F478507
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 740 | 354 | 716 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100138924|Ga0070680_1001389242 |
| Length | 292 |
| Sequence | MTGEGERARASRSPRAFRRPVRSTGNDPGTTTALMAAYDTQKVLTVHHWNESLFTFTCTRGKSLRFESGHFVMVGILVDGKPLMRAYSIASAHYEEHLEFFSIKVPNGPLTSRLQHIRVGEEVLVGNKPTGTLVLTDLLPGRFLYLFATGTGLAPFMSIIRDPDTYERFEKIVLVHGVRKVDELAYADLIAHDLPRHDHLGEQVREQLVYYPTVTREPFRNQGRLPDLIANGKLCSDIGFPQIDPKHDRAMICGGPAMLKDMRTILDGAGFRISAGVGQAGDYVIERAFVEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 2 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 3 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 4 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 5 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 6 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 7 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 8 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 9 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 10 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 11 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 12 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 13 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 14 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 15 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 16 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 17 | 2941479691 | |||
| 18 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 21 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 89 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 187 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 190 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 191 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 193 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 197 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 205 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 206 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 209 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 211 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 212 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 213 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 214 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 216 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 217 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 218 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 219 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 220 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 221 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 222 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 223 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 224 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 243 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 244 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 245 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 246 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 247 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 248 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 249 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 250 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 251 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 252 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 253 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 254 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 255 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 258 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 261 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 290 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 291 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 292 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 295 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 296 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 297 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 298 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 299 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 300 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 301 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 302 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 303 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 304 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 305 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 306 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 307 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 308 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 309 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 321 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 322 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 323 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 325 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 328 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 331 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 332 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 333 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 335 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 337 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 338 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 339 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 340 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 341 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 342 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 343 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 344 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 345 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 346 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 348 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 350 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 351 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 352 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 353 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 354 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.35 |
| Metatranscriptomes | 0.41 |
| Isolates | 3.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.14 |
| Bulb | 0 |
| Endosphere | 6.76 |
| Nodule | 0.41 |
| Rhizoplane | 2.16 |
| Rhizosphere | 81.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10090637 | 3300003320 | Bacteria | 3703 |
| 2 | rootH2_10265435 | 3300003320 | Bacteria | 3217 |
| 3 | rootH1_10007832 | 3300003323 | Bacteria | 40222 |
| 4 | rootH1_10013353 | 3300003323 | Bacteria | 23546 |
| 5 | Ga0006562J51391_1031350 | 3300003578 | Bacteria | 1180 |
| 6 | Ga0055535_1000326 | 3300003761 | Bacteria | 48157 |
| 7 | Ga0055529_1000053 | 3300003763 | Bacteria | 198996 |
| 8 | Ga0065715_10108371 | 3300005293 | Bacteria | 2722 |
| 9 | Ga0065715_10245837 | 3300005293 | Bacteria | 1183 |
| 10 | Ga0065707_10081888 | 3300005295 | Bacteria | 31190 |
| 11 | Ga0070676_10011536 | 3300005328 | Bacteria | 4806 |
| 12 | Ga0070676_10011678 | 3300005328 | Bacteria | 4780 |
| 13 | Ga0070676_10018496 | 3300005328 | Bacteria | 3863 |
| 14 | Ga0070683_100161729 | 3300005329 | Bacteria | 2124 |
| 15 | Ga0070690_100146050 | 3300005330 | Bacteria | 1609 |
| 16 | Ga0070670_100011021 | 3300005331 | Bacteria | 7723 |
| 17 | Ga0070670_100012601 | 3300005331 | Bacteria | 7240 |
| 18 | Ga0070670_100109486 | 3300005331 | Bacteria | 2380 |
| 19 | Ga0070670_100125470 | 3300005331 | Bacteria | 2215 |
| 20 | Ga0070677_10015903 | 3300005333 | Bacteria | 2671 |
| 21 | Ga0070677_10022737 | 3300005333 | Bacteria | 2313 |
| 22 | Ga0070677_10047534 | 3300005333 | Bacteria | 1721 |
| 23 | Ga0070677_10068897 | 3300005333 | Bacteria | 1482 |
| 24 | Ga0068869_100004489 | 3300005334 | Bacteria | 8678 |
| 25 | Ga0068869_100007554 | 3300005334 | Bacteria | 6957 |
| 26 | Ga0070666_10004510 | 3300005335 | Bacteria | 8484 |
| 27 | Ga0070666_10029393 | 3300005335 | Bacteria | 3612 |
| 28 | Ga0070680_100138924 | 3300005336 | Bacteria | 2037 |
| 29 | Ga0068868_100001176 | 3300005338 | Bacteria | 17913 |
| 30 | Ga0068868_100022208 | 3300005338 | Bacteria | 4787 |
| 31 | Ga0068868_100215370 | 3300005338 | Bacteria | 1607 |
| 32 | Ga0068868_100317455 | 3300005338 | Bacteria | 1327 |
| 33 | Ga0068868_100392174 | 3300005338 | Bacteria | 1197 |
| 34 | Ga0070689_100028096 | 3300005340 | Bacteria | 4249 |
| 35 | Ga0070687_100002759 | 3300005343 | Bacteria | 6668 |
| 36 | Ga0070687_100014191 | 3300005343 | Bacteria | 3573 |
| 37 | Ga0070687_100322952 | 3300005343 | Bacteria | 987 |
| 38 | Ga0070661_100008395 | 3300005344 | Bacteria | 7137 |
| 39 | Ga0070661_100299886 | 3300005344 | Bacteria | 1251 |
| 40 | Ga0070661_100307367 | 3300005344 | Bacteria | 1235 |
| 41 | Ga0070668_100010597 | 3300005347 | Bacteria | 6855 |
| 42 | Ga0070668_100140552 | 3300005347 | Bacteria | 1945 |
| 43 | Ga0070668_100246096 | 3300005347 | Bacteria | 1483 |
| 44 | Ga0070669_100005375 | 3300005353 | Bacteria | 9243 |
| 45 | Ga0070669_100009750 | 3300005353 | Bacteria | 6839 |
| 46 | Ga0070669_100534804 | 3300005353 | Bacteria | 976 |
| 47 | Ga0070675_100013532 | 3300005354 | Bacteria | 6414 |
| 48 | Ga0070675_100043334 | 3300005354 | Bacteria | 3677 |
| 49 | Ga0070675_100046663 | 3300005354 | Bacteria | 3548 |
| 50 | Ga0070675_100109109 | 3300005354 | Bacteria | 2338 |
| 51 | Ga0070671_100000534 | 3300005355 | Bacteria | 26702 |
| 52 | Ga0070671_100005572 | 3300005355 | Bacteria | 10031 |
| 53 | Ga0070671_100039382 | 3300005355 | Bacteria | 3923 |
| 54 | Ga0070671_100040943 | 3300005355 | Bacteria | 3850 |
| 55 | Ga0070671_100273614 | 3300005355 | Bacteria | 1435 |
| 56 | Ga0070674_100002413 | 3300005356 | Bacteria | 10323 |
| 57 | Ga0070674_100004864 | 3300005356 | Bacteria | 7699 |
| 58 | Ga0070674_100014620 | 3300005356 | Bacteria | 4883 |
| 59 | Ga0070674_100119715 | 3300005356 | Bacteria | 1947 |
| 60 | Ga0070674_100184270 | 3300005356 | Bacteria | 1601 |
| 61 | Ga0070673_100000789 | 3300005364 | Bacteria | 17609 |
| 62 | Ga0070673_100001085 | 3300005364 | Bacteria | 15555 |
| 63 | Ga0070673_100006551 | 3300005364 | Bacteria | 7576 |
| 64 | Ga0070673_100028497 | 3300005364 | Bacteria | 4153 |
| 65 | Ga0070659_100007809 | 3300005366 | Bacteria | 7784 |
| 66 | Ga0070659_100038858 | 3300005366 | Bacteria | 3713 |
| 67 | Ga0070659_100039920 | 3300005366 | Bacteria | 3666 |
| 68 | Ga0070659_100404102 | 3300005366 | Bacteria | 1153 |
| 69 | Ga0070667_100017115 | 3300005367 | Bacteria | 6006 |
| 70 | Ga0070667_100029025 | 3300005367 | Bacteria | 4607 |
| 71 | Ga0070667_100096568 | 3300005367 | Bacteria | 2549 |
| 72 | Ga0070700_100372176 | 3300005441 | Bacteria | 1066 |
| 73 | Ga0070694_100090009 | 3300005444 | Bacteria | 2151 |
| 74 | Ga0070663_100023029 | 3300005455 | Bacteria | 4170 |
| 75 | Ga0070663_100136784 | 3300005455 | Bacteria | 1866 |
| 76 | Ga0070663_100263891 | 3300005455 | Bacteria | 1367 |
| 77 | Ga0070678_100030214 | 3300005456 | Bacteria | 3722 |
| 78 | Ga0070678_100244319 | 3300005456 | Bacteria | 1502 |
| 79 | Ga0070662_100001314 | 3300005457 | Bacteria | 15279 |
| 80 | Ga0070662_100003868 | 3300005457 | Bacteria | 9383 |
| 81 | Ga0070662_100015654 | 3300005457 | Bacteria | 5084 |
| 82 | Ga0070662_100040799 | 3300005457 | Bacteria | 3307 |
| 83 | Ga0070662_100058856 | 3300005457 | Bacteria | 2798 |
| 84 | Ga0070662_100133212 | 3300005457 | Bacteria | 1919 |
| 85 | Ga0070662_100309501 | 3300005457 | Bacteria | 1285 |
| 86 | Ga0070681_10010756 | 3300005458 | Bacteria | 9044 |
| 87 | Ga0070681_10180756 | 3300005458 | Bacteria | 2031 |
| 88 | Ga0068867_100004451 | 3300005459 | Bacteria | 9852 |
| 89 | Ga0068867_100024085 | 3300005459 | Bacteria | 4362 |
| 90 | Ga0070706_100002539 | 3300005467 | Bacteria | 18347 |
| 91 | Ga0070698_100161840 | 3300005471 | Bacteria | 2181 |
| 92 | Ga0070679_100025237 | 3300005530 | Bacteria | 5830 |
| 93 | Ga0070679_100107585 | 3300005530 | Bacteria | 2774 |
| 94 | Ga0070679_100221626 | 3300005530 | Bacteria | 1852 |
| 95 | Ga0070684_100122884 | 3300005535 | Bacteria | 2336 |
| 96 | Ga0070684_100209079 | 3300005535 | Bacteria | 1778 |
| 97 | Ga0068853_100003486 | 3300005539 | Bacteria | 12037 |
| 98 | Ga0068853_100103541 | 3300005539 | Bacteria | 2519 |
| 99 | Ga0068853_100122152 | 3300005539 | Bacteria | 2324 |
| 100 | Ga0068853_100422448 | 3300005539 | Bacteria | 1250 |
| 101 | Ga0070672_100001315 | 3300005543 | Bacteria | 15315 |
| 102 | Ga0070672_100010467 | 3300005543 | Bacteria | 6434 |
| 103 | Ga0070672_100013149 | 3300005543 | Bacteria | 5835 |
| 104 | Ga0070672_100016750 | 3300005543 | Bacteria | 5255 |
| 105 | Ga0070672_100036486 | 3300005543 | Bacteria | 3745 |
| 106 | Ga0070672_100040420 | 3300005543 | Bacteria | 3578 |
| 107 | Ga0070672_100144564 | 3300005543 | Bacteria | 1964 |
| 108 | Ga0070672_100180807 | 3300005543 | Bacteria | 1757 |
| 109 | Ga0070696_100593931 | 3300005546 | Bacteria | 892 |
| 110 | Ga0070693_100080985 | 3300005547 | Bacteria | 1935 |
| 111 | Ga0070693_100302523 | 3300005547 | Bacteria | 1079 |
| 112 | Ga0070665_100155518 | 3300005548 | Bacteria | 2288 |
| 113 | Ga0070665_100268575 | 3300005548 | Bacteria | 1707 |
| 114 | Ga0070704_100095101 | 3300005549 | Bacteria | 2231 |
| 115 | Ga0068855_100102182 | 3300005563 | Bacteria | 3299 |
| 116 | Ga0068855_100129507 | 3300005563 | Bacteria | 2883 |
| 117 | Ga0068855_100408654 | 3300005563 | Bacteria | 1487 |
| 118 | Ga0070664_100341878 | 3300005564 | Bacteria | 1359 |
| 119 | Ga0070664_100416788 | 3300005564 | Bacteria | 1229 |
| 120 | Ga0070664_100547763 | 3300005564 | Bacteria | 1069 |
| 121 | Ga0068857_100076606 | 3300005577 | Bacteria | 2983 |
| 122 | Ga0068857_100139059 | 3300005577 | Bacteria | 2194 |
| 123 | Ga0068857_100290056 | 3300005577 | Bacteria | 1506 |
| 124 | Ga0068854_100005390 | 3300005578 | Bacteria | 8074 |
| 125 | Ga0068854_100013308 | 3300005578 | Bacteria | 5395 |
| 126 | Ga0068854_100263266 | 3300005578 | Bacteria | 1381 |
| 127 | Ga0068856_100008252 | 3300005614 | Bacteria | 10153 |
| 128 | Ga0068856_100147831 | 3300005614 | Bacteria | 2357 |
| 129 | Ga0068852_100068084 | 3300005616 | Bacteria | 3114 |
| 130 | Ga0068852_100092165 | 3300005616 | Bacteria | 2713 |
| 131 | Ga0068852_100095506 | 3300005616 | Bacteria | 2670 |
| 132 | Ga0068859_100204543 | 3300005617 | Bacteria | 2059 |
| 133 | Ga0068864_100000813 | 3300005618 | Bacteria | 26262 |
| 134 | Ga0068864_100015826 | 3300005618 | Bacteria | 6276 |
| 135 | Ga0068864_100084608 | 3300005618 | Bacteria | 2787 |
| 136 | Ga0068866_10013868 | 3300005718 | Bacteria | 3545 |
| 137 | Ga0068866_10056834 | 3300005718 | Bacteria | 2014 |
| 138 | Ga0068861_100003863 | 3300005719 | Bacteria | 10009 |
| 139 | Ga0068861_100008132 | 3300005719 | Bacteria | 7217 |
| 140 | Ga0068861_100008314 | 3300005719 | Bacteria | 7136 |
| 141 | Ga0068861_100111348 | 3300005719 | Bacteria | 2194 |
| 142 | Ga0068851_10012946 | 3300005834 | Bacteria | 3940 |
| 143 | Ga0068851_10017761 | 3300005834 | Bacteria | 3422 |
| 144 | Ga0068851_10131784 | 3300005834 | Bacteria | 1352 |
| 145 | Ga0068870_10002894 | 3300005840 | Bacteria | 7233 |
| 146 | Ga0068870_10034500 | 3300005840 | Bacteria | 2590 |
| 147 | Ga0068870_10147721 | 3300005840 | Bacteria | 1381 |
| 148 | Ga0068863_100175614 | 3300005841 | Bacteria | 2056 |
| 149 | Ga0068863_100458604 | 3300005841 | Bacteria | 1251 |
| 150 | Ga0068858_100002966 | 3300005842 | Bacteria | 17039 |
| 151 | Ga0068858_100033342 | 3300005842 | Bacteria | 4780 |
| 152 | Ga0068858_100037802 | 3300005842 | Bacteria | 4476 |
| 153 | Ga0068860_100052139 | 3300005843 | Bacteria | 3891 |
| 154 | Ga0068860_100134642 | 3300005843 | Bacteria | 2373 |
| 155 | Ga0068862_100039379 | 3300005844 | Bacteria | 4014 |
| 156 | Ga0075364_10012125 | 3300006051 | Bacteria | 5261 |
| 157 | Ga0075367_10018271 | 3300006178 | Bacteria | 3865 |
| 158 | Ga0075369_10074872 | 3300006186 | Bacteria | 1494 |
| 159 | Ga0075366_10016003 | 3300006195 | Bacteria | 4306 |
| 160 | Ga0075366_10062487 | 3300006195 | Bacteria | 2213 |
| 161 | Ga0075366_10086812 | 3300006195 | Bacteria | 1872 |
| 162 | Ga0075366_10088782 | 3300006195 | Bacteria | 1851 |
| 163 | Ga0097621_100015735 | 3300006237 | Bacteria | 5700 |
| 164 | Ga0097621_100023459 | 3300006237 | Bacteria | 4804 |
| 165 | Ga0097621_100030919 | 3300006237 | Bacteria | 4242 |
| 166 | Ga0075370_10001199 | 3300006353 | Bacteria | 10934 |
| 167 | Ga0075370_10004021 | 3300006353 | Bacteria | 7069 |
| 168 | Ga0075370_10033742 | 3300006353 | Bacteria | 2866 |
| 169 | Ga0075370_10073530 | 3300006353 | Bacteria | 1958 |
| 170 | Ga0068871_100054306 | 3300006358 | Bacteria | 3250 |
| 171 | Ga0068871_100085405 | 3300006358 | Bacteria | 2620 |
| 172 | Ga0068865_100008925 | 3300006881 | Bacteria | 6202 |
| 173 | Ga0068865_100031493 | 3300006881 | Bacteria | 3537 |
| 174 | Ga0068865_100100608 | 3300006881 | Bacteria | 2115 |
| 175 | Ga0068865_100244744 | 3300006881 | Bacteria | 1413 |
| 176 | Ga0097620_100175902 | 3300006931 | Bacteria | 2222 |
| 177 | Ga0097620_100204547 | 3300006931 | Bacteria | 2059 |
| 178 | Ga0099794_10003794 | 3300007265 | Bacteria | 5834 |
| 179 | Ga0099794_10047481 | 3300007265 | Bacteria | 2059 |
| 180 | Ga0099795_10000120 | 3300007788 | Bacteria | 13107 |
| 181 | Ga0105240_10000706 | 3300009093 | Bacteria | 61234 |
| 182 | Ga0105240_10027814 | 3300009093 | Bacteria | 7399 |
| 183 | Ga0105240_10130188 | 3300009093 | Bacteria | 3019 |
| 184 | Ga0105240_10175720 | 3300009093 | Bacteria | 2532 |
| 185 | Ga0111539_10296689 | 3300009094 | Bacteria | 1881 |
| 186 | Ga0105245_10060592 | 3300009098 | Bacteria | 3408 |
| 187 | Ga0105245_10277001 | 3300009098 | Bacteria | 1638 |
| 188 | Ga0105247_10406370 | 3300009101 | Bacteria | 971 |
| 189 | Ga0105243_10013318 | 3300009148 | Bacteria | 6219 |
| 190 | Ga0105243_10180310 | 3300009148 | Bacteria | 1836 |
| 191 | Ga0105241_10054918 | 3300009174 | Bacteria | 3051 |
| 192 | Ga0105241_10346117 | 3300009174 | Bacteria | 1289 |
| 193 | Ga0105242_10033767 | 3300009176 | Bacteria | 4099 |
| 194 | Ga0105248_10037307 | 3300009177 | Bacteria | 5437 |
| 195 | Ga0105248_10090533 | 3300009177 | Bacteria | 3445 |
| 196 | Ga0105248_10118638 | 3300009177 | Bacteria | 2984 |
| 197 | Ga0105248_10173206 | 3300009177 | Bacteria | 2432 |
| 198 | Ga0105248_10407885 | 3300009177 | Bacteria | 1530 |
| 199 | Ga0105248_10556958 | 3300009177 | Bacteria | 1293 |
| 200 | Ga0105237_10000048 | 3300009545 | Bacteria | 165532 |
| 201 | Ga0105237_10003764 | 3300009545 | Bacteria | 17858 |
| 202 | Ga0105237_10102263 | 3300009545 | Bacteria | 2857 |
| 203 | Ga0105238_10008003 | 3300009551 | Bacteria | 10576 |
| 204 | Ga0105249_10046249 | 3300009553 | Bacteria | 3961 |
| 205 | Ga0099796_10001454 | 3300010159 | Bacteria | 4776 |
| 206 | Ga0105239_10014548 | 3300010375 | Bacteria | 8730 |
| 207 | Ga0105239_10062082 | 3300010375 | Bacteria | 4102 |
| 208 | Ga0105239_10066928 | 3300010375 | Bacteria | 3946 |
| 209 | Ga0105239_10206315 | 3300010375 | Bacteria | 2202 |
| 210 | Ga0105239_10314913 | 3300010375 | Bacteria | 1764 |
| 211 | Ga0105239_10402781 | 3300010375 | Bacteria | 1548 |
| 212 | Ga0105246_10085154 | 3300011119 | Bacteria | 2263 |
| 213 | Ga0157345_1007296 | 3300012498 | Bacteria | 899 |
| 214 | Ga0157373_10175582 | 3300013100 | Bacteria | 1508 |
| 215 | Ga0157371_10188885 | 3300013102 | Bacteria | 1475 |
| 216 | Ga0157370_10373940 | 3300013104 | Bacteria | 1313 |
| 217 | Ga0157369_10189424 | 3300013105 | Bacteria | 2162 |
| 218 | Ga0157374_10000224 | 3300013296 | Bacteria | 52387 |
| 219 | Ga0157374_10032656 | 3300013296 | Bacteria | 4742 |
| 220 | Ga0157374_10334911 | 3300013296 | Bacteria | 1502 |
| 221 | Ga0157378_10118853 | 3300013297 | Bacteria | 2433 |
| 222 | Ga0163162_10008352 | 3300013306 | Bacteria | 10095 |
| 223 | Ga0163162_10022095 | 3300013306 | Bacteria | 6269 |
| 224 | Ga0163162_10192195 | 3300013306 | Bacteria | 2169 |
| 225 | Ga0163162_10264813 | 3300013306 | Bacteria | 1850 |
| 226 | Ga0157372_10120596 | 3300013307 | Bacteria | 3012 |
| 227 | Ga0157372_10166061 | 3300013307 | Bacteria | 2553 |
| 228 | Ga0157375_10008196 | 3300013308 | Bacteria | 9150 |
| 229 | Ga0157375_10009765 | 3300013308 | Bacteria | 8435 |
| 230 | Ga0157375_10031208 | 3300013308 | Bacteria | 5033 |
| 231 | Ga0157375_10031973 | 3300013308 | Bacteria | 4986 |
| 232 | Ga0157375_10086108 | 3300013308 | Bacteria | 3192 |
| 233 | Ga0163163_10007916 | 3300014325 | Bacteria | 9396 |
| 234 | Ga0163163_10102754 | 3300014325 | Bacteria | 2882 |
| 235 | Ga0157380_10024990 | 3300014326 | Bacteria | 4526 |
| 236 | Ga0157380_10025167 | 3300014326 | Bacteria | 4511 |
| 237 | Ga0157380_10088577 | 3300014326 | Bacteria | 2548 |
| 238 | Ga0157380_10571946 | 3300014326 | Bacteria | 1113 |
| 239 | Ga0157379_10011793 | 3300014968 | Bacteria | 7633 |
| 240 | Ga0157379_10039972 | 3300014968 | Bacteria | 4185 |
| 241 | Ga0157379_10072147 | 3300014968 | Bacteria | 3089 |
| 242 | Ga0157379_10259954 | 3300014968 | Bacteria | 1577 |
| 243 | Ga0157379_10295214 | 3300014968 | Bacteria | 1476 |
| 244 | Ga0157379_10502082 | 3300014968 | Bacteria | 1124 |
| 245 | Ga0157376_10018675 | 3300014969 | Bacteria | 5324 |
| 246 | Ga0157376_10205952 | 3300014969 | Bacteria | 1813 |
| 247 | Ga0163161_10029151 | 3300017792 | Bacteria | 3923 |
| 248 | Ga0163161_10099446 | 3300017792 | Bacteria | 2163 |
| 249 | Ga0163161_10108763 | 3300017792 | Bacteria | 2070 |
| 250 | Ga0163161_10206411 | 3300017792 | Bacteria | 1516 |
| 251 | Ga0209258_100074 | 3300025242 | Bacteria | 271062 |
| 252 | Ga0209759_1000521 | 3300025256 | Bacteria | 41549 |
| 253 | Ga0209233_1010646 | 3300025261 | Bacteria | 2745 |
| 254 | Ga0209455_1000066 | 3300025272 | Bacteria | 316811 |
| 255 | Ga0209676_1014399 | 3300025292 | Bacteria | 2976 |
| 256 | Ga0209257_1023440 | 3300025304 | Bacteria | 2170 |
| 257 | Ga0207656_10018987 | 3300025321 | Bacteria | 2715 |
| 258 | Ga0207656_10062067 | 3300025321 | Bacteria | 1642 |
| 259 | Ga0207682_10001514 | 3300025893 | Bacteria | 10710 |
| 260 | Ga0207682_10025440 | 3300025893 | Bacteria | 2347 |
| 261 | Ga0207682_10074879 | 3300025893 | Bacteria | 1440 |
| 262 | Ga0207682_10077183 | 3300025893 | Bacteria | 1421 |
| 263 | Ga0207642_10116266 | 3300025899 | Bacteria | 1371 |
| 264 | Ga0207642_10147436 | 3300025899 | Bacteria | 1248 |
| 265 | Ga0207688_10024772 | 3300025901 | Bacteria | 3292 |
| 266 | Ga0207688_10074441 | 3300025901 | Bacteria | 1931 |
| 267 | Ga0207688_10120427 | 3300025901 | Bacteria | 1531 |
| 268 | Ga0207680_10002999 | 3300025903 | Bacteria | 7913 |
| 269 | Ga0207680_10039133 | 3300025903 | Bacteria | 2749 |
| 270 | Ga0207680_10160718 | 3300025903 | Bacteria | 1506 |
| 271 | Ga0207645_10003747 | 3300025907 | Bacteria | 11429 |
| 272 | Ga0207645_10009087 | 3300025907 | Bacteria | 6894 |
| 273 | Ga0207645_10009373 | 3300025907 | Bacteria | 6776 |
| 274 | Ga0207645_10057735 | 3300025907 | Bacteria | 2478 |
| 275 | Ga0207645_10090512 | 3300025907 | Bacteria | 1967 |
| 276 | Ga0207645_10157225 | 3300025907 | Bacteria | 1486 |
| 277 | Ga0207645_10392791 | 3300025907 | Bacteria | 932 |
| 278 | Ga0207643_10013001 | 3300025908 | Bacteria | 4499 |
| 279 | Ga0207643_10031440 | 3300025908 | Bacteria | 2959 |
| 280 | Ga0207643_10052954 | 3300025908 | Bacteria | 2305 |
| 281 | Ga0207705_10033965 | 3300025909 | Bacteria | 3646 |
| 282 | Ga0207705_10120206 | 3300025909 | Bacteria | 1949 |
| 283 | Ga0207684_10007765 | 3300025910 | Bacteria | 9606 |
| 284 | Ga0207684_10453426 | 3300025910 | Bacteria | 1101 |
| 285 | Ga0207654_10226755 | 3300025911 | Bacteria | 1242 |
| 286 | Ga0207707_10150408 | 3300025912 | Bacteria | 2035 |
| 287 | Ga0207695_10004844 | 3300025913 | Bacteria | 18169 |
| 288 | Ga0207695_10066130 | 3300025913 | Bacteria | 3714 |
| 289 | Ga0207695_10115948 | 3300025913 | Bacteria | 2653 |
| 290 | Ga0207695_10231218 | 3300025913 | Bacteria | 1753 |
| 291 | Ga0207695_10390665 | 3300025913 | Bacteria | 1276 |
| 292 | Ga0207671_10000077 | 3300025914 | Bacteria | 150801 |
| 293 | Ga0207671_10107160 | 3300025914 | Bacteria | 2122 |
| 294 | Ga0207660_10168998 | 3300025917 | Bacteria | 1691 |
| 295 | Ga0207662_10007584 | 3300025918 | Bacteria | 5912 |
| 296 | Ga0207662_10037414 | 3300025918 | Bacteria | 2840 |
| 297 | Ga0207662_10058525 | 3300025918 | Bacteria | 2307 |
| 298 | Ga0207657_10035844 | 3300025919 | Bacteria | 4444 |
| 299 | Ga0207657_10124336 | 3300025919 | Bacteria | 2120 |
| 300 | Ga0207657_10426487 | 3300025919 | Bacteria | 1042 |
| 301 | Ga0207657_10520161 | 3300025919 | Unclassified | 931 |
| 302 | Ga0207652_10028046 | 3300025921 | Bacteria | 4695 |
| 303 | Ga0207652_10075574 | 3300025921 | Bacteria | 2936 |
| 304 | Ga0207652_10129143 | 3300025921 | Bacteria | 2253 |
| 305 | Ga0207646_10052001 | 3300025922 | Bacteria | 3665 |
| 306 | Ga0207681_10004549 | 3300025923 | Bacteria | 8537 |
| 307 | Ga0207681_10005781 | 3300025923 | Bacteria | 7587 |
| 308 | Ga0207681_10097234 | 3300025923 | Bacteria | 2115 |
| 309 | Ga0207681_10114053 | 3300025923 | Bacteria | 1971 |
| 310 | Ga0207694_10013058 | 3300025924 | Bacteria | 6252 |
| 311 | Ga0207694_10015728 | 3300025924 | Bacteria | 5707 |
| 312 | Ga0207694_10024397 | 3300025924 | Bacteria | 4593 |
| 313 | Ga0207694_10067557 | 3300025924 | Bacteria | 2790 |
| 314 | Ga0207694_10070653 | 3300025924 | Bacteria | 2728 |
| 315 | Ga0207650_10001113 | 3300025925 | Bacteria | 19790 |
| 316 | Ga0207650_10002251 | 3300025925 | Bacteria | 13483 |
| 317 | Ga0207650_10036670 | 3300025925 | Bacteria | 3568 |
| 318 | Ga0207650_10039567 | 3300025925 | Bacteria | 3445 |
| 319 | Ga0207650_10053612 | 3300025925 | Bacteria | 2989 |
| 320 | Ga0207650_10248264 | 3300025925 | Bacteria | 1440 |
| 321 | Ga0207650_10760369 | 3300025925 | Bacteria | 820 |
| 322 | Ga0207659_10000343 | 3300025926 | Bacteria | 27873 |
| 323 | Ga0207659_10000773 | 3300025926 | Bacteria | 18947 |
| 324 | Ga0207659_10013872 | 3300025926 | Bacteria | 5179 |
| 325 | Ga0207659_10070005 | 3300025926 | Bacteria | 2557 |
| 326 | Ga0207659_10198310 | 3300025926 | Bacteria | 1601 |
| 327 | Ga0207687_10045643 | 3300025927 | Bacteria | 3029 |
| 328 | Ga0207687_10083313 | 3300025927 | Bacteria | 2315 |
| 329 | Ga0207644_10007907 | 3300025931 | Bacteria | 6954 |
| 330 | Ga0207644_10023290 | 3300025931 | Bacteria | 4240 |
| 331 | Ga0207644_10038493 | 3300025931 | Bacteria | 3369 |
| 332 | Ga0207644_10047903 | 3300025931 | Bacteria | 3052 |
| 333 | Ga0207644_10328817 | 3300025931 | Bacteria | 1237 |
| 334 | Ga0207690_10012761 | 3300025932 | Bacteria | 5035 |
| 335 | Ga0207690_10137342 | 3300025932 | Bacteria | 1796 |
| 336 | Ga0207706_10000280 | 3300025933 | Bacteria | 55678 |
| 337 | Ga0207706_10064403 | 3300025933 | Bacteria | 3227 |
| 338 | Ga0207706_10152553 | 3300025933 | Bacteria | 2032 |
| 339 | Ga0207686_10014281 | 3300025934 | Bacteria | 4416 |
| 340 | Ga0207686_10278569 | 3300025934 | Bacteria | 1233 |
| 341 | Ga0207709_10003697 | 3300025935 | Bacteria | 9008 |
| 342 | Ga0207709_10124780 | 3300025935 | Bacteria | 1744 |
| 343 | Ga0207670_10028602 | 3300025936 | Bacteria | 3541 |
| 344 | Ga0207670_10377052 | 3300025936 | Bacteria | 1129 |
| 345 | Ga0207669_10005448 | 3300025937 | Bacteria | 5710 |
| 346 | Ga0207669_10008481 | 3300025937 | Bacteria | 4828 |
| 347 | Ga0207704_10048342 | 3300025938 | Bacteria | 2549 |
| 348 | Ga0207704_10052070 | 3300025938 | Bacteria | 2480 |
| 349 | Ga0207704_10068096 | 3300025938 | Bacteria | 2243 |
| 350 | Ga0207704_10111232 | 3300025938 | Bacteria | 1852 |
| 351 | Ga0207704_10470769 | 3300025938 | Bacteria | 1007 |
| 352 | Ga0207665_10065691 | 3300025939 | Bacteria | 2467 |
| 353 | Ga0207691_10002193 | 3300025940 | Bacteria | 19089 |
| 354 | Ga0207691_10002225 | 3300025940 | Bacteria | 18972 |
| 355 | Ga0207691_10016300 | 3300025940 | Bacteria | 7055 |
| 356 | Ga0207691_10017159 | 3300025940 | Bacteria | 6868 |
| 357 | Ga0207691_10037681 | 3300025940 | Bacteria | 4476 |
| 358 | Ga0207691_10072777 | 3300025940 | Bacteria | 3100 |
| 359 | Ga0207691_10106410 | 3300025940 | Bacteria | 2498 |
| 360 | Ga0207691_10129600 | 3300025940 | Bacteria | 2229 |
| 361 | Ga0207691_10162598 | 3300025940 | Bacteria | 1958 |
| 362 | Ga0207691_10235009 | 3300025940 | Bacteria | 1586 |
| 363 | Ga0207691_10410994 | 3300025940 | Bacteria | 1154 |
| 364 | Ga0207711_10127809 | 3300025941 | Bacteria | 2275 |
| 365 | Ga0207711_10169205 | 3300025941 | Bacteria | 1982 |
| 366 | Ga0207711_10180997 | 3300025941 | Bacteria | 1917 |
| 367 | Ga0207711_10185967 | 3300025941 | Bacteria | 1891 |
| 368 | Ga0207711_10258323 | 3300025941 | Bacteria | 1600 |
| 369 | Ga0207689_10002313 | 3300025942 | Bacteria | 17849 |
| 370 | Ga0207689_10015369 | 3300025942 | Bacteria | 6480 |
| 371 | Ga0207689_10025978 | 3300025942 | Bacteria | 4904 |
| 372 | Ga0207689_10052967 | 3300025942 | Bacteria | 3343 |
| 373 | Ga0207661_10083500 | 3300025944 | Bacteria | 2643 |
| 374 | Ga0207667_10078147 | 3300025949 | Bacteria | 3430 |
| 375 | Ga0207667_10109268 | 3300025949 | Bacteria | 2852 |
| 376 | Ga0207651_10000137 | 3300025960 | Bacteria | 31859 |
| 377 | Ga0207651_10000467 | 3300025960 | Bacteria | 17039 |
| 378 | Ga0207651_10012704 | 3300025960 | Bacteria | 4779 |
| 379 | Ga0207651_10036963 | 3300025960 | Bacteria | 3194 |
| 380 | Ga0207651_10058499 | 3300025960 | Bacteria | 2664 |
| 381 | Ga0207651_10242319 | 3300025960 | Bacteria | 1470 |
| 382 | Ga0207651_10270130 | 3300025960 | Bacteria | 1400 |
| 383 | Ga0207651_10300043 | 3300025960 | Bacteria | 1335 |
| 384 | Ga0207712_10067513 | 3300025961 | Bacteria | 2560 |
| 385 | Ga0207712_10220600 | 3300025961 | Bacteria | 1516 |
| 386 | Ga0207668_10005664 | 3300025972 | Bacteria | 7353 |
| 387 | Ga0207668_10235927 | 3300025972 | Bacteria | 1477 |
| 388 | Ga0207640_10005332 | 3300025981 | Bacteria | 7007 |
| 389 | Ga0207640_10064401 | 3300025981 | Bacteria | 2440 |
| 390 | Ga0207640_10136324 | 3300025981 | Bacteria | 1782 |
| 391 | Ga0207640_10241861 | 3300025981 | Bacteria | 1395 |
| 392 | Ga0207640_10305582 | 3300025981 | Bacteria | 1260 |
| 393 | Ga0207658_10000459 | 3300025986 | Bacteria | 38145 |
| 394 | Ga0207658_10008081 | 3300025986 | Bacteria | 7168 |
| 395 | Ga0207658_10084597 | 3300025986 | Bacteria | 2441 |
| 396 | Ga0207658_10174581 | 3300025986 | Bacteria | 1774 |
| 397 | Ga0207677_10001138 | 3300026023 | Bacteria | 14488 |
| 398 | Ga0207677_10007955 | 3300026023 | Bacteria | 5895 |
| 399 | Ga0207677_10140814 | 3300026023 | Bacteria | 1846 |
| 400 | Ga0207703_10002051 | 3300026035 | Bacteria | 17777 |
| 401 | Ga0207703_10012174 | 3300026035 | Bacteria | 6705 |
| 402 | Ga0207703_10021603 | 3300026035 | Bacteria | 5040 |
| 403 | Ga0207639_10002665 | 3300026041 | Bacteria | 11982 |
| 404 | Ga0207639_10055949 | 3300026041 | Bacteria | 3021 |
| 405 | Ga0207639_10182026 | 3300026041 | Bacteria | 1788 |
| 406 | Ga0207639_10291334 | 3300026041 | Bacteria | 1439 |
| 407 | Ga0207639_10362244 | 3300026041 | Bacteria | 1298 |
| 408 | Ga0207678_10099510 | 3300026067 | Bacteria | 2484 |
| 409 | Ga0207678_10115586 | 3300026067 | Bacteria | 2289 |
| 410 | Ga0207678_10126887 | 3300026067 | Bacteria | 2176 |
| 411 | Ga0207708_10416854 | 3300026075 | Bacteria | 1113 |
| 412 | Ga0207702_10040642 | 3300026078 | Bacteria | 3898 |
| 413 | Ga0207702_10247974 | 3300026078 | Bacteria | 1671 |
| 414 | Ga0207702_10299801 | 3300026078 | Bacteria | 1525 |
| 415 | Ga0207702_10461271 | 3300026078 | Bacteria | 1234 |
| 416 | Ga0207702_10811363 | 3300026078 | Bacteria | 925 |
| 417 | Ga0207641_10006901 | 3300026088 | Bacteria | 9500 |
| 418 | Ga0207641_10008170 | 3300026088 | Bacteria | 8660 |
| 419 | Ga0207641_10033206 | 3300026088 | Bacteria | 4288 |
| 420 | Ga0207641_10151573 | 3300026088 | Bacteria | 2100 |
| 421 | Ga0207641_10256236 | 3300026088 | Bacteria | 1636 |
| 422 | Ga0207648_10000878 | 3300026089 | Bacteria | 33868 |
| 423 | Ga0207648_10007913 | 3300026089 | Bacteria | 10363 |
| 424 | Ga0207648_10010992 | 3300026089 | Bacteria | 8548 |
| 425 | Ga0207648_10034718 | 3300026089 | Bacteria | 4444 |
| 426 | Ga0207648_10075011 | 3300026089 | Bacteria | 2949 |
| 427 | Ga0207648_10104646 | 3300026089 | Bacteria | 2482 |
| 428 | Ga0207648_10131009 | 3300026089 | Bacteria | 2207 |
| 429 | Ga0207648_10307154 | 3300026089 | Bacteria | 1423 |
| 430 | Ga0207676_10003213 | 3300026095 | Bacteria | 11647 |
| 431 | Ga0207676_10009121 | 3300026095 | Bacteria | 7064 |
| 432 | Ga0207676_10010157 | 3300026095 | Bacteria | 6701 |
| 433 | Ga0207676_10041155 | 3300026095 | Bacteria | 3545 |
| 434 | Ga0207676_10105478 | 3300026095 | Bacteria | 2346 |
| 435 | Ga0207676_10226519 | 3300026095 | Bacteria | 1668 |
| 436 | Ga0207676_10261380 | 3300026095 | Bacteria | 1563 |
| 437 | Ga0207674_10015428 | 3300026116 | Bacteria | 8393 |
| 438 | Ga0207674_10053226 | 3300026116 | Bacteria | 4126 |
| 439 | Ga0207675_100005117 | 3300026118 | Bacteria | 12625 |
| 440 | Ga0207675_100026312 | 3300026118 | Bacteria | 5415 |
| 441 | Ga0207675_100047083 | 3300026118 | Bacteria | 4027 |
| 442 | Ga0207675_100059251 | 3300026118 | Bacteria | 3573 |
| 443 | Ga0207675_100166081 | 3300026118 | Bacteria | 2108 |
| 444 | Ga0207683_10006134 | 3300026121 | Bacteria | 10296 |
| 445 | Ga0207683_10012895 | 3300026121 | Bacteria | 7135 |
| 446 | Ga0207683_10026507 | 3300026121 | Bacteria | 5002 |
| 447 | Ga0207683_10303248 | 3300026121 | Bacteria | 1461 |
| 448 | Ga0207683_10559139 | 3300026121 | Bacteria | 1058 |
| 449 | Ga0207698_10028871 | 3300026142 | Bacteria | 3963 |
| 450 | Ga0207698_10030460 | 3300026142 | Bacteria | 3880 |
| 451 | Ga0207698_10034956 | 3300026142 | Bacteria | 3671 |
| 452 | Ga0207698_10451857 | 3300026142 | Bacteria | 1241 |
| 453 | Ga0209371_1023392 | 3300027312 | Bacteria | 1455 |
| 454 | Ga0209588_1048046 | 3300027671 | Bacteria | 1380 |
| 455 | Ga0265354_1002352 | 3300028016 | Bacteria | 2369 |
| 456 | Ga0268266_10098696 | 3300028379 | Bacteria | 2570 |
| 457 | Ga0268266_10873387 | 3300028379 | Bacteria | 869 |
| 458 | Ga0268265_10030187 | 3300028380 | Bacteria | 3900 |
| 459 | Ga0268265_10040482 | 3300028380 | Bacteria | 3442 |
| 460 | Ga0268264_10015847 | 3300028381 | Bacteria | 6171 |
| 461 | Ga0268264_10072826 | 3300028381 | Bacteria | 2914 |
| 462 | Ga0268264_10122723 | 3300028381 | Bacteria | 2292 |
| 463 | Ga0265319_1036053 | 3300028563 | Bacteria | 1694 |
| 464 | Ga0265334_10001873 | 3300028573 | Bacteria | 9987 |
| 465 | Ga0265318_10000011 | 3300028577 | Bacteria | 231078 |
| 466 | Ga0307517_10000131 | 3300028786 | Bacteria | 113233 |
| 467 | Ga0307515_10010230 | 3300028794 | Bacteria | 18010 |
| 468 | Ga0307515_10016716 | 3300028794 | Bacteria | 13417 |
| 469 | Ga0307515_10045865 | 3300028794 | Bacteria | 6699 |
| 470 | Ga0268256_1026586 | 3300030500 | Bacteria | 1452 |
| 471 | Ga0307512_10014097 | 3300030522 | Bacteria | 7462 |
| 472 | Ga0307512_10077087 | 3300030522 | Bacteria | 2425 |
| 473 | Ga0265760_10000144 | 3300031090 | Bacteria | 18264 |
| 474 | Ga0265330_10000019 | 3300031235 | Bacteria | 156905 |
| 475 | Ga0265332_10000209 | 3300031238 | Bacteria | 47448 |
| 476 | Ga0265328_10020600 | 3300031239 | Bacteria | 2522 |
| 477 | Ga0265320_10000005 | 3300031240 | Bacteria | 354422 |
| 478 | Ga0265320_10086885 | 3300031240 | Bacteria | 1453 |
| 479 | Ga0265329_10000727 | 3300031242 | Bacteria | 16709 |
| 480 | Ga0265331_10000207 | 3300031250 | Bacteria | 71159 |
| 481 | Ga0265327_10012683 | 3300031251 | Bacteria | 5665 |
| 482 | Ga0307509_10002009 | 3300031507 | Bacteria | 33629 |
| 483 | Ga0307509_10003678 | 3300031507 | Bacteria | 22944 |
| 484 | Ga0307509_10004862 | 3300031507 | Bacteria | 19056 |
| 485 | Ga0307509_10044590 | 3300031507 | Bacteria | 4790 |
| 486 | Ga0307408_100017706 | 3300031548 | Bacteria | 4773 |
| 487 | Ga0307408_100167002 | 3300031548 | Bacteria | 1754 |
| 488 | Ga0307408_100215769 | 3300031548 | Bacteria | 1562 |
| 489 | Ga0265313_10000019 | 3300031595 | Bacteria | 149106 |
| 490 | Ga0265313_10068906 | 3300031595 | Bacteria | 1633 |
| 491 | Ga0265313_10082124 | 3300031595 | Bacteria | 1461 |
| 492 | Ga0307508_10002648 | 3300031616 | Bacteria | 18776 |
| 493 | Ga0307508_10082842 | 3300031616 | Bacteria | 2790 |
| 494 | Ga0307514_10026868 | 3300031649 | Bacteria | 4652 |
| 495 | Ga0307514_10091098 | 3300031649 | Bacteria | 2222 |
| 496 | Ga0265314_10002597 | 3300031711 | Bacteria | 18274 |
| 497 | Ga0265342_10215283 | 3300031712 | Bacteria | 1037 |
| 498 | Ga0307516_10000148 | 3300031730 | Bacteria | 86902 |
| 499 | Ga0307516_10000244 | 3300031730 | Bacteria | 70125 |
| 500 | Ga0307516_10000419 | 3300031730 | Bacteria | 55599 |
| 501 | Ga0307516_10141850 | 3300031730 | Bacteria | 2171 |
| 502 | Ga0307516_10252142 | 3300031730 | Bacteria | 1459 |
| 503 | Ga0307516_10295794 | 3300031730 | Bacteria | 1296 |
| 504 | Ga0307405_10408028 | 3300031731 | Bacteria | 1065 |
| 505 | Ga0307413_10000991 | 3300031824 | Bacteria | 10216 |
| 506 | Ga0307413_10102515 | 3300031824 | Bacteria | 1895 |
| 507 | Ga0307410_10016802 | 3300031852 | Bacteria | 4375 |
| 508 | Ga0307410_10370898 | 3300031852 | Bacteria | 1149 |
| 509 | Ga0307410_10512792 | 3300031852 | Bacteria | 988 |
| 510 | Ga0307406_10013821 | 3300031901 | Bacteria | 4633 |
| 511 | Ga0307406_10025879 | 3300031901 | Bacteria | 3517 |
| 512 | Ga0307407_10215087 | 3300031903 | Bacteria | 1296 |
| 513 | Ga0307407_10406174 | 3300031903 | Bacteria | 978 |
| 514 | Ga0307412_10001535 | 3300031911 | Bacteria | 12773 |
| 515 | Ga0307412_10008145 | 3300031911 | Bacteria | 5972 |
| 516 | Ga0307409_100008870 | 3300031995 | Bacteria | 6137 |
| 517 | Ga0307409_100008875 | 3300031995 | Bacteria | 6135 |
| 518 | Ga0307409_100318569 | 3300031995 | Bacteria | 1454 |
| 519 | Ga0307416_100039771 | 3300032002 | Bacteria | 3645 |
| 520 | Ga0307416_100299941 | 3300032002 | Bacteria | 1596 |
| 521 | Ga0307416_100787306 | 3300032002 | Bacteria | 1046 |
| 522 | Ga0307414_10053015 | 3300032004 | Bacteria | 2827 |
| 523 | Ga0307414_10065461 | 3300032004 | Bacteria | 2593 |
| 524 | Ga0307411_10010745 | 3300032005 | Bacteria | 4898 |
| 525 | Ga0307415_100020682 | 3300032126 | Bacteria | 4024 |
| 526 | Ga0307507_10047402 | 3300033179 | Bacteria | 4197 |
| 527 | Ga0307510_10005846 | 3300033180 | Bacteria | 14671 |
| 528 | Ga0307510_10026370 | 3300033180 | Bacteria | 6680 |
| 529 | Ga0307510_10040673 | 3300033180 | Bacteria | 5099 |
| 530 | Ga0307510_10180482 | 3300033180 | Bacteria | 1674 |
| 531 | Ga0373950_0000070 | 3300034818 | Bacteria | 52640 |
| 532 | Ga0373938_0017392 | 3300034957 | Bacteria | 1415 |
| 533 | Ga0373928_0013521 | 3300035084 | Bacteria | 1640 |
| 534 | Ga0373932_0032723 | 3300035112 | Bacteria | 1456 |
| 535 | Ga0373941_0125815 | 3300035115 | Bacteria | 918 |
| 536 | Ga0373960_0011567 | 3300035121 | Bacteria | 2175 |
| 537 | Ga0373943_0032411 | 3300035170 | Bacteria | 2484 |
| 538 | Ga0373946_0203928 | 3300035171 | Bacteria | 948 |
| 539 | Ga0373955_0122582 | 3300035172 | Bacteria | 1512 |
| 540 | Ga0373924_0010107 | 3300035410 | Bacteria | 3474 |
| 541 | Ga0373924_0119360 | 3300035410 | Bacteria | 1143 |
| 542 | Ga0373931_0018291 | 3300035691 | Bacteria | 3483 |
| 543 | Ga0373931_0026635 | 3300035691 | Bacteria | 2944 |
| 544 | Ga0373937_0028375 | 3300036401 | Bacteria | 5064 |
| 545 | Ga0373925_0085409 | 3300037068 | Bacteria | 2406 |
| 546 | Ga0395899_0081098 | 3300037312 | Bacteria | 2361 |
| 547 | Ga0395900_0000025 | 3300037418 | Bacteria | 321217 |
| 548 | Ga0395898_0000893 | 3300037466 | Bacteria | 48473 |
| 549 | Ga0395898_0202985 | 3300037466 | Bacteria | 1892 |
| 550 | Ga0395905_0000329 | 3300037471 | Bacteria | 68145 |
| 551 | Ga0395905_0006586 | 3300037471 | Bacteria | 11665 |
| 552 | Ga0395901_0144709 | 3300038443 | Bacteria | 2499 |
| 553 | Ga0436365_0217206 | 3300039437 | Bacteria | 2092 |
| 554 | Ga0436365_1681085 | 3300039437 | Bacteria | 1778 |
| 555 | Ga0436361_0147510 | 3300039447 | Bacteria | 46306 |
| 556 | Ga0436361_0795551 | 3300039447 | Bacteria | 1438 |
| 557 | Ga0436363_0285956 | 3300039450 | Bacteria | 3827 |
| 558 | Ga0439436_0059487 | 3300041404 | Bacteria | 1071 |
| 559 | Ga0451833_0953641 | 3300041491 | Bacteria | 1713 |
| 560 | Ga0451843_1226642 | 3300041509 | Bacteria | 1362 |
| 561 | Ga0451853_2678590 | 3300041512 | Bacteria | 2295 |
| 562 | Ga0450921_006991 | 3300042123 | Bacteria | 888 |
| 563 | Ga0439464_0017741 | 3300042439 | Bacteria | 1932 |
| 564 | Ga0450901_004161 | 3300042533 | Unclassified | 1499 |
| 565 | Ga0451577_0024273 | 3300042876 | Bacteria | 5517 |
| 566 | Ga0451577_0093882 | 3300042876 | Bacteria | 2679 |
| 567 | Ga0466969_0000830 | 3300044656 | Bacteria | 16802 |
| 568 | Ga0453683_0048715 | 3300044673 | Bacteria | 2658 |
| 569 | Ga0453683_0091117 | 3300044673 | Bacteria | 1911 |
| 570 | Ga0453683_0146552 | 3300044673 | Bacteria | 1491 |
| 571 | Ga0453683_0204192 | 3300044673 | Bacteria | 1255 |
| 572 | Ga0466965_0070443 | 3300044683 | Bacteria | 1757 |
| 573 | Ga0466965_0287942 | 3300044683 | Bacteria | 889 |
| 574 | Ga0466966_0040681 | 3300044684 | Bacteria | 2991 |
| 575 | Ga0466961_0008582 | 3300044693 | Bacteria | 6510 |
| 576 | Ga0453684_0003853 | 3300044712 | Bacteria | 33049 |
| 577 | Ga0453684_0058655 | 3300044712 | Bacteria | 4970 |
| 578 | Ga0453684_0646593 | 3300044712 | Bacteria | 1154 |
| 579 | Ga0453684_1099214 | 3300044712 | Bacteria | 840 |
| 580 | Ga0466970_0140522 | 3300044765 | Bacteria | 1330 |
| 581 | Ga0466959_0042728 | 3300045049 | Bacteria | 3343 |
| 582 | Ga0451576_0000535 | 3300045051 | Bacteria | 81918 |
| 583 | Ga0451576_0041165 | 3300045051 | Bacteria | 4886 |
| 584 | Ga0451576_0064872 | 3300045051 | Bacteria | 3803 |
| 585 | Ga0451576_0080415 | 3300045051 | Bacteria | 3391 |
| 586 | Ga0451576_0294782 | 3300045051 | Bacteria | 1696 |
| 587 | Ga0451576_0315486 | 3300045051 | Bacteria | 1636 |
| 588 | Ga0466967_0389845 | 3300045976 | Bacteria | 1354 |
| 589 | Ga0495592_0000394 | 3300046454 | Bacteria | 33973 |
| 590 | Ga0495590_0020399 | 3300046457 | Bacteria | 2355 |
| 591 | Ga0495580_0110854 | 3300046472 | Bacteria | 1906 |
| 592 | Ga0495580_0180961 | 3300046472 | Bacteria | 1456 |
| 593 | Ga0495605_0057705 | 3300046474 | Bacteria | 1868 |
| 594 | Ga0495630_0486680 | 3300046517 | Bacteria | 946 |
| 595 | Ga0495632_0067443 | 3300046519 | Bacteria | 1725 |
| 596 | Ga0495663_0000523 | 3300046525 | Bacteria | 13846 |
| 597 | Ga0495654_0060464 | 3300046530 | Bacteria | 1821 |
| 598 | Ga0495587_0173272 | 3300046536 | Bacteria | 1225 |
| 599 | Ga0495598_0079438 | 3300046537 | Bacteria | 1049 |
| 600 | Ga0495621_0185404 | 3300046539 | Bacteria | 832 |
| 601 | Ga0495645_0043051 | 3300046543 | Bacteria | 3293 |
| 602 | Ga0495633_0001633 | 3300046558 | Bacteria | 16923 |
| 603 | Ga0495668_0063228 | 3300046616 | Bacteria | 2039 |
| 604 | Ga0495634_0106617 | 3300046642 | Bacteria | 1806 |
| 605 | Ga0495635_0234220 | 3300046663 | Bacteria | 1240 |
| 606 | Ga0495658_0019632 | 3300046683 | Bacteria | 3531 |
| 607 | Ga0495658_0209140 | 3300046683 | Bacteria | 1218 |
| 608 | Ga0495624_0049046 | 3300046690 | Bacteria | 2678 |
| 609 | Ga0495649_0004358 | 3300046694 | Bacteria | 9269 |
| 610 | Ga0495672_0000459 | 3300047320 | Bacteria | 48101 |
| 611 | Ga0495676_0149538 | 3300047321 | Bacteria | 1664 |
| 612 | Ga0495687_002007 | 3300047443 | Bacteria | 17252 |
| 613 | Ga0495684_0090083 | 3300047471 | Bacteria | 2324 |
| 614 | Ga0495686_0002603 | 3300047472 | Bacteria | 16741 |
| 615 | Ga0495593_0108019 | 3300047673 | Bacteria | 1422 |
| 616 | Ga0495626_0104005 | 3300048091 | Bacteria | 1235 |
| 617 | Ga0496101_0308915 | 3300048904 | Bacteria | 1239 |
| 618 | Ga0496102_0021356 | 3300048905 | Bacteria | 5726 |
| 619 | Ga0496104_0850407 | 3300048907 | Bacteria | 818 |
| 620 | Ga0496105_0035474 | 3300048908 | Bacteria | 4104 |
| 621 | Ga0496107_0008694 | 3300048910 | Bacteria | 7034 |
| 622 | Ga0496108_0037639 | 3300048911 | Bacteria | 4031 |
| 623 | Ga0496108_0108971 | 3300048911 | Bacteria | 2366 |
| 624 | Ga0496109_0065263 | 3300048912 | Bacteria | 3332 |
| 625 | Ga0496109_0535054 | 3300048912 | Bacteria | 1105 |
| 626 | Ga0496110_0094193 | 3300048913 | Bacteria | 2681 |
| 627 | Ga0496110_0112180 | 3300048913 | Bacteria | 2451 |
| 628 | Ga0496110_0149400 | 3300048913 | Bacteria | 2115 |
| 629 | Ga0496111_0040071 | 3300048914 | Bacteria | 3360 |
| 630 | Ga0496114_0104997 | 3300048917 | Bacteria | 2416 |
| 631 | Ga0496115_0026217 | 3300048918 | Bacteria | 4547 |
| 632 | Ga0496116_0005768 | 3300048919 | Bacteria | 11384 |
| 633 | Ga0496117_0073829 | 3300048920 | Bacteria | 2274 |
| 634 | Ga0496118_0043390 | 3300048921 | Bacteria | 3536 |
| 635 | Ga0496118_0098504 | 3300048921 | Bacteria | 1985 |
| 636 | Ga0496119_0015034 | 3300048922 | Bacteria | 5996 |
| 637 | Ga0496120_0071246 | 3300048923 | Bacteria | 1908 |
| 638 | Ga0496121_0000200 | 3300048924 | Bacteria | 131314 |
| 639 | Ga0496121_0017358 | 3300048924 | Bacteria | 7359 |
| 640 | Ga0496122_0000021 | 3300048925 | Bacteria | 391363 |
| 641 | Ga0496122_0037277 | 3300048925 | Bacteria | 3916 |
| 642 | Ga0496123_0000382 | 3300048926 | Bacteria | 83286 |
| 643 | Ga0496123_0015028 | 3300048926 | Bacteria | 6377 |
| 644 | Ga0496124_0008879 | 3300048927 | Bacteria | 10431 |
| 645 | Ga0496125_0000005 | 3300048928 | Bacteria | 827598 |
| 646 | Ga0496125_0087395 | 3300048928 | Bacteria | 2355 |
| 647 | Ga0496126_0018419 | 3300048929 | Bacteria | 6919 |
| 648 | Ga0496126_0080528 | 3300048929 | Bacteria | 2882 |
| 649 | Ga0501336_007437 | 3300049552 | Bacteria | 831 |
| 650 | Ga0501037_0082650 | 3300049573 | Bacteria | 2327 |
| 651 | Ga0501039_0556708 | 3300049575 | Bacteria | 900 |
| 652 | Ga0501046_0517468 | 3300049580 | Bacteria | 853 |
| 653 | Ga0501047_0003039 | 3300049581 | Bacteria | 15916 |
| 654 | Ga0501047_0027619 | 3300049581 | Bacteria | 5467 |
| 655 | Ga0501047_0264457 | 3300049581 | Bacteria | 1567 |
| 656 | Ga0501067_0000032 | 3300049583 | Bacteria | 86474 |
| 657 | Ga0501068_0009627 | 3300049584 | Bacteria | 5411 |
| 658 | Ga0501069_0032905 | 3300049585 | Bacteria | 2854 |
| 659 | Ga0501070_0019775 | 3300049586 | Bacteria | 5647 |
| 660 | Ga0501070_0296629 | 3300049586 | Bacteria | 1317 |
| 661 | Ga0501073_0003918 | 3300049589 | Bacteria | 11173 |
| 662 | Ga0501073_0035750 | 3300049589 | Bacteria | 3529 |
| 663 | Ga0501074_0017424 | 3300049590 | Bacteria | 5212 |
| 664 | Ga0501074_0024189 | 3300049590 | Bacteria | 4414 |
| 665 | Ga0501199_008182 | 3300049650 | Bacteria | 1091 |
| 666 | Ga0501208_006262 | 3300049655 | Bacteria | 1507 |
| 667 | Ga0501222_009332 | 3300049662 | Bacteria | 1299 |
| 668 | Ga0501223_010048 | 3300049663 | Bacteria | 1910 |
| 669 | Ga0501257_000018 | 3300049686 | Bacteria | 48053 |
| 670 | Ga0501080_0009668 | 3300049742 | Bacteria | 8804 |
| 671 | Ga0501080_0059748 | 3300049742 | Bacteria | 3548 |
| 672 | Ga0501083_0008135 | 3300049744 | Bacteria | 7419 |
| 673 | Ga0501280_013230 | 3300049776 | Bacteria | 1165 |
| 674 | Ga0501035_0012342 | 3300049822 | Bacteria | 7896 |
| 675 | Ga0501035_0032946 | 3300049822 | Bacteria | 4713 |
| 676 | Ga0501044_0000693 | 3300049823 | Bacteria | 40818 |
| 677 | Ga0501044_0009530 | 3300049823 | Bacteria | 10573 |
| 678 | Ga0501044_0010994 | 3300049823 | Bacteria | 9826 |
| 679 | Ga0501044_0013382 | 3300049823 | Bacteria | 8871 |
| 680 | Ga0501044_0609886 | 3300049823 | Bacteria | 984 |
| 681 | nmdc:mga03683_75355_c1 | 3300050489 | Bacteria | 1449 |
| 682 | nmdc:mga00v17_83071_c1 | 3300050491 | Bacteria | 2003 |
| 683 | nmdc:mga00v17_8686_c1 | 3300050491 | Bacteria | 5471 |
| 684 | nmdc:mga0k408_119151_c1 | 3300050493 | Bacteria | 1563 |
| 685 | nmdc:mga0k408_124822_c1 | 3300050493 | Bacteria | 1526 |
| 686 | nmdc:mga0k408_15878_c1 | 3300050493 | Bacteria | 4169 |
| 687 | nmdc:mga0k408_19076_c1 | 3300050493 | Bacteria | 3830 |
| 688 | nmdc:mga0k408_200409_c1 | 3300050493 | Bacteria | 1191 |
| 689 | nmdc:mga0k408_218663_c2 | 3300050493 | Bacteria | 840 |
| 690 | nmdc:mga0k408_25901_c1 | 3300050493 | Bacteria | 3324 |
| 691 | nmdc:mga0k408_3369_c1 | 3300050493 | Bacteria | 8465 |
| 692 | nmdc:mga0k408_84918_c1 | 3300050493 | Bacteria | 1858 |
| 693 | nmdc:mga06z11_4534_c1 | 3300050494 | Bacteria | 5472 |
| 694 | nmdc:mga07m45_61534_c1 | 3300050496 | Bacteria | 2127 |
| 695 | nmdc:mga07m45_6946_c1 | 3300050496 | Bacteria | 5757 |
| 696 | nmdc:mga07m45_83228_c1 | 3300050496 | Bacteria | 1828 |
| 697 | nmdc:mga07m45_9087_c1 | 3300050496 | Bacteria | 5136 |
| 698 | Ga0495619_0136408 | 3300053085 | Bacteria | 1688 |
| 699 | Ga0495619_0198423 | 3300053085 | Bacteria | 1389 |
| 700 | Ga0500643_003747 | 3300053087 | Bacteria | 7144 |
| 701 | Ga0500643_036839 | 3300053087 | Bacteria | 1459 |
| 702 | Ga0500651_0003737 | 3300053093 | Bacteria | 8384 |
| 703 | Ga0500650_0000007 | 3300053098 | Bacteria | 108097 |
| 704 | Ga0500650_0062862 | 3300053098 | Bacteria | 1734 |
| 705 | Ga0500592_000008 | 3300053116 | Bacteria | 89104 |
| 706 | Ga0500594_0001043 | 3300053118 | Bacteria | 5931 |
| 707 | Ga0500652_053689 | 3300053131 | Bacteria | 1649 |
| 708 | Ga0500559_0000446 | 3300053136 | Bacteria | 29360 |
| 709 | Ga0500568_0011845 | 3300053139 | Bacteria | 4028 |
| 710 | Ga0500604_0021916 | 3300053151 | Bacteria | 1810 |
| 711 | Ga0500622_0000111 | 3300053156 | Bacteria | 83844 |
| 712 | Ga0500627_0000055 | 3300053158 | Bacteria | 54775 |
| 713 | Ga0500627_0176825 | 3300053158 | Bacteria | 960 |
| 714 | Ga0500637_0199804 | 3300053178 | Bacteria | 1139 |
| 715 | Ga0501082_0052471 | 3300060353 | Bacteria | 3515 |
| 716 | Ga0466962_0039510 | 3300061719 | Bacteria | 2259 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049580 | Ga0501046_0517468 | Ga0501046_0517468_108_830 | 240 |
| 2 | iso_pu_bacteria | 2511231008 | 2511277167 | 241 |
| 3 | 3300005295 | Ga0065707_10081888 | Ga0065707_100818885 | 245 |
| 4 | 3300005719 | Ga0068861_100003863 | Ga0068861_1000038637 | 245 |
| 5 | 3300014326 | Ga0157380_10088577 | Ga0157380_100885773 | 245 |
| 6 | 3300026118 | Ga0207675_100026312 | Ga0207675_1000263123 | 245 |
| 7 | 3300048921 | Ga0496118_0098504 | Ga0496118_0098504_1178_1954 | 245 |
| 8 | iso_pu_bacteria | 2855730933 | 2855731543 | 245 |
| 9 | iso_pu_bacteria | 2855767633 | 2855768249 | 245 |
| 10 | 3300045051 | Ga0451576_0041165 | Ga0451576_0041165_2498_3274 | 247 |
| 11 | 3300042876 | Ga0451577_0024273 | Ga0451577_0024273_3127_3903 | 248 |
| 12 | 3300044683 | Ga0466965_0287942 | Ga0466965_0287942_29_778 | 249 |
| 13 | 3300044712 | Ga0453684_0003853 | Ga0453684_0003853_21504_22283 | 249 |
| 14 | 3300045051 | Ga0451576_0080415 | Ga0451576_0080415_1754_2530 | 249 |
| 15 | 3300026067 | Ga0207678_10126887 | Ga0207678_101268872 | 253 |
| 16 | iso_pu_bacteria | 2534681786 | 2535484106 | 254 |
| 17 | iso_pu_bacteria | 2574179768 | 2574432028 | 254 |
| 18 | iso_pu_bacteria | 2574179768 | 2574433328 | 254 |
| 19 | iso_pu_bacteria | 2738541276 | 2738715362 | 254 |
| 20 | iso_pu_bacteria | 2854911287 | 2854914248 | 254 |
| 21 | iso_pu_bacteria | 2857537821 | 2857541363 | 254 |
| 22 | iso_pu_bacteria | 2858950400 | 2858951678 | 254 |
| 23 | iso_pu_bacteria | 2881412998 | 2881413582 | 254 |
| 24 | iso_pu_bacteria | 2891633521 | 2891634527 | 254 |
| 25 | iso_pu_bacteria | 2904479285 | 2904481271 | 254 |
| 26 | iso_pu_bacteria | 2915650412 | 2915651130 | 254 |
| 27 | iso_pu_bacteria | 2917832318 | 2917835014 | 254 |
| 28 | iso_pu_bacteria | 2941479691 | 2941483163 | 254 |
| 29 | iso_pu_bacteria | 2984504281 | 2984505176 | 254 |
| 30 | iso_pu_bacteria | 639633007 | 639787813 | 254 |
| 31 | iso_pu_bacteria | 8002392321 | 8002394356 | 254 |
| 32 | iso_pu_bacteria | 8002745576 | 8002748838 | 254 |
| 33 | iso_pu_bacteria | 8048746797 | 8048749403 | 254 |
| 34 | iso_pu_bacteria | 8055225921 | 8055229030 | 254 |
| 35 | 3300003578 | Ga0006562J51391_1031350 | Ga0006562J51391_10313501 | 257 |
| 36 | 3300005343 | Ga0070687_100322952 | Ga0070687_1003229521 | 257 |
| 37 | 3300005366 | Ga0070659_100039920 | Ga0070659_1000399203 | 257 |
| 38 | 3300005458 | Ga0070681_10180756 | Ga0070681_101807561 | 257 |
| 39 | 3300005530 | Ga0070679_100025237 | Ga0070679_1000252371 | 257 |
| 40 | 3300005530 | Ga0070679_100107585 | Ga0070679_1001075851 | 257 |
| 41 | 3300005563 | Ga0068855_100408654 | Ga0068855_1004086542 | 257 |
| 42 | 3300006195 | Ga0075366_10088782 | Ga0075366_100887823 | 257 |
| 43 | 3300009093 | Ga0105240_10000706 | Ga0105240_1000070628 | 257 |
| 44 | 3300009545 | Ga0105237_10000048 | Ga0105237_10000048146 | 257 |
| 45 | 3300010375 | Ga0105239_10062082 | Ga0105239_100620825 | 257 |
| 46 | 3300010375 | Ga0105239_10314913 | Ga0105239_103149131 | 257 |
| 47 | 3300025909 | Ga0207705_10033965 | Ga0207705_100339653 | 257 |
| 48 | 3300025910 | Ga0207684_10453426 | Ga0207684_104534261 | 257 |
| 49 | 3300025912 | Ga0207707_10150408 | Ga0207707_101504083 | 257 |
| 50 | 3300025913 | Ga0207695_10004844 | Ga0207695_1000484410 | 257 |
| 51 | 3300025914 | Ga0207671_10000077 | Ga0207671_1000007765 | 257 |
| 52 | 3300025918 | Ga0207662_10058525 | Ga0207662_100585252 | 257 |
| 53 | 3300025921 | Ga0207652_10028046 | Ga0207652_100280464 | 257 |
| 54 | 3300025921 | Ga0207652_10075574 | Ga0207652_100755741 | 257 |
| 55 | 3300025924 | Ga0207694_10013058 | Ga0207694_100130581 | 257 |
| 56 | 3300026078 | Ga0207702_10247974 | Ga0207702_102479741 | 257 |
| 57 | 3300026078 | Ga0207702_10811363 | Ga0207702_108113631 | 257 |
| 58 | 3300028563 | Ga0265319_1036053 | Ga0265319_10360532 | 257 |
| 59 | 3300028577 | Ga0265318_10000011 | Ga0265318_1000001147 | 257 |
| 60 | 3300031235 | Ga0265330_10000019 | Ga0265330_10000019102 | 257 |
| 61 | 3300031238 | Ga0265332_10000209 | Ga0265332_1000020929 | 257 |
| 62 | 3300031239 | Ga0265328_10020600 | Ga0265328_100206001 | 257 |
| 63 | 3300031240 | Ga0265320_10000005 | Ga0265320_10000005273 | 257 |
| 64 | 3300031240 | Ga0265320_10086885 | Ga0265320_100868851 | 257 |
| 65 | 3300031242 | Ga0265329_10000727 | Ga0265329_100007275 | 257 |
| 66 | 3300031250 | Ga0265331_10000207 | Ga0265331_1000020715 | 257 |
| 67 | 3300031595 | Ga0265313_10000019 | Ga0265313_10000019131 | 257 |
| 68 | 3300031595 | Ga0265313_10068906 | Ga0265313_100689062 | 257 |
| 69 | 3300031595 | Ga0265313_10082124 | Ga0265313_100821242 | 257 |
| 70 | 3300031711 | Ga0265314_10002597 | Ga0265314_100025972 | 257 |
| 71 | 3300031712 | Ga0265342_10215283 | Ga0265342_102152831 | 257 |
| 72 | 3300034818 | Ga0373950_0000070 | Ga0373950_0000070_25870_26646 | 257 |
| 73 | 3300042876 | Ga0451577_0093882 | Ga0451577_0093882_543_1316 | 257 |
| 74 | 3300044712 | Ga0453684_0646593 | Ga0453684_0646593_53_826 | 257 |
| 75 | 3300048927 | Ga0496124_0008879 | Ga0496124_0008879_6882_7655 | 257 |
| 76 | 3300049583 | Ga0501067_0000032 | Ga0501067_0000032_10049_10825 | 257 |
| 77 | 3300049584 | Ga0501068_0009627 | Ga0501068_0009627_1817_2593 | 257 |
| 78 | 3300049586 | Ga0501070_0296629 | Ga0501070_0296629_443_1219 | 257 |
| 79 | 3300049589 | Ga0501073_0003918 | Ga0501073_0003918_6326_7102 | 257 |
| 80 | 3300049589 | Ga0501073_0035750 | Ga0501073_0035750_23_799 | 257 |
| 81 | 3300049590 | Ga0501074_0017424 | Ga0501074_0017424_4214_4990 | 257 |
| 82 | 3300049744 | Ga0501083_0008135 | Ga0501083_0008135_6314_7090 | 257 |
| 83 | 3300049823 | Ga0501044_0609886 | Ga0501044_0609886_124_897 | 257 |
| 84 | 3300050493 | nmdc:mga0k408_218663_c2 | nmdc:mga0k408_218663_c2_47_820 | 257 |
| 85 | 3300050493 | nmdc:mga0k408_84918_c1 | nmdc:mga0k408_84918_c1_891_1664 | 257 |
| 86 | 3300053098 | Ga0500650_0000007 | Ga0500650_0000007_21162_21935 | 257 |
| 87 | 3300060353 | Ga0501082_0052471 | Ga0501082_0052471_148_924 | 257 |
| 88 | 3300003320 | rootH2_10265435 | rootH2_102654354 | 258 |
| 89 | 3300003323 | rootH1_10007832 | rootH1_100078323 | 258 |
| 90 | 3300003323 | rootH1_10013353 | rootH1_100133533 | 258 |
| 91 | 3300003761 | Ga0055535_1000326 | Ga0055535_100032635 | 258 |
| 92 | 3300003763 | Ga0055529_1000053 | Ga0055529_100005374 | 258 |
| 93 | 3300005293 | Ga0065715_10108371 | Ga0065715_101083712 | 258 |
| 94 | 3300005328 | Ga0070676_10011536 | Ga0070676_100115364 | 258 |
| 95 | 3300005328 | Ga0070676_10011678 | Ga0070676_100116783 | 258 |
| 96 | 3300005328 | Ga0070676_10018496 | Ga0070676_100184962 | 258 |
| 97 | 3300005329 | Ga0070683_100161729 | Ga0070683_1001617292 | 258 |
| 98 | 3300005330 | Ga0070690_100146050 | Ga0070690_1001460502 | 258 |
| 99 | 3300005331 | Ga0070670_100011021 | Ga0070670_1000110214 | 258 |
| 100 | 3300005331 | Ga0070670_100012601 | Ga0070670_1000126014 | 258 |
| 101 | 3300005331 | Ga0070670_100109486 | Ga0070670_1001094863 | 258 |
| 102 | 3300005331 | Ga0070670_100125470 | Ga0070670_1001254702 | 258 |
| 103 | 3300005333 | Ga0070677_10015903 | Ga0070677_100159032 | 258 |
| 104 | 3300005333 | Ga0070677_10047534 | Ga0070677_100475342 | 258 |
| 105 | 3300005333 | Ga0070677_10068897 | Ga0070677_100688972 | 258 |
| 106 | 3300005334 | Ga0068869_100004489 | Ga0068869_1000044897 | 258 |
| 107 | 3300005334 | Ga0068869_100007554 | Ga0068869_1000075543 | 258 |
| 108 | 3300005335 | Ga0070666_10029393 | Ga0070666_100293934 | 258 |
| 109 | 3300005338 | Ga0068868_100022208 | Ga0068868_1000222084 | 258 |
| 110 | 3300005338 | Ga0068868_100215370 | Ga0068868_1002153702 | 258 |
| 111 | 3300005338 | Ga0068868_100317455 | Ga0068868_1003174552 | 258 |
| 112 | 3300005338 | Ga0068868_100392174 | Ga0068868_1003921742 | 258 |
| 113 | 3300005343 | Ga0070687_100002759 | Ga0070687_1000027595 | 258 |
| 114 | 3300005343 | Ga0070687_100014191 | Ga0070687_1000141914 | 258 |
| 115 | 3300005344 | Ga0070661_100008395 | Ga0070661_1000083955 | 258 |
| 116 | 3300005344 | Ga0070661_100299886 | Ga0070661_1002998862 | 258 |
| 117 | 3300005344 | Ga0070661_100307367 | Ga0070661_1003073672 | 258 |
| 118 | 3300005347 | Ga0070668_100010597 | Ga0070668_1000105974 | 258 |
| 119 | 3300005347 | Ga0070668_100140552 | Ga0070668_1001405523 | 258 |
| 120 | 3300005353 | Ga0070669_100005375 | Ga0070669_1000053754 | 258 |
| 121 | 3300005353 | Ga0070669_100009750 | Ga0070669_1000097505 | 258 |
| 122 | 3300005353 | Ga0070669_100534804 | Ga0070669_1005348041 | 258 |
| 123 | 3300005354 | Ga0070675_100013532 | Ga0070675_1000135325 | 258 |
| 124 | 3300005354 | Ga0070675_100043334 | Ga0070675_1000433344 | 258 |
| 125 | 3300005354 | Ga0070675_100046663 | Ga0070675_1000466632 | 258 |
| 126 | 3300005354 | Ga0070675_100109109 | Ga0070675_1001091093 | 258 |
| 127 | 3300005355 | Ga0070671_100000534 | Ga0070671_10000053425 | 258 |
| 128 | 3300005355 | Ga0070671_100039382 | Ga0070671_1000393823 | 258 |
| 129 | 3300005355 | Ga0070671_100040943 | Ga0070671_1000409432 | 258 |
| 130 | 3300005355 | Ga0070671_100273614 | Ga0070671_1002736142 | 258 |
| 131 | 3300005356 | Ga0070674_100002413 | Ga0070674_1000024135 | 258 |
| 132 | 3300005356 | Ga0070674_100004864 | Ga0070674_1000048643 | 258 |
| 133 | 3300005356 | Ga0070674_100014620 | Ga0070674_1000146204 | 258 |
| 134 | 3300005356 | Ga0070674_100119715 | Ga0070674_1001197153 | 258 |
| 135 | 3300005356 | Ga0070674_100184270 | Ga0070674_1001842702 | 258 |
| 136 | 3300005364 | Ga0070673_100000789 | Ga0070673_1000007896 | 258 |
| 137 | 3300005364 | Ga0070673_100006551 | Ga0070673_1000065512 | 258 |
| 138 | 3300005364 | Ga0070673_100028497 | Ga0070673_1000284975 | 258 |
| 139 | 3300005366 | Ga0070659_100007809 | Ga0070659_1000078095 | 258 |
| 140 | 3300005366 | Ga0070659_100038858 | Ga0070659_1000388584 | 258 |
| 141 | 3300005366 | Ga0070659_100404102 | Ga0070659_1004041022 | 258 |
| 142 | 3300005367 | Ga0070667_100029025 | Ga0070667_1000290252 | 258 |
| 143 | 3300005367 | Ga0070667_100096568 | Ga0070667_1000965682 | 258 |
| 144 | 3300005441 | Ga0070700_100372176 | Ga0070700_1003721761 | 258 |
| 145 | 3300005444 | Ga0070694_100090009 | Ga0070694_1000900091 | 258 |
| 146 | 3300005455 | Ga0070663_100023029 | Ga0070663_1000230293 | 258 |
| 147 | 3300005455 | Ga0070663_100136784 | Ga0070663_1001367842 | 258 |
| 148 | 3300005455 | Ga0070663_100263891 | Ga0070663_1002638911 | 258 |
| 149 | 3300005456 | Ga0070678_100030214 | Ga0070678_1000302143 | 258 |
| 150 | 3300005456 | Ga0070678_100244319 | Ga0070678_1002443192 | 258 |
| 151 | 3300005457 | Ga0070662_100001314 | Ga0070662_10000131410 | 258 |
| 152 | 3300005457 | Ga0070662_100003868 | Ga0070662_1000038687 | 258 |
| 153 | 3300005457 | Ga0070662_100015654 | Ga0070662_1000156543 | 258 |
| 154 | 3300005457 | Ga0070662_100040799 | Ga0070662_1000407993 | 258 |
| 155 | 3300005457 | Ga0070662_100133212 | Ga0070662_1001332122 | 258 |
| 156 | 3300005457 | Ga0070662_100309501 | Ga0070662_1003095012 | 258 |
| 157 | 3300005458 | Ga0070681_10010756 | Ga0070681_100107568 | 258 |
| 158 | 3300005459 | Ga0068867_100004451 | Ga0068867_1000044514 | 258 |
| 159 | 3300005459 | Ga0068867_100024085 | Ga0068867_1000240856 | 258 |
| 160 | 3300005467 | Ga0070706_100002539 | Ga0070706_10000253915 | 258 |
| 161 | 3300005471 | Ga0070698_100161840 | Ga0070698_1001618403 | 258 |
| 162 | 3300005535 | Ga0070684_100122884 | Ga0070684_1001228842 | 258 |
| 163 | 3300005535 | Ga0070684_100209079 | Ga0070684_1002090792 | 258 |
| 164 | 3300005539 | Ga0068853_100003486 | Ga0068853_1000034863 | 258 |
| 165 | 3300005539 | Ga0068853_100103541 | Ga0068853_1001035413 | 258 |
| 166 | 3300005539 | Ga0068853_100122152 | Ga0068853_1001221522 | 258 |
| 167 | 3300005539 | Ga0068853_100422448 | Ga0068853_1004224482 | 258 |
| 168 | 3300005543 | Ga0070672_100001315 | Ga0070672_10000131510 | 258 |
| 169 | 3300005543 | Ga0070672_100010467 | Ga0070672_1000104674 | 258 |
| 170 | 3300005543 | Ga0070672_100013149 | Ga0070672_1000131493 | 258 |
| 171 | 3300005543 | Ga0070672_100036486 | Ga0070672_1000364862 | 258 |
| 172 | 3300005543 | Ga0070672_100040420 | Ga0070672_1000404204 | 258 |
| 173 | 3300005543 | Ga0070672_100144564 | Ga0070672_1001445642 | 258 |
| 174 | 3300005543 | Ga0070672_100180807 | Ga0070672_1001808072 | 258 |
| 175 | 3300005546 | Ga0070696_100593931 | Ga0070696_1005939311 | 258 |
| 176 | 3300005547 | Ga0070693_100080985 | Ga0070693_1000809852 | 258 |
| 177 | 3300005547 | Ga0070693_100302523 | Ga0070693_1003025232 | 258 |
| 178 | 3300005548 | Ga0070665_100155518 | Ga0070665_1001555182 | 258 |
| 179 | 3300005548 | Ga0070665_100268575 | Ga0070665_1002685752 | 258 |
| 180 | 3300005549 | Ga0070704_100095101 | Ga0070704_1000951012 | 258 |
| 181 | 3300005563 | Ga0068855_100102182 | Ga0068855_1001021823 | 258 |
| 182 | 3300005563 | Ga0068855_100129507 | Ga0068855_1001295073 | 258 |
| 183 | 3300005564 | Ga0070664_100341878 | Ga0070664_1003418782 | 258 |
| 184 | 3300005564 | Ga0070664_100416788 | Ga0070664_1004167882 | 258 |
| 185 | 3300005564 | Ga0070664_100547763 | Ga0070664_1005477631 | 258 |
| 186 | 3300005577 | Ga0068857_100076606 | Ga0068857_1000766062 | 258 |
| 187 | 3300005577 | Ga0068857_100139059 | Ga0068857_1001390592 | 258 |
| 188 | 3300005577 | Ga0068857_100290056 | Ga0068857_1002900562 | 258 |
| 189 | 3300005578 | Ga0068854_100005390 | Ga0068854_1000053903 | 258 |
| 190 | 3300005578 | Ga0068854_100013308 | Ga0068854_1000133086 | 258 |
| 191 | 3300005578 | Ga0068854_100263266 | Ga0068854_1002632662 | 258 |
| 192 | 3300005614 | Ga0068856_100008252 | Ga0068856_1000082525 | 258 |
| 193 | 3300005614 | Ga0068856_100147831 | Ga0068856_1001478312 | 258 |
| 194 | 3300005616 | Ga0068852_100068084 | Ga0068852_1000680842 | 258 |
| 195 | 3300005616 | Ga0068852_100092165 | Ga0068852_1000921654 | 258 |
| 196 | 3300005618 | Ga0068864_100015826 | Ga0068864_1000158262 | 258 |
| 197 | 3300005618 | Ga0068864_100084608 | Ga0068864_1000846082 | 258 |
| 198 | 3300005718 | Ga0068866_10013868 | Ga0068866_100138685 | 258 |
| 199 | 3300005718 | Ga0068866_10056834 | Ga0068866_100568343 | 258 |
| 200 | 3300005719 | Ga0068861_100008132 | Ga0068861_1000081324 | 258 |
| 201 | 3300005719 | Ga0068861_100008314 | Ga0068861_1000083145 | 258 |
| 202 | 3300005834 | Ga0068851_10012946 | Ga0068851_100129464 | 258 |
| 203 | 3300005834 | Ga0068851_10017761 | Ga0068851_100177614 | 258 |
| 204 | 3300005834 | Ga0068851_10131784 | Ga0068851_101317842 | 258 |
| 205 | 3300005840 | Ga0068870_10002894 | Ga0068870_100028945 | 258 |
| 206 | 3300005840 | Ga0068870_10034500 | Ga0068870_100345001 | 258 |
| 207 | 3300005840 | Ga0068870_10147721 | Ga0068870_101477211 | 258 |
| 208 | 3300005841 | Ga0068863_100175614 | Ga0068863_1001756143 | 258 |
| 209 | 3300005841 | Ga0068863_100458604 | Ga0068863_1004586042 | 258 |
| 210 | 3300005842 | Ga0068858_100033342 | Ga0068858_1000333424 | 258 |
| 211 | 3300005842 | Ga0068858_100037802 | Ga0068858_1000378024 | 258 |
| 212 | 3300005843 | Ga0068860_100052139 | Ga0068860_1000521394 | 258 |
| 213 | 3300005844 | Ga0068862_100039379 | Ga0068862_1000393794 | 258 |
| 214 | 3300006051 | Ga0075364_10012125 | Ga0075364_100121252 | 258 |
| 215 | 3300006178 | Ga0075367_10018271 | Ga0075367_100182714 | 258 |
| 216 | 3300006186 | Ga0075369_10074872 | Ga0075369_100748722 | 258 |
| 217 | 3300006195 | Ga0075366_10016003 | Ga0075366_100160032 | 258 |
| 218 | 3300006195 | Ga0075366_10062487 | Ga0075366_100624873 | 258 |
| 219 | 3300006195 | Ga0075366_10086812 | Ga0075366_100868123 | 258 |
| 220 | 3300006237 | Ga0097621_100023459 | Ga0097621_1000234592 | 258 |
| 221 | 3300006237 | Ga0097621_100030919 | Ga0097621_1000309192 | 258 |
| 222 | 3300006353 | Ga0075370_10001199 | Ga0075370_100011997 | 258 |
| 223 | 3300006353 | Ga0075370_10004021 | Ga0075370_100040216 | 258 |
| 224 | 3300006353 | Ga0075370_10033742 | Ga0075370_100337423 | 258 |
| 225 | 3300006353 | Ga0075370_10073530 | Ga0075370_100735303 | 258 |
| 226 | 3300006358 | Ga0068871_100054306 | Ga0068871_1000543062 | 258 |
| 227 | 3300006358 | Ga0068871_100085405 | Ga0068871_1000854054 | 258 |
| 228 | 3300006881 | Ga0068865_100008925 | Ga0068865_1000089255 | 258 |
| 229 | 3300006881 | Ga0068865_100031493 | Ga0068865_1000314932 | 258 |
| 230 | 3300006881 | Ga0068865_100100608 | Ga0068865_1001006082 | 258 |
| 231 | 3300006881 | Ga0068865_100244744 | Ga0068865_1002447442 | 258 |
| 232 | 3300006931 | Ga0097620_100175902 | Ga0097620_1001759023 | 258 |
| 233 | 3300007265 | Ga0099794_10003794 | Ga0099794_100037943 | 258 |
| 234 | 3300007265 | Ga0099794_10047481 | Ga0099794_100474812 | 258 |
| 235 | 3300007788 | Ga0099795_10000120 | Ga0099795_100001208 | 258 |
| 236 | 3300009093 | Ga0105240_10027814 | Ga0105240_100278147 | 258 |
| 237 | 3300009093 | Ga0105240_10130188 | Ga0105240_101301882 | 258 |
| 238 | 3300009093 | Ga0105240_10175720 | Ga0105240_101757202 | 258 |
| 239 | 3300009094 | Ga0111539_10296689 | Ga0111539_102966893 | 258 |
| 240 | 3300009098 | Ga0105245_10060592 | Ga0105245_100605923 | 258 |
| 241 | 3300009098 | Ga0105245_10277001 | Ga0105245_102770013 | 258 |
| 242 | 3300009101 | Ga0105247_10406370 | Ga0105247_104063701 | 258 |
| 243 | 3300009148 | Ga0105243_10013318 | Ga0105243_100133187 | 258 |
| 244 | 3300009148 | Ga0105243_10180310 | Ga0105243_101803102 | 258 |
| 245 | 3300009174 | Ga0105241_10054918 | Ga0105241_100549182 | 258 |
| 246 | 3300009174 | Ga0105241_10346117 | Ga0105241_103461172 | 258 |
| 247 | 3300009176 | Ga0105242_10033767 | Ga0105242_100337674 | 258 |
| 248 | 3300009177 | Ga0105248_10037307 | Ga0105248_100373074 | 258 |
| 249 | 3300009177 | Ga0105248_10118638 | Ga0105248_101186383 | 258 |
| 250 | 3300009177 | Ga0105248_10173206 | Ga0105248_101732063 | 258 |
| 251 | 3300009177 | Ga0105248_10407885 | Ga0105248_104078852 | 258 |
| 252 | 3300009177 | Ga0105248_10556958 | Ga0105248_105569582 | 258 |
| 253 | 3300009545 | Ga0105237_10003764 | Ga0105237_1000376415 | 258 |
| 254 | 3300009545 | Ga0105237_10102263 | Ga0105237_101022632 | 258 |
| 255 | 3300009551 | Ga0105238_10008003 | Ga0105238_100080035 | 258 |
| 256 | 3300009553 | Ga0105249_10046249 | Ga0105249_100462494 | 258 |
| 257 | 3300010159 | Ga0099796_10001454 | Ga0099796_100014543 | 258 |
| 258 | 3300010375 | Ga0105239_10014548 | Ga0105239_100145485 | 258 |
| 259 | 3300010375 | Ga0105239_10066928 | Ga0105239_100669282 | 258 |
| 260 | 3300010375 | Ga0105239_10206315 | Ga0105239_102063153 | 258 |
| 261 | 3300010375 | Ga0105239_10402781 | Ga0105239_104027811 | 258 |
| 262 | 3300011119 | Ga0105246_10085154 | Ga0105246_100851542 | 258 |
| 263 | 3300012498 | Ga0157345_1007296 | Ga0157345_10072961 | 258 |
| 264 | 3300013100 | Ga0157373_10175582 | Ga0157373_101755822 | 258 |
| 265 | 3300013102 | Ga0157371_10188885 | Ga0157371_101888852 | 258 |
| 266 | 3300013104 | Ga0157370_10373940 | Ga0157370_103739402 | 258 |
| 267 | 3300013105 | Ga0157369_10189424 | Ga0157369_101894243 | 258 |
| 268 | 3300013296 | Ga0157374_10000224 | Ga0157374_1000022413 | 258 |
| 269 | 3300013296 | Ga0157374_10032656 | Ga0157374_100326564 | 258 |
| 270 | 3300013296 | Ga0157374_10334911 | Ga0157374_103349112 | 258 |
| 271 | 3300013306 | Ga0163162_10008352 | Ga0163162_100083525 | 258 |
| 272 | 3300013306 | Ga0163162_10192195 | Ga0163162_101921952 | 258 |
| 273 | 3300013306 | Ga0163162_10264813 | Ga0163162_102648132 | 258 |
| 274 | 3300013307 | Ga0157372_10120596 | Ga0157372_101205962 | 258 |
| 275 | 3300013307 | Ga0157372_10166061 | Ga0157372_101660613 | 258 |
| 276 | 3300013308 | Ga0157375_10009765 | Ga0157375_100097655 | 258 |
| 277 | 3300013308 | Ga0157375_10031208 | Ga0157375_100312084 | 258 |
| 278 | 3300013308 | Ga0157375_10031973 | Ga0157375_100319736 | 258 |
| 279 | 3300013308 | Ga0157375_10086108 | Ga0157375_100861085 | 258 |
| 280 | 3300014325 | Ga0163163_10102754 | Ga0163163_101027544 | 258 |
| 281 | 3300014326 | Ga0157380_10024990 | Ga0157380_100249902 | 258 |
| 282 | 3300014326 | Ga0157380_10025167 | Ga0157380_100251673 | 258 |
| 283 | 3300014326 | Ga0157380_10571946 | Ga0157380_105719462 | 258 |
| 284 | 3300014968 | Ga0157379_10039972 | Ga0157379_100399724 | 258 |
| 285 | 3300014968 | Ga0157379_10072147 | Ga0157379_100721472 | 258 |
| 286 | 3300014968 | Ga0157379_10259954 | Ga0157379_102599542 | 258 |
| 287 | 3300014968 | Ga0157379_10295214 | Ga0157379_102952142 | 258 |
| 288 | 3300014968 | Ga0157379_10502082 | Ga0157379_105020822 | 258 |
| 289 | 3300014969 | Ga0157376_10018675 | Ga0157376_100186755 | 258 |
| 290 | 3300014969 | Ga0157376_10205952 | Ga0157376_102059522 | 258 |
| 291 | 3300017792 | Ga0163161_10029151 | Ga0163161_100291514 | 258 |
| 292 | 3300017792 | Ga0163161_10099446 | Ga0163161_100994462 | 258 |
| 293 | 3300017792 | Ga0163161_10206411 | Ga0163161_102064111 | 258 |
| 294 | 3300025242 | Ga0209258_100074 | Ga0209258_10007436 | 258 |
| 295 | 3300025256 | Ga0209759_1000521 | Ga0209759_100052128 | 258 |
| 296 | 3300025261 | Ga0209233_1010646 | Ga0209233_10106462 | 258 |
| 297 | 3300025272 | Ga0209455_1000066 | Ga0209455_100006676 | 258 |
| 298 | 3300025292 | Ga0209676_1014399 | Ga0209676_10143994 | 258 |
| 299 | 3300025304 | Ga0209257_1023440 | Ga0209257_10234403 | 258 |
| 300 | 3300025321 | Ga0207656_10018987 | Ga0207656_100189874 | 258 |
| 301 | 3300025321 | Ga0207656_10062067 | Ga0207656_100620672 | 258 |
| 302 | 3300025893 | Ga0207682_10001514 | Ga0207682_100015145 | 258 |
| 303 | 3300025893 | Ga0207682_10025440 | Ga0207682_100254403 | 258 |
| 304 | 3300025893 | Ga0207682_10074879 | Ga0207682_100748792 | 258 |
| 305 | 3300025893 | Ga0207682_10077183 | Ga0207682_100771832 | 258 |
| 306 | 3300025899 | Ga0207642_10116266 | Ga0207642_101162662 | 258 |
| 307 | 3300025901 | Ga0207688_10024772 | Ga0207688_100247723 | 258 |
| 308 | 3300025901 | Ga0207688_10074441 | Ga0207688_100744412 | 258 |
| 309 | 3300025901 | Ga0207688_10120427 | Ga0207688_101204271 | 258 |
| 310 | 3300025903 | Ga0207680_10039133 | Ga0207680_100391334 | 258 |
| 311 | 3300025903 | Ga0207680_10160718 | Ga0207680_101607182 | 258 |
| 312 | 3300025907 | Ga0207645_10003747 | Ga0207645_100037472 | 258 |
| 313 | 3300025907 | Ga0207645_10009087 | Ga0207645_100090875 | 258 |
| 314 | 3300025907 | Ga0207645_10009373 | Ga0207645_100093734 | 258 |
| 315 | 3300025907 | Ga0207645_10057735 | Ga0207645_100577352 | 258 |
| 316 | 3300025907 | Ga0207645_10157225 | Ga0207645_101572252 | 258 |
| 317 | 3300025907 | Ga0207645_10392791 | Ga0207645_103927911 | 258 |
| 318 | 3300025908 | Ga0207643_10013001 | Ga0207643_100130014 | 258 |
| 319 | 3300025908 | Ga0207643_10052954 | Ga0207643_100529542 | 258 |
| 320 | 3300025909 | Ga0207705_10120206 | Ga0207705_101202062 | 258 |
| 321 | 3300025910 | Ga0207684_10007765 | Ga0207684_100077657 | 258 |
| 322 | 3300025911 | Ga0207654_10226755 | Ga0207654_102267552 | 258 |
| 323 | 3300025913 | Ga0207695_10066130 | Ga0207695_100661304 | 258 |
| 324 | 3300025913 | Ga0207695_10115948 | Ga0207695_101159481 | 258 |
| 325 | 3300025913 | Ga0207695_10231218 | Ga0207695_102312182 | 258 |
| 326 | 3300025913 | Ga0207695_10390665 | Ga0207695_103906651 | 258 |
| 327 | 3300025914 | Ga0207671_10107160 | Ga0207671_101071602 | 258 |
| 328 | 3300025918 | Ga0207662_10007584 | Ga0207662_100075845 | 258 |
| 329 | 3300025918 | Ga0207662_10037414 | Ga0207662_100374143 | 258 |
| 330 | 3300025919 | Ga0207657_10035844 | Ga0207657_100358444 | 258 |
| 331 | 3300025919 | Ga0207657_10124336 | Ga0207657_101243362 | 258 |
| 332 | 3300025919 | Ga0207657_10426487 | Ga0207657_104264871 | 258 |
| 333 | 3300025919 | Ga0207657_10520161 | Ga0207657_105201612 | 258 |
| 334 | 3300025922 | Ga0207646_10052001 | Ga0207646_100520012 | 258 |
| 335 | 3300025923 | Ga0207681_10004549 | Ga0207681_100045495 | 258 |
| 336 | 3300025923 | Ga0207681_10005781 | Ga0207681_100057819 | 258 |
| 337 | 3300025923 | Ga0207681_10097234 | Ga0207681_100972342 | 258 |
| 338 | 3300025923 | Ga0207681_10114053 | Ga0207681_101140533 | 258 |
| 339 | 3300025924 | Ga0207694_10015728 | Ga0207694_100157286 | 258 |
| 340 | 3300025924 | Ga0207694_10024397 | Ga0207694_100243974 | 258 |
| 341 | 3300025924 | Ga0207694_10067557 | Ga0207694_100675573 | 258 |
| 342 | 3300025924 | Ga0207694_10070653 | Ga0207694_100706533 | 258 |
| 343 | 3300025925 | Ga0207650_10001113 | Ga0207650_1000111316 | 258 |
| 344 | 3300025925 | Ga0207650_10002251 | Ga0207650_1000225112 | 258 |
| 345 | 3300025925 | Ga0207650_10036670 | Ga0207650_100366702 | 258 |
| 346 | 3300025925 | Ga0207650_10039567 | Ga0207650_100395674 | 258 |
| 347 | 3300025925 | Ga0207650_10248264 | Ga0207650_102482642 | 258 |
| 348 | 3300025925 | Ga0207650_10760369 | Ga0207650_107603691 | 258 |
| 349 | 3300025926 | Ga0207659_10000343 | Ga0207659_1000034321 | 258 |
| 350 | 3300025926 | Ga0207659_10013872 | Ga0207659_100138724 | 258 |
| 351 | 3300025926 | Ga0207659_10070005 | Ga0207659_100700052 | 258 |
| 352 | 3300025926 | Ga0207659_10198310 | Ga0207659_101983102 | 258 |
| 353 | 3300025927 | Ga0207687_10045643 | Ga0207687_100456433 | 258 |
| 354 | 3300025927 | Ga0207687_10083313 | Ga0207687_100833133 | 258 |
| 355 | 3300025931 | Ga0207644_10007907 | Ga0207644_100079072 | 258 |
| 356 | 3300025931 | Ga0207644_10023290 | Ga0207644_100232902 | 258 |
| 357 | 3300025931 | Ga0207644_10047903 | Ga0207644_100479032 | 258 |
| 358 | 3300025931 | Ga0207644_10328817 | Ga0207644_103288172 | 258 |
| 359 | 3300025932 | Ga0207690_10012761 | Ga0207690_100127613 | 258 |
| 360 | 3300025932 | Ga0207690_10137342 | Ga0207690_101373422 | 258 |
| 361 | 3300025933 | Ga0207706_10000280 | Ga0207706_1000028019 | 258 |
| 362 | 3300025933 | Ga0207706_10064403 | Ga0207706_100644034 | 258 |
| 363 | 3300025933 | Ga0207706_10152553 | Ga0207706_101525532 | 258 |
| 364 | 3300025934 | Ga0207686_10014281 | Ga0207686_100142815 | 258 |
| 365 | 3300025934 | Ga0207686_10278569 | Ga0207686_102785692 | 258 |
| 366 | 3300025935 | Ga0207709_10003697 | Ga0207709_100036977 | 258 |
| 367 | 3300025935 | Ga0207709_10124780 | Ga0207709_101247802 | 258 |
| 368 | 3300025936 | Ga0207670_10377052 | Ga0207670_103770522 | 258 |
| 369 | 3300025937 | Ga0207669_10005448 | Ga0207669_100054484 | 258 |
| 370 | 3300025937 | Ga0207669_10008481 | Ga0207669_100084812 | 258 |
| 371 | 3300025938 | Ga0207704_10048342 | Ga0207704_100483423 | 258 |
| 372 | 3300025938 | Ga0207704_10052070 | Ga0207704_100520702 | 258 |
| 373 | 3300025938 | Ga0207704_10068096 | Ga0207704_100680962 | 258 |
| 374 | 3300025938 | Ga0207704_10111232 | Ga0207704_101112322 | 258 |
| 375 | 3300025938 | Ga0207704_10470769 | Ga0207704_104707692 | 258 |
| 376 | 3300025939 | Ga0207665_10065691 | Ga0207665_100656912 | 258 |
| 377 | 3300025940 | Ga0207691_10002193 | Ga0207691_1000219314 | 258 |
| 378 | 3300025940 | Ga0207691_10002225 | Ga0207691_100022259 | 258 |
| 379 | 3300025940 | Ga0207691_10016300 | Ga0207691_100163006 | 258 |
| 380 | 3300025940 | Ga0207691_10037681 | Ga0207691_100376812 | 258 |
| 381 | 3300025940 | Ga0207691_10072777 | Ga0207691_100727773 | 258 |
| 382 | 3300025940 | Ga0207691_10106410 | Ga0207691_101064102 | 258 |
| 383 | 3300025940 | Ga0207691_10129600 | Ga0207691_101296003 | 258 |
| 384 | 3300025940 | Ga0207691_10162598 | Ga0207691_101625982 | 258 |
| 385 | 3300025940 | Ga0207691_10235009 | Ga0207691_102350092 | 258 |
| 386 | 3300025940 | Ga0207691_10410994 | Ga0207691_104109942 | 258 |
| 387 | 3300025941 | Ga0207711_10127809 | Ga0207711_101278092 | 258 |
| 388 | 3300025941 | Ga0207711_10169205 | Ga0207711_101692052 | 258 |
| 389 | 3300025941 | Ga0207711_10180997 | Ga0207711_101809972 | 258 |
| 390 | 3300025941 | Ga0207711_10185967 | Ga0207711_101859672 | 258 |
| 391 | 3300025941 | Ga0207711_10258323 | Ga0207711_102583232 | 258 |
| 392 | 3300025942 | Ga0207689_10002313 | Ga0207689_100023134 | 258 |
| 393 | 3300025942 | Ga0207689_10015369 | Ga0207689_100153692 | 258 |
| 394 | 3300025942 | Ga0207689_10025978 | Ga0207689_100259784 | 258 |
| 395 | 3300025942 | Ga0207689_10052967 | Ga0207689_100529672 | 258 |
| 396 | 3300025944 | Ga0207661_10083500 | Ga0207661_100835003 | 258 |
| 397 | 3300025949 | Ga0207667_10078147 | Ga0207667_100781472 | 258 |
| 398 | 3300025949 | Ga0207667_10109268 | Ga0207667_101092682 | 258 |
| 399 | 3300025960 | Ga0207651_10000137 | Ga0207651_1000013713 | 258 |
| 400 | 3300025960 | Ga0207651_10012704 | Ga0207651_100127043 | 258 |
| 401 | 3300025960 | Ga0207651_10036963 | Ga0207651_100369635 | 258 |
| 402 | 3300025960 | Ga0207651_10058499 | Ga0207651_100584992 | 258 |
| 403 | 3300025960 | Ga0207651_10242319 | Ga0207651_102423192 | 258 |
| 404 | 3300025960 | Ga0207651_10270130 | Ga0207651_102701302 | 258 |
| 405 | 3300025960 | Ga0207651_10300043 | Ga0207651_103000432 | 258 |
| 406 | 3300025961 | Ga0207712_10067513 | Ga0207712_100675133 | 258 |
| 407 | 3300025961 | Ga0207712_10220600 | Ga0207712_102206002 | 258 |
| 408 | 3300025972 | Ga0207668_10005664 | Ga0207668_100056645 | 258 |
| 409 | 3300025972 | Ga0207668_10235927 | Ga0207668_102359272 | 258 |
| 410 | 3300025981 | Ga0207640_10005332 | Ga0207640_100053322 | 258 |
| 411 | 3300025981 | Ga0207640_10064401 | Ga0207640_100644013 | 258 |
| 412 | 3300025981 | Ga0207640_10136324 | Ga0207640_101363242 | 258 |
| 413 | 3300025981 | Ga0207640_10241861 | Ga0207640_102418612 | 258 |
| 414 | 3300025981 | Ga0207640_10305582 | Ga0207640_103055822 | 258 |
| 415 | 3300025986 | Ga0207658_10000459 | Ga0207658_100004592 | 258 |
| 416 | 3300025986 | Ga0207658_10084597 | Ga0207658_100845972 | 258 |
| 417 | 3300025986 | Ga0207658_10174581 | Ga0207658_101745813 | 258 |
| 418 | 3300026023 | Ga0207677_10007955 | Ga0207677_100079554 | 258 |
| 419 | 3300026023 | Ga0207677_10140814 | Ga0207677_101408143 | 258 |
| 420 | 3300026035 | Ga0207703_10012174 | Ga0207703_100121745 | 258 |
| 421 | 3300026035 | Ga0207703_10021603 | Ga0207703_100216034 | 258 |
| 422 | 3300026041 | Ga0207639_10002665 | Ga0207639_100026653 | 258 |
| 423 | 3300026041 | Ga0207639_10055949 | Ga0207639_100559492 | 258 |
| 424 | 3300026041 | Ga0207639_10182026 | Ga0207639_101820263 | 258 |
| 425 | 3300026041 | Ga0207639_10291334 | Ga0207639_102913341 | 258 |
| 426 | 3300026041 | Ga0207639_10362244 | Ga0207639_103622442 | 258 |
| 427 | 3300026067 | Ga0207678_10099510 | Ga0207678_100995101 | 258 |
| 428 | 3300026067 | Ga0207678_10115586 | Ga0207678_101155862 | 258 |
| 429 | 3300026075 | Ga0207708_10416854 | Ga0207708_104168541 | 258 |
| 430 | 3300026078 | Ga0207702_10040642 | Ga0207702_100406423 | 258 |
| 431 | 3300026078 | Ga0207702_10299801 | Ga0207702_102998012 | 258 |
| 432 | 3300026078 | Ga0207702_10461271 | Ga0207702_104612712 | 258 |
| 433 | 3300026088 | Ga0207641_10008170 | Ga0207641_100081705 | 258 |
| 434 | 3300026088 | Ga0207641_10033206 | Ga0207641_100332063 | 258 |
| 435 | 3300026088 | Ga0207641_10151573 | Ga0207641_101515732 | 258 |
| 436 | 3300026088 | Ga0207641_10256236 | Ga0207641_102562362 | 258 |
| 437 | 3300026089 | Ga0207648_10000878 | Ga0207648_1000087816 | 258 |
| 438 | 3300026089 | Ga0207648_10007913 | Ga0207648_100079134 | 258 |
| 439 | 3300026089 | Ga0207648_10010992 | Ga0207648_100109925 | 258 |
| 440 | 3300026089 | Ga0207648_10034718 | Ga0207648_100347182 | 258 |
| 441 | 3300026089 | Ga0207648_10075011 | Ga0207648_100750113 | 258 |
| 442 | 3300026089 | Ga0207648_10104646 | Ga0207648_101046462 | 258 |
| 443 | 3300026089 | Ga0207648_10131009 | Ga0207648_101310092 | 258 |
| 444 | 3300026095 | Ga0207676_10009121 | Ga0207676_100091214 | 258 |
| 445 | 3300026095 | Ga0207676_10010157 | Ga0207676_100101577 | 258 |
| 446 | 3300026095 | Ga0207676_10041155 | Ga0207676_100411552 | 258 |
| 447 | 3300026095 | Ga0207676_10105478 | Ga0207676_101054781 | 258 |
| 448 | 3300026095 | Ga0207676_10226519 | Ga0207676_102265192 | 258 |
| 449 | 3300026095 | Ga0207676_10261380 | Ga0207676_102613802 | 258 |
| 450 | 3300026116 | Ga0207674_10015428 | Ga0207674_100154283 | 258 |
| 451 | 3300026116 | Ga0207674_10053226 | Ga0207674_100532264 | 258 |
| 452 | 3300026118 | Ga0207675_100005117 | Ga0207675_1000051174 | 258 |
| 453 | 3300026118 | Ga0207675_100059251 | Ga0207675_1000592513 | 258 |
| 454 | 3300026118 | Ga0207675_100166081 | Ga0207675_1001660812 | 258 |
| 455 | 3300026121 | Ga0207683_10012895 | Ga0207683_100128955 | 258 |
| 456 | 3300026121 | Ga0207683_10026507 | Ga0207683_100265077 | 258 |
| 457 | 3300026121 | Ga0207683_10303248 | Ga0207683_103032482 | 258 |
| 458 | 3300026121 | Ga0207683_10559139 | Ga0207683_105591392 | 258 |
| 459 | 3300026142 | Ga0207698_10028871 | Ga0207698_100288712 | 258 |
| 460 | 3300026142 | Ga0207698_10030460 | Ga0207698_100304602 | 258 |
| 461 | 3300026142 | Ga0207698_10034956 | Ga0207698_100349563 | 258 |
| 462 | 3300026142 | Ga0207698_10451857 | Ga0207698_104518571 | 258 |
| 463 | 3300027312 | Ga0209371_1023392 | Ga0209371_10233922 | 258 |
| 464 | 3300027671 | Ga0209588_1048046 | Ga0209588_10480462 | 258 |
| 465 | 3300028016 | Ga0265354_1002352 | Ga0265354_10023523 | 258 |
| 466 | 3300028379 | Ga0268266_10098696 | Ga0268266_100986963 | 258 |
| 467 | 3300028379 | Ga0268266_10873387 | Ga0268266_108733871 | 258 |
| 468 | 3300028380 | Ga0268265_10030187 | Ga0268265_100301871 | 258 |
| 469 | 3300028380 | Ga0268265_10040482 | Ga0268265_100404824 | 258 |
| 470 | 3300028381 | Ga0268264_10015847 | Ga0268264_100158475 | 258 |
| 471 | 3300028381 | Ga0268264_10072826 | Ga0268264_100728261 | 258 |
| 472 | 3300028573 | Ga0265334_10001873 | Ga0265334_100018731 | 258 |
| 473 | 3300028786 | Ga0307517_10000131 | Ga0307517_1000013143 | 258 |
| 474 | 3300028794 | Ga0307515_10010230 | Ga0307515_1001023013 | 258 |
| 475 | 3300028794 | Ga0307515_10016716 | Ga0307515_1001671612 | 258 |
| 476 | 3300028794 | Ga0307515_10045865 | Ga0307515_100458651 | 258 |
| 477 | 3300030500 | Ga0268256_1026586 | Ga0268256_10265862 | 258 |
| 478 | 3300030522 | Ga0307512_10014097 | Ga0307512_100140977 | 258 |
| 479 | 3300030522 | Ga0307512_10077087 | Ga0307512_100770873 | 258 |
| 480 | 3300031090 | Ga0265760_10000144 | Ga0265760_100001445 | 258 |
| 481 | 3300031251 | Ga0265327_10012683 | Ga0265327_100126832 | 258 |
| 482 | 3300031507 | Ga0307509_10002009 | Ga0307509_100020096 | 258 |
| 483 | 3300031507 | Ga0307509_10003678 | Ga0307509_1000367818 | 258 |
| 484 | 3300031507 | Ga0307509_10004862 | Ga0307509_1000486218 | 258 |
| 485 | 3300031507 | Ga0307509_10044590 | Ga0307509_100445903 | 258 |
| 486 | 3300031548 | Ga0307408_100017706 | Ga0307408_1000177063 | 258 |
| 487 | 3300031548 | Ga0307408_100167002 | Ga0307408_1001670022 | 258 |
| 488 | 3300031548 | Ga0307408_100215769 | Ga0307408_1002157692 | 258 |
| 489 | 3300031616 | Ga0307508_10002648 | Ga0307508_100026487 | 258 |
| 490 | 3300031616 | Ga0307508_10082842 | Ga0307508_100828422 | 258 |
| 491 | 3300031649 | Ga0307514_10026868 | Ga0307514_100268684 | 258 |
| 492 | 3300031649 | Ga0307514_10091098 | Ga0307514_100910983 | 258 |
| 493 | 3300031730 | Ga0307516_10000148 | Ga0307516_1000014861 | 258 |
| 494 | 3300031730 | Ga0307516_10000244 | Ga0307516_100002445 | 258 |
| 495 | 3300031730 | Ga0307516_10000419 | Ga0307516_1000041926 | 258 |
| 496 | 3300031730 | Ga0307516_10141850 | Ga0307516_101418502 | 258 |
| 497 | 3300031730 | Ga0307516_10252142 | Ga0307516_102521422 | 258 |
| 498 | 3300031730 | Ga0307516_10295794 | Ga0307516_102957942 | 258 |
| 499 | 3300031731 | Ga0307405_10408028 | Ga0307405_104080282 | 258 |
| 500 | 3300031824 | Ga0307413_10000991 | Ga0307413_100009915 | 258 |
| 501 | 3300031824 | Ga0307413_10102515 | Ga0307413_101025152 | 258 |
| 502 | 3300031852 | Ga0307410_10016802 | Ga0307410_100168021 | 258 |
| 503 | 3300031852 | Ga0307410_10370898 | Ga0307410_103708981 | 258 |
| 504 | 3300031852 | Ga0307410_10512792 | Ga0307410_105127921 | 258 |
| 505 | 3300031901 | Ga0307406_10013821 | Ga0307406_100138213 | 258 |
| 506 | 3300031901 | Ga0307406_10025879 | Ga0307406_100258793 | 258 |
| 507 | 3300031903 | Ga0307407_10215087 | Ga0307407_102150872 | 258 |
| 508 | 3300031903 | Ga0307407_10406174 | Ga0307407_104061741 | 258 |
| 509 | 3300031911 | Ga0307412_10001535 | Ga0307412_1000153511 | 258 |
| 510 | 3300031911 | Ga0307412_10008145 | Ga0307412_100081458 | 258 |
| 511 | 3300031995 | Ga0307409_100008870 | Ga0307409_1000088704 | 258 |
| 512 | 3300031995 | Ga0307409_100008875 | Ga0307409_1000088758 | 258 |
| 513 | 3300031995 | Ga0307409_100318569 | Ga0307409_1003185692 | 258 |
| 514 | 3300032002 | Ga0307416_100039771 | Ga0307416_1000397714 | 258 |
| 515 | 3300032002 | Ga0307416_100299941 | Ga0307416_1002999412 | 258 |
| 516 | 3300032002 | Ga0307416_100787306 | Ga0307416_1007873062 | 258 |
| 517 | 3300032004 | Ga0307414_10053015 | Ga0307414_100530152 | 258 |
| 518 | 3300032004 | Ga0307414_10065461 | Ga0307414_100654613 | 258 |
| 519 | 3300032005 | Ga0307411_10010745 | Ga0307411_100107453 | 258 |
| 520 | 3300032126 | Ga0307415_100020682 | Ga0307415_1000206824 | 258 |
| 521 | 3300033179 | Ga0307507_10047402 | Ga0307507_100474024 | 258 |
| 522 | 3300033180 | Ga0307510_10005846 | Ga0307510_1000584612 | 258 |
| 523 | 3300033180 | Ga0307510_10026370 | Ga0307510_100263707 | 258 |
| 524 | 3300033180 | Ga0307510_10040673 | Ga0307510_100406735 | 258 |
| 525 | 3300033180 | Ga0307510_10180482 | Ga0307510_101804822 | 258 |
| 526 | 3300034957 | Ga0373938_0017392 | Ga0373938_0017392_617_1393 | 258 |
| 527 | 3300035084 | Ga0373928_0013521 | Ga0373928_0013521_576_1352 | 258 |
| 528 | 3300035112 | Ga0373932_0032723 | Ga0373932_0032723_636_1412 | 258 |
| 529 | 3300035115 | Ga0373941_0125815 | Ga0373941_0125815_125_901 | 258 |
| 530 | 3300035121 | Ga0373960_0011567 | Ga0373960_0011567_1225_2001 | 258 |
| 531 | 3300035170 | Ga0373943_0032411 | Ga0373943_0032411_1508_2284 | 258 |
| 532 | 3300035171 | Ga0373946_0203928 | Ga0373946_0203928_35_811 | 258 |
| 533 | 3300035172 | Ga0373955_0122582 | Ga0373955_0122582_186_962 | 258 |
| 534 | 3300035410 | Ga0373924_0010107 | Ga0373924_0010107_1435_2211 | 258 |
| 535 | 3300035410 | Ga0373924_0119360 | Ga0373924_0119360_353_1129 | 258 |
| 536 | 3300035691 | Ga0373931_0018291 | Ga0373931_0018291_221_997 | 258 |
| 537 | 3300035691 | Ga0373931_0026635 | Ga0373931_0026635_568_1344 | 258 |
| 538 | 3300036401 | Ga0373937_0028375 | Ga0373937_0028375_3239_4015 | 258 |
| 539 | 3300037068 | Ga0373925_0085409 | Ga0373925_0085409_910_1686 | 258 |
| 540 | 3300037312 | Ga0395899_0081098 | Ga0395899_0081098_1313_2089 | 258 |
| 541 | 3300037418 | Ga0395900_0000025 | Ga0395900_0000025_199745_200521 | 258 |
| 542 | 3300037466 | Ga0395898_0000893 | Ga0395898_0000893_33382_34158 | 258 |
| 543 | 3300037466 | Ga0395898_0202985 | Ga0395898_0202985_210_986 | 258 |
| 544 | 3300037471 | Ga0395905_0000329 | Ga0395905_0000329_37715_38491 | 258 |
| 545 | 3300037471 | Ga0395905_0006586 | Ga0395905_0006586_10493_11269 | 258 |
| 546 | 3300038443 | Ga0395901_0144709 | Ga0395901_0144709_907_1689 | 258 |
| 547 | 3300039437 | Ga0436365_0217206 | Ga0436365_0217206_452_1228 | 258 |
| 548 | 3300039437 | Ga0436365_1681085 | Ga0436365_1681085_303_1079 | 258 |
| 549 | 3300039447 | Ga0436361_0147510 | Ga0436361_0147510_24253_25029 | 258 |
| 550 | 3300039447 | Ga0436361_0795551 | Ga0436361_0795551_233_1009 | 258 |
| 551 | 3300039450 | Ga0436363_0285956 | Ga0436363_0285956_637_1413 | 258 |
| 552 | 3300041404 | Ga0439436_0059487 | Ga0439436_0059487_235_1011 | 258 |
| 553 | 3300041491 | Ga0451833_0953641 | Ga0451833_0953641_811_1587 | 258 |
| 554 | 3300041509 | Ga0451843_1226642 | Ga0451843_1226642_146_922 | 258 |
| 555 | 3300041512 | Ga0451853_2678590 | Ga0451853_2678590_640_1416 | 258 |
| 556 | 3300042123 | Ga0450921_006991 | Ga0450921_006991_70_846 | 258 |
| 557 | 3300042439 | Ga0439464_0017741 | Ga0439464_0017741_1065_1841 | 258 |
| 558 | 3300044656 | Ga0466969_0000830 | Ga0466969_0000830_11855_12631 | 258 |
| 559 | 3300044673 | Ga0453683_0048715 | Ga0453683_0048715_1097_1873 | 258 |
| 560 | 3300044673 | Ga0453683_0146552 | Ga0453683_0146552_222_998 | 258 |
| 561 | 3300044673 | Ga0453683_0204192 | Ga0453683_0204192_81_857 | 258 |
| 562 | 3300044683 | Ga0466965_0070443 | Ga0466965_0070443_251_1030 | 258 |
| 563 | 3300044684 | Ga0466966_0040681 | Ga0466966_0040681_1435_2211 | 258 |
| 564 | 3300044693 | Ga0466961_0008582 | Ga0466961_0008582_2922_3698 | 258 |
| 565 | 3300044712 | Ga0453684_0058655 | Ga0453684_0058655_605_1381 | 258 |
| 566 | 3300044712 | Ga0453684_1099214 | Ga0453684_1099214_44_820 | 258 |
| 567 | 3300044765 | Ga0466970_0140522 | Ga0466970_0140522_232_1011 | 258 |
| 568 | 3300045049 | Ga0466959_0042728 | Ga0466959_0042728_336_1112 | 258 |
| 569 | 3300045051 | Ga0451576_0000535 | Ga0451576_0000535_15278_16054 | 258 |
| 570 | 3300045051 | Ga0451576_0064872 | Ga0451576_0064872_1180_1956 | 258 |
| 571 | 3300045051 | Ga0451576_0315486 | Ga0451576_0315486_543_1322 | 258 |
| 572 | 3300045976 | Ga0466967_0389845 | Ga0466967_0389845_178_966 | 258 |
| 573 | 3300046454 | Ga0495592_0000394 | Ga0495592_0000394_16833_17609 | 258 |
| 574 | 3300046457 | Ga0495590_0020399 | Ga0495590_0020399_1137_1913 | 258 |
| 575 | 3300046472 | Ga0495580_0110854 | Ga0495580_0110854_762_1538 | 258 |
| 576 | 3300046472 | Ga0495580_0180961 | Ga0495580_0180961_316_1092 | 258 |
| 577 | 3300046474 | Ga0495605_0057705 | Ga0495605_0057705_47_823 | 258 |
| 578 | 3300046517 | Ga0495630_0486680 | Ga0495630_0486680_11_787 | 258 |
| 579 | 3300046519 | Ga0495632_0067443 | Ga0495632_0067443_485_1261 | 258 |
| 580 | 3300046530 | Ga0495654_0060464 | Ga0495654_0060464_452_1228 | 258 |
| 581 | 3300046536 | Ga0495587_0173272 | Ga0495587_0173272_202_978 | 258 |
| 582 | 3300046537 | Ga0495598_0079438 | Ga0495598_0079438_246_1022 | 258 |
| 583 | 3300046539 | Ga0495621_0185404 | Ga0495621_0185404_15_791 | 258 |
| 584 | 3300046543 | Ga0495645_0043051 | Ga0495645_0043051_1447_2223 | 258 |
| 585 | 3300046616 | Ga0495668_0063228 | Ga0495668_0063228_588_1364 | 258 |
| 586 | 3300046642 | Ga0495634_0106617 | Ga0495634_0106617_76_852 | 258 |
| 587 | 3300046663 | Ga0495635_0234220 | Ga0495635_0234220_23_799 | 258 |
| 588 | 3300046683 | Ga0495658_0019632 | Ga0495658_0019632_1243_2019 | 258 |
| 589 | 3300046683 | Ga0495658_0209140 | Ga0495658_0209140_49_825 | 258 |
| 590 | 3300046690 | Ga0495624_0049046 | Ga0495624_0049046_1277_2053 | 258 |
| 591 | 3300046694 | Ga0495649_0004358 | Ga0495649_0004358_967_1743 | 258 |
| 592 | 3300047320 | Ga0495672_0000459 | Ga0495672_0000459_20067_20891 | 258 |
| 593 | 3300047321 | Ga0495676_0149538 | Ga0495676_0149538_580_1356 | 258 |
| 594 | 3300047443 | Ga0495687_002007 | Ga0495687_002007_3182_3958 | 258 |
| 595 | 3300047471 | Ga0495684_0090083 | Ga0495684_0090083_208_984 | 258 |
| 596 | 3300047472 | Ga0495686_0002603 | Ga0495686_0002603_14882_15658 | 258 |
| 597 | 3300047673 | Ga0495593_0108019 | Ga0495593_0108019_162_938 | 258 |
| 598 | 3300048091 | Ga0495626_0104005 | Ga0495626_0104005_264_1040 | 258 |
| 599 | 3300048904 | Ga0496101_0308915 | Ga0496101_0308915_55_831 | 258 |
| 600 | 3300048905 | Ga0496102_0021356 | Ga0496102_0021356_1429_2205 | 258 |
| 601 | 3300048907 | Ga0496104_0850407 | Ga0496104_0850407_12_788 | 258 |
| 602 | 3300048908 | Ga0496105_0035474 | Ga0496105_0035474_1101_1877 | 258 |
| 603 | 3300048910 | Ga0496107_0008694 | Ga0496107_0008694_3454_4230 | 258 |
| 604 | 3300048911 | Ga0496108_0037639 | Ga0496108_0037639_2140_2916 | 258 |
| 605 | 3300048912 | Ga0496109_0065263 | Ga0496109_0065263_1236_2012 | 258 |
| 606 | 3300048912 | Ga0496109_0535054 | Ga0496109_0535054_305_1081 | 258 |
| 607 | 3300048913 | Ga0496110_0094193 | Ga0496110_0094193_1047_1823 | 258 |
| 608 | 3300048913 | Ga0496110_0112180 | Ga0496110_0112180_1658_2434 | 258 |
| 609 | 3300048914 | Ga0496111_0040071 | Ga0496111_0040071_938_1714 | 258 |
| 610 | 3300048917 | Ga0496114_0104997 | Ga0496114_0104997_723_1499 | 258 |
| 611 | 3300048918 | Ga0496115_0026217 | Ga0496115_0026217_3453_4229 | 258 |
| 612 | 3300048919 | Ga0496116_0005768 | Ga0496116_0005768_9615_10391 | 258 |
| 613 | 3300048920 | Ga0496117_0073829 | Ga0496117_0073829_632_1408 | 258 |
| 614 | 3300048921 | Ga0496118_0043390 | Ga0496118_0043390_2568_3344 | 258 |
| 615 | 3300048922 | Ga0496119_0015034 | Ga0496119_0015034_3760_4536 | 258 |
| 616 | 3300048923 | Ga0496120_0071246 | Ga0496120_0071246_343_1119 | 258 |
| 617 | 3300048924 | Ga0496121_0000200 | Ga0496121_0000200_32775_33551 | 258 |
| 618 | 3300048924 | Ga0496121_0017358 | Ga0496121_0017358_4925_5701 | 258 |
| 619 | 3300048925 | Ga0496122_0000021 | Ga0496122_0000021_110013_110789 | 258 |
| 620 | 3300048925 | Ga0496122_0037277 | Ga0496122_0037277_2908_3684 | 258 |
| 621 | 3300048926 | Ga0496123_0000382 | Ga0496123_0000382_56131_56907 | 258 |
| 622 | 3300048926 | Ga0496123_0015028 | Ga0496123_0015028_952_1728 | 258 |
| 623 | 3300048928 | Ga0496125_0000005 | Ga0496125_0000005_394158_394934 | 258 |
| 624 | 3300048928 | Ga0496125_0087395 | Ga0496125_0087395_1013_1789 | 258 |
| 625 | 3300048929 | Ga0496126_0018419 | Ga0496126_0018419_1096_1872 | 258 |
| 626 | 3300048929 | Ga0496126_0080528 | Ga0496126_0080528_811_1587 | 258 |
| 627 | 3300049552 | Ga0501336_007437 | Ga0501336_007437_12_788 | 258 |
| 628 | 3300049573 | Ga0501037_0082650 | Ga0501037_0082650_384_1160 | 258 |
| 629 | 3300049575 | Ga0501039_0556708 | Ga0501039_0556708_69_845 | 258 |
| 630 | 3300049581 | Ga0501047_0003039 | Ga0501047_0003039_13354_14130 | 258 |
| 631 | 3300049581 | Ga0501047_0027619 | Ga0501047_0027619_4413_5189 | 258 |
| 632 | 3300049581 | Ga0501047_0264457 | Ga0501047_0264457_88_864 | 258 |
| 633 | 3300049585 | Ga0501069_0032905 | Ga0501069_0032905_51_827 | 258 |
| 634 | 3300049586 | Ga0501070_0019775 | Ga0501070_0019775_1234_2010 | 258 |
| 635 | 3300049590 | Ga0501074_0024189 | Ga0501074_0024189_2184_2960 | 258 |
| 636 | 3300049650 | Ga0501199_008182 | Ga0501199_008182_44_820 | 258 |
| 637 | 3300049655 | Ga0501208_006262 | Ga0501208_006262_465_1241 | 258 |
| 638 | 3300049662 | Ga0501222_009332 | Ga0501222_009332_179_955 | 258 |
| 639 | 3300049663 | Ga0501223_010048 | Ga0501223_010048_581_1357 | 258 |
| 640 | 3300049686 | Ga0501257_000018 | Ga0501257_000018_45812_46588 | 258 |
| 641 | 3300049742 | Ga0501080_0009668 | Ga0501080_0009668_3461_4237 | 258 |
| 642 | 3300049742 | Ga0501080_0059748 | Ga0501080_0059748_2353_3129 | 258 |
| 643 | 3300049776 | Ga0501280_013230 | Ga0501280_013230_345_1121 | 258 |
| 644 | 3300049822 | Ga0501035_0012342 | Ga0501035_0012342_5817_6593 | 258 |
| 645 | 3300049822 | Ga0501035_0032946 | Ga0501035_0032946_1006_1782 | 258 |
| 646 | 3300049823 | Ga0501044_0000693 | Ga0501044_0000693_30306_31082 | 258 |
| 647 | 3300049823 | Ga0501044_0009530 | Ga0501044_0009530_2014_2790 | 258 |
| 648 | 3300049823 | Ga0501044_0010994 | Ga0501044_0010994_1264_2040 | 258 |
| 649 | 3300049823 | Ga0501044_0013382 | Ga0501044_0013382_3229_4005 | 258 |
| 650 | 3300050489 | nmdc:mga03683_75355_c1 | nmdc:mga03683_75355_c1_315_1091 | 258 |
| 651 | 3300050491 | nmdc:mga00v17_83071_c1 | nmdc:mga00v17_83071_c1_715_1491 | 258 |
| 652 | 3300050491 | nmdc:mga00v17_8686_c1 | nmdc:mga00v17_8686_c1_3163_3939 | 258 |
| 653 | 3300050493 | nmdc:mga0k408_119151_c1 | nmdc:mga0k408_119151_c1_775_1551 | 258 |
| 654 | 3300050493 | nmdc:mga0k408_124822_c1 | nmdc:mga0k408_124822_c1_352_1128 | 258 |
| 655 | 3300050493 | nmdc:mga0k408_15878_c1 | nmdc:mga0k408_15878_c1_3008_3784 | 258 |
| 656 | 3300050493 | nmdc:mga0k408_19076_c1 | nmdc:mga0k408_19076_c1_50_826 | 258 |
| 657 | 3300050493 | nmdc:mga0k408_200409_c1 | nmdc:mga0k408_200409_c1_372_1148 | 258 |
| 658 | 3300050493 | nmdc:mga0k408_25901_c1 | nmdc:mga0k408_25901_c1_629_1405 | 258 |
| 659 | 3300050493 | nmdc:mga0k408_3369_c1 | nmdc:mga0k408_3369_c1_7274_8050 | 258 |
| 660 | 3300050494 | nmdc:mga06z11_4534_c1 | nmdc:mga06z11_4534_c1_3419_4195 | 258 |
| 661 | 3300050496 | nmdc:mga07m45_61534_c1 | nmdc:mga07m45_61534_c1_82_858 | 258 |
| 662 | 3300050496 | nmdc:mga07m45_6946_c1 | nmdc:mga07m45_6946_c1_3880_4656 | 258 |
| 663 | 3300050496 | nmdc:mga07m45_83228_c1 | nmdc:mga07m45_83228_c1_891_1667 | 258 |
| 664 | 3300050496 | nmdc:mga07m45_9087_c1 | nmdc:mga07m45_9087_c1_2841_3617 | 258 |
| 665 | 3300053085 | Ga0495619_0136408 | Ga0495619_0136408_82_858 | 258 |
| 666 | 3300053085 | Ga0495619_0198423 | Ga0495619_0198423_137_913 | 258 |
| 667 | 3300053087 | Ga0500643_003747 | Ga0500643_003747_5828_6604 | 258 |
| 668 | 3300053087 | Ga0500643_036839 | Ga0500643_036839_298_1074 | 258 |
| 669 | 3300053093 | Ga0500651_0003737 | Ga0500651_0003737_2031_2807 | 258 |
| 670 | 3300053098 | Ga0500650_0062862 | Ga0500650_0062862_898_1674 | 258 |
| 671 | 3300053116 | Ga0500592_000008 | Ga0500592_000008_34456_35232 | 258 |
| 672 | 3300053118 | Ga0500594_0001043 | Ga0500594_0001043_1228_2004 | 258 |
| 673 | 3300053131 | Ga0500652_053689 | Ga0500652_053689_60_836 | 258 |
| 674 | 3300053136 | Ga0500559_0000446 | Ga0500559_0000446_18891_19667 | 258 |
| 675 | 3300053139 | Ga0500568_0011845 | Ga0500568_0011845_1418_2194 | 258 |
| 676 | 3300053151 | Ga0500604_0021916 | Ga0500604_0021916_620_1396 | 258 |
| 677 | 3300053156 | Ga0500622_0000111 | Ga0500622_0000111_73556_74332 | 258 |
| 678 | 3300053158 | Ga0500627_0000055 | Ga0500627_0000055_21846_22622 | 258 |
| 679 | 3300053158 | Ga0500627_0176825 | Ga0500627_0176825_11_787 | 258 |
| 680 | 3300053178 | Ga0500637_0199804 | Ga0500637_0199804_95_871 | 258 |
| 681 | 3300061719 | Ga0466962_0039510 | Ga0466962_0039510_1388_2164 | 258 |
| 682 | 3300005336 | Ga0070680_100138924 | Ga0070680_1001389242 | 264 |
| 683 | 3300005530 | Ga0070679_100221626 | Ga0070679_1002216262 | 264 |
| 684 | 3300025917 | Ga0207660_10168998 | Ga0207660_101689982 | 264 |
| 685 | 3300025921 | Ga0207652_10129143 | Ga0207652_101291433 | 264 |
| 686 | 3300044673 | Ga0453683_0091117 | Ga0453683_0091117_349_1155 | 264 |
| 687 | 3300045051 | Ga0451576_0294782 | Ga0451576_0294782_219_1025 | 264 |
| 688 | 3300005347 | Ga0070668_100246096 | Ga0070668_1002460962 | 267 |
| 689 | 3300042533 | Ga0450901_004161 | Ga0450901_004161_20_832 | 267 |
| 690 | 3300003320 | rootH2_10090637 | rootH2_100906372 | 269 |
| 691 | 3300005293 | Ga0065715_10245837 | Ga0065715_102458371 | 269 |
| 692 | 3300005333 | Ga0070677_10022737 | Ga0070677_100227373 | 269 |
| 693 | 3300005335 | Ga0070666_10004510 | Ga0070666_100045103 | 269 |
| 694 | 3300005338 | Ga0068868_100001176 | Ga0068868_10000117610 | 269 |
| 695 | 3300005340 | Ga0070689_100028096 | Ga0070689_1000280963 | 269 |
| 696 | 3300005355 | Ga0070671_100005572 | Ga0070671_1000055722 | 269 |
| 697 | 3300005364 | Ga0070673_100001085 | Ga0070673_1000010859 | 269 |
| 698 | 3300005367 | Ga0070667_100017115 | Ga0070667_1000171154 | 269 |
| 699 | 3300005457 | Ga0070662_100058856 | Ga0070662_1000588562 | 269 |
| 700 | 3300005543 | Ga0070672_100016750 | Ga0070672_1000167503 | 269 |
| 701 | 3300005616 | Ga0068852_100095506 | Ga0068852_1000955062 | 269 |
| 702 | 3300005617 | Ga0068859_100204543 | Ga0068859_1002045432 | 269 |
| 703 | 3300005618 | Ga0068864_100000813 | Ga0068864_10000081316 | 269 |
| 704 | 3300005719 | Ga0068861_100111348 | Ga0068861_1001113481 | 269 |
| 705 | 3300005842 | Ga0068858_100002966 | Ga0068858_10000296612 | 269 |
| 706 | 3300005843 | Ga0068860_100134642 | Ga0068860_1001346422 | 269 |
| 707 | 3300006237 | Ga0097621_100015735 | Ga0097621_1000157352 | 269 |
| 708 | 3300006931 | Ga0097620_100204547 | Ga0097620_1002045472 | 269 |
| 709 | 3300009177 | Ga0105248_10090533 | Ga0105248_100905333 | 269 |
| 710 | 3300013297 | Ga0157378_10118853 | Ga0157378_101188533 | 269 |
| 711 | 3300013306 | Ga0163162_10022095 | Ga0163162_100220953 | 269 |
| 712 | 3300013308 | Ga0157375_10008196 | Ga0157375_100081967 | 269 |
| 713 | 3300014325 | Ga0163163_10007916 | Ga0163163_100079165 | 269 |
| 714 | 3300014968 | Ga0157379_10011793 | Ga0157379_100117932 | 269 |
| 715 | 3300017792 | Ga0163161_10108763 | Ga0163161_101087632 | 269 |
| 716 | 3300025899 | Ga0207642_10147436 | Ga0207642_101474362 | 269 |
| 717 | 3300025903 | Ga0207680_10002999 | Ga0207680_100029993 | 269 |
| 718 | 3300025907 | Ga0207645_10090512 | Ga0207645_100905122 | 269 |
| 719 | 3300025908 | Ga0207643_10031440 | Ga0207643_100314402 | 269 |
| 720 | 3300025925 | Ga0207650_10053612 | Ga0207650_100536122 | 269 |
| 721 | 3300025926 | Ga0207659_10000773 | Ga0207659_100007739 | 269 |
| 722 | 3300025931 | Ga0207644_10038493 | Ga0207644_100384933 | 269 |
| 723 | 3300025936 | Ga0207670_10028602 | Ga0207670_100286023 | 269 |
| 724 | 3300025940 | Ga0207691_10017159 | Ga0207691_100171593 | 269 |
| 725 | 3300025960 | Ga0207651_10000467 | Ga0207651_100004675 | 269 |
| 726 | 3300025986 | Ga0207658_10008081 | Ga0207658_100080814 | 269 |
| 727 | 3300026023 | Ga0207677_10001138 | Ga0207677_100011382 | 269 |
| 728 | 3300026035 | Ga0207703_10002051 | Ga0207703_100020518 | 269 |
| 729 | 3300026088 | Ga0207641_10006901 | Ga0207641_100069016 | 269 |
| 730 | 3300026089 | Ga0207648_10307154 | Ga0207648_103071541 | 269 |
| 731 | 3300026095 | Ga0207676_10003213 | Ga0207676_100032133 | 269 |
| 732 | 3300026118 | Ga0207675_100047083 | Ga0207675_1000470831 | 269 |
| 733 | 3300026121 | Ga0207683_10006134 | Ga0207683_100061344 | 269 |
| 734 | 3300028381 | Ga0268264_10122723 | Ga0268264_101227233 | 269 |
| 735 | 3300046525 | Ga0495663_0000523 | Ga0495663_0000523_6554_7405 | 269 |
| 736 | 3300046558 | Ga0495633_0001633 | Ga0495633_0001633_10020_10871 | 269 |
| 737 | 3300048911 | Ga0496108_0108971 | Ga0496108_0108971_1035_1880 | 269 |
| 738 | 3300048913 | Ga0496110_0149400 | Ga0496110_0149400_1242_2087 | 269 |
| 739 | iso_pu_bacteria | 2599185292 | 2599902274 | 269 |
| 740 | iso_pu_bacteria | 2808606395 | 2809036280 | 269 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5thx-assembly1.cif.gz_A | crystal structure of a ferredoxin nadp+ reductase from neisseria gonorrhoeae with bound nadp and fad | 0.9816 | 13 | 269 |
| 1a8p-assembly1.cif.gz_A | ferredoxin reductase from azotobacter vinelandii | 0.9793 | 14 | 269 |
| 2qdx-assembly1.cif.gz_A | p.aeruginosa fpr with fad | 0.9789 | 14 | 269 |
| 4b4d-assembly1.cif.gz_A-2 | crystal structure of fad-containing ferredoxin-nadp reductase from xanthomonas axonopodis pv. citri | 0.9786 | 14 | 269 |
| 5thx-assembly1.cif.gz_A | crystal structure of a ferredoxin nadp+ reductase from neisseria gonorrhoeae with bound nadp and fad | 0.9778 | 13 | 269 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1a8pA01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9888 | 14 | 107 | 2.40.30.10 |
| 5ufaC01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9785 | 13 | 107 | 2.40.30.10 |
| 2bgjA01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9733 | 20 | 102 | 2.40.30.10 |
| 1a8pA01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9684 | 14 | 107 | 2.40.30.10 |
| 1fdrA01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9612 | 15 | 108 | 2.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Y6CY59-F1-model_v4 | Ferredoxin--NADP+ reductase | 0.9983 | 18 | 88 |
GO:0034599
GO:0042167 |
| AF-A0A848QHK4-F1-model_v4 | deleted | 0.9961 | 14 | 211 |
|
| AF-A0A496WGZ5-F1-model_v4 | Ferredoxin--NADP reductase | 0.9951 | 23 | 119 |
GO:0016491
GO:0034599 GO:0042167 |
| AF-Q8KT46-F1-model_v4 | Catechol 1,2-dioxygenase | 0.9916 | 147 | 249 |
GO:0034599
GO:0042167 GO:0051213 |
| AF-A0A1Z1F890-F1-model_v4 | ferredoxin--NADP(+) reductase (EC 1.18.1.2) | 0.9841 | 15 | 269 |
GO:0000166
GO:0004324 GO:0034599 GO:0042167 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar