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
304 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
305 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
306 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
307 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
315 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
316 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
317 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
318 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
319 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
320 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
321 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
322 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
323 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
324 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
325 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
326 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
327 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
328 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
330 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
331 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
337 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
338 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
339 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
340 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
341 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
342 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
343 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
344 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
345 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
346 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
347 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
348 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
349 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
350 639633007 Azoarcus olearius BH72 Isolate Unclassified
351 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
352 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
353 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
354 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.35
Metatranscriptomes 0.41
Isolates 3.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 6.76
Nodule 0.41
Rhizoplane 2.16
Rhizosphere 81.49
Stem 0
Stem Tuber 0
Unclassified 9.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10090637 3300003320 Bacteria 3703
2 rootH2_10265435 3300003320 Bacteria 3217
3 rootH1_10007832 3300003323 Bacteria 40222
4 rootH1_10013353 3300003323 Bacteria 23546
5 Ga0006562J51391_1031350 3300003578 Bacteria 1180
6 Ga0055535_1000326 3300003761 Bacteria 48157
7 Ga0055529_1000053 3300003763 Bacteria 198996
8 Ga0065715_10108371 3300005293 Bacteria 2722
9 Ga0065715_10245837 3300005293 Bacteria 1183
10 Ga0065707_10081888 3300005295 Bacteria 31190
11 Ga0070676_10011536 3300005328 Bacteria 4806
12 Ga0070676_10011678 3300005328 Bacteria 4780
13 Ga0070676_10018496 3300005328 Bacteria 3863
14 Ga0070683_100161729 3300005329 Bacteria 2124
15 Ga0070690_100146050 3300005330 Bacteria 1609
16 Ga0070670_100011021 3300005331 Bacteria 7723
17 Ga0070670_100012601 3300005331 Bacteria 7240
18 Ga0070670_100109486 3300005331 Bacteria 2380
19 Ga0070670_100125470 3300005331 Bacteria 2215
20 Ga0070677_10015903 3300005333 Bacteria 2671
21 Ga0070677_10022737 3300005333 Bacteria 2313
22 Ga0070677_10047534 3300005333 Bacteria 1721
23 Ga0070677_10068897 3300005333 Bacteria 1482
24 Ga0068869_100004489 3300005334 Bacteria 8678
25 Ga0068869_100007554 3300005334 Bacteria 6957
26 Ga0070666_10004510 3300005335 Bacteria 8484
27 Ga0070666_10029393 3300005335 Bacteria 3612
28 Ga0070680_100138924 3300005336 Bacteria 2037
29 Ga0068868_100001176 3300005338 Bacteria 17913
30 Ga0068868_100022208 3300005338 Bacteria 4787
31 Ga0068868_100215370 3300005338 Bacteria 1607
32 Ga0068868_100317455 3300005338 Bacteria 1327
33 Ga0068868_100392174 3300005338 Bacteria 1197
34 Ga0070689_100028096 3300005340 Bacteria 4249
35 Ga0070687_100002759 3300005343 Bacteria 6668
36 Ga0070687_100014191 3300005343 Bacteria 3573
37 Ga0070687_100322952 3300005343 Bacteria 987
38 Ga0070661_100008395 3300005344 Bacteria 7137
39 Ga0070661_100299886 3300005344 Bacteria 1251
40 Ga0070661_100307367 3300005344 Bacteria 1235
41 Ga0070668_100010597 3300005347 Bacteria 6855
42 Ga0070668_100140552 3300005347 Bacteria 1945
43 Ga0070668_100246096 3300005347 Bacteria 1483
44 Ga0070669_100005375 3300005353 Bacteria 9243
45 Ga0070669_100009750 3300005353 Bacteria 6839
46 Ga0070669_100534804 3300005353 Bacteria 976
47 Ga0070675_100013532 3300005354 Bacteria 6414
48 Ga0070675_100043334 3300005354 Bacteria 3677
49 Ga0070675_100046663 3300005354 Bacteria 3548
50 Ga0070675_100109109 3300005354 Bacteria 2338
51 Ga0070671_100000534 3300005355 Bacteria 26702
52 Ga0070671_100005572 3300005355 Bacteria 10031
53 Ga0070671_100039382 3300005355 Bacteria 3923
54 Ga0070671_100040943 3300005355 Bacteria 3850
55 Ga0070671_100273614 3300005355 Bacteria 1435
56 Ga0070674_100002413 3300005356 Bacteria 10323
57 Ga0070674_100004864 3300005356 Bacteria 7699
58 Ga0070674_100014620 3300005356 Bacteria 4883
59 Ga0070674_100119715 3300005356 Bacteria 1947
60 Ga0070674_100184270 3300005356 Bacteria 1601
61 Ga0070673_100000789 3300005364 Bacteria 17609
62 Ga0070673_100001085 3300005364 Bacteria 15555
63 Ga0070673_100006551 3300005364 Bacteria 7576
64 Ga0070673_100028497 3300005364 Bacteria 4153
65 Ga0070659_100007809 3300005366 Bacteria 7784
66 Ga0070659_100038858 3300005366 Bacteria 3713
67 Ga0070659_100039920 3300005366 Bacteria 3666
68 Ga0070659_100404102 3300005366 Bacteria 1153
69 Ga0070667_100017115 3300005367 Bacteria 6006
70 Ga0070667_100029025 3300005367 Bacteria 4607
71 Ga0070667_100096568 3300005367 Bacteria 2549
72 Ga0070700_100372176 3300005441 Bacteria 1066
73 Ga0070694_100090009 3300005444 Bacteria 2151
74 Ga0070663_100023029 3300005455 Bacteria 4170
75 Ga0070663_100136784 3300005455 Bacteria 1866
76 Ga0070663_100263891 3300005455 Bacteria 1367
77 Ga0070678_100030214 3300005456 Bacteria 3722
78 Ga0070678_100244319 3300005456 Bacteria 1502
79 Ga0070662_100001314 3300005457 Bacteria 15279
80 Ga0070662_100003868 3300005457 Bacteria 9383
81 Ga0070662_100015654 3300005457 Bacteria 5084
82 Ga0070662_100040799 3300005457 Bacteria 3307
83 Ga0070662_100058856 3300005457 Bacteria 2798
84 Ga0070662_100133212 3300005457 Bacteria 1919
85 Ga0070662_100309501 3300005457 Bacteria 1285
86 Ga0070681_10010756 3300005458 Bacteria 9044
87 Ga0070681_10180756 3300005458 Bacteria 2031
88 Ga0068867_100004451 3300005459 Bacteria 9852
89 Ga0068867_100024085 3300005459 Bacteria 4362
90 Ga0070706_100002539 3300005467 Bacteria 18347
91 Ga0070698_100161840 3300005471 Bacteria 2181
92 Ga0070679_100025237 3300005530 Bacteria 5830
93 Ga0070679_100107585 3300005530 Bacteria 2774
94 Ga0070679_100221626 3300005530 Bacteria 1852
95 Ga0070684_100122884 3300005535 Bacteria 2336
96 Ga0070684_100209079 3300005535 Bacteria 1778
97 Ga0068853_100003486 3300005539 Bacteria 12037
98 Ga0068853_100103541 3300005539 Bacteria 2519
99 Ga0068853_100122152 3300005539 Bacteria 2324
100 Ga0068853_100422448 3300005539 Bacteria 1250
101 Ga0070672_100001315 3300005543 Bacteria 15315
102 Ga0070672_100010467 3300005543 Bacteria 6434
103 Ga0070672_100013149 3300005543 Bacteria 5835
104 Ga0070672_100016750 3300005543 Bacteria 5255
105 Ga0070672_100036486 3300005543 Bacteria 3745
106 Ga0070672_100040420 3300005543 Bacteria 3578
107 Ga0070672_100144564 3300005543 Bacteria 1964
108 Ga0070672_100180807 3300005543 Bacteria 1757
109 Ga0070696_100593931 3300005546 Bacteria 892
110 Ga0070693_100080985 3300005547 Bacteria 1935
111 Ga0070693_100302523 3300005547 Bacteria 1079
112 Ga0070665_100155518 3300005548 Bacteria 2288
113 Ga0070665_100268575 3300005548 Bacteria 1707
114 Ga0070704_100095101 3300005549 Bacteria 2231
115 Ga0068855_100102182 3300005563 Bacteria 3299
116 Ga0068855_100129507 3300005563 Bacteria 2883
117 Ga0068855_100408654 3300005563 Bacteria 1487
118 Ga0070664_100341878 3300005564 Bacteria 1359
119 Ga0070664_100416788 3300005564 Bacteria 1229
120 Ga0070664_100547763 3300005564 Bacteria 1069
121 Ga0068857_100076606 3300005577 Bacteria 2983
122 Ga0068857_100139059 3300005577 Bacteria 2194
123 Ga0068857_100290056 3300005577 Bacteria 1506
124 Ga0068854_100005390 3300005578 Bacteria 8074
125 Ga0068854_100013308 3300005578 Bacteria 5395
126 Ga0068854_100263266 3300005578 Bacteria 1381
127 Ga0068856_100008252 3300005614 Bacteria 10153
128 Ga0068856_100147831 3300005614 Bacteria 2357
129 Ga0068852_100068084 3300005616 Bacteria 3114
130 Ga0068852_100092165 3300005616 Bacteria 2713
131 Ga0068852_100095506 3300005616 Bacteria 2670
132 Ga0068859_100204543 3300005617 Bacteria 2059
133 Ga0068864_100000813 3300005618 Bacteria 26262
134 Ga0068864_100015826 3300005618 Bacteria 6276
135 Ga0068864_100084608 3300005618 Bacteria 2787
136 Ga0068866_10013868 3300005718 Bacteria 3545
137 Ga0068866_10056834 3300005718 Bacteria 2014
138 Ga0068861_100003863 3300005719 Bacteria 10009
139 Ga0068861_100008132 3300005719 Bacteria 7217
140 Ga0068861_100008314 3300005719 Bacteria 7136
141 Ga0068861_100111348 3300005719 Bacteria 2194
142 Ga0068851_10012946 3300005834 Bacteria 3940
143 Ga0068851_10017761 3300005834 Bacteria 3422
144 Ga0068851_10131784 3300005834 Bacteria 1352
145 Ga0068870_10002894 3300005840 Bacteria 7233
146 Ga0068870_10034500 3300005840 Bacteria 2590
147 Ga0068870_10147721 3300005840 Bacteria 1381
148 Ga0068863_100175614 3300005841 Bacteria 2056
149 Ga0068863_100458604 3300005841 Bacteria 1251
150 Ga0068858_100002966 3300005842 Bacteria 17039
151 Ga0068858_100033342 3300005842 Bacteria 4780
152 Ga0068858_100037802 3300005842 Bacteria 4476
153 Ga0068860_100052139 3300005843 Bacteria 3891
154 Ga0068860_100134642 3300005843 Bacteria 2373
155 Ga0068862_100039379 3300005844 Bacteria 4014
156 Ga0075364_10012125 3300006051 Bacteria 5261
157 Ga0075367_10018271 3300006178 Bacteria 3865
158 Ga0075369_10074872 3300006186 Bacteria 1494
159 Ga0075366_10016003 3300006195 Bacteria 4306
160 Ga0075366_10062487 3300006195 Bacteria 2213
161 Ga0075366_10086812 3300006195 Bacteria 1872
162 Ga0075366_10088782 3300006195 Bacteria 1851
163 Ga0097621_100015735 3300006237 Bacteria 5700
164 Ga0097621_100023459 3300006237 Bacteria 4804
165 Ga0097621_100030919 3300006237 Bacteria 4242
166 Ga0075370_10001199 3300006353 Bacteria 10934
167 Ga0075370_10004021 3300006353 Bacteria 7069
168 Ga0075370_10033742 3300006353 Bacteria 2866
169 Ga0075370_10073530 3300006353 Bacteria 1958
170 Ga0068871_100054306 3300006358 Bacteria 3250
171 Ga0068871_100085405 3300006358 Bacteria 2620
172 Ga0068865_100008925 3300006881 Bacteria 6202
173 Ga0068865_100031493 3300006881 Bacteria 3537
174 Ga0068865_100100608 3300006881 Bacteria 2115
175 Ga0068865_100244744 3300006881 Bacteria 1413
176 Ga0097620_100175902 3300006931 Bacteria 2222
177 Ga0097620_100204547 3300006931 Bacteria 2059
178 Ga0099794_10003794 3300007265 Bacteria 5834
179 Ga0099794_10047481 3300007265 Bacteria 2059
180 Ga0099795_10000120 3300007788 Bacteria 13107
181 Ga0105240_10000706 3300009093 Bacteria 61234
182 Ga0105240_10027814 3300009093 Bacteria 7399
183 Ga0105240_10130188 3300009093 Bacteria 3019
184 Ga0105240_10175720 3300009093 Bacteria 2532
185 Ga0111539_10296689 3300009094 Bacteria 1881
186 Ga0105245_10060592 3300009098 Bacteria 3408
187 Ga0105245_10277001 3300009098 Bacteria 1638
188 Ga0105247_10406370 3300009101 Bacteria 971
189 Ga0105243_10013318 3300009148 Bacteria 6219
190 Ga0105243_10180310 3300009148 Bacteria 1836
191 Ga0105241_10054918 3300009174 Bacteria 3051
192 Ga0105241_10346117 3300009174 Bacteria 1289
193 Ga0105242_10033767 3300009176 Bacteria 4099
194 Ga0105248_10037307 3300009177 Bacteria 5437
195 Ga0105248_10090533 3300009177 Bacteria 3445
196 Ga0105248_10118638 3300009177 Bacteria 2984
197 Ga0105248_10173206 3300009177 Bacteria 2432
198 Ga0105248_10407885 3300009177 Bacteria 1530
199 Ga0105248_10556958 3300009177 Bacteria 1293
200 Ga0105237_10000048 3300009545 Bacteria 165532
201 Ga0105237_10003764 3300009545 Bacteria 17858
202 Ga0105237_10102263 3300009545 Bacteria 2857
203 Ga0105238_10008003 3300009551 Bacteria 10576
204 Ga0105249_10046249 3300009553 Bacteria 3961
205 Ga0099796_10001454 3300010159 Bacteria 4776
206 Ga0105239_10014548 3300010375 Bacteria 8730
207 Ga0105239_10062082 3300010375 Bacteria 4102
208 Ga0105239_10066928 3300010375 Bacteria 3946
209 Ga0105239_10206315 3300010375 Bacteria 2202
210 Ga0105239_10314913 3300010375 Bacteria 1764
211 Ga0105239_10402781 3300010375 Bacteria 1548
212 Ga0105246_10085154 3300011119 Bacteria 2263
213 Ga0157345_1007296 3300012498 Bacteria 899
214 Ga0157373_10175582 3300013100 Bacteria 1508
215 Ga0157371_10188885 3300013102 Bacteria 1475
216 Ga0157370_10373940 3300013104 Bacteria 1313
217 Ga0157369_10189424 3300013105 Bacteria 2162
218 Ga0157374_10000224 3300013296 Bacteria 52387
219 Ga0157374_10032656 3300013296 Bacteria 4742
220 Ga0157374_10334911 3300013296 Bacteria 1502
221 Ga0157378_10118853 3300013297 Bacteria 2433
222 Ga0163162_10008352 3300013306 Bacteria 10095
223 Ga0163162_10022095 3300013306 Bacteria 6269
224 Ga0163162_10192195 3300013306 Bacteria 2169
225 Ga0163162_10264813 3300013306 Bacteria 1850
226 Ga0157372_10120596 3300013307 Bacteria 3012
227 Ga0157372_10166061 3300013307 Bacteria 2553
228 Ga0157375_10008196 3300013308 Bacteria 9150
229 Ga0157375_10009765 3300013308 Bacteria 8435
230 Ga0157375_10031208 3300013308 Bacteria 5033
231 Ga0157375_10031973 3300013308 Bacteria 4986
232 Ga0157375_10086108 3300013308 Bacteria 3192
233 Ga0163163_10007916 3300014325 Bacteria 9396
234 Ga0163163_10102754 3300014325 Bacteria 2882
235 Ga0157380_10024990 3300014326 Bacteria 4526
236 Ga0157380_10025167 3300014326 Bacteria 4511
237 Ga0157380_10088577 3300014326 Bacteria 2548
238 Ga0157380_10571946 3300014326 Bacteria 1113
239 Ga0157379_10011793 3300014968 Bacteria 7633
240 Ga0157379_10039972 3300014968 Bacteria 4185
241 Ga0157379_10072147 3300014968 Bacteria 3089
242 Ga0157379_10259954 3300014968 Bacteria 1577
243 Ga0157379_10295214 3300014968 Bacteria 1476
244 Ga0157379_10502082 3300014968 Bacteria 1124
245 Ga0157376_10018675 3300014969 Bacteria 5324
246 Ga0157376_10205952 3300014969 Bacteria 1813
247 Ga0163161_10029151 3300017792 Bacteria 3923
248 Ga0163161_10099446 3300017792 Bacteria 2163
249 Ga0163161_10108763 3300017792 Bacteria 2070
250 Ga0163161_10206411 3300017792 Bacteria 1516
251 Ga0209258_100074 3300025242 Bacteria 271062
252 Ga0209759_1000521 3300025256 Bacteria 41549
253 Ga0209233_1010646 3300025261 Bacteria 2745
254 Ga0209455_1000066 3300025272 Bacteria 316811
255 Ga0209676_1014399 3300025292 Bacteria 2976
256 Ga0209257_1023440 3300025304 Bacteria 2170
257 Ga0207656_10018987 3300025321 Bacteria 2715
258 Ga0207656_10062067 3300025321 Bacteria 1642
259 Ga0207682_10001514 3300025893 Bacteria 10710
260 Ga0207682_10025440 3300025893 Bacteria 2347
261 Ga0207682_10074879 3300025893 Bacteria 1440
262 Ga0207682_10077183 3300025893 Bacteria 1421
263 Ga0207642_10116266 3300025899 Bacteria 1371
264 Ga0207642_10147436 3300025899 Bacteria 1248
265 Ga0207688_10024772 3300025901 Bacteria 3292
266 Ga0207688_10074441 3300025901 Bacteria 1931
267 Ga0207688_10120427 3300025901 Bacteria 1531
268 Ga0207680_10002999 3300025903 Bacteria 7913
269 Ga0207680_10039133 3300025903 Bacteria 2749
270 Ga0207680_10160718 3300025903 Bacteria 1506
271 Ga0207645_10003747 3300025907 Bacteria 11429
272 Ga0207645_10009087 3300025907 Bacteria 6894
273 Ga0207645_10009373 3300025907 Bacteria 6776
274 Ga0207645_10057735 3300025907 Bacteria 2478
275 Ga0207645_10090512 3300025907 Bacteria 1967
276 Ga0207645_10157225 3300025907 Bacteria 1486
277 Ga0207645_10392791 3300025907 Bacteria 932
278 Ga0207643_10013001 3300025908 Bacteria 4499
279 Ga0207643_10031440 3300025908 Bacteria 2959
280 Ga0207643_10052954 3300025908 Bacteria 2305
281 Ga0207705_10033965 3300025909 Bacteria 3646
282 Ga0207705_10120206 3300025909 Bacteria 1949
283 Ga0207684_10007765 3300025910 Bacteria 9606
284 Ga0207684_10453426 3300025910 Bacteria 1101
285 Ga0207654_10226755 3300025911 Bacteria 1242
286 Ga0207707_10150408 3300025912 Bacteria 2035
287 Ga0207695_10004844 3300025913 Bacteria 18169
288 Ga0207695_10066130 3300025913 Bacteria 3714
289 Ga0207695_10115948 3300025913 Bacteria 2653
290 Ga0207695_10231218 3300025913 Bacteria 1753
291 Ga0207695_10390665 3300025913 Bacteria 1276
292 Ga0207671_10000077 3300025914 Bacteria 150801
293 Ga0207671_10107160 3300025914 Bacteria 2122
294 Ga0207660_10168998 3300025917 Bacteria 1691
295 Ga0207662_10007584 3300025918 Bacteria 5912
296 Ga0207662_10037414 3300025918 Bacteria 2840
297 Ga0207662_10058525 3300025918 Bacteria 2307
298 Ga0207657_10035844 3300025919 Bacteria 4444
299 Ga0207657_10124336 3300025919 Bacteria 2120
300 Ga0207657_10426487 3300025919 Bacteria 1042
301 Ga0207657_10520161 3300025919 Unclassified 931
302 Ga0207652_10028046 3300025921 Bacteria 4695
303 Ga0207652_10075574 3300025921 Bacteria 2936
304 Ga0207652_10129143 3300025921 Bacteria 2253
305 Ga0207646_10052001 3300025922 Bacteria 3665
306 Ga0207681_10004549 3300025923 Bacteria 8537
307 Ga0207681_10005781 3300025923 Bacteria 7587
308 Ga0207681_10097234 3300025923 Bacteria 2115
309 Ga0207681_10114053 3300025923 Bacteria 1971
310 Ga0207694_10013058 3300025924 Bacteria 6252
311 Ga0207694_10015728 3300025924 Bacteria 5707
312 Ga0207694_10024397 3300025924 Bacteria 4593
313 Ga0207694_10067557 3300025924 Bacteria 2790
314 Ga0207694_10070653 3300025924 Bacteria 2728
315 Ga0207650_10001113 3300025925 Bacteria 19790
316 Ga0207650_10002251 3300025925 Bacteria 13483
317 Ga0207650_10036670 3300025925 Bacteria 3568
318 Ga0207650_10039567 3300025925 Bacteria 3445
319 Ga0207650_10053612 3300025925 Bacteria 2989
320 Ga0207650_10248264 3300025925 Bacteria 1440
321 Ga0207650_10760369 3300025925 Bacteria 820
322 Ga0207659_10000343 3300025926 Bacteria 27873
323 Ga0207659_10000773 3300025926 Bacteria 18947
324 Ga0207659_10013872 3300025926 Bacteria 5179
325 Ga0207659_10070005 3300025926 Bacteria 2557
326 Ga0207659_10198310 3300025926 Bacteria 1601
327 Ga0207687_10045643 3300025927 Bacteria 3029
328 Ga0207687_10083313 3300025927 Bacteria 2315
329 Ga0207644_10007907 3300025931 Bacteria 6954
330 Ga0207644_10023290 3300025931 Bacteria 4240
331 Ga0207644_10038493 3300025931 Bacteria 3369
332 Ga0207644_10047903 3300025931 Bacteria 3052
333 Ga0207644_10328817 3300025931 Bacteria 1237
334 Ga0207690_10012761 3300025932 Bacteria 5035
335 Ga0207690_10137342 3300025932 Bacteria 1796
336 Ga0207706_10000280 3300025933 Bacteria 55678
337 Ga0207706_10064403 3300025933 Bacteria 3227
338 Ga0207706_10152553 3300025933 Bacteria 2032
339 Ga0207686_10014281 3300025934 Bacteria 4416
340 Ga0207686_10278569 3300025934 Bacteria 1233
341 Ga0207709_10003697 3300025935 Bacteria 9008
342 Ga0207709_10124780 3300025935 Bacteria 1744
343 Ga0207670_10028602 3300025936 Bacteria 3541
344 Ga0207670_10377052 3300025936 Bacteria 1129
345 Ga0207669_10005448 3300025937 Bacteria 5710
346 Ga0207669_10008481 3300025937 Bacteria 4828
347 Ga0207704_10048342 3300025938 Bacteria 2549
348 Ga0207704_10052070 3300025938 Bacteria 2480
349 Ga0207704_10068096 3300025938 Bacteria 2243
350 Ga0207704_10111232 3300025938 Bacteria 1852
351 Ga0207704_10470769 3300025938 Bacteria 1007
352 Ga0207665_10065691 3300025939 Bacteria 2467
353 Ga0207691_10002193 3300025940 Bacteria 19089
354 Ga0207691_10002225 3300025940 Bacteria 18972
355 Ga0207691_10016300 3300025940 Bacteria 7055
356 Ga0207691_10017159 3300025940 Bacteria 6868
357 Ga0207691_10037681 3300025940 Bacteria 4476
358 Ga0207691_10072777 3300025940 Bacteria 3100
359 Ga0207691_10106410 3300025940 Bacteria 2498
360 Ga0207691_10129600 3300025940 Bacteria 2229
361 Ga0207691_10162598 3300025940 Bacteria 1958
362 Ga0207691_10235009 3300025940 Bacteria 1586
363 Ga0207691_10410994 3300025940 Bacteria 1154
364 Ga0207711_10127809 3300025941 Bacteria 2275
365 Ga0207711_10169205 3300025941 Bacteria 1982
366 Ga0207711_10180997 3300025941 Bacteria 1917
367 Ga0207711_10185967 3300025941 Bacteria 1891
368 Ga0207711_10258323 3300025941 Bacteria 1600
369 Ga0207689_10002313 3300025942 Bacteria 17849
370 Ga0207689_10015369 3300025942 Bacteria 6480
371 Ga0207689_10025978 3300025942 Bacteria 4904
372 Ga0207689_10052967 3300025942 Bacteria 3343
373 Ga0207661_10083500 3300025944 Bacteria 2643
374 Ga0207667_10078147 3300025949 Bacteria 3430
375 Ga0207667_10109268 3300025949 Bacteria 2852
376 Ga0207651_10000137 3300025960 Bacteria 31859
377 Ga0207651_10000467 3300025960 Bacteria 17039
378 Ga0207651_10012704 3300025960 Bacteria 4779
379 Ga0207651_10036963 3300025960 Bacteria 3194
380 Ga0207651_10058499 3300025960 Bacteria 2664
381 Ga0207651_10242319 3300025960 Bacteria 1470
382 Ga0207651_10270130 3300025960 Bacteria 1400
383 Ga0207651_10300043 3300025960 Bacteria 1335
384 Ga0207712_10067513 3300025961 Bacteria 2560
385 Ga0207712_10220600 3300025961 Bacteria 1516
386 Ga0207668_10005664 3300025972 Bacteria 7353
387 Ga0207668_10235927 3300025972 Bacteria 1477
388 Ga0207640_10005332 3300025981 Bacteria 7007
389 Ga0207640_10064401 3300025981 Bacteria 2440
390 Ga0207640_10136324 3300025981 Bacteria 1782
391 Ga0207640_10241861 3300025981 Bacteria 1395
392 Ga0207640_10305582 3300025981 Bacteria 1260
393 Ga0207658_10000459 3300025986 Bacteria 38145
394 Ga0207658_10008081 3300025986 Bacteria 7168
395 Ga0207658_10084597 3300025986 Bacteria 2441
396 Ga0207658_10174581 3300025986 Bacteria 1774
397 Ga0207677_10001138 3300026023 Bacteria 14488
398 Ga0207677_10007955 3300026023 Bacteria 5895
399 Ga0207677_10140814 3300026023 Bacteria 1846
400 Ga0207703_10002051 3300026035 Bacteria 17777
401 Ga0207703_10012174 3300026035 Bacteria 6705
402 Ga0207703_10021603 3300026035 Bacteria 5040
403 Ga0207639_10002665 3300026041 Bacteria 11982
404 Ga0207639_10055949 3300026041 Bacteria 3021
405 Ga0207639_10182026 3300026041 Bacteria 1788
406 Ga0207639_10291334 3300026041 Bacteria 1439
407 Ga0207639_10362244 3300026041 Bacteria 1298
408 Ga0207678_10099510 3300026067 Bacteria 2484
409 Ga0207678_10115586 3300026067 Bacteria 2289
410 Ga0207678_10126887 3300026067 Bacteria 2176
411 Ga0207708_10416854 3300026075 Bacteria 1113
412 Ga0207702_10040642 3300026078 Bacteria 3898
413 Ga0207702_10247974 3300026078 Bacteria 1671
414 Ga0207702_10299801 3300026078 Bacteria 1525
415 Ga0207702_10461271 3300026078 Bacteria 1234
416 Ga0207702_10811363 3300026078 Bacteria 925
417 Ga0207641_10006901 3300026088 Bacteria 9500
418 Ga0207641_10008170 3300026088 Bacteria 8660
419 Ga0207641_10033206 3300026088 Bacteria 4288
420 Ga0207641_10151573 3300026088 Bacteria 2100
421 Ga0207641_10256236 3300026088 Bacteria 1636
422 Ga0207648_10000878 3300026089 Bacteria 33868
423 Ga0207648_10007913 3300026089 Bacteria 10363
424 Ga0207648_10010992 3300026089 Bacteria 8548
425 Ga0207648_10034718 3300026089 Bacteria 4444
426 Ga0207648_10075011 3300026089 Bacteria 2949
427 Ga0207648_10104646 3300026089 Bacteria 2482
428 Ga0207648_10131009 3300026089 Bacteria 2207
429 Ga0207648_10307154 3300026089 Bacteria 1423
430 Ga0207676_10003213 3300026095 Bacteria 11647
431 Ga0207676_10009121 3300026095 Bacteria 7064
432 Ga0207676_10010157 3300026095 Bacteria 6701
433 Ga0207676_10041155 3300026095 Bacteria 3545
434 Ga0207676_10105478 3300026095 Bacteria 2346
435 Ga0207676_10226519 3300026095 Bacteria 1668
436 Ga0207676_10261380 3300026095 Bacteria 1563
437 Ga0207674_10015428 3300026116 Bacteria 8393
438 Ga0207674_10053226 3300026116 Bacteria 4126
439 Ga0207675_100005117 3300026118 Bacteria 12625
440 Ga0207675_100026312 3300026118 Bacteria 5415
441 Ga0207675_100047083 3300026118 Bacteria 4027
442 Ga0207675_100059251 3300026118 Bacteria 3573
443 Ga0207675_100166081 3300026118 Bacteria 2108
444 Ga0207683_10006134 3300026121 Bacteria 10296
445 Ga0207683_10012895 3300026121 Bacteria 7135
446 Ga0207683_10026507 3300026121 Bacteria 5002
447 Ga0207683_10303248 3300026121 Bacteria 1461
448 Ga0207683_10559139 3300026121 Bacteria 1058
449 Ga0207698_10028871 3300026142 Bacteria 3963
450 Ga0207698_10030460 3300026142 Bacteria 3880
451 Ga0207698_10034956 3300026142 Bacteria 3671
452 Ga0207698_10451857 3300026142 Bacteria 1241
453 Ga0209371_1023392 3300027312 Bacteria 1455
454 Ga0209588_1048046 3300027671 Bacteria 1380
455 Ga0265354_1002352 3300028016 Bacteria 2369
456 Ga0268266_10098696 3300028379 Bacteria 2570
457 Ga0268266_10873387 3300028379 Bacteria 869
458 Ga0268265_10030187 3300028380 Bacteria 3900
459 Ga0268265_10040482 3300028380 Bacteria 3442
460 Ga0268264_10015847 3300028381 Bacteria 6171
461 Ga0268264_10072826 3300028381 Bacteria 2914
462 Ga0268264_10122723 3300028381 Bacteria 2292
463 Ga0265319_1036053 3300028563 Bacteria 1694
464 Ga0265334_10001873 3300028573 Bacteria 9987
465 Ga0265318_10000011 3300028577 Bacteria 231078
466 Ga0307517_10000131 3300028786 Bacteria 113233
467 Ga0307515_10010230 3300028794 Bacteria 18010
468 Ga0307515_10016716 3300028794 Bacteria 13417
469 Ga0307515_10045865 3300028794 Bacteria 6699
470 Ga0268256_1026586 3300030500 Bacteria 1452
471 Ga0307512_10014097 3300030522 Bacteria 7462
472 Ga0307512_10077087 3300030522 Bacteria 2425
473 Ga0265760_10000144 3300031090 Bacteria 18264
474 Ga0265330_10000019 3300031235 Bacteria 156905
475 Ga0265332_10000209 3300031238 Bacteria 47448
476 Ga0265328_10020600 3300031239 Bacteria 2522
477 Ga0265320_10000005 3300031240 Bacteria 354422
478 Ga0265320_10086885 3300031240 Bacteria 1453
479 Ga0265329_10000727 3300031242 Bacteria 16709
480 Ga0265331_10000207 3300031250 Bacteria 71159
481 Ga0265327_10012683 3300031251 Bacteria 5665
482 Ga0307509_10002009 3300031507 Bacteria 33629
483 Ga0307509_10003678 3300031507 Bacteria 22944
484 Ga0307509_10004862 3300031507 Bacteria 19056
485 Ga0307509_10044590 3300031507 Bacteria 4790
486 Ga0307408_100017706 3300031548 Bacteria 4773
487 Ga0307408_100167002 3300031548 Bacteria 1754
488 Ga0307408_100215769 3300031548 Bacteria 1562
489 Ga0265313_10000019 3300031595 Bacteria 149106
490 Ga0265313_10068906 3300031595 Bacteria 1633
491 Ga0265313_10082124 3300031595 Bacteria 1461
492 Ga0307508_10002648 3300031616 Bacteria 18776
493 Ga0307508_10082842 3300031616 Bacteria 2790
494 Ga0307514_10026868 3300031649 Bacteria 4652
495 Ga0307514_10091098 3300031649 Bacteria 2222
496 Ga0265314_10002597 3300031711 Bacteria 18274
497 Ga0265342_10215283 3300031712 Bacteria 1037
498 Ga0307516_10000148 3300031730 Bacteria 86902
499 Ga0307516_10000244 3300031730 Bacteria 70125
500 Ga0307516_10000419 3300031730 Bacteria 55599
501 Ga0307516_10141850 3300031730 Bacteria 2171
502 Ga0307516_10252142 3300031730 Bacteria 1459
503 Ga0307516_10295794 3300031730 Bacteria 1296
504 Ga0307405_10408028 3300031731 Bacteria 1065
505 Ga0307413_10000991 3300031824 Bacteria 10216
506 Ga0307413_10102515 3300031824 Bacteria 1895
507 Ga0307410_10016802 3300031852 Bacteria 4375
508 Ga0307410_10370898 3300031852 Bacteria 1149
509 Ga0307410_10512792 3300031852 Bacteria 988
510 Ga0307406_10013821 3300031901 Bacteria 4633
511 Ga0307406_10025879 3300031901 Bacteria 3517
512 Ga0307407_10215087 3300031903 Bacteria 1296
513 Ga0307407_10406174 3300031903 Bacteria 978
514 Ga0307412_10001535 3300031911 Bacteria 12773
515 Ga0307412_10008145 3300031911 Bacteria 5972
516 Ga0307409_100008870 3300031995 Bacteria 6137
517 Ga0307409_100008875 3300031995 Bacteria 6135
518 Ga0307409_100318569 3300031995 Bacteria 1454
519 Ga0307416_100039771 3300032002 Bacteria 3645
520 Ga0307416_100299941 3300032002 Bacteria 1596
521 Ga0307416_100787306 3300032002 Bacteria 1046
522 Ga0307414_10053015 3300032004 Bacteria 2827
523 Ga0307414_10065461 3300032004 Bacteria 2593
524 Ga0307411_10010745 3300032005 Bacteria 4898
525 Ga0307415_100020682 3300032126 Bacteria 4024
526 Ga0307507_10047402 3300033179 Bacteria 4197
527 Ga0307510_10005846 3300033180 Bacteria 14671
528 Ga0307510_10026370 3300033180 Bacteria 6680
529 Ga0307510_10040673 3300033180 Bacteria 5099
530 Ga0307510_10180482 3300033180 Bacteria 1674
531 Ga0373950_0000070 3300034818 Bacteria 52640
532 Ga0373938_0017392 3300034957 Bacteria 1415
533 Ga0373928_0013521 3300035084 Bacteria 1640
534 Ga0373932_0032723 3300035112 Bacteria 1456
535 Ga0373941_0125815 3300035115 Bacteria 918
536 Ga0373960_0011567 3300035121 Bacteria 2175
537 Ga0373943_0032411 3300035170 Bacteria 2484
538 Ga0373946_0203928 3300035171 Bacteria 948
539 Ga0373955_0122582 3300035172 Bacteria 1512
540 Ga0373924_0010107 3300035410 Bacteria 3474
541 Ga0373924_0119360 3300035410 Bacteria 1143
542 Ga0373931_0018291 3300035691 Bacteria 3483
543 Ga0373931_0026635 3300035691 Bacteria 2944
544 Ga0373937_0028375 3300036401 Bacteria 5064
545 Ga0373925_0085409 3300037068 Bacteria 2406
546 Ga0395899_0081098 3300037312 Bacteria 2361
547 Ga0395900_0000025 3300037418 Bacteria 321217
548 Ga0395898_0000893 3300037466 Bacteria 48473
549 Ga0395898_0202985 3300037466 Bacteria 1892
550 Ga0395905_0000329 3300037471 Bacteria 68145
551 Ga0395905_0006586 3300037471 Bacteria 11665
552 Ga0395901_0144709 3300038443 Bacteria 2499
553 Ga0436365_0217206 3300039437 Bacteria 2092
554 Ga0436365_1681085 3300039437 Bacteria 1778
555 Ga0436361_0147510 3300039447 Bacteria 46306
556 Ga0436361_0795551 3300039447 Bacteria 1438
557 Ga0436363_0285956 3300039450 Bacteria 3827
558 Ga0439436_0059487 3300041404 Bacteria 1071
559 Ga0451833_0953641 3300041491 Bacteria 1713
560 Ga0451843_1226642 3300041509 Bacteria 1362
561 Ga0451853_2678590 3300041512 Bacteria 2295
562 Ga0450921_006991 3300042123 Bacteria 888
563 Ga0439464_0017741 3300042439 Bacteria 1932
564 Ga0450901_004161 3300042533 Unclassified 1499
565 Ga0451577_0024273 3300042876 Bacteria 5517
566 Ga0451577_0093882 3300042876 Bacteria 2679
567 Ga0466969_0000830 3300044656 Bacteria 16802
568 Ga0453683_0048715 3300044673 Bacteria 2658
569 Ga0453683_0091117 3300044673 Bacteria 1911
570 Ga0453683_0146552 3300044673 Bacteria 1491
571 Ga0453683_0204192 3300044673 Bacteria 1255
572 Ga0466965_0070443 3300044683 Bacteria 1757
573 Ga0466965_0287942 3300044683 Bacteria 889
574 Ga0466966_0040681 3300044684 Bacteria 2991
575 Ga0466961_0008582 3300044693 Bacteria 6510
576 Ga0453684_0003853 3300044712 Bacteria 33049
577 Ga0453684_0058655 3300044712 Bacteria 4970
578 Ga0453684_0646593 3300044712 Bacteria 1154
579 Ga0453684_1099214 3300044712 Bacteria 840
580 Ga0466970_0140522 3300044765 Bacteria 1330
581 Ga0466959_0042728 3300045049 Bacteria 3343
582 Ga0451576_0000535 3300045051 Bacteria 81918
583 Ga0451576_0041165 3300045051 Bacteria 4886
584 Ga0451576_0064872 3300045051 Bacteria 3803
585 Ga0451576_0080415 3300045051 Bacteria 3391
586 Ga0451576_0294782 3300045051 Bacteria 1696
587 Ga0451576_0315486 3300045051 Bacteria 1636
588 Ga0466967_0389845 3300045976 Bacteria 1354
589 Ga0495592_0000394 3300046454 Bacteria 33973
590 Ga0495590_0020399 3300046457 Bacteria 2355
591 Ga0495580_0110854 3300046472 Bacteria 1906
592 Ga0495580_0180961 3300046472 Bacteria 1456
593 Ga0495605_0057705 3300046474 Bacteria 1868
594 Ga0495630_0486680 3300046517 Bacteria 946
595 Ga0495632_0067443 3300046519 Bacteria 1725
596 Ga0495663_0000523 3300046525 Bacteria 13846
597 Ga0495654_0060464 3300046530 Bacteria 1821
598 Ga0495587_0173272 3300046536 Bacteria 1225
599 Ga0495598_0079438 3300046537 Bacteria 1049
600 Ga0495621_0185404 3300046539 Bacteria 832
601 Ga0495645_0043051 3300046543 Bacteria 3293
602 Ga0495633_0001633 3300046558 Bacteria 16923
603 Ga0495668_0063228 3300046616 Bacteria 2039
604 Ga0495634_0106617 3300046642 Bacteria 1806
605 Ga0495635_0234220 3300046663 Bacteria 1240
606 Ga0495658_0019632 3300046683 Bacteria 3531
607 Ga0495658_0209140 3300046683 Bacteria 1218
608 Ga0495624_0049046 3300046690 Bacteria 2678
609 Ga0495649_0004358 3300046694 Bacteria 9269
610 Ga0495672_0000459 3300047320 Bacteria 48101
611 Ga0495676_0149538 3300047321 Bacteria 1664
612 Ga0495687_002007 3300047443 Bacteria 17252
613 Ga0495684_0090083 3300047471 Bacteria 2324
614 Ga0495686_0002603 3300047472 Bacteria 16741
615 Ga0495593_0108019 3300047673 Bacteria 1422
616 Ga0495626_0104005 3300048091 Bacteria 1235
617 Ga0496101_0308915 3300048904 Bacteria 1239
618 Ga0496102_0021356 3300048905 Bacteria 5726
619 Ga0496104_0850407 3300048907 Bacteria 818
620 Ga0496105_0035474 3300048908 Bacteria 4104
621 Ga0496107_0008694 3300048910 Bacteria 7034
622 Ga0496108_0037639 3300048911 Bacteria 4031
623 Ga0496108_0108971 3300048911 Bacteria 2366
624 Ga0496109_0065263 3300048912 Bacteria 3332
625 Ga0496109_0535054 3300048912 Bacteria 1105
626 Ga0496110_0094193 3300048913 Bacteria 2681
627 Ga0496110_0112180 3300048913 Bacteria 2451
628 Ga0496110_0149400 3300048913 Bacteria 2115
629 Ga0496111_0040071 3300048914 Bacteria 3360
630 Ga0496114_0104997 3300048917 Bacteria 2416
631 Ga0496115_0026217 3300048918 Bacteria 4547
632 Ga0496116_0005768 3300048919 Bacteria 11384
633 Ga0496117_0073829 3300048920 Bacteria 2274
634 Ga0496118_0043390 3300048921 Bacteria 3536
635 Ga0496118_0098504 3300048921 Bacteria 1985
636 Ga0496119_0015034 3300048922 Bacteria 5996
637 Ga0496120_0071246 3300048923 Bacteria 1908
638 Ga0496121_0000200 3300048924 Bacteria 131314
639 Ga0496121_0017358 3300048924 Bacteria 7359
640 Ga0496122_0000021 3300048925 Bacteria 391363
641 Ga0496122_0037277 3300048925 Bacteria 3916
642 Ga0496123_0000382 3300048926 Bacteria 83286
643 Ga0496123_0015028 3300048926 Bacteria 6377
644 Ga0496124_0008879 3300048927 Bacteria 10431
645 Ga0496125_0000005 3300048928 Bacteria 827598
646 Ga0496125_0087395 3300048928 Bacteria 2355
647 Ga0496126_0018419 3300048929 Bacteria 6919
648 Ga0496126_0080528 3300048929 Bacteria 2882
649 Ga0501336_007437 3300049552 Bacteria 831
650 Ga0501037_0082650 3300049573 Bacteria 2327
651 Ga0501039_0556708 3300049575 Bacteria 900
652 Ga0501046_0517468 3300049580 Bacteria 853
653 Ga0501047_0003039 3300049581 Bacteria 15916
654 Ga0501047_0027619 3300049581 Bacteria 5467
655 Ga0501047_0264457 3300049581 Bacteria 1567
656 Ga0501067_0000032 3300049583 Bacteria 86474
657 Ga0501068_0009627 3300049584 Bacteria 5411
658 Ga0501069_0032905 3300049585 Bacteria 2854
659 Ga0501070_0019775 3300049586 Bacteria 5647
660 Ga0501070_0296629 3300049586 Bacteria 1317
661 Ga0501073_0003918 3300049589 Bacteria 11173
662 Ga0501073_0035750 3300049589 Bacteria 3529
663 Ga0501074_0017424 3300049590 Bacteria 5212
664 Ga0501074_0024189 3300049590 Bacteria 4414
665 Ga0501199_008182 3300049650 Bacteria 1091
666 Ga0501208_006262 3300049655 Bacteria 1507
667 Ga0501222_009332 3300049662 Bacteria 1299
668 Ga0501223_010048 3300049663 Bacteria 1910
669 Ga0501257_000018 3300049686 Bacteria 48053
670 Ga0501080_0009668 3300049742 Bacteria 8804
671 Ga0501080_0059748 3300049742 Bacteria 3548
672 Ga0501083_0008135 3300049744 Bacteria 7419
673 Ga0501280_013230 3300049776 Bacteria 1165
674 Ga0501035_0012342 3300049822 Bacteria 7896
675 Ga0501035_0032946 3300049822 Bacteria 4713
676 Ga0501044_0000693 3300049823 Bacteria 40818
677 Ga0501044_0009530 3300049823 Bacteria 10573
678 Ga0501044_0010994 3300049823 Bacteria 9826
679 Ga0501044_0013382 3300049823 Bacteria 8871
680 Ga0501044_0609886 3300049823 Bacteria 984
681 nmdc:mga03683_75355_c1 3300050489 Bacteria 1449
682 nmdc:mga00v17_83071_c1 3300050491 Bacteria 2003
683 nmdc:mga00v17_8686_c1 3300050491 Bacteria 5471
684 nmdc:mga0k408_119151_c1 3300050493 Bacteria 1563
685 nmdc:mga0k408_124822_c1 3300050493 Bacteria 1526
686 nmdc:mga0k408_15878_c1 3300050493 Bacteria 4169
687 nmdc:mga0k408_19076_c1 3300050493 Bacteria 3830
688 nmdc:mga0k408_200409_c1 3300050493 Bacteria 1191
689 nmdc:mga0k408_218663_c2 3300050493 Bacteria 840
690 nmdc:mga0k408_25901_c1 3300050493 Bacteria 3324
691 nmdc:mga0k408_3369_c1 3300050493 Bacteria 8465
692 nmdc:mga0k408_84918_c1 3300050493 Bacteria 1858
693 nmdc:mga06z11_4534_c1 3300050494 Bacteria 5472
694 nmdc:mga07m45_61534_c1 3300050496 Bacteria 2127
695 nmdc:mga07m45_6946_c1 3300050496 Bacteria 5757
696 nmdc:mga07m45_83228_c1 3300050496 Bacteria 1828
697 nmdc:mga07m45_9087_c1 3300050496 Bacteria 5136
698 Ga0495619_0136408 3300053085 Bacteria 1688
699 Ga0495619_0198423 3300053085 Bacteria 1389
700 Ga0500643_003747 3300053087 Bacteria 7144
701 Ga0500643_036839 3300053087 Bacteria 1459
702 Ga0500651_0003737 3300053093 Bacteria 8384
703 Ga0500650_0000007 3300053098 Bacteria 108097
704 Ga0500650_0062862 3300053098 Bacteria 1734
705 Ga0500592_000008 3300053116 Bacteria 89104
706 Ga0500594_0001043 3300053118 Bacteria 5931
707 Ga0500652_053689 3300053131 Bacteria 1649
708 Ga0500559_0000446 3300053136 Bacteria 29360
709 Ga0500568_0011845 3300053139 Bacteria 4028
710 Ga0500604_0021916 3300053151 Bacteria 1810
711 Ga0500622_0000111 3300053156 Bacteria 83844
712 Ga0500627_0000055 3300053158 Bacteria 54775
713 Ga0500627_0176825 3300053158 Bacteria 960
714 Ga0500637_0199804 3300053178 Bacteria 1139
715 Ga0501082_0052471 3300060353 Bacteria 3515
716 Ga0466962_0039510 3300061719 Bacteria 2259

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0517468 Ga0501046_0517468_108_830 240
2 iso_pu_bacteria 2511231008 2511277167 241
3 3300005295 Ga0065707_10081888 Ga0065707_100818885 245
4 3300005719 Ga0068861_100003863 Ga0068861_1000038637 245
5 3300014326 Ga0157380_10088577 Ga0157380_100885773 245
6 3300026118 Ga0207675_100026312 Ga0207675_1000263123 245
7 3300048921 Ga0496118_0098504 Ga0496118_0098504_1178_1954 245
8 iso_pu_bacteria 2855730933 2855731543 245
9 iso_pu_bacteria 2855767633 2855768249 245
10 3300045051 Ga0451576_0041165 Ga0451576_0041165_2498_3274 247
11 3300042876 Ga0451577_0024273 Ga0451577_0024273_3127_3903 248
12 3300044683 Ga0466965_0287942 Ga0466965_0287942_29_778 249
13 3300044712 Ga0453684_0003853 Ga0453684_0003853_21504_22283 249
14 3300045051 Ga0451576_0080415 Ga0451576_0080415_1754_2530 249
15 3300026067 Ga0207678_10126887 Ga0207678_101268872 253
16 iso_pu_bacteria 2534681786 2535484106 254
17 iso_pu_bacteria 2574179768 2574432028 254
18 iso_pu_bacteria 2574179768 2574433328 254
19 iso_pu_bacteria 2738541276 2738715362 254
20 iso_pu_bacteria 2854911287 2854914248 254
21 iso_pu_bacteria 2857537821 2857541363 254
22 iso_pu_bacteria 2858950400 2858951678 254
23 iso_pu_bacteria 2881412998 2881413582 254
24 iso_pu_bacteria 2891633521 2891634527 254
25 iso_pu_bacteria 2904479285 2904481271 254
26 iso_pu_bacteria 2915650412 2915651130 254
27 iso_pu_bacteria 2917832318 2917835014 254
28 iso_pu_bacteria 2941479691 2941483163 254
29 iso_pu_bacteria 2984504281 2984505176 254
30 iso_pu_bacteria 639633007 639787813 254
31 iso_pu_bacteria 8002392321 8002394356 254
32 iso_pu_bacteria 8002745576 8002748838 254
33 iso_pu_bacteria 8048746797 8048749403 254
34 iso_pu_bacteria 8055225921 8055229030 254
35 3300003578 Ga0006562J51391_1031350 Ga0006562J51391_10313501 257
36 3300005343 Ga0070687_100322952 Ga0070687_1003229521 257
37 3300005366 Ga0070659_100039920 Ga0070659_1000399203 257
38 3300005458 Ga0070681_10180756 Ga0070681_101807561 257
39 3300005530 Ga0070679_100025237 Ga0070679_1000252371 257
40 3300005530 Ga0070679_100107585 Ga0070679_1001075851 257
41 3300005563 Ga0068855_100408654 Ga0068855_1004086542 257
42 3300006195 Ga0075366_10088782 Ga0075366_100887823 257
43 3300009093 Ga0105240_10000706 Ga0105240_1000070628 257
44 3300009545 Ga0105237_10000048 Ga0105237_10000048146 257
45 3300010375 Ga0105239_10062082 Ga0105239_100620825 257
46 3300010375 Ga0105239_10314913 Ga0105239_103149131 257
47 3300025909 Ga0207705_10033965 Ga0207705_100339653 257
48 3300025910 Ga0207684_10453426 Ga0207684_104534261 257
49 3300025912 Ga0207707_10150408 Ga0207707_101504083 257
50 3300025913 Ga0207695_10004844 Ga0207695_1000484410 257
51 3300025914 Ga0207671_10000077 Ga0207671_1000007765 257
52 3300025918 Ga0207662_10058525 Ga0207662_100585252 257
53 3300025921 Ga0207652_10028046 Ga0207652_100280464 257
54 3300025921 Ga0207652_10075574 Ga0207652_100755741 257
55 3300025924 Ga0207694_10013058 Ga0207694_100130581 257
56 3300026078 Ga0207702_10247974 Ga0207702_102479741 257
57 3300026078 Ga0207702_10811363 Ga0207702_108113631 257
58 3300028563 Ga0265319_1036053 Ga0265319_10360532 257
59 3300028577 Ga0265318_10000011 Ga0265318_1000001147 257
60 3300031235 Ga0265330_10000019 Ga0265330_10000019102 257
61 3300031238 Ga0265332_10000209 Ga0265332_1000020929 257
62 3300031239 Ga0265328_10020600 Ga0265328_100206001 257
63 3300031240 Ga0265320_10000005 Ga0265320_10000005273 257
64 3300031240 Ga0265320_10086885 Ga0265320_100868851 257
65 3300031242 Ga0265329_10000727 Ga0265329_100007275 257
66 3300031250 Ga0265331_10000207 Ga0265331_1000020715 257
67 3300031595 Ga0265313_10000019 Ga0265313_10000019131 257
68 3300031595 Ga0265313_10068906 Ga0265313_100689062 257
69 3300031595 Ga0265313_10082124 Ga0265313_100821242 257
70 3300031711 Ga0265314_10002597 Ga0265314_100025972 257
71 3300031712 Ga0265342_10215283 Ga0265342_102152831 257
72 3300034818 Ga0373950_0000070 Ga0373950_0000070_25870_26646 257
73 3300042876 Ga0451577_0093882 Ga0451577_0093882_543_1316 257
74 3300044712 Ga0453684_0646593 Ga0453684_0646593_53_826 257
75 3300048927 Ga0496124_0008879 Ga0496124_0008879_6882_7655 257
76 3300049583 Ga0501067_0000032 Ga0501067_0000032_10049_10825 257
77 3300049584 Ga0501068_0009627 Ga0501068_0009627_1817_2593 257
78 3300049586 Ga0501070_0296629 Ga0501070_0296629_443_1219 257
79 3300049589 Ga0501073_0003918 Ga0501073_0003918_6326_7102 257
80 3300049589 Ga0501073_0035750 Ga0501073_0035750_23_799 257
81 3300049590 Ga0501074_0017424 Ga0501074_0017424_4214_4990 257
82 3300049744 Ga0501083_0008135 Ga0501083_0008135_6314_7090 257
83 3300049823 Ga0501044_0609886 Ga0501044_0609886_124_897 257
84 3300050493 nmdc:mga0k408_218663_c2 nmdc:mga0k408_218663_c2_47_820 257
85 3300050493 nmdc:mga0k408_84918_c1 nmdc:mga0k408_84918_c1_891_1664 257
86 3300053098 Ga0500650_0000007 Ga0500650_0000007_21162_21935 257
87 3300060353 Ga0501082_0052471 Ga0501082_0052471_148_924 257
88 3300003320 rootH2_10265435 rootH2_102654354 258
89 3300003323 rootH1_10007832 rootH1_100078323 258
90 3300003323 rootH1_10013353 rootH1_100133533 258
91 3300003761 Ga0055535_1000326 Ga0055535_100032635 258
92 3300003763 Ga0055529_1000053 Ga0055529_100005374 258
93 3300005293 Ga0065715_10108371 Ga0065715_101083712 258
94 3300005328 Ga0070676_10011536 Ga0070676_100115364 258
95 3300005328 Ga0070676_10011678 Ga0070676_100116783 258
96 3300005328 Ga0070676_10018496 Ga0070676_100184962 258
97 3300005329 Ga0070683_100161729 Ga0070683_1001617292 258
98 3300005330 Ga0070690_100146050 Ga0070690_1001460502 258
99 3300005331 Ga0070670_100011021 Ga0070670_1000110214 258
100 3300005331 Ga0070670_100012601 Ga0070670_1000126014 258
101 3300005331 Ga0070670_100109486 Ga0070670_1001094863 258
102 3300005331 Ga0070670_100125470 Ga0070670_1001254702 258
103 3300005333 Ga0070677_10015903 Ga0070677_100159032 258
104 3300005333 Ga0070677_10047534 Ga0070677_100475342 258
105 3300005333 Ga0070677_10068897 Ga0070677_100688972 258
106 3300005334 Ga0068869_100004489 Ga0068869_1000044897 258
107 3300005334 Ga0068869_100007554 Ga0068869_1000075543 258
108 3300005335 Ga0070666_10029393 Ga0070666_100293934 258
109 3300005338 Ga0068868_100022208 Ga0068868_1000222084 258
110 3300005338 Ga0068868_100215370 Ga0068868_1002153702 258
111 3300005338 Ga0068868_100317455 Ga0068868_1003174552 258
112 3300005338 Ga0068868_100392174 Ga0068868_1003921742 258
113 3300005343 Ga0070687_100002759 Ga0070687_1000027595 258
114 3300005343 Ga0070687_100014191 Ga0070687_1000141914 258
115 3300005344 Ga0070661_100008395 Ga0070661_1000083955 258
116 3300005344 Ga0070661_100299886 Ga0070661_1002998862 258
117 3300005344 Ga0070661_100307367 Ga0070661_1003073672 258
118 3300005347 Ga0070668_100010597 Ga0070668_1000105974 258
119 3300005347 Ga0070668_100140552 Ga0070668_1001405523 258
120 3300005353 Ga0070669_100005375 Ga0070669_1000053754 258
121 3300005353 Ga0070669_100009750 Ga0070669_1000097505 258
122 3300005353 Ga0070669_100534804 Ga0070669_1005348041 258
123 3300005354 Ga0070675_100013532 Ga0070675_1000135325 258
124 3300005354 Ga0070675_100043334 Ga0070675_1000433344 258
125 3300005354 Ga0070675_100046663 Ga0070675_1000466632 258
126 3300005354 Ga0070675_100109109 Ga0070675_1001091093 258
127 3300005355 Ga0070671_100000534 Ga0070671_10000053425 258
128 3300005355 Ga0070671_100039382 Ga0070671_1000393823 258
129 3300005355 Ga0070671_100040943 Ga0070671_1000409432 258
130 3300005355 Ga0070671_100273614 Ga0070671_1002736142 258
131 3300005356 Ga0070674_100002413 Ga0070674_1000024135 258
132 3300005356 Ga0070674_100004864 Ga0070674_1000048643 258
133 3300005356 Ga0070674_100014620 Ga0070674_1000146204 258
134 3300005356 Ga0070674_100119715 Ga0070674_1001197153 258
135 3300005356 Ga0070674_100184270 Ga0070674_1001842702 258
136 3300005364 Ga0070673_100000789 Ga0070673_1000007896 258
137 3300005364 Ga0070673_100006551 Ga0070673_1000065512 258
138 3300005364 Ga0070673_100028497 Ga0070673_1000284975 258
139 3300005366 Ga0070659_100007809 Ga0070659_1000078095 258
140 3300005366 Ga0070659_100038858 Ga0070659_1000388584 258
141 3300005366 Ga0070659_100404102 Ga0070659_1004041022 258
142 3300005367 Ga0070667_100029025 Ga0070667_1000290252 258
143 3300005367 Ga0070667_100096568 Ga0070667_1000965682 258
144 3300005441 Ga0070700_100372176 Ga0070700_1003721761 258
145 3300005444 Ga0070694_100090009 Ga0070694_1000900091 258
146 3300005455 Ga0070663_100023029 Ga0070663_1000230293 258
147 3300005455 Ga0070663_100136784 Ga0070663_1001367842 258
148 3300005455 Ga0070663_100263891 Ga0070663_1002638911 258
149 3300005456 Ga0070678_100030214 Ga0070678_1000302143 258
150 3300005456 Ga0070678_100244319 Ga0070678_1002443192 258
151 3300005457 Ga0070662_100001314 Ga0070662_10000131410 258
152 3300005457 Ga0070662_100003868 Ga0070662_1000038687 258
153 3300005457 Ga0070662_100015654 Ga0070662_1000156543 258
154 3300005457 Ga0070662_100040799 Ga0070662_1000407993 258
155 3300005457 Ga0070662_100133212 Ga0070662_1001332122 258
156 3300005457 Ga0070662_100309501 Ga0070662_1003095012 258
157 3300005458 Ga0070681_10010756 Ga0070681_100107568 258
158 3300005459 Ga0068867_100004451 Ga0068867_1000044514 258
159 3300005459 Ga0068867_100024085 Ga0068867_1000240856 258
160 3300005467 Ga0070706_100002539 Ga0070706_10000253915 258
161 3300005471 Ga0070698_100161840 Ga0070698_1001618403 258
162 3300005535 Ga0070684_100122884 Ga0070684_1001228842 258
163 3300005535 Ga0070684_100209079 Ga0070684_1002090792 258
164 3300005539 Ga0068853_100003486 Ga0068853_1000034863 258
165 3300005539 Ga0068853_100103541 Ga0068853_1001035413 258
166 3300005539 Ga0068853_100122152 Ga0068853_1001221522 258
167 3300005539 Ga0068853_100422448 Ga0068853_1004224482 258
168 3300005543 Ga0070672_100001315 Ga0070672_10000131510 258
169 3300005543 Ga0070672_100010467 Ga0070672_1000104674 258
170 3300005543 Ga0070672_100013149 Ga0070672_1000131493 258
171 3300005543 Ga0070672_100036486 Ga0070672_1000364862 258
172 3300005543 Ga0070672_100040420 Ga0070672_1000404204 258
173 3300005543 Ga0070672_100144564 Ga0070672_1001445642 258
174 3300005543 Ga0070672_100180807 Ga0070672_1001808072 258
175 3300005546 Ga0070696_100593931 Ga0070696_1005939311 258
176 3300005547 Ga0070693_100080985 Ga0070693_1000809852 258
177 3300005547 Ga0070693_100302523 Ga0070693_1003025232 258
178 3300005548 Ga0070665_100155518 Ga0070665_1001555182 258
179 3300005548 Ga0070665_100268575 Ga0070665_1002685752 258
180 3300005549 Ga0070704_100095101 Ga0070704_1000951012 258
181 3300005563 Ga0068855_100102182 Ga0068855_1001021823 258
182 3300005563 Ga0068855_100129507 Ga0068855_1001295073 258
183 3300005564 Ga0070664_100341878 Ga0070664_1003418782 258
184 3300005564 Ga0070664_100416788 Ga0070664_1004167882 258
185 3300005564 Ga0070664_100547763 Ga0070664_1005477631 258
186 3300005577 Ga0068857_100076606 Ga0068857_1000766062 258
187 3300005577 Ga0068857_100139059 Ga0068857_1001390592 258
188 3300005577 Ga0068857_100290056 Ga0068857_1002900562 258
189 3300005578 Ga0068854_100005390 Ga0068854_1000053903 258
190 3300005578 Ga0068854_100013308 Ga0068854_1000133086 258
191 3300005578 Ga0068854_100263266 Ga0068854_1002632662 258
192 3300005614 Ga0068856_100008252 Ga0068856_1000082525 258
193 3300005614 Ga0068856_100147831 Ga0068856_1001478312 258
194 3300005616 Ga0068852_100068084 Ga0068852_1000680842 258
195 3300005616 Ga0068852_100092165 Ga0068852_1000921654 258
196 3300005618 Ga0068864_100015826 Ga0068864_1000158262 258
197 3300005618 Ga0068864_100084608 Ga0068864_1000846082 258
198 3300005718 Ga0068866_10013868 Ga0068866_100138685 258
199 3300005718 Ga0068866_10056834 Ga0068866_100568343 258
200 3300005719 Ga0068861_100008132 Ga0068861_1000081324 258
201 3300005719 Ga0068861_100008314 Ga0068861_1000083145 258
202 3300005834 Ga0068851_10012946 Ga0068851_100129464 258
203 3300005834 Ga0068851_10017761 Ga0068851_100177614 258
204 3300005834 Ga0068851_10131784 Ga0068851_101317842 258
205 3300005840 Ga0068870_10002894 Ga0068870_100028945 258
206 3300005840 Ga0068870_10034500 Ga0068870_100345001 258
207 3300005840 Ga0068870_10147721 Ga0068870_101477211 258
208 3300005841 Ga0068863_100175614 Ga0068863_1001756143 258
209 3300005841 Ga0068863_100458604 Ga0068863_1004586042 258
210 3300005842 Ga0068858_100033342 Ga0068858_1000333424 258
211 3300005842 Ga0068858_100037802 Ga0068858_1000378024 258
212 3300005843 Ga0068860_100052139 Ga0068860_1000521394 258
213 3300005844 Ga0068862_100039379 Ga0068862_1000393794 258
214 3300006051 Ga0075364_10012125 Ga0075364_100121252 258
215 3300006178 Ga0075367_10018271 Ga0075367_100182714 258
216 3300006186 Ga0075369_10074872 Ga0075369_100748722 258
217 3300006195 Ga0075366_10016003 Ga0075366_100160032 258
218 3300006195 Ga0075366_10062487 Ga0075366_100624873 258
219 3300006195 Ga0075366_10086812 Ga0075366_100868123 258
220 3300006237 Ga0097621_100023459 Ga0097621_1000234592 258
221 3300006237 Ga0097621_100030919 Ga0097621_1000309192 258
222 3300006353 Ga0075370_10001199 Ga0075370_100011997 258
223 3300006353 Ga0075370_10004021 Ga0075370_100040216 258
224 3300006353 Ga0075370_10033742 Ga0075370_100337423 258
225 3300006353 Ga0075370_10073530 Ga0075370_100735303 258
226 3300006358 Ga0068871_100054306 Ga0068871_1000543062 258
227 3300006358 Ga0068871_100085405 Ga0068871_1000854054 258
228 3300006881 Ga0068865_100008925 Ga0068865_1000089255 258
229 3300006881 Ga0068865_100031493 Ga0068865_1000314932 258
230 3300006881 Ga0068865_100100608 Ga0068865_1001006082 258
231 3300006881 Ga0068865_100244744 Ga0068865_1002447442 258
232 3300006931 Ga0097620_100175902 Ga0097620_1001759023 258
233 3300007265 Ga0099794_10003794 Ga0099794_100037943 258
234 3300007265 Ga0099794_10047481 Ga0099794_100474812 258
235 3300007788 Ga0099795_10000120 Ga0099795_100001208 258
236 3300009093 Ga0105240_10027814 Ga0105240_100278147 258
237 3300009093 Ga0105240_10130188 Ga0105240_101301882 258
238 3300009093 Ga0105240_10175720 Ga0105240_101757202 258
239 3300009094 Ga0111539_10296689 Ga0111539_102966893 258
240 3300009098 Ga0105245_10060592 Ga0105245_100605923 258
241 3300009098 Ga0105245_10277001 Ga0105245_102770013 258
242 3300009101 Ga0105247_10406370 Ga0105247_104063701 258
243 3300009148 Ga0105243_10013318 Ga0105243_100133187 258
244 3300009148 Ga0105243_10180310 Ga0105243_101803102 258
245 3300009174 Ga0105241_10054918 Ga0105241_100549182 258
246 3300009174 Ga0105241_10346117 Ga0105241_103461172 258
247 3300009176 Ga0105242_10033767 Ga0105242_100337674 258
248 3300009177 Ga0105248_10037307 Ga0105248_100373074 258
249 3300009177 Ga0105248_10118638 Ga0105248_101186383 258
250 3300009177 Ga0105248_10173206 Ga0105248_101732063 258
251 3300009177 Ga0105248_10407885 Ga0105248_104078852 258
252 3300009177 Ga0105248_10556958 Ga0105248_105569582 258
253 3300009545 Ga0105237_10003764 Ga0105237_1000376415 258
254 3300009545 Ga0105237_10102263 Ga0105237_101022632 258
255 3300009551 Ga0105238_10008003 Ga0105238_100080035 258
256 3300009553 Ga0105249_10046249 Ga0105249_100462494 258
257 3300010159 Ga0099796_10001454 Ga0099796_100014543 258
258 3300010375 Ga0105239_10014548 Ga0105239_100145485 258
259 3300010375 Ga0105239_10066928 Ga0105239_100669282 258
260 3300010375 Ga0105239_10206315 Ga0105239_102063153 258
261 3300010375 Ga0105239_10402781 Ga0105239_104027811 258
262 3300011119 Ga0105246_10085154 Ga0105246_100851542 258
263 3300012498 Ga0157345_1007296 Ga0157345_10072961 258
264 3300013100 Ga0157373_10175582 Ga0157373_101755822 258
265 3300013102 Ga0157371_10188885 Ga0157371_101888852 258
266 3300013104 Ga0157370_10373940 Ga0157370_103739402 258
267 3300013105 Ga0157369_10189424 Ga0157369_101894243 258
268 3300013296 Ga0157374_10000224 Ga0157374_1000022413 258
269 3300013296 Ga0157374_10032656 Ga0157374_100326564 258
270 3300013296 Ga0157374_10334911 Ga0157374_103349112 258
271 3300013306 Ga0163162_10008352 Ga0163162_100083525 258
272 3300013306 Ga0163162_10192195 Ga0163162_101921952 258
273 3300013306 Ga0163162_10264813 Ga0163162_102648132 258
274 3300013307 Ga0157372_10120596 Ga0157372_101205962 258
275 3300013307 Ga0157372_10166061 Ga0157372_101660613 258
276 3300013308 Ga0157375_10009765 Ga0157375_100097655 258
277 3300013308 Ga0157375_10031208 Ga0157375_100312084 258
278 3300013308 Ga0157375_10031973 Ga0157375_100319736 258
279 3300013308 Ga0157375_10086108 Ga0157375_100861085 258
280 3300014325 Ga0163163_10102754 Ga0163163_101027544 258
281 3300014326 Ga0157380_10024990 Ga0157380_100249902 258
282 3300014326 Ga0157380_10025167 Ga0157380_100251673 258
283 3300014326 Ga0157380_10571946 Ga0157380_105719462 258
284 3300014968 Ga0157379_10039972 Ga0157379_100399724 258
285 3300014968 Ga0157379_10072147 Ga0157379_100721472 258
286 3300014968 Ga0157379_10259954 Ga0157379_102599542 258
287 3300014968 Ga0157379_10295214 Ga0157379_102952142 258
288 3300014968 Ga0157379_10502082 Ga0157379_105020822 258
289 3300014969 Ga0157376_10018675 Ga0157376_100186755 258
290 3300014969 Ga0157376_10205952 Ga0157376_102059522 258
291 3300017792 Ga0163161_10029151 Ga0163161_100291514 258
292 3300017792 Ga0163161_10099446 Ga0163161_100994462 258
293 3300017792 Ga0163161_10206411 Ga0163161_102064111 258
294 3300025242 Ga0209258_100074 Ga0209258_10007436 258
295 3300025256 Ga0209759_1000521 Ga0209759_100052128 258
296 3300025261 Ga0209233_1010646 Ga0209233_10106462 258
297 3300025272 Ga0209455_1000066 Ga0209455_100006676 258
298 3300025292 Ga0209676_1014399 Ga0209676_10143994 258
299 3300025304 Ga0209257_1023440 Ga0209257_10234403 258
300 3300025321 Ga0207656_10018987 Ga0207656_100189874 258
301 3300025321 Ga0207656_10062067 Ga0207656_100620672 258
302 3300025893 Ga0207682_10001514 Ga0207682_100015145 258
303 3300025893 Ga0207682_10025440 Ga0207682_100254403 258
304 3300025893 Ga0207682_10074879 Ga0207682_100748792 258
305 3300025893 Ga0207682_10077183 Ga0207682_100771832 258
306 3300025899 Ga0207642_10116266 Ga0207642_101162662 258
307 3300025901 Ga0207688_10024772 Ga0207688_100247723 258
308 3300025901 Ga0207688_10074441 Ga0207688_100744412 258
309 3300025901 Ga0207688_10120427 Ga0207688_101204271 258
310 3300025903 Ga0207680_10039133 Ga0207680_100391334 258
311 3300025903 Ga0207680_10160718 Ga0207680_101607182 258
312 3300025907 Ga0207645_10003747 Ga0207645_100037472 258
313 3300025907 Ga0207645_10009087 Ga0207645_100090875 258
314 3300025907 Ga0207645_10009373 Ga0207645_100093734 258
315 3300025907 Ga0207645_10057735 Ga0207645_100577352 258
316 3300025907 Ga0207645_10157225 Ga0207645_101572252 258
317 3300025907 Ga0207645_10392791 Ga0207645_103927911 258
318 3300025908 Ga0207643_10013001 Ga0207643_100130014 258
319 3300025908 Ga0207643_10052954 Ga0207643_100529542 258
320 3300025909 Ga0207705_10120206 Ga0207705_101202062 258
321 3300025910 Ga0207684_10007765 Ga0207684_100077657 258
322 3300025911 Ga0207654_10226755 Ga0207654_102267552 258
323 3300025913 Ga0207695_10066130 Ga0207695_100661304 258
324 3300025913 Ga0207695_10115948 Ga0207695_101159481 258
325 3300025913 Ga0207695_10231218 Ga0207695_102312182 258
326 3300025913 Ga0207695_10390665 Ga0207695_103906651 258
327 3300025914 Ga0207671_10107160 Ga0207671_101071602 258
328 3300025918 Ga0207662_10007584 Ga0207662_100075845 258
329 3300025918 Ga0207662_10037414 Ga0207662_100374143 258
330 3300025919 Ga0207657_10035844 Ga0207657_100358444 258
331 3300025919 Ga0207657_10124336 Ga0207657_101243362 258
332 3300025919 Ga0207657_10426487 Ga0207657_104264871 258
333 3300025919 Ga0207657_10520161 Ga0207657_105201612 258
334 3300025922 Ga0207646_10052001 Ga0207646_100520012 258
335 3300025923 Ga0207681_10004549 Ga0207681_100045495 258
336 3300025923 Ga0207681_10005781 Ga0207681_100057819 258
337 3300025923 Ga0207681_10097234 Ga0207681_100972342 258
338 3300025923 Ga0207681_10114053 Ga0207681_101140533 258
339 3300025924 Ga0207694_10015728 Ga0207694_100157286 258
340 3300025924 Ga0207694_10024397 Ga0207694_100243974 258
341 3300025924 Ga0207694_10067557 Ga0207694_100675573 258
342 3300025924 Ga0207694_10070653 Ga0207694_100706533 258
343 3300025925 Ga0207650_10001113 Ga0207650_1000111316 258
344 3300025925 Ga0207650_10002251 Ga0207650_1000225112 258
345 3300025925 Ga0207650_10036670 Ga0207650_100366702 258
346 3300025925 Ga0207650_10039567 Ga0207650_100395674 258
347 3300025925 Ga0207650_10248264 Ga0207650_102482642 258
348 3300025925 Ga0207650_10760369 Ga0207650_107603691 258
349 3300025926 Ga0207659_10000343 Ga0207659_1000034321 258
350 3300025926 Ga0207659_10013872 Ga0207659_100138724 258
351 3300025926 Ga0207659_10070005 Ga0207659_100700052 258
352 3300025926 Ga0207659_10198310 Ga0207659_101983102 258
353 3300025927 Ga0207687_10045643 Ga0207687_100456433 258
354 3300025927 Ga0207687_10083313 Ga0207687_100833133 258
355 3300025931 Ga0207644_10007907 Ga0207644_100079072 258
356 3300025931 Ga0207644_10023290 Ga0207644_100232902 258
357 3300025931 Ga0207644_10047903 Ga0207644_100479032 258
358 3300025931 Ga0207644_10328817 Ga0207644_103288172 258
359 3300025932 Ga0207690_10012761 Ga0207690_100127613 258
360 3300025932 Ga0207690_10137342 Ga0207690_101373422 258
361 3300025933 Ga0207706_10000280 Ga0207706_1000028019 258
362 3300025933 Ga0207706_10064403 Ga0207706_100644034 258
363 3300025933 Ga0207706_10152553 Ga0207706_101525532 258
364 3300025934 Ga0207686_10014281 Ga0207686_100142815 258
365 3300025934 Ga0207686_10278569 Ga0207686_102785692 258
366 3300025935 Ga0207709_10003697 Ga0207709_100036977 258
367 3300025935 Ga0207709_10124780 Ga0207709_101247802 258
368 3300025936 Ga0207670_10377052 Ga0207670_103770522 258
369 3300025937 Ga0207669_10005448 Ga0207669_100054484 258
370 3300025937 Ga0207669_10008481 Ga0207669_100084812 258
371 3300025938 Ga0207704_10048342 Ga0207704_100483423 258
372 3300025938 Ga0207704_10052070 Ga0207704_100520702 258
373 3300025938 Ga0207704_10068096 Ga0207704_100680962 258
374 3300025938 Ga0207704_10111232 Ga0207704_101112322 258
375 3300025938 Ga0207704_10470769 Ga0207704_104707692 258
376 3300025939 Ga0207665_10065691 Ga0207665_100656912 258
377 3300025940 Ga0207691_10002193 Ga0207691_1000219314 258
378 3300025940 Ga0207691_10002225 Ga0207691_100022259 258
379 3300025940 Ga0207691_10016300 Ga0207691_100163006 258
380 3300025940 Ga0207691_10037681 Ga0207691_100376812 258
381 3300025940 Ga0207691_10072777 Ga0207691_100727773 258
382 3300025940 Ga0207691_10106410 Ga0207691_101064102 258
383 3300025940 Ga0207691_10129600 Ga0207691_101296003 258
384 3300025940 Ga0207691_10162598 Ga0207691_101625982 258
385 3300025940 Ga0207691_10235009 Ga0207691_102350092 258
386 3300025940 Ga0207691_10410994 Ga0207691_104109942 258
387 3300025941 Ga0207711_10127809 Ga0207711_101278092 258
388 3300025941 Ga0207711_10169205 Ga0207711_101692052 258
389 3300025941 Ga0207711_10180997 Ga0207711_101809972 258
390 3300025941 Ga0207711_10185967 Ga0207711_101859672 258
391 3300025941 Ga0207711_10258323 Ga0207711_102583232 258
392 3300025942 Ga0207689_10002313 Ga0207689_100023134 258
393 3300025942 Ga0207689_10015369 Ga0207689_100153692 258
394 3300025942 Ga0207689_10025978 Ga0207689_100259784 258
395 3300025942 Ga0207689_10052967 Ga0207689_100529672 258
396 3300025944 Ga0207661_10083500 Ga0207661_100835003 258
397 3300025949 Ga0207667_10078147 Ga0207667_100781472 258
398 3300025949 Ga0207667_10109268 Ga0207667_101092682 258
399 3300025960 Ga0207651_10000137 Ga0207651_1000013713 258
400 3300025960 Ga0207651_10012704 Ga0207651_100127043 258
401 3300025960 Ga0207651_10036963 Ga0207651_100369635 258
402 3300025960 Ga0207651_10058499 Ga0207651_100584992 258
403 3300025960 Ga0207651_10242319 Ga0207651_102423192 258
404 3300025960 Ga0207651_10270130 Ga0207651_102701302 258
405 3300025960 Ga0207651_10300043 Ga0207651_103000432 258
406 3300025961 Ga0207712_10067513 Ga0207712_100675133 258
407 3300025961 Ga0207712_10220600 Ga0207712_102206002 258
408 3300025972 Ga0207668_10005664 Ga0207668_100056645 258
409 3300025972 Ga0207668_10235927 Ga0207668_102359272 258
410 3300025981 Ga0207640_10005332 Ga0207640_100053322 258
411 3300025981 Ga0207640_10064401 Ga0207640_100644013 258
412 3300025981 Ga0207640_10136324 Ga0207640_101363242 258
413 3300025981 Ga0207640_10241861 Ga0207640_102418612 258
414 3300025981 Ga0207640_10305582 Ga0207640_103055822 258
415 3300025986 Ga0207658_10000459 Ga0207658_100004592 258
416 3300025986 Ga0207658_10084597 Ga0207658_100845972 258
417 3300025986 Ga0207658_10174581 Ga0207658_101745813 258
418 3300026023 Ga0207677_10007955 Ga0207677_100079554 258
419 3300026023 Ga0207677_10140814 Ga0207677_101408143 258
420 3300026035 Ga0207703_10012174 Ga0207703_100121745 258
421 3300026035 Ga0207703_10021603 Ga0207703_100216034 258
422 3300026041 Ga0207639_10002665 Ga0207639_100026653 258
423 3300026041 Ga0207639_10055949 Ga0207639_100559492 258
424 3300026041 Ga0207639_10182026 Ga0207639_101820263 258
425 3300026041 Ga0207639_10291334 Ga0207639_102913341 258
426 3300026041 Ga0207639_10362244 Ga0207639_103622442 258
427 3300026067 Ga0207678_10099510 Ga0207678_100995101 258
428 3300026067 Ga0207678_10115586 Ga0207678_101155862 258
429 3300026075 Ga0207708_10416854 Ga0207708_104168541 258
430 3300026078 Ga0207702_10040642 Ga0207702_100406423 258
431 3300026078 Ga0207702_10299801 Ga0207702_102998012 258
432 3300026078 Ga0207702_10461271 Ga0207702_104612712 258
433 3300026088 Ga0207641_10008170 Ga0207641_100081705 258
434 3300026088 Ga0207641_10033206 Ga0207641_100332063 258
435 3300026088 Ga0207641_10151573 Ga0207641_101515732 258
436 3300026088 Ga0207641_10256236 Ga0207641_102562362 258
437 3300026089 Ga0207648_10000878 Ga0207648_1000087816 258
438 3300026089 Ga0207648_10007913 Ga0207648_100079134 258
439 3300026089 Ga0207648_10010992 Ga0207648_100109925 258
440 3300026089 Ga0207648_10034718 Ga0207648_100347182 258
441 3300026089 Ga0207648_10075011 Ga0207648_100750113 258
442 3300026089 Ga0207648_10104646 Ga0207648_101046462 258
443 3300026089 Ga0207648_10131009 Ga0207648_101310092 258
444 3300026095 Ga0207676_10009121 Ga0207676_100091214 258
445 3300026095 Ga0207676_10010157 Ga0207676_100101577 258
446 3300026095 Ga0207676_10041155 Ga0207676_100411552 258
447 3300026095 Ga0207676_10105478 Ga0207676_101054781 258
448 3300026095 Ga0207676_10226519 Ga0207676_102265192 258
449 3300026095 Ga0207676_10261380 Ga0207676_102613802 258
450 3300026116 Ga0207674_10015428 Ga0207674_100154283 258
451 3300026116 Ga0207674_10053226 Ga0207674_100532264 258
452 3300026118 Ga0207675_100005117 Ga0207675_1000051174 258
453 3300026118 Ga0207675_100059251 Ga0207675_1000592513 258
454 3300026118 Ga0207675_100166081 Ga0207675_1001660812 258
455 3300026121 Ga0207683_10012895 Ga0207683_100128955 258
456 3300026121 Ga0207683_10026507 Ga0207683_100265077 258
457 3300026121 Ga0207683_10303248 Ga0207683_103032482 258
458 3300026121 Ga0207683_10559139 Ga0207683_105591392 258
459 3300026142 Ga0207698_10028871 Ga0207698_100288712 258
460 3300026142 Ga0207698_10030460 Ga0207698_100304602 258
461 3300026142 Ga0207698_10034956 Ga0207698_100349563 258
462 3300026142 Ga0207698_10451857 Ga0207698_104518571 258
463 3300027312 Ga0209371_1023392 Ga0209371_10233922 258
464 3300027671 Ga0209588_1048046 Ga0209588_10480462 258
465 3300028016 Ga0265354_1002352 Ga0265354_10023523 258
466 3300028379 Ga0268266_10098696 Ga0268266_100986963 258
467 3300028379 Ga0268266_10873387 Ga0268266_108733871 258
468 3300028380 Ga0268265_10030187 Ga0268265_100301871 258
469 3300028380 Ga0268265_10040482 Ga0268265_100404824 258
470 3300028381 Ga0268264_10015847 Ga0268264_100158475 258
471 3300028381 Ga0268264_10072826 Ga0268264_100728261 258
472 3300028573 Ga0265334_10001873 Ga0265334_100018731 258
473 3300028786 Ga0307517_10000131 Ga0307517_1000013143 258
474 3300028794 Ga0307515_10010230 Ga0307515_1001023013 258
475 3300028794 Ga0307515_10016716 Ga0307515_1001671612 258
476 3300028794 Ga0307515_10045865 Ga0307515_100458651 258
477 3300030500 Ga0268256_1026586 Ga0268256_10265862 258
478 3300030522 Ga0307512_10014097 Ga0307512_100140977 258
479 3300030522 Ga0307512_10077087 Ga0307512_100770873 258
480 3300031090 Ga0265760_10000144 Ga0265760_100001445 258
481 3300031251 Ga0265327_10012683 Ga0265327_100126832 258
482 3300031507 Ga0307509_10002009 Ga0307509_100020096 258
483 3300031507 Ga0307509_10003678 Ga0307509_1000367818 258
484 3300031507 Ga0307509_10004862 Ga0307509_1000486218 258
485 3300031507 Ga0307509_10044590 Ga0307509_100445903 258
486 3300031548 Ga0307408_100017706 Ga0307408_1000177063 258
487 3300031548 Ga0307408_100167002 Ga0307408_1001670022 258
488 3300031548 Ga0307408_100215769 Ga0307408_1002157692 258
489 3300031616 Ga0307508_10002648 Ga0307508_100026487 258
490 3300031616 Ga0307508_10082842 Ga0307508_100828422 258
491 3300031649 Ga0307514_10026868 Ga0307514_100268684 258
492 3300031649 Ga0307514_10091098 Ga0307514_100910983 258
493 3300031730 Ga0307516_10000148 Ga0307516_1000014861 258
494 3300031730 Ga0307516_10000244 Ga0307516_100002445 258
495 3300031730 Ga0307516_10000419 Ga0307516_1000041926 258
496 3300031730 Ga0307516_10141850 Ga0307516_101418502 258
497 3300031730 Ga0307516_10252142 Ga0307516_102521422 258
498 3300031730 Ga0307516_10295794 Ga0307516_102957942 258
499 3300031731 Ga0307405_10408028 Ga0307405_104080282 258
500 3300031824 Ga0307413_10000991 Ga0307413_100009915 258
501 3300031824 Ga0307413_10102515 Ga0307413_101025152 258
502 3300031852 Ga0307410_10016802 Ga0307410_100168021 258
503 3300031852 Ga0307410_10370898 Ga0307410_103708981 258
504 3300031852 Ga0307410_10512792 Ga0307410_105127921 258
505 3300031901 Ga0307406_10013821 Ga0307406_100138213 258
506 3300031901 Ga0307406_10025879 Ga0307406_100258793 258
507 3300031903 Ga0307407_10215087 Ga0307407_102150872 258
508 3300031903 Ga0307407_10406174 Ga0307407_104061741 258
509 3300031911 Ga0307412_10001535 Ga0307412_1000153511 258
510 3300031911 Ga0307412_10008145 Ga0307412_100081458 258
511 3300031995 Ga0307409_100008870 Ga0307409_1000088704 258
512 3300031995 Ga0307409_100008875 Ga0307409_1000088758 258
513 3300031995 Ga0307409_100318569 Ga0307409_1003185692 258
514 3300032002 Ga0307416_100039771 Ga0307416_1000397714 258
515 3300032002 Ga0307416_100299941 Ga0307416_1002999412 258
516 3300032002 Ga0307416_100787306 Ga0307416_1007873062 258
517 3300032004 Ga0307414_10053015 Ga0307414_100530152 258
518 3300032004 Ga0307414_10065461 Ga0307414_100654613 258
519 3300032005 Ga0307411_10010745 Ga0307411_100107453 258
520 3300032126 Ga0307415_100020682 Ga0307415_1000206824 258
521 3300033179 Ga0307507_10047402 Ga0307507_100474024 258
522 3300033180 Ga0307510_10005846 Ga0307510_1000584612 258
523 3300033180 Ga0307510_10026370 Ga0307510_100263707 258
524 3300033180 Ga0307510_10040673 Ga0307510_100406735 258
525 3300033180 Ga0307510_10180482 Ga0307510_101804822 258
526 3300034957 Ga0373938_0017392 Ga0373938_0017392_617_1393 258
527 3300035084 Ga0373928_0013521 Ga0373928_0013521_576_1352 258
528 3300035112 Ga0373932_0032723 Ga0373932_0032723_636_1412 258
529 3300035115 Ga0373941_0125815 Ga0373941_0125815_125_901 258
530 3300035121 Ga0373960_0011567 Ga0373960_0011567_1225_2001 258
531 3300035170 Ga0373943_0032411 Ga0373943_0032411_1508_2284 258
532 3300035171 Ga0373946_0203928 Ga0373946_0203928_35_811 258
533 3300035172 Ga0373955_0122582 Ga0373955_0122582_186_962 258
534 3300035410 Ga0373924_0010107 Ga0373924_0010107_1435_2211 258
535 3300035410 Ga0373924_0119360 Ga0373924_0119360_353_1129 258
536 3300035691 Ga0373931_0018291 Ga0373931_0018291_221_997 258
537 3300035691 Ga0373931_0026635 Ga0373931_0026635_568_1344 258
538 3300036401 Ga0373937_0028375 Ga0373937_0028375_3239_4015 258
539 3300037068 Ga0373925_0085409 Ga0373925_0085409_910_1686 258
540 3300037312 Ga0395899_0081098 Ga0395899_0081098_1313_2089 258
541 3300037418 Ga0395900_0000025 Ga0395900_0000025_199745_200521 258
542 3300037466 Ga0395898_0000893 Ga0395898_0000893_33382_34158 258
543 3300037466 Ga0395898_0202985 Ga0395898_0202985_210_986 258
544 3300037471 Ga0395905_0000329 Ga0395905_0000329_37715_38491 258
545 3300037471 Ga0395905_0006586 Ga0395905_0006586_10493_11269 258
546 3300038443 Ga0395901_0144709 Ga0395901_0144709_907_1689 258
547 3300039437 Ga0436365_0217206 Ga0436365_0217206_452_1228 258
548 3300039437 Ga0436365_1681085 Ga0436365_1681085_303_1079 258
549 3300039447 Ga0436361_0147510 Ga0436361_0147510_24253_25029 258
550 3300039447 Ga0436361_0795551 Ga0436361_0795551_233_1009 258
551 3300039450 Ga0436363_0285956 Ga0436363_0285956_637_1413 258
552 3300041404 Ga0439436_0059487 Ga0439436_0059487_235_1011 258
553 3300041491 Ga0451833_0953641 Ga0451833_0953641_811_1587 258
554 3300041509 Ga0451843_1226642 Ga0451843_1226642_146_922 258
555 3300041512 Ga0451853_2678590 Ga0451853_2678590_640_1416 258
556 3300042123 Ga0450921_006991 Ga0450921_006991_70_846 258
557 3300042439 Ga0439464_0017741 Ga0439464_0017741_1065_1841 258
558 3300044656 Ga0466969_0000830 Ga0466969_0000830_11855_12631 258
559 3300044673 Ga0453683_0048715 Ga0453683_0048715_1097_1873 258
560 3300044673 Ga0453683_0146552 Ga0453683_0146552_222_998 258
561 3300044673 Ga0453683_0204192 Ga0453683_0204192_81_857 258
562 3300044683 Ga0466965_0070443 Ga0466965_0070443_251_1030 258
563 3300044684 Ga0466966_0040681 Ga0466966_0040681_1435_2211 258
564 3300044693 Ga0466961_0008582 Ga0466961_0008582_2922_3698 258
565 3300044712 Ga0453684_0058655 Ga0453684_0058655_605_1381 258
566 3300044712 Ga0453684_1099214 Ga0453684_1099214_44_820 258
567 3300044765 Ga0466970_0140522 Ga0466970_0140522_232_1011 258
568 3300045049 Ga0466959_0042728 Ga0466959_0042728_336_1112 258
569 3300045051 Ga0451576_0000535 Ga0451576_0000535_15278_16054 258
570 3300045051 Ga0451576_0064872 Ga0451576_0064872_1180_1956 258
571 3300045051 Ga0451576_0315486 Ga0451576_0315486_543_1322 258
572 3300045976 Ga0466967_0389845 Ga0466967_0389845_178_966 258
573 3300046454 Ga0495592_0000394 Ga0495592_0000394_16833_17609 258
574 3300046457 Ga0495590_0020399 Ga0495590_0020399_1137_1913 258
575 3300046472 Ga0495580_0110854 Ga0495580_0110854_762_1538 258
576 3300046472 Ga0495580_0180961 Ga0495580_0180961_316_1092 258
577 3300046474 Ga0495605_0057705 Ga0495605_0057705_47_823 258
578 3300046517 Ga0495630_0486680 Ga0495630_0486680_11_787 258
579 3300046519 Ga0495632_0067443 Ga0495632_0067443_485_1261 258
580 3300046530 Ga0495654_0060464 Ga0495654_0060464_452_1228 258
581 3300046536 Ga0495587_0173272 Ga0495587_0173272_202_978 258
582 3300046537 Ga0495598_0079438 Ga0495598_0079438_246_1022 258
583 3300046539 Ga0495621_0185404 Ga0495621_0185404_15_791 258
584 3300046543 Ga0495645_0043051 Ga0495645_0043051_1447_2223 258
585 3300046616 Ga0495668_0063228 Ga0495668_0063228_588_1364 258
586 3300046642 Ga0495634_0106617 Ga0495634_0106617_76_852 258
587 3300046663 Ga0495635_0234220 Ga0495635_0234220_23_799 258
588 3300046683 Ga0495658_0019632 Ga0495658_0019632_1243_2019 258
589 3300046683 Ga0495658_0209140 Ga0495658_0209140_49_825 258
590 3300046690 Ga0495624_0049046 Ga0495624_0049046_1277_2053 258
591 3300046694 Ga0495649_0004358 Ga0495649_0004358_967_1743 258
592 3300047320 Ga0495672_0000459 Ga0495672_0000459_20067_20891 258
593 3300047321 Ga0495676_0149538 Ga0495676_0149538_580_1356 258
594 3300047443 Ga0495687_002007 Ga0495687_002007_3182_3958 258
595 3300047471 Ga0495684_0090083 Ga0495684_0090083_208_984 258
596 3300047472 Ga0495686_0002603 Ga0495686_0002603_14882_15658 258
597 3300047673 Ga0495593_0108019 Ga0495593_0108019_162_938 258
598 3300048091 Ga0495626_0104005 Ga0495626_0104005_264_1040 258
599 3300048904 Ga0496101_0308915 Ga0496101_0308915_55_831 258
600 3300048905 Ga0496102_0021356 Ga0496102_0021356_1429_2205 258
601 3300048907 Ga0496104_0850407 Ga0496104_0850407_12_788 258
602 3300048908 Ga0496105_0035474 Ga0496105_0035474_1101_1877 258
603 3300048910 Ga0496107_0008694 Ga0496107_0008694_3454_4230 258
604 3300048911 Ga0496108_0037639 Ga0496108_0037639_2140_2916 258
605 3300048912 Ga0496109_0065263 Ga0496109_0065263_1236_2012 258
606 3300048912 Ga0496109_0535054 Ga0496109_0535054_305_1081 258
607 3300048913 Ga0496110_0094193 Ga0496110_0094193_1047_1823 258
608 3300048913 Ga0496110_0112180 Ga0496110_0112180_1658_2434 258
609 3300048914 Ga0496111_0040071 Ga0496111_0040071_938_1714 258
610 3300048917 Ga0496114_0104997 Ga0496114_0104997_723_1499 258
611 3300048918 Ga0496115_0026217 Ga0496115_0026217_3453_4229 258
612 3300048919 Ga0496116_0005768 Ga0496116_0005768_9615_10391 258
613 3300048920 Ga0496117_0073829 Ga0496117_0073829_632_1408 258
614 3300048921 Ga0496118_0043390 Ga0496118_0043390_2568_3344 258
615 3300048922 Ga0496119_0015034 Ga0496119_0015034_3760_4536 258
616 3300048923 Ga0496120_0071246 Ga0496120_0071246_343_1119 258
617 3300048924 Ga0496121_0000200 Ga0496121_0000200_32775_33551 258
618 3300048924 Ga0496121_0017358 Ga0496121_0017358_4925_5701 258
619 3300048925 Ga0496122_0000021 Ga0496122_0000021_110013_110789 258
620 3300048925 Ga0496122_0037277 Ga0496122_0037277_2908_3684 258
621 3300048926 Ga0496123_0000382 Ga0496123_0000382_56131_56907 258
622 3300048926 Ga0496123_0015028 Ga0496123_0015028_952_1728 258
623 3300048928 Ga0496125_0000005 Ga0496125_0000005_394158_394934 258
624 3300048928 Ga0496125_0087395 Ga0496125_0087395_1013_1789 258
625 3300048929 Ga0496126_0018419 Ga0496126_0018419_1096_1872 258
626 3300048929 Ga0496126_0080528 Ga0496126_0080528_811_1587 258
627 3300049552 Ga0501336_007437 Ga0501336_007437_12_788 258
628 3300049573 Ga0501037_0082650 Ga0501037_0082650_384_1160 258
629 3300049575 Ga0501039_0556708 Ga0501039_0556708_69_845 258
630 3300049581 Ga0501047_0003039 Ga0501047_0003039_13354_14130 258
631 3300049581 Ga0501047_0027619 Ga0501047_0027619_4413_5189 258
632 3300049581 Ga0501047_0264457 Ga0501047_0264457_88_864 258
633 3300049585 Ga0501069_0032905 Ga0501069_0032905_51_827 258
634 3300049586 Ga0501070_0019775 Ga0501070_0019775_1234_2010 258
635 3300049590 Ga0501074_0024189 Ga0501074_0024189_2184_2960 258
636 3300049650 Ga0501199_008182 Ga0501199_008182_44_820 258
637 3300049655 Ga0501208_006262 Ga0501208_006262_465_1241 258
638 3300049662 Ga0501222_009332 Ga0501222_009332_179_955 258
639 3300049663 Ga0501223_010048 Ga0501223_010048_581_1357 258
640 3300049686 Ga0501257_000018 Ga0501257_000018_45812_46588 258
641 3300049742 Ga0501080_0009668 Ga0501080_0009668_3461_4237 258
642 3300049742 Ga0501080_0059748 Ga0501080_0059748_2353_3129 258
643 3300049776 Ga0501280_013230 Ga0501280_013230_345_1121 258
644 3300049822 Ga0501035_0012342 Ga0501035_0012342_5817_6593 258
645 3300049822 Ga0501035_0032946 Ga0501035_0032946_1006_1782 258
646 3300049823 Ga0501044_0000693 Ga0501044_0000693_30306_31082 258
647 3300049823 Ga0501044_0009530 Ga0501044_0009530_2014_2790 258
648 3300049823 Ga0501044_0010994 Ga0501044_0010994_1264_2040 258
649 3300049823 Ga0501044_0013382 Ga0501044_0013382_3229_4005 258
650 3300050489 nmdc:mga03683_75355_c1 nmdc:mga03683_75355_c1_315_1091 258
651 3300050491 nmdc:mga00v17_83071_c1 nmdc:mga00v17_83071_c1_715_1491 258
652 3300050491 nmdc:mga00v17_8686_c1 nmdc:mga00v17_8686_c1_3163_3939 258
653 3300050493 nmdc:mga0k408_119151_c1 nmdc:mga0k408_119151_c1_775_1551 258
654 3300050493 nmdc:mga0k408_124822_c1 nmdc:mga0k408_124822_c1_352_1128 258
655 3300050493 nmdc:mga0k408_15878_c1 nmdc:mga0k408_15878_c1_3008_3784 258
656 3300050493 nmdc:mga0k408_19076_c1 nmdc:mga0k408_19076_c1_50_826 258
657 3300050493 nmdc:mga0k408_200409_c1 nmdc:mga0k408_200409_c1_372_1148 258
658 3300050493 nmdc:mga0k408_25901_c1 nmdc:mga0k408_25901_c1_629_1405 258
659 3300050493 nmdc:mga0k408_3369_c1 nmdc:mga0k408_3369_c1_7274_8050 258
660 3300050494 nmdc:mga06z11_4534_c1 nmdc:mga06z11_4534_c1_3419_4195 258
661 3300050496 nmdc:mga07m45_61534_c1 nmdc:mga07m45_61534_c1_82_858 258
662 3300050496 nmdc:mga07m45_6946_c1 nmdc:mga07m45_6946_c1_3880_4656 258
663 3300050496 nmdc:mga07m45_83228_c1 nmdc:mga07m45_83228_c1_891_1667 258
664 3300050496 nmdc:mga07m45_9087_c1 nmdc:mga07m45_9087_c1_2841_3617 258
665 3300053085 Ga0495619_0136408 Ga0495619_0136408_82_858 258
666 3300053085 Ga0495619_0198423 Ga0495619_0198423_137_913 258
667 3300053087 Ga0500643_003747 Ga0500643_003747_5828_6604 258
668 3300053087 Ga0500643_036839 Ga0500643_036839_298_1074 258
669 3300053093 Ga0500651_0003737 Ga0500651_0003737_2031_2807 258
670 3300053098 Ga0500650_0062862 Ga0500650_0062862_898_1674 258
671 3300053116 Ga0500592_000008 Ga0500592_000008_34456_35232 258
672 3300053118 Ga0500594_0001043 Ga0500594_0001043_1228_2004 258
673 3300053131 Ga0500652_053689 Ga0500652_053689_60_836 258
674 3300053136 Ga0500559_0000446 Ga0500559_0000446_18891_19667 258
675 3300053139 Ga0500568_0011845 Ga0500568_0011845_1418_2194 258
676 3300053151 Ga0500604_0021916 Ga0500604_0021916_620_1396 258
677 3300053156 Ga0500622_0000111 Ga0500622_0000111_73556_74332 258
678 3300053158 Ga0500627_0000055 Ga0500627_0000055_21846_22622 258
679 3300053158 Ga0500627_0176825 Ga0500627_0176825_11_787 258
680 3300053178 Ga0500637_0199804 Ga0500637_0199804_95_871 258
681 3300061719 Ga0466962_0039510 Ga0466962_0039510_1388_2164 258
682 3300005336 Ga0070680_100138924 Ga0070680_1001389242 264
683 3300005530 Ga0070679_100221626 Ga0070679_1002216262 264
684 3300025917 Ga0207660_10168998 Ga0207660_101689982 264
685 3300025921 Ga0207652_10129143 Ga0207652_101291433 264
686 3300044673 Ga0453683_0091117 Ga0453683_0091117_349_1155 264
687 3300045051 Ga0451576_0294782 Ga0451576_0294782_219_1025 264
688 3300005347 Ga0070668_100246096 Ga0070668_1002460962 267
689 3300042533 Ga0450901_004161 Ga0450901_004161_20_832 267
690 3300003320 rootH2_10090637 rootH2_100906372 269
691 3300005293 Ga0065715_10245837 Ga0065715_102458371 269
692 3300005333 Ga0070677_10022737 Ga0070677_100227373 269
693 3300005335 Ga0070666_10004510 Ga0070666_100045103 269
694 3300005338 Ga0068868_100001176 Ga0068868_10000117610 269
695 3300005340 Ga0070689_100028096 Ga0070689_1000280963 269
696 3300005355 Ga0070671_100005572 Ga0070671_1000055722 269
697 3300005364 Ga0070673_100001085 Ga0070673_1000010859 269
698 3300005367 Ga0070667_100017115 Ga0070667_1000171154 269
699 3300005457 Ga0070662_100058856 Ga0070662_1000588562 269
700 3300005543 Ga0070672_100016750 Ga0070672_1000167503 269
701 3300005616 Ga0068852_100095506 Ga0068852_1000955062 269
702 3300005617 Ga0068859_100204543 Ga0068859_1002045432 269
703 3300005618 Ga0068864_100000813 Ga0068864_10000081316 269
704 3300005719 Ga0068861_100111348 Ga0068861_1001113481 269
705 3300005842 Ga0068858_100002966 Ga0068858_10000296612 269
706 3300005843 Ga0068860_100134642 Ga0068860_1001346422 269
707 3300006237 Ga0097621_100015735 Ga0097621_1000157352 269
708 3300006931 Ga0097620_100204547 Ga0097620_1002045472 269
709 3300009177 Ga0105248_10090533 Ga0105248_100905333 269
710 3300013297 Ga0157378_10118853 Ga0157378_101188533 269
711 3300013306 Ga0163162_10022095 Ga0163162_100220953 269
712 3300013308 Ga0157375_10008196 Ga0157375_100081967 269
713 3300014325 Ga0163163_10007916 Ga0163163_100079165 269
714 3300014968 Ga0157379_10011793 Ga0157379_100117932 269
715 3300017792 Ga0163161_10108763 Ga0163161_101087632 269
716 3300025899 Ga0207642_10147436 Ga0207642_101474362 269
717 3300025903 Ga0207680_10002999 Ga0207680_100029993 269
718 3300025907 Ga0207645_10090512 Ga0207645_100905122 269
719 3300025908 Ga0207643_10031440 Ga0207643_100314402 269
720 3300025925 Ga0207650_10053612 Ga0207650_100536122 269
721 3300025926 Ga0207659_10000773 Ga0207659_100007739 269
722 3300025931 Ga0207644_10038493 Ga0207644_100384933 269
723 3300025936 Ga0207670_10028602 Ga0207670_100286023 269
724 3300025940 Ga0207691_10017159 Ga0207691_100171593 269
725 3300025960 Ga0207651_10000467 Ga0207651_100004675 269
726 3300025986 Ga0207658_10008081 Ga0207658_100080814 269
727 3300026023 Ga0207677_10001138 Ga0207677_100011382 269
728 3300026035 Ga0207703_10002051 Ga0207703_100020518 269
729 3300026088 Ga0207641_10006901 Ga0207641_100069016 269
730 3300026089 Ga0207648_10307154 Ga0207648_103071541 269
731 3300026095 Ga0207676_10003213 Ga0207676_100032133 269
732 3300026118 Ga0207675_100047083 Ga0207675_1000470831 269
733 3300026121 Ga0207683_10006134 Ga0207683_100061344 269
734 3300028381 Ga0268264_10122723 Ga0268264_101227233 269
735 3300046525 Ga0495663_0000523 Ga0495663_0000523_6554_7405 269
736 3300046558 Ga0495633_0001633 Ga0495633_0001633_10020_10871 269
737 3300048911 Ga0496108_0108971 Ga0496108_0108971_1035_1880 269
738 3300048913 Ga0496110_0149400 Ga0496110_0149400_1242_2087 269
739 iso_pu_bacteria 2599185292 2599902274 269
740 iso_pu_bacteria 2808606395 2809036280 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00970

FAD_binding_6

Oxidoreductase FAD-binding domain

42

134

0.84

PF00175

NAD_binding_1

Oxidoreductase NAD-binding domain

146

264

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5thx-assembly1.cif.gz_A crystal structure of a ferredoxin nadp+ reductase from neisseria gonorrhoeae with bound nadp and fad 0.9816 13 269
1a8p-assembly1.cif.gz_A ferredoxin reductase from azotobacter vinelandii 0.9793 14 269
2qdx-assembly1.cif.gz_A p.aeruginosa fpr with fad 0.9789 14 269
4b4d-assembly1.cif.gz_A-2 crystal structure of fad-containing ferredoxin-nadp reductase from xanthomonas axonopodis pv. citri 0.9786 14 269
5thx-assembly1.cif.gz_A crystal structure of a ferredoxin nadp+ reductase from neisseria gonorrhoeae with bound nadp and fad 0.9778 13 269
ID Description Score Start End Superfamily
1a8pA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9888 14 107 2.40.30.10
5ufaC01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9785 13 107 2.40.30.10
2bgjA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9733 20 102 2.40.30.10
1a8pA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9684 14 107 2.40.30.10
1fdrA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9612 15 108 2.40.30.10
ID Description Score Start End GO Terms
AF-A0A1Y6CY59-F1-model_v4 Ferredoxin--NADP+ reductase 0.9983 18 88 GO:0034599
GO:0042167
AF-A0A848QHK4-F1-model_v4 deleted 0.9961 14 211
AF-A0A496WGZ5-F1-model_v4 Ferredoxin--NADP reductase 0.9951 23 119 GO:0016491
GO:0034599
GO:0042167
AF-Q8KT46-F1-model_v4 Catechol 1,2-dioxygenase 0.9916 147 249 GO:0034599
GO:0042167
GO:0051213
AF-A0A1Z1F890-F1-model_v4 ferredoxin--NADP(+) reductase (EC 1.18.1.2) 0.9841 15 269 GO:0000166
GO:0004324
GO:0034599
GO:0042167

Feature Viewer

pLDDT pTM Quality
91.94 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map