F478448
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 739 | 318 | 739 | 96 |
Family's Representative Sequence
| Representative Sequence | 3300005564|Ga0070664_101995701|Ga0070664_1019957012 |
| Length | 114 |
| Sequence | MAYLFIALSFAIAGGIVGRIKGSSFFIWFLISGIVPVIGLAAALLYRWDRNELRRQCPGCGRVVKLHDTLCTRCGTELYFPEVAIASEADLADRRAAGAAANAANRLSSGKIRW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2149837012 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 120 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 183 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 184 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 185 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 203 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 208 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 209 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 223 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 224 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 225 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 229 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 230 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 231 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 232 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 233 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 234 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 235 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 236 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 237 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 238 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 239 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 240 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 241 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 242 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 243 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 244 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 245 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 246 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 247 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 248 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 287 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 288 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 289 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 300 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 301 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 306 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 307 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 316 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.62 |
| Metatranscriptomes | 3.38 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.54 |
| Nodule | 0 |
| Rhizoplane | 8.66 |
| Rhizosphere | 85.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | _GD4IA4401A3XHU | 2149837012 | Bacteria | 501 |
| 2 | JGI24743J22301_10143661 | 3300001991 | Bacteria | 532 |
| 3 | Ga0006777J48905_1111430 | 3300003308 | Bacteria | 621 |
| 4 | Ga0006781J51513_1011970 | 3300003568 | Bacteria | 522 |
| 5 | Ga0006781J51513_1028949 | 3300003568 | Bacteria | 605 |
| 6 | Ga0007409J51694_1045270 | 3300003575 | Bacteria | 551 |
| 7 | Ga0007416J51690_1096729 | 3300003577 | Bacteria | 546 |
| 8 | Ga0007429J51699_1035403 | 3300003579 | Bacteria | 617 |
| 9 | Ga0007429J51699_1040535 | 3300003579 | Bacteria | 757 |
| 10 | Ga0032354_1047956 | 3300003693 | Bacteria | 667 |
| 11 | Ga0058858_1310944 | 3300004785 | Bacteria | 571 |
| 12 | Ga0058861_11833874 | 3300004800 | Bacteria | 861 |
| 13 | Ga0070658_10631770 | 3300005327 | Bacteria | 929 |
| 14 | Ga0070658_11911632 | 3300005327 | Bacteria | 513 |
| 15 | Ga0070676_10668009 | 3300005328 | Bacteria | 756 |
| 16 | Ga0070676_10792425 | 3300005328 | Bacteria | 699 |
| 17 | Ga0070683_100580273 | 3300005329 | Bacteria | 1072 |
| 18 | Ga0070683_101080481 | 3300005329 | Bacteria | 771 |
| 19 | Ga0070683_101941040 | 3300005329 | Bacteria | 566 |
| 20 | Ga0070690_100238365 | 3300005330 | Bacteria | 1282 |
| 21 | Ga0070670_100751674 | 3300005331 | Bacteria | 879 |
| 22 | Ga0070677_10584891 | 3300005333 | Bacteria | 616 |
| 23 | Ga0068869_100126415 | 3300005334 | Bacteria | 1961 |
| 24 | Ga0068869_100992120 | 3300005334 | Bacteria | 731 |
| 25 | Ga0068869_101530324 | 3300005334 | Bacteria | 593 |
| 26 | Ga0070682_100078491 | 3300005337 | Bacteria | 2130 |
| 27 | Ga0070682_100362283 | 3300005337 | Bacteria | 1084 |
| 28 | Ga0070682_100363563 | 3300005337 | Bacteria | 1083 |
| 29 | Ga0068868_100282928 | 3300005338 | Bacteria | 1404 |
| 30 | Ga0068868_100288252 | 3300005338 | Bacteria | 1391 |
| 31 | Ga0068868_100392579 | 3300005338 | Bacteria | 1196 |
| 32 | Ga0068868_100512834 | 3300005338 | Bacteria | 1052 |
| 33 | Ga0068868_100834889 | 3300005338 | Bacteria | 834 |
| 34 | Ga0068868_102116808 | 3300005338 | Bacteria | 535 |
| 35 | Ga0070660_100062883 | 3300005339 | Bacteria | 2885 |
| 36 | Ga0070660_100073022 | 3300005339 | Bacteria | 2682 |
| 37 | Ga0070660_100756855 | 3300005339 | Bacteria | 816 |
| 38 | Ga0070660_101286061 | 3300005339 | Unclassified | 621 |
| 39 | Ga0070660_101755487 | 3300005339 | Bacteria | 529 |
| 40 | Ga0070691_10121148 | 3300005341 | Bacteria | 1317 |
| 41 | Ga0070691_10416026 | 3300005341 | Bacteria | 761 |
| 42 | Ga0070687_100215026 | 3300005343 | Bacteria | 1174 |
| 43 | Ga0070687_100557317 | 3300005343 | Bacteria | 781 |
| 44 | Ga0070687_100876307 | 3300005343 | Bacteria | 642 |
| 45 | Ga0070687_101031909 | 3300005343 | Unclassified | 598 |
| 46 | Ga0070661_100114771 | 3300005344 | Bacteria | 2014 |
| 47 | Ga0070661_100415333 | 3300005344 | Bacteria | 1066 |
| 48 | Ga0070661_101301942 | 3300005344 | Bacteria | 610 |
| 49 | Ga0070692_10006061 | 3300005345 | Bacteria | 5217 |
| 50 | Ga0070692_10131587 | 3300005345 | Bacteria | 1406 |
| 51 | Ga0070692_10454149 | 3300005345 | Bacteria | 821 |
| 52 | Ga0070668_100009317 | 3300005347 | Bacteria | 7284 |
| 53 | Ga0070668_100393005 | 3300005347 | Bacteria | 1183 |
| 54 | Ga0070669_100019002 | 3300005353 | Bacteria | 4912 |
| 55 | Ga0070669_100123071 | 3300005353 | Bacteria | 1982 |
| 56 | Ga0070669_100260043 | 3300005353 | Bacteria | 1385 |
| 57 | Ga0070675_100725845 | 3300005354 | Bacteria | 906 |
| 58 | Ga0070671_100517563 | 3300005355 | Bacteria | 1027 |
| 59 | Ga0070671_102088493 | 3300005355 | Bacteria | 505 |
| 60 | Ga0070674_100081739 | 3300005356 | Bacteria | 2309 |
| 61 | Ga0070674_100126134 | 3300005356 | Bacteria | 1901 |
| 62 | Ga0070674_101185433 | 3300005356 | Bacteria | 677 |
| 63 | Ga0070673_100651938 | 3300005364 | Bacteria | 964 |
| 64 | Ga0070659_100000132 | 3300005366 | Bacteria | 56931 |
| 65 | Ga0070659_100697675 | 3300005366 | Bacteria | 877 |
| 66 | Ga0070659_100726915 | 3300005366 | Bacteria | 860 |
| 67 | Ga0070659_100934861 | 3300005366 | Bacteria | 759 |
| 68 | Ga0070659_100976914 | 3300005366 | Bacteria | 743 |
| 69 | Ga0070659_101196954 | 3300005366 | Bacteria | 672 |
| 70 | Ga0070659_101261614 | 3300005366 | Bacteria | 655 |
| 71 | Ga0070667_102252154 | 3300005367 | Bacteria | 513 |
| 72 | Ga0070709_10159646 | 3300005434 | Bacteria | 1566 |
| 73 | Ga0070714_100036859 | 3300005435 | Bacteria | 4105 |
| 74 | Ga0070714_100689243 | 3300005435 | Unclassified | 985 |
| 75 | Ga0070714_101165883 | 3300005435 | Bacteria | 751 |
| 76 | Ga0070714_102512313 | 3300005435 | Bacteria | 500 |
| 77 | Ga0070710_10000015 | 3300005437 | Bacteria | 103891 |
| 78 | Ga0070710_10072659 | 3300005437 | Bacteria | 1987 |
| 79 | Ga0070701_11112316 | 3300005438 | Bacteria | 557 |
| 80 | Ga0070711_101542976 | 3300005439 | Bacteria | 580 |
| 81 | Ga0070705_100000870 | 3300005440 | Bacteria | 16885 |
| 82 | Ga0070700_100203413 | 3300005441 | Bacteria | 1392 |
| 83 | Ga0070700_100428098 | 3300005441 | Bacteria | 1002 |
| 84 | Ga0070700_100441879 | 3300005441 | Bacteria | 988 |
| 85 | Ga0070700_100742331 | 3300005441 | Bacteria | 785 |
| 86 | Ga0070694_101020497 | 3300005444 | Bacteria | 687 |
| 87 | Ga0070663_100328115 | 3300005455 | Bacteria | 1232 |
| 88 | Ga0070663_100378738 | 3300005455 | Bacteria | 1152 |
| 89 | Ga0070663_100718233 | 3300005455 | Bacteria | 851 |
| 90 | Ga0070663_101422804 | 3300005455 | Bacteria | 614 |
| 91 | Ga0070678_100512875 | 3300005456 | Bacteria | 1060 |
| 92 | Ga0070678_100932872 | 3300005456 | Bacteria | 795 |
| 93 | Ga0070678_101264686 | 3300005456 | Bacteria | 686 |
| 94 | Ga0070678_101648816 | 3300005456 | Bacteria | 603 |
| 95 | Ga0070678_102189983 | 3300005456 | Bacteria | 524 |
| 96 | Ga0070678_102278535 | 3300005456 | Bacteria | 514 |
| 97 | Ga0070662_100155907 | 3300005457 | Bacteria | 1782 |
| 98 | Ga0070662_100192532 | 3300005457 | Bacteria | 1614 |
| 99 | Ga0070662_100423397 | 3300005457 | Bacteria | 1102 |
| 100 | Ga0070662_100604428 | 3300005457 | Bacteria | 923 |
| 101 | Ga0070681_10231584 | 3300005458 | Bacteria | 1762 |
| 102 | Ga0068867_100062732 | 3300005459 | Bacteria | 2762 |
| 103 | Ga0068867_100132843 | 3300005459 | Bacteria | 1936 |
| 104 | Ga0068867_100649339 | 3300005459 | Bacteria | 926 |
| 105 | Ga0068867_101022725 | 3300005459 | Bacteria | 750 |
| 106 | Ga0068867_101116497 | 3300005459 | Unclassified | 720 |
| 107 | Ga0070685_10147419 | 3300005466 | Bacteria | 1488 |
| 108 | Ga0070685_10377747 | 3300005466 | Bacteria | 975 |
| 109 | Ga0070707_100976409 | 3300005468 | Unclassified | 812 |
| 110 | Ga0070699_101171855 | 3300005518 | Bacteria | 705 |
| 111 | Ga0070679_100062457 | 3300005530 | Bacteria | 3714 |
| 112 | Ga0070679_100465416 | 3300005530 | Bacteria | 1209 |
| 113 | Ga0070684_100052037 | 3300005535 | Bacteria | 3559 |
| 114 | Ga0070684_100330197 | 3300005535 | Bacteria | 1401 |
| 115 | Ga0070684_100380680 | 3300005535 | Bacteria | 1300 |
| 116 | Ga0070684_100440613 | 3300005535 | Bacteria | 1203 |
| 117 | Ga0070684_100913694 | 3300005535 | Bacteria | 823 |
| 118 | Ga0070684_101155906 | 3300005535 | Bacteria | 728 |
| 119 | Ga0068853_100363500 | 3300005539 | Bacteria | 1349 |
| 120 | Ga0070672_100180153 | 3300005543 | Bacteria | 1761 |
| 121 | Ga0070672_100677811 | 3300005543 | Bacteria | 902 |
| 122 | Ga0070672_101203469 | 3300005543 | Bacteria | 675 |
| 123 | Ga0070686_100688889 | 3300005544 | Bacteria | 814 |
| 124 | Ga0070695_100930995 | 3300005545 | Archaea | 703 |
| 125 | Ga0070696_101462389 | 3300005546 | Bacteria | 584 |
| 126 | Ga0070693_100303082 | 3300005547 | Bacteria | 1078 |
| 127 | Ga0070665_100976063 | 3300005548 | Bacteria | 860 |
| 128 | Ga0070704_100424783 | 3300005549 | Bacteria | 1139 |
| 129 | Ga0070664_100140859 | 3300005564 | Bacteria | 2123 |
| 130 | Ga0070664_100347314 | 3300005564 | Bacteria | 1349 |
| 131 | Ga0070664_100441651 | 3300005564 | Bacteria | 1193 |
| 132 | Ga0070664_101515251 | 3300005564 | Unclassified | 635 |
| 133 | Ga0070664_101995701 | 3300005564 | Bacteria | 551 |
| 134 | Ga0070664_102125389 | 3300005564 | Bacteria | 533 |
| 135 | Ga0068857_100202462 | 3300005577 | Bacteria | 1810 |
| 136 | Ga0068854_100122530 | 3300005578 | Bacteria | 1976 |
| 137 | Ga0068854_100299802 | 3300005578 | Bacteria | 1300 |
| 138 | Ga0068856_100057926 | 3300005614 | Bacteria | 3826 |
| 139 | Ga0068856_100341471 | 3300005614 | Bacteria | 1516 |
| 140 | Ga0068856_100348956 | 3300005614 | Unclassified | 1498 |
| 141 | Ga0068856_100604280 | 3300005614 | Bacteria | 1118 |
| 142 | Ga0070702_100066914 | 3300005615 | Bacteria | 2109 |
| 143 | Ga0070702_100393994 | 3300005615 | Bacteria | 988 |
| 144 | Ga0068852_100363553 | 3300005616 | Bacteria | 1416 |
| 145 | Ga0068852_101338922 | 3300005616 | Bacteria | 738 |
| 146 | Ga0068852_102553635 | 3300005616 | Bacteria | 531 |
| 147 | Ga0068859_100582315 | 3300005617 | Bacteria | 1213 |
| 148 | Ga0068864_100080512 | 3300005618 | Bacteria | 2854 |
| 149 | Ga0068864_100573671 | 3300005618 | Bacteria | 1092 |
| 150 | Ga0068864_100636263 | 3300005618 | Bacteria | 1038 |
| 151 | Ga0068864_102643525 | 3300005618 | Bacteria | 508 |
| 152 | Ga0068866_10193882 | 3300005718 | Bacteria | 1209 |
| 153 | Ga0068861_100056451 | 3300005719 | Bacteria | 2998 |
| 154 | Ga0068861_100163036 | 3300005719 | Bacteria | 1840 |
| 155 | Ga0068861_100270455 | 3300005719 | Bacteria | 1459 |
| 156 | Ga0068861_100376757 | 3300005719 | Bacteria | 1252 |
| 157 | Ga0068851_10120789 | 3300005834 | Bacteria | 1408 |
| 158 | Ga0068851_10284994 | 3300005834 | Bacteria | 946 |
| 159 | Ga0068870_10162962 | 3300005840 | Bacteria | 1324 |
| 160 | Ga0068870_10432294 | 3300005840 | Bacteria | 864 |
| 161 | Ga0068863_100189364 | 3300005841 | Bacteria | 1977 |
| 162 | Ga0068863_100607301 | 3300005841 | Unclassified | 1083 |
| 163 | Ga0068863_102298631 | 3300005841 | Bacteria | 549 |
| 164 | Ga0068858_100350611 | 3300005842 | Bacteria | 1414 |
| 165 | Ga0068858_100573021 | 3300005842 | Bacteria | 1094 |
| 166 | Ga0068860_100920606 | 3300005843 | Bacteria | 891 |
| 167 | Ga0068862_100627060 | 3300005844 | Unclassified | 1035 |
| 168 | Ga0068862_101120603 | 3300005844 | Bacteria | 783 |
| 169 | Ga0081455_10008248 | 3300005937 | Bacteria | 10860 |
| 170 | Ga0081455_10242847 | 3300005937 | Bacteria | 1322 |
| 171 | Ga0081455_10328824 | 3300005937 | Bacteria | 1086 |
| 172 | Ga0081538_10005959 | 3300005981 | Bacteria | 10848 |
| 173 | Ga0081538_10039395 | 3300005981 | Bacteria | 3032 |
| 174 | Ga0081538_10108952 | 3300005981 | Bacteria | 1366 |
| 175 | Ga0081540_1001786 | 3300005983 | Bacteria | 18030 |
| 176 | Ga0070717_10766660 | 3300006028 | Unclassified | 877 |
| 177 | Ga0075363_100229570 | 3300006048 | Bacteria | 1065 |
| 178 | Ga0070716_100186428 | 3300006173 | Bacteria | 1367 |
| 179 | Ga0070712_100000050 | 3300006175 | Bacteria | 63870 |
| 180 | Ga0070712_100005314 | 3300006175 | Bacteria | 7971 |
| 181 | Ga0070712_100231458 | 3300006175 | Unclassified | 1468 |
| 182 | Ga0070712_101894269 | 3300006175 | Bacteria | 522 |
| 183 | Ga0097621_100880548 | 3300006237 | Bacteria | 833 |
| 184 | Ga0075428_100500182 | 3300006844 | Bacteria | 1300 |
| 185 | Ga0075428_101867641 | 3300006844 | Bacteria | 624 |
| 186 | Ga0075428_102368142 | 3300006844 | Bacteria | 546 |
| 187 | Ga0075431_101628941 | 3300006847 | Unclassified | 603 |
| 188 | Ga0075434_100681937 | 3300006871 | Bacteria | 1045 |
| 189 | Ga0075434_101036197 | 3300006871 | Bacteria | 834 |
| 190 | Ga0075434_102203227 | 3300006871 | Bacteria | 555 |
| 191 | Ga0075429_100014611 | 3300006880 | Bacteria | 6806 |
| 192 | Ga0068865_100051211 | 3300006881 | Bacteria | 2857 |
| 193 | Ga0068865_100156795 | 3300006881 | Bacteria | 1732 |
| 194 | Ga0068865_100614730 | 3300006881 | Bacteria | 920 |
| 195 | Ga0068865_100630702 | 3300006881 | Unclassified | 909 |
| 196 | Ga0068865_100987428 | 3300006881 | Bacteria | 737 |
| 197 | Ga0075436_100226694 | 3300006914 | Bacteria | 1327 |
| 198 | Ga0075436_101544708 | 3300006914 | Bacteria | 504 |
| 199 | Ga0097620_100582335 | 3300006931 | Bacteria | 1213 |
| 200 | Ga0075435_101897065 | 3300007076 | Unclassified | 523 |
| 201 | Ga0105240_10151435 | 3300009093 | Bacteria | 2762 |
| 202 | Ga0111539_10721274 | 3300009094 | Bacteria | 1160 |
| 203 | Ga0111539_10759020 | 3300009094 | Bacteria | 1129 |
| 204 | Ga0111539_11060218 | 3300009094 | Bacteria | 942 |
| 205 | Ga0105245_10046340 | 3300009098 | Bacteria | 3885 |
| 206 | Ga0105245_10186449 | 3300009098 | Bacteria | 1985 |
| 207 | Ga0105245_10314713 | 3300009098 | Bacteria | 1540 |
| 208 | Ga0105245_10834036 | 3300009098 | Bacteria | 961 |
| 209 | Ga0105245_10880466 | 3300009098 | Bacteria | 936 |
| 210 | Ga0105245_11649917 | 3300009098 | Bacteria | 693 |
| 211 | Ga0105245_12736864 | 3300009098 | Unclassified | 546 |
| 212 | Ga0105247_10459527 | 3300009101 | Bacteria | 919 |
| 213 | Ga0114129_11668578 | 3300009147 | Bacteria | 778 |
| 214 | Ga0114129_13297100 | 3300009147 | Unclassified | 522 |
| 215 | Ga0105243_10058843 | 3300009148 | Bacteria | 3064 |
| 216 | Ga0105243_10112983 | 3300009148 | Bacteria | 2277 |
| 217 | Ga0105243_10177918 | 3300009148 | Bacteria | 1848 |
| 218 | Ga0105243_10284846 | 3300009148 | Bacteria | 1490 |
| 219 | Ga0105243_10873284 | 3300009148 | Bacteria | 892 |
| 220 | Ga0105243_11187441 | 3300009148 | Bacteria | 775 |
| 221 | Ga0105242_10647438 | 3300009176 | Bacteria | 1027 |
| 222 | Ga0105242_12389713 | 3300009176 | Bacteria | 576 |
| 223 | Ga0105242_12432958 | 3300009176 | Bacteria | 571 |
| 224 | Ga0105237_10940816 | 3300009545 | Bacteria | 871 |
| 225 | Ga0105237_12726160 | 3300009545 | Unclassified | 505 |
| 226 | Ga0105238_11473074 | 3300009551 | Bacteria | 709 |
| 227 | Ga0105249_10139754 | 3300009553 | Bacteria | 2321 |
| 228 | Ga0105249_10895176 | 3300009553 | Unclassified | 954 |
| 229 | Ga0105249_11078219 | 3300009553 | Bacteria | 873 |
| 230 | Ga0105249_11091829 | 3300009553 | Bacteria | 868 |
| 231 | Ga0105249_11251769 | 3300009553 | Bacteria | 813 |
| 232 | Ga0105249_11408934 | 3300009553 | Bacteria | 769 |
| 233 | Ga0105239_10233083 | 3300010375 | Bacteria | 2066 |
| 234 | Ga0105239_10591738 | 3300010375 | Bacteria | 1265 |
| 235 | Ga0105239_10594287 | 3300010375 | Unclassified | 1262 |
| 236 | Ga0105239_10772591 | 3300010375 | Bacteria | 1100 |
| 237 | Ga0105239_11922601 | 3300010375 | Bacteria | 686 |
| 238 | Ga0105239_12022260 | 3300010375 | Bacteria | 669 |
| 239 | Ga0105239_12148879 | 3300010375 | Bacteria | 649 |
| 240 | Ga0105239_13245451 | 3300010375 | Bacteria | 529 |
| 241 | Ga0105246_10023374 | 3300011119 | Bacteria | 3999 |
| 242 | Ga0105246_10233122 | 3300011119 | Bacteria | 1451 |
| 243 | Ga0105246_10794609 | 3300011119 | Bacteria | 839 |
| 244 | Ga0105246_10968446 | 3300011119 | Bacteria | 768 |
| 245 | Ga0105246_11065201 | 3300011119 | Bacteria | 736 |
| 246 | Ga0105246_11536054 | 3300011119 | Bacteria | 627 |
| 247 | Ga0105246_11814375 | 3300011119 | Bacteria | 583 |
| 248 | Ga0157371_10284213 | 3300013102 | Bacteria | 1196 |
| 249 | Ga0157371_10654874 | 3300013102 | Bacteria | 784 |
| 250 | Ga0157371_11181823 | 3300013102 | Unclassified | 589 |
| 251 | Ga0157374_12709569 | 3300013296 | Unclassified | 523 |
| 252 | Ga0163162_10500585 | 3300013306 | Bacteria | 1345 |
| 253 | Ga0157372_10420739 | 3300013307 | Bacteria | 1557 |
| 254 | Ga0157372_10490485 | 3300013307 | Bacteria | 1432 |
| 255 | Ga0157372_10625884 | 3300013307 | Bacteria | 1254 |
| 256 | Ga0157372_10739756 | 3300013307 | Bacteria | 1144 |
| 257 | Ga0157375_10532724 | 3300013308 | Bacteria | 1337 |
| 258 | Ga0163163_10255761 | 3300014325 | Bacteria | 1802 |
| 259 | Ga0163163_12977000 | 3300014325 | Bacteria | 528 |
| 260 | Ga0157380_10435996 | 3300014326 | Bacteria | 1254 |
| 261 | Ga0157380_10594023 | 3300014326 | Bacteria | 1094 |
| 262 | Ga0157380_10717023 | 3300014326 | Bacteria | 1007 |
| 263 | Ga0157380_11610236 | 3300014326 | Unclassified | 705 |
| 264 | Ga0157380_12643295 | 3300014326 | Bacteria | 568 |
| 265 | Ga0157380_12935800 | 3300014326 | Bacteria | 543 |
| 266 | Ga0182008_10142544 | 3300014497 | Bacteria | 1199 |
| 267 | Ga0182008_10287607 | 3300014497 | Bacteria | 857 |
| 268 | Ga0157377_10250499 | 3300014745 | Bacteria | 1148 |
| 269 | Ga0157377_10380456 | 3300014745 | Bacteria | 955 |
| 270 | Ga0157377_10612768 | 3300014745 | Bacteria | 778 |
| 271 | Ga0157377_11070264 | 3300014745 | Bacteria | 616 |
| 272 | Ga0157377_11350959 | 3300014745 | Bacteria | 559 |
| 273 | Ga0157379_10266864 | 3300014968 | Bacteria | 1556 |
| 274 | Ga0157379_11840792 | 3300014968 | Bacteria | 595 |
| 275 | Ga0197907_10615912 | 3300020069 | Bacteria | 1061 |
| 276 | Ga0206349_1231240 | 3300020075 | Bacteria | 523 |
| 277 | Ga0206350_11164447 | 3300020080 | Bacteria | 1157 |
| 278 | Ga0206350_11482167 | 3300020080 | Bacteria | 775 |
| 279 | Ga0206354_11362747 | 3300020081 | Bacteria | 628 |
| 280 | Ga0206353_10800325 | 3300020082 | Bacteria | 900 |
| 281 | Ga0154015_1115475 | 3300020610 | Bacteria | 545 |
| 282 | Ga0154015_1516197 | 3300020610 | Bacteria | 1295 |
| 283 | Ga0213873_10041941 | 3300021358 | Unclassified | 1182 |
| 284 | Ga0213874_10018585 | 3300021377 | Bacteria | 1880 |
| 285 | Ga0213874_10156658 | 3300021377 | Bacteria | 798 |
| 286 | Ga0213876_10003709 | 3300021384 | Bacteria | 8663 |
| 287 | Ga0213876_10007820 | 3300021384 | Bacteria | 5799 |
| 288 | Ga0213876_10014352 | 3300021384 | Bacteria | 4198 |
| 289 | Ga0213876_10073210 | 3300021384 | Bacteria | 1809 |
| 290 | Ga0213876_10277713 | 3300021384 | Bacteria | 890 |
| 291 | Ga0213875_10014955 | 3300021388 | Bacteria | 3780 |
| 292 | Ga0213875_10041759 | 3300021388 | Bacteria | 2157 |
| 293 | Ga0213875_10058999 | 3300021388 | Bacteria | 1796 |
| 294 | Ga0213875_10473011 | 3300021388 | Bacteria | 601 |
| 295 | Ga0207692_10000013 | 3300025898 | Bacteria | 103819 |
| 296 | Ga0207692_10065462 | 3300025898 | Bacteria | 1896 |
| 297 | Ga0207692_10655782 | 3300025898 | Bacteria | 678 |
| 298 | Ga0207642_10076269 | 3300025899 | Bacteria | 1613 |
| 299 | Ga0207688_10136005 | 3300025901 | Bacteria | 1443 |
| 300 | Ga0207688_10170646 | 3300025901 | Bacteria | 1293 |
| 301 | Ga0207688_10333832 | 3300025901 | Bacteria | 932 |
| 302 | Ga0207688_10344447 | 3300025901 | Bacteria | 917 |
| 303 | Ga0207688_10361112 | 3300025901 | Bacteria | 896 |
| 304 | Ga0207688_10427849 | 3300025901 | Bacteria | 823 |
| 305 | Ga0207680_10856616 | 3300025903 | Unclassified | 651 |
| 306 | Ga0207699_10202180 | 3300025906 | Bacteria | 1347 |
| 307 | Ga0207699_10885595 | 3300025906 | Unclassified | 658 |
| 308 | Ga0207645_10112564 | 3300025907 | Bacteria | 1763 |
| 309 | Ga0207645_10430680 | 3300025907 | Bacteria | 889 |
| 310 | Ga0207643_10284500 | 3300025908 | Bacteria | 1026 |
| 311 | Ga0207643_10518784 | 3300025908 | Bacteria | 763 |
| 312 | Ga0207705_10547475 | 3300025909 | Bacteria | 899 |
| 313 | Ga0207707_10284321 | 3300025912 | Bacteria | 1432 |
| 314 | Ga0207707_10429276 | 3300025912 | Bacteria | 1132 |
| 315 | Ga0207695_10113274 | 3300025913 | Bacteria | 2689 |
| 316 | Ga0207671_10003194 | 3300025914 | Bacteria | 16519 |
| 317 | Ga0207693_10000151 | 3300025915 | Bacteria | 64033 |
| 318 | Ga0207693_10008924 | 3300025915 | Bacteria | 8184 |
| 319 | Ga0207693_10732879 | 3300025915 | Unclassified | 764 |
| 320 | Ga0207663_10313510 | 3300025916 | Bacteria | 1176 |
| 321 | Ga0207663_10458954 | 3300025916 | Unclassified | 984 |
| 322 | Ga0207660_11398269 | 3300025917 | Bacteria | 567 |
| 323 | Ga0207662_10136404 | 3300025918 | Bacteria | 1551 |
| 324 | Ga0207662_10252368 | 3300025918 | Bacteria | 1158 |
| 325 | Ga0207657_10216511 | 3300025919 | Bacteria | 1536 |
| 326 | Ga0207657_10305119 | 3300025919 | Bacteria | 1261 |
| 327 | Ga0207649_10132712 | 3300025920 | Bacteria | 1694 |
| 328 | Ga0207649_10323696 | 3300025920 | Bacteria | 1133 |
| 329 | Ga0207649_10803619 | 3300025920 | Unclassified | 734 |
| 330 | Ga0207649_11372976 | 3300025920 | Bacteria | 559 |
| 331 | Ga0207652_10093457 | 3300025921 | Bacteria | 2647 |
| 332 | Ga0207646_10848867 | 3300025922 | Unclassified | 812 |
| 333 | Ga0207681_10003336 | 3300025923 | Bacteria | 10055 |
| 334 | Ga0207681_10287351 | 3300025923 | Bacteria | 1297 |
| 335 | Ga0207650_10944823 | 3300025925 | Bacteria | 733 |
| 336 | Ga0207659_10822432 | 3300025926 | Bacteria | 798 |
| 337 | Ga0207687_10208186 | 3300025927 | Bacteria | 1533 |
| 338 | Ga0207687_10313926 | 3300025927 | Bacteria | 1267 |
| 339 | Ga0207687_10533650 | 3300025927 | Unclassified | 983 |
| 340 | Ga0207687_10617331 | 3300025927 | Bacteria | 915 |
| 341 | Ga0207700_10613221 | 3300025928 | Bacteria | 969 |
| 342 | Ga0207664_10000331 | 3300025929 | Bacteria | 35072 |
| 343 | Ga0207664_10005338 | 3300025929 | Bacteria | 8777 |
| 344 | Ga0207664_10493781 | 3300025929 | Bacteria | 1096 |
| 345 | Ga0207664_11431398 | 3300025929 | Unclassified | 612 |
| 346 | Ga0207664_11883171 | 3300025929 | Bacteria | 521 |
| 347 | Ga0207690_10000075 | 3300025932 | Bacteria | 85885 |
| 348 | Ga0207690_10733290 | 3300025932 | Bacteria | 814 |
| 349 | Ga0207690_10846286 | 3300025932 | Unclassified | 757 |
| 350 | Ga0207690_11154395 | 3300025932 | Unclassified | 646 |
| 351 | Ga0207690_11661987 | 3300025932 | Unclassified | 534 |
| 352 | Ga0207706_10030392 | 3300025933 | Bacteria | 4819 |
| 353 | Ga0207706_10414635 | 3300025933 | Bacteria | 1167 |
| 354 | Ga0207686_10641335 | 3300025934 | Bacteria | 839 |
| 355 | Ga0207686_11438443 | 3300025934 | Bacteria | 568 |
| 356 | Ga0207709_10034617 | 3300025935 | Bacteria | 2978 |
| 357 | Ga0207709_10052158 | 3300025935 | Bacteria | 2510 |
| 358 | Ga0207709_10202100 | 3300025935 | Bacteria | 1420 |
| 359 | Ga0207709_10679633 | 3300025935 | Bacteria | 822 |
| 360 | Ga0207669_10449055 | 3300025937 | Bacteria | 1021 |
| 361 | Ga0207669_10679593 | 3300025937 | Bacteria | 844 |
| 362 | Ga0207669_10865200 | 3300025937 | Bacteria | 753 |
| 363 | Ga0207669_11455513 | 3300025937 | Bacteria | 584 |
| 364 | Ga0207704_10032117 | 3300025938 | Bacteria | 2967 |
| 365 | Ga0207704_10181495 | 3300025938 | Bacteria | 1521 |
| 366 | Ga0207704_10476749 | 3300025938 | Bacteria | 1001 |
| 367 | Ga0207704_10669427 | 3300025938 | Bacteria | 856 |
| 368 | Ga0207704_11309152 | 3300025938 | Bacteria | 620 |
| 369 | Ga0207665_11436162 | 3300025939 | Bacteria | 549 |
| 370 | Ga0207691_10153831 | 3300025940 | Bacteria | 2021 |
| 371 | Ga0207711_10566640 | 3300025941 | Bacteria | 1059 |
| 372 | Ga0207689_10270215 | 3300025942 | Bacteria | 1408 |
| 373 | Ga0207689_10582832 | 3300025942 | Bacteria | 940 |
| 374 | Ga0207661_10014965 | 3300025944 | Bacteria | 5696 |
| 375 | Ga0207661_10107025 | 3300025944 | Bacteria | 2358 |
| 376 | Ga0207661_10171655 | 3300025944 | Bacteria | 1888 |
| 377 | Ga0207661_10284218 | 3300025944 | Bacteria | 1479 |
| 378 | Ga0207661_10861347 | 3300025944 | Bacteria | 834 |
| 379 | Ga0207661_10876172 | 3300025944 | Bacteria | 827 |
| 380 | Ga0207661_11578741 | 3300025944 | Unclassified | 601 |
| 381 | Ga0207679_10231580 | 3300025945 | Bacteria | 1560 |
| 382 | Ga0207679_10379518 | 3300025945 | Bacteria | 1239 |
| 383 | Ga0207679_10582222 | 3300025945 | Bacteria | 1007 |
| 384 | Ga0207679_10699890 | 3300025945 | Bacteria | 919 |
| 385 | Ga0207679_11496555 | 3300025945 | Bacteria | 619 |
| 386 | Ga0207667_11702590 | 3300025949 | Bacteria | 597 |
| 387 | Ga0207651_11004114 | 3300025960 | Bacteria | 746 |
| 388 | Ga0207712_10574550 | 3300025961 | Bacteria | 972 |
| 389 | Ga0207712_11999224 | 3300025961 | Bacteria | 519 |
| 390 | Ga0207668_10401469 | 3300025972 | Bacteria | 1159 |
| 391 | Ga0207640_10566785 | 3300025981 | Unclassified | 957 |
| 392 | Ga0207640_11333372 | 3300025981 | Bacteria | 641 |
| 393 | Ga0207658_11139563 | 3300025986 | Bacteria | 713 |
| 394 | Ga0207677_10070256 | 3300026023 | Bacteria | 2467 |
| 395 | Ga0207677_10122676 | 3300026023 | Bacteria | 1958 |
| 396 | Ga0207677_10291079 | 3300026023 | Bacteria | 1345 |
| 397 | Ga0207677_10316583 | 3300026023 | Bacteria | 1295 |
| 398 | Ga0207677_10738834 | 3300026023 | Bacteria | 876 |
| 399 | Ga0207677_11792327 | 3300026023 | Bacteria | 570 |
| 400 | Ga0207677_12242083 | 3300026023 | Bacteria | 508 |
| 401 | Ga0207703_10968933 | 3300026035 | Bacteria | 816 |
| 402 | Ga0207639_11524487 | 3300026041 | Bacteria | 627 |
| 403 | Ga0207678_10279433 | 3300026067 | Bacteria | 1433 |
| 404 | Ga0207678_10367638 | 3300026067 | Bacteria | 1242 |
| 405 | Ga0207678_10475697 | 3300026067 | Bacteria | 1088 |
| 406 | Ga0207678_11299408 | 3300026067 | Bacteria | 644 |
| 407 | Ga0207708_10000878 | 3300026075 | Bacteria | 22588 |
| 408 | Ga0207708_10219419 | 3300026075 | Bacteria | 1523 |
| 409 | Ga0207708_10480163 | 3300026075 | Bacteria | 1039 |
| 410 | Ga0207708_10503588 | 3300026075 | Bacteria | 1015 |
| 411 | Ga0207708_10922232 | 3300026075 | Bacteria | 757 |
| 412 | Ga0207702_10248857 | 3300026078 | Bacteria | 1668 |
| 413 | Ga0207702_10308922 | 3300026078 | Unclassified | 1503 |
| 414 | Ga0207641_10289497 | 3300026088 | Bacteria | 1544 |
| 415 | Ga0207641_11985241 | 3300026088 | Bacteria | 583 |
| 416 | Ga0207648_10112472 | 3300026089 | Bacteria | 2391 |
| 417 | Ga0207648_10142390 | 3300026089 | Bacteria | 2114 |
| 418 | Ga0207648_10204040 | 3300026089 | Bacteria | 1754 |
| 419 | Ga0207648_10654727 | 3300026089 | Bacteria | 971 |
| 420 | Ga0207648_12150188 | 3300026089 | Bacteria | 519 |
| 421 | Ga0207676_10441982 | 3300026095 | Bacteria | 1224 |
| 422 | Ga0207676_10524474 | 3300026095 | Bacteria | 1128 |
| 423 | Ga0207676_10694976 | 3300026095 | Bacteria | 985 |
| 424 | Ga0207676_10893744 | 3300026095 | Unclassified | 871 |
| 425 | Ga0207674_10472681 | 3300026116 | Bacteria | 1212 |
| 426 | Ga0207675_100102172 | 3300026118 | Bacteria | 2701 |
| 427 | Ga0207675_100158112 | 3300026118 | Bacteria | 2160 |
| 428 | Ga0207675_100169805 | 3300026118 | Bacteria | 2084 |
| 429 | Ga0207675_100212850 | 3300026118 | Bacteria | 1860 |
| 430 | Ga0207675_100237773 | 3300026118 | Bacteria | 1759 |
| 431 | Ga0207675_100641902 | 3300026118 | Bacteria | 1067 |
| 432 | Ga0207683_10498305 | 3300026121 | Unclassified | 1125 |
| 433 | Ga0207683_10568260 | 3300026121 | Bacteria | 1049 |
| 434 | Ga0207698_10189328 | 3300026142 | Bacteria | 1831 |
| 435 | Ga0207698_10373185 | 3300026142 | Bacteria | 1355 |
| 436 | Ga0207698_10479279 | 3300026142 | Bacteria | 1206 |
| 437 | Ga0207698_10971009 | 3300026142 | Unclassified | 859 |
| 438 | Ga0207698_11017943 | 3300026142 | Bacteria | 839 |
| 439 | Ga0207698_11111563 | 3300026142 | Bacteria | 803 |
| 440 | Ga0207428_10569871 | 3300027907 | Bacteria | 818 |
| 441 | Ga0268266_10203971 | 3300028379 | Bacteria | 1811 |
| 442 | Ga0268265_11182120 | 3300028380 | Unclassified | 762 |
| 443 | Ga0265337_1018502 | 3300028556 | Bacteria | 2211 |
| 444 | Ga0265326_10000023 | 3300028558 | Bacteria | 113142 |
| 445 | Ga0265326_10015531 | 3300028558 | Bacteria | 2207 |
| 446 | Ga0265319_1000147 | 3300028563 | Bacteria | 52278 |
| 447 | Ga0265319_1257873 | 3300028563 | Unclassified | 531 |
| 448 | Ga0265334_10000135 | 3300028573 | Bacteria | 46602 |
| 449 | Ga0265334_10049903 | 3300028573 | Bacteria | 1609 |
| 450 | Ga0265334_10170953 | 3300028573 | Bacteria | 761 |
| 451 | Ga0265318_10003281 | 3300028577 | Bacteria | 8221 |
| 452 | Ga0265336_10000004 | 3300028666 | Bacteria | 418303 |
| 453 | Ga0265336_10009601 | 3300028666 | Bacteria | 3338 |
| 454 | Ga0265338_10000012 | 3300028800 | Bacteria | 418599 |
| 455 | Ga0265338_10000902 | 3300028800 | Bacteria | 49948 |
| 456 | Ga0265338_10216133 | 3300028800 | Bacteria | 1435 |
| 457 | Ga0265324_10002787 | 3300029957 | Bacteria | 8634 |
| 458 | Ga0265777_123614 | 3300030877 | Unclassified | 519 |
| 459 | Ga0265765_1031362 | 3300030879 | Bacteria | 679 |
| 460 | Ga0265320_10091945 | 3300031240 | Bacteria | 1405 |
| 461 | Ga0265340_10000001 | 3300031247 | Bacteria | 1647668 |
| 462 | Ga0265327_10024549 | 3300031251 | Bacteria | 3538 |
| 463 | Ga0265327_10217830 | 3300031251 | Unclassified | 859 |
| 464 | Ga0265316_10122406 | 3300031344 | Bacteria | 1964 |
| 465 | Ga0307408_100377914 | 3300031548 | Bacteria | 1210 |
| 466 | Ga0307408_101042289 | 3300031548 | Bacteria | 756 |
| 467 | Ga0265314_10091338 | 3300031711 | Bacteria | 1982 |
| 468 | Ga0265314_10469534 | 3300031711 | Unclassified | 667 |
| 469 | Ga0265342_10240145 | 3300031712 | Unclassified | 970 |
| 470 | Ga0307405_11063814 | 3300031731 | Bacteria | 693 |
| 471 | Ga0307413_11240298 | 3300031824 | Unclassified | 650 |
| 472 | Ga0307410_10015235 | 3300031852 | Bacteria | 4554 |
| 473 | Ga0307410_10123587 | 3300031852 | Bacteria | 1891 |
| 474 | Ga0307410_10358893 | 3300031852 | Bacteria | 1167 |
| 475 | Ga0307407_10080421 | 3300031903 | Bacteria | 1969 |
| 476 | Ga0307407_10104721 | 3300031903 | Bacteria | 1764 |
| 477 | Ga0307407_10629598 | 3300031903 | Bacteria | 802 |
| 478 | Ga0307407_10973942 | 3300031903 | Bacteria | 654 |
| 479 | Ga0307412_10093308 | 3300031911 | Bacteria | 2111 |
| 480 | Ga0307412_10419701 | 3300031911 | Bacteria | 1094 |
| 481 | Ga0307412_10532219 | 3300031911 | Bacteria | 984 |
| 482 | Ga0307412_11595944 | 3300031911 | Bacteria | 595 |
| 483 | Ga0307409_100144232 | 3300031995 | Bacteria | 2056 |
| 484 | Ga0307409_100569943 | 3300031995 | Bacteria | 1114 |
| 485 | Ga0307409_100978965 | 3300031995 | Bacteria | 863 |
| 486 | Ga0307409_101099425 | 3300031995 | Bacteria | 816 |
| 487 | Ga0307409_101541596 | 3300031995 | Bacteria | 692 |
| 488 | Ga0307409_102949935 | 3300031995 | Unclassified | 502 |
| 489 | Ga0307416_100064502 | 3300032002 | Bacteria | 3005 |
| 490 | Ga0307416_100109289 | 3300032002 | Bacteria | 2432 |
| 491 | Ga0307416_100116805 | 3300032002 | Bacteria | 2366 |
| 492 | Ga0307416_100254575 | 3300032002 | Bacteria | 1711 |
| 493 | Ga0307416_100542396 | 3300032002 | Bacteria | 1235 |
| 494 | Ga0307416_100596589 | 3300032002 | Bacteria | 1184 |
| 495 | Ga0307414_10441703 | 3300032004 | Bacteria | 1139 |
| 496 | Ga0307411_11198637 | 3300032005 | Unclassified | 688 |
| 497 | Ga0307415_100004333 | 3300032126 | Bacteria | 7349 |
| 498 | Ga0307415_100053661 | 3300032126 | Bacteria | 2748 |
| 499 | Ga0307415_100063811 | 3300032126 | Bacteria | 2561 |
| 500 | Ga0307415_100242201 | 3300032126 | Bacteria | 1459 |
| 501 | Ga0373944_0059204 | 3300035089 | Bacteria | 1225 |
| 502 | Ga0373943_0026167 | 3300035170 | Bacteria | 2732 |
| 503 | Ga0373931_0908810 | 3300035691 | Bacteria | 592 |
| 504 | Ga0373935_0448338 | 3300035692 | Bacteria | 932 |
| 505 | Ga0373947_0192034 | 3300035725 | Bacteria | 1333 |
| 506 | Ga0373925_1221299 | 3300037068 | Bacteria | 617 |
| 507 | Ga0395899_0922616 | 3300037312 | Bacteria | 531 |
| 508 | Ga0395900_0106720 | 3300037418 | Bacteria | 2877 |
| 509 | Ga0395900_0806991 | 3300037418 | Bacteria | 866 |
| 510 | Ga0395898_0234206 | 3300037466 | Bacteria | 1751 |
| 511 | Ga0395898_0620157 | 3300037466 | Bacteria | 1024 |
| 512 | Ga0395898_1355335 | 3300037466 | Bacteria | 640 |
| 513 | Ga0395905_0406955 | 3300037471 | Bacteria | 1256 |
| 514 | Ga0395905_0768554 | 3300037471 | Bacteria | 866 |
| 515 | Ga0436364_0069035 | 3300037853 | Bacteria | 1276 |
| 516 | Ga0436364_0083442 | 3300037853 | Bacteria | 20899 |
| 517 | Ga0436364_0143594 | 3300037853 | Bacteria | 957 |
| 518 | Ga0436364_0253679 | 3300037853 | Bacteria | 41160 |
| 519 | Ga0436364_0696536 | 3300037853 | Bacteria | 1426 |
| 520 | Ga0436364_0711358 | 3300037853 | Bacteria | 1581 |
| 521 | Ga0436364_1236778 | 3300037853 | Bacteria | 581 |
| 522 | Ga0436364_1506247 | 3300037853 | Bacteria | 6182 |
| 523 | Ga0395901_0142972 | 3300038443 | Bacteria | 2515 |
| 524 | Ga0395901_0179675 | 3300038443 | Bacteria | 2219 |
| 525 | Ga0395901_0216600 | 3300038443 | Bacteria | 2003 |
| 526 | Ga0395901_0218353 | 3300038443 | Bacteria | 1993 |
| 527 | Ga0395901_1023908 | 3300038443 | Bacteria | 800 |
| 528 | Ga0395901_1104003 | 3300038443 | Bacteria | 764 |
| 529 | Ga0436365_0047645 | 3300039437 | Bacteria | 1134 |
| 530 | Ga0436365_0300577 | 3300039437 | Bacteria | 7330 |
| 531 | Ga0436365_0644636 | 3300039437 | Bacteria | 2316 |
| 532 | Ga0436365_0914767 | 3300039437 | Bacteria | 1894 |
| 533 | Ga0436365_1188153 | 3300039437 | Bacteria | 27546 |
| 534 | Ga0436361_1073365 | 3300039447 | Unclassified | 1594 |
| 535 | Ga0436363_0115300 | 3300039450 | Bacteria | 1694 |
| 536 | Ga0436363_0202603 | 3300039450 | Bacteria | 1729 |
| 537 | Ga0436363_0702773 | 3300039450 | Bacteria | 1298 |
| 538 | Ga0436363_0771235 | 3300039450 | Bacteria | 1298 |
| 539 | Ga0436363_0991270 | 3300039450 | Bacteria | 1481 |
| 540 | Ga0436363_1384290 | 3300039450 | Bacteria | 1722 |
| 541 | Ga0436363_1523944 | 3300039450 | Bacteria | 2634 |
| 542 | Ga0436362_0786700 | 3300039453 | Bacteria | 2468 |
| 543 | Ga0436362_0791856 | 3300039453 | Bacteria | 794 |
| 544 | Ga0451793_0439203 | 3300041452 | Unclassified | 577 |
| 545 | Ga0451797_0069996 | 3300041453 | Bacteria | 871 |
| 546 | Ga0451800_0592877 | 3300041459 | Bacteria | 1035 |
| 547 | Ga0451833_0898710 | 3300041491 | Bacteria | 1051 |
| 548 | Ga0451839_1363326 | 3300041496 | Bacteria | 541 |
| 549 | Ga0451849_0674714 | 3300041505 | Bacteria | 616 |
| 550 | Ga0451853_2965079 | 3300041512 | Bacteria | 952 |
| 551 | Ga0451853_3353689 | 3300041512 | Bacteria | 948 |
| 552 | Ga0439450_040958 | 3300042008 | Bacteria | 1075 |
| 553 | Ga0439454_110961 | 3300042011 | Bacteria | 523 |
| 554 | Ga0450888_033760 | 3300042126 | Bacteria | 693 |
| 555 | Ga0450902_041476 | 3300042137 | Bacteria | 784 |
| 556 | Ga0439464_0026506 | 3300042439 | Bacteria | 1608 |
| 557 | Ga0439440_0173325 | 3300042993 | Bacteria | 628 |
| 558 | Ga0466972_0209235 | 3300044658 | Bacteria | 913 |
| 559 | Ga0466965_0379640 | 3300044683 | Bacteria | 778 |
| 560 | Ga0466966_0239222 | 3300044684 | Bacteria | 1095 |
| 561 | Ga0466966_0452250 | 3300044684 | Bacteria | 772 |
| 562 | Ga0466966_0725518 | 3300044684 | Bacteria | 599 |
| 563 | Ga0466961_0038116 | 3300044693 | Bacteria | 3083 |
| 564 | Ga0466961_0098052 | 3300044693 | Bacteria | 1848 |
| 565 | Ga0466961_0101439 | 3300044693 | Bacteria | 1813 |
| 566 | Ga0466961_0479169 | 3300044693 | Bacteria | 752 |
| 567 | Ga0466961_0768401 | 3300044693 | Bacteria | 576 |
| 568 | Ga0466963_0011113 | 3300044694 | Bacteria | 5475 |
| 569 | Ga0466963_0033768 | 3300044694 | Bacteria | 3325 |
| 570 | Ga0466963_0081636 | 3300044694 | Bacteria | 2190 |
| 571 | Ga0466963_0242055 | 3300044694 | Bacteria | 1265 |
| 572 | Ga0466963_0343239 | 3300044694 | Bacteria | 1051 |
| 573 | Ga0466963_0405309 | 3300044694 | Bacteria | 962 |
| 574 | Ga0466963_0660745 | 3300044694 | Bacteria | 738 |
| 575 | Ga0466963_0890961 | 3300044694 | Bacteria | 627 |
| 576 | Ga0466963_0949701 | 3300044694 | Bacteria | 606 |
| 577 | Ga0466963_0959413 | 3300044694 | Unclassified | 602 |
| 578 | Ga0466963_1042400 | 3300044694 | Unclassified | 576 |
| 579 | Ga0466964_0014898 | 3300044706 | Bacteria | 2961 |
| 580 | Ga0466964_0361280 | 3300044706 | Bacteria | 749 |
| 581 | Ga0466964_0383124 | 3300044706 | Bacteria | 730 |
| 582 | Ga0466971_0341886 | 3300044719 | Archaea | 723 |
| 583 | Ga0466968_0045560 | 3300044735 | Bacteria | 1862 |
| 584 | Ga0466970_0120321 | 3300044765 | Bacteria | 1438 |
| 585 | Ga0466970_0252482 | 3300044765 | Bacteria | 988 |
| 586 | Ga0466970_0602189 | 3300044765 | Bacteria | 637 |
| 587 | Ga0466970_0902112 | 3300044765 | Bacteria | 520 |
| 588 | Ga0466957_0847608 | 3300044842 | Bacteria | 651 |
| 589 | Ga0466960_0114928 | 3300044901 | Bacteria | 1403 |
| 590 | Ga0466960_0248728 | 3300044901 | Bacteria | 987 |
| 591 | Ga0466960_0263040 | 3300044901 | Bacteria | 962 |
| 592 | Ga0466960_0357698 | 3300044901 | Bacteria | 834 |
| 593 | Ga0466960_0951418 | 3300044901 | Unclassified | 526 |
| 594 | Ga0466960_1059276 | 3300044901 | Bacteria | 500 |
| 595 | Ga0466959_0060127 | 3300045049 | Bacteria | 2765 |
| 596 | Ga0466959_0068304 | 3300045049 | Bacteria | 2575 |
| 597 | Ga0466959_0136602 | 3300045049 | Bacteria | 1735 |
| 598 | Ga0466959_0148462 | 3300045049 | Bacteria | 1654 |
| 599 | Ga0466959_0175035 | 3300045049 | Bacteria | 1504 |
| 600 | Ga0466959_0197771 | 3300045049 | Bacteria | 1401 |
| 601 | Ga0466959_0878112 | 3300045049 | Bacteria | 598 |
| 602 | Ga0466959_0992765 | 3300045049 | Bacteria | 559 |
| 603 | Ga0466958_0010792 | 3300045836 | Bacteria | 5127 |
| 604 | Ga0466958_0101731 | 3300045836 | Bacteria | 1787 |
| 605 | Ga0466958_0645792 | 3300045836 | Bacteria | 689 |
| 606 | Ga0466958_1057031 | 3300045836 | Unclassified | 530 |
| 607 | Ga0466967_0030588 | 3300045976 | Bacteria | 4520 |
| 608 | Ga0466967_0034138 | 3300045976 | Bacteria | 4314 |
| 609 | Ga0466967_0060637 | 3300045976 | Bacteria | 3353 |
| 610 | Ga0466967_0145748 | 3300045976 | Bacteria | 2209 |
| 611 | Ga0466967_0184093 | 3300045976 | Bacteria | 1971 |
| 612 | Ga0466967_0570363 | 3300045976 | Unclassified | 1115 |
| 613 | Ga0466967_0702264 | 3300045976 | Bacteria | 1002 |
| 614 | Ga0466967_1070291 | 3300045976 | Bacteria | 803 |
| 615 | Ga0466967_1393236 | 3300045976 | Bacteria | 698 |
| 616 | Ga0466967_1654833 | 3300045976 | Bacteria | 637 |
| 617 | Ga0466967_1667427 | 3300045976 | Bacteria | 635 |
| 618 | Ga0466967_2027541 | 3300045976 | Unclassified | 572 |
| 619 | Ga0495603_0095519 | 3300046455 | Bacteria | 1737 |
| 620 | Ga0495641_0495293 | 3300046461 | Bacteria | 557 |
| 621 | Ga0495651_0673594 | 3300046462 | Unclassified | 647 |
| 622 | Ga0495653_0001695 | 3300046463 | Bacteria | 17331 |
| 623 | Ga0495650_0000398 | 3300046471 | Bacteria | 72672 |
| 624 | Ga0495582_0096920 | 3300046473 | Bacteria | 1649 |
| 625 | Ga0495584_0308504 | 3300046491 | Bacteria | 804 |
| 626 | Ga0495608_0225185 | 3300046511 | Bacteria | 1175 |
| 627 | Ga0495618_0000149 | 3300046514 | Bacteria | 49623 |
| 628 | Ga0495620_0056131 | 3300046515 | Bacteria | 1658 |
| 629 | Ga0495630_0000182 | 3300046517 | Bacteria | 48697 |
| 630 | Ga0495630_1475543 | 3300046517 | Bacteria | 511 |
| 631 | Ga0495652_0404348 | 3300046529 | Unclassified | 966 |
| 632 | Ga0495609_0143532 | 3300046538 | Bacteria | 1018 |
| 633 | Ga0495609_0377076 | 3300046538 | Bacteria | 570 |
| 634 | Ga0495645_0000181 | 3300046543 | Bacteria | 44474 |
| 635 | Ga0495657_0000213 | 3300046675 | Bacteria | 52360 |
| 636 | Ga0495658_0373348 | 3300046683 | Unclassified | 908 |
| 637 | Ga0495581_0269671 | 3300047315 | Bacteria | 995 |
| 638 | Ga0495672_0018594 | 3300047320 | Bacteria | 4608 |
| 639 | Ga0496100_0000650 | 3300048903 | Bacteria | 16486 |
| 640 | Ga0496100_0002493 | 3300048903 | Bacteria | 9367 |
| 641 | Ga0496100_0424892 | 3300048903 | Bacteria | 1015 |
| 642 | Ga0496101_0002222 | 3300048904 | Bacteria | 11860 |
| 643 | Ga0496101_0030126 | 3300048904 | Bacteria | 3802 |
| 644 | Ga0496101_0095311 | 3300048904 | Bacteria | 2220 |
| 645 | Ga0496101_1318884 | 3300048904 | Bacteria | 564 |
| 646 | Ga0496102_0124870 | 3300048905 | Bacteria | 2405 |
| 647 | Ga0496102_0135736 | 3300048905 | Bacteria | 2305 |
| 648 | Ga0496102_0547606 | 3300048905 | Bacteria | 1080 |
| 649 | Ga0496102_0672192 | 3300048905 | Bacteria | 959 |
| 650 | Ga0496102_1100917 | 3300048905 | Bacteria | 714 |
| 651 | Ga0496103_0143445 | 3300048906 | Bacteria | 1528 |
| 652 | Ga0496104_0010231 | 3300048907 | Bacteria | 8375 |
| 653 | Ga0496104_0080428 | 3300048907 | Bacteria | 3107 |
| 654 | Ga0496104_0265996 | 3300048907 | Bacteria | 1627 |
| 655 | Ga0496105_0147973 | 3300048908 | Bacteria | 1931 |
| 656 | Ga0496106_0012233 | 3300048909 | Bacteria | 6334 |
| 657 | Ga0496106_0065193 | 3300048909 | Bacteria | 2773 |
| 658 | Ga0496106_0695084 | 3300048909 | Bacteria | 811 |
| 659 | Ga0496107_0258404 | 3300048910 | Bacteria | 1296 |
| 660 | Ga0496107_0457202 | 3300048910 | Bacteria | 948 |
| 661 | Ga0496107_0481661 | 3300048910 | Bacteria | 921 |
| 662 | Ga0496107_1097481 | 3300048910 | Unclassified | 575 |
| 663 | Ga0496108_0002318 | 3300048911 | Bacteria | 15233 |
| 664 | Ga0496108_0033301 | 3300048911 | Bacteria | 4281 |
| 665 | Ga0496108_0240798 | 3300048911 | Bacteria | 1574 |
| 666 | Ga0496108_0278659 | 3300048911 | Bacteria | 1456 |
| 667 | Ga0496108_1317119 | 3300048911 | Bacteria | 607 |
| 668 | Ga0496109_0000757 | 3300048912 | Bacteria | 26932 |
| 669 | Ga0496109_0060451 | 3300048912 | Bacteria | 3462 |
| 670 | Ga0496109_0214678 | 3300048912 | Bacteria | 1809 |
| 671 | Ga0496109_0682075 | 3300048912 | Bacteria | 965 |
| 672 | Ga0496109_0927063 | 3300048912 | Bacteria | 809 |
| 673 | Ga0496109_1163521 | 3300048912 | Bacteria | 708 |
| 674 | Ga0496110_0000630 | 3300048913 | Bacteria | 24110 |
| 675 | Ga0496110_0100084 | 3300048913 | Bacteria | 2598 |
| 676 | Ga0496110_0168645 | 3300048913 | Bacteria | 1986 |
| 677 | Ga0496110_0475068 | 3300048913 | Bacteria | 1139 |
| 678 | Ga0496111_0018084 | 3300048914 | Bacteria | 4877 |
| 679 | Ga0496111_0174935 | 3300048914 | Bacteria | 1595 |
| 680 | Ga0496111_0508290 | 3300048914 | Bacteria | 886 |
| 681 | Ga0496111_0842689 | 3300048914 | Unclassified | 662 |
| 682 | Ga0496112_0000308 | 3300048915 | Bacteria | 31586 |
| 683 | Ga0496112_0031510 | 3300048915 | Bacteria | 5144 |
| 684 | Ga0496112_0059519 | 3300048915 | Bacteria | 3764 |
| 685 | Ga0496112_0098263 | 3300048915 | Bacteria | 2897 |
| 686 | Ga0496112_0140696 | 3300048915 | Bacteria | 2382 |
| 687 | Ga0496112_0576116 | 3300048915 | Bacteria | 1058 |
| 688 | Ga0496112_0618573 | 3300048915 | Bacteria | 1014 |
| 689 | Ga0496112_1110581 | 3300048915 | Bacteria | 709 |
| 690 | Ga0496112_1314997 | 3300048915 | Bacteria | 638 |
| 691 | Ga0496113_0017090 | 3300048916 | Bacteria | 5029 |
| 692 | Ga0496113_0043441 | 3300048916 | Bacteria | 3326 |
| 693 | Ga0496113_0284274 | 3300048916 | Bacteria | 1323 |
| 694 | Ga0496113_0936555 | 3300048916 | Unclassified | 684 |
| 695 | Ga0496113_1204680 | 3300048916 | Bacteria | 591 |
| 696 | Ga0496114_0070676 | 3300048917 | Bacteria | 2933 |
| 697 | Ga0496114_0518202 | 3300048917 | Bacteria | 1054 |
| 698 | Ga0496115_0000680 | 3300048918 | Bacteria | 25141 |
| 699 | Ga0496115_0739487 | 3300048918 | Bacteria | 770 |
| 700 | Ga0496121_0100779 | 3300048924 | Bacteria | 2229 |
| 701 | Ga0496122_0155324 | 3300048925 | Bacteria | 1405 |
| 702 | Ga0496126_0475004 | 3300048929 | Bacteria | 1003 |
| 703 | Ga0501317_105810 | 3300049533 | Bacteria | 512 |
| 704 | Ga0501318_008980 | 3300049534 | Bacteria | 1081 |
| 705 | Ga0501325_049548 | 3300049541 | Bacteria | 531 |
| 706 | Ga0501038_1076730 | 3300049574 | Bacteria | 588 |
| 707 | Ga0501039_0680880 | 3300049575 | Bacteria | 805 |
| 708 | Ga0501047_0275459 | 3300049581 | Bacteria | 1528 |
| 709 | Ga0501048_0320114 | 3300049582 | Bacteria | 1105 |
| 710 | Ga0501069_0710559 | 3300049585 | Bacteria | 607 |
| 711 | Ga0501075_0891368 | 3300049591 | Bacteria | 676 |
| 712 | Ga0501076_0755323 | 3300049592 | Bacteria | 803 |
| 713 | Ga0501198_078525 | 3300049649 | Bacteria | 635 |
| 714 | Ga0501223_111771 | 3300049663 | Bacteria | 571 |
| 715 | Ga0501079_0706836 | 3300049741 | Bacteria | 793 |
| 716 | Ga0501081_0999958 | 3300049743 | Bacteria | 632 |
| 717 | Ga0501035_1205489 | 3300049822 | Unclassified | 587 |
| 718 | Ga0501045_1065431 | 3300049824 | Bacteria | 592 |
| 719 | nmdc:mga00v17_449506_c1 | 3300050491 | Bacteria | 836 |
| 720 | nmdc:mga0yw44_726562_c1 | 3300050492 | Bacteria | 674 |
| 721 | nmdc:mga05p37_695082_c1 | 3300050507 | Bacteria | 1131 |
| 722 | nmdc:mga09592_10356_c1 | 3300050508 | Bacteria | 7587 |
| 723 | nmdc:mga09592_1043764_c1 | 3300050508 | Bacteria | 681 |
| 724 | nmdc:mga06r32_1495464_c1 | 3300050510 | Bacteria | 615 |
| 725 | nmdc:mga08y16_463984_c1 | 3300050511 | Bacteria | 1290 |
| 726 | nmdc:mga08y16_610241_c1 | 3300050511 | Bacteria | 1099 |
| 727 | nmdc:mga0rr50_1301770_c1 | 3300050513 | Bacteria | 616 |
| 728 | nmdc:mga0rr50_590773_c1 | 3300050513 | Bacteria | 946 |
| 729 | nmdc:mga0rr50_595799_c1 | 3300050513 | Unclassified | 942 |
| 730 | Ga0495601_0007254 | 3300053077 | Bacteria | 6502 |
| 731 | Ga0495601_0468977 | 3300053077 | Bacteria | 814 |
| 732 | Ga0495601_0699347 | 3300053077 | Bacteria | 647 |
| 733 | Ga0495612_0000057 | 3300053078 | Bacteria | 49938 |
| 734 | Ga0495619_1116297 | 3300053085 | Unclassified | 524 |
| 735 | Ga0500588_0029025 | 3300053146 | Bacteria | 1574 |
| 736 | Ga0587073_0319924 | 3300059492 | Bacteria | 511 |
| 737 | Ga0587076_152923 | 3300059645 | Unclassified | 561 |
| 738 | Ga0466962_0448288 | 3300061719 | Bacteria | 650 |
| 739 | Ga0466962_0597895 | 3300061719 | Bacteria | 562 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049591 | Ga0501075_0891368 | Ga0501075_0891368_51_338 | 82 |
| 2 | 3300049822 | Ga0501035_1205489 | Ga0501035_1205489_225_512 | 82 |
| 3 | 3300049824 | Ga0501045_1065431 | Ga0501045_1065431_124_411 | 82 |
| 4 | 3300037471 | Ga0395905_0406955 | Ga0395905_0406955_416_694 | 88 |
| 5 | 3300038443 | Ga0395901_0142972 | Ga0395901_0142972_142_420 | 88 |
| 6 | 3300041505 | Ga0451849_0674714 | Ga0451849_0674714_17_295 | 88 |
| 7 | 3300053077 | Ga0495601_0699347 | Ga0495601_0699347_267_545 | 88 |
| 8 | 3300005338 | Ga0068868_100282928 | Ga0068868_1002829284 | 89 |
| 9 | 3300005338 | Ga0068868_100392579 | Ga0068868_1003925792 | 89 |
| 10 | 3300005339 | Ga0070660_100073022 | Ga0070660_1000730222 | 89 |
| 11 | 3300005343 | Ga0070687_100876307 | Ga0070687_1008763072 | 89 |
| 12 | 3300005366 | Ga0070659_100726915 | Ga0070659_1007269152 | 89 |
| 13 | 3300005366 | Ga0070659_100934861 | Ga0070659_1009348612 | 89 |
| 14 | 3300005366 | Ga0070659_100976914 | Ga0070659_1009769143 | 89 |
| 15 | 3300005456 | Ga0070678_100932872 | Ga0070678_1009328722 | 89 |
| 16 | 3300005530 | Ga0070679_100062457 | Ga0070679_1000624573 | 89 |
| 17 | 3300005564 | Ga0070664_102125389 | Ga0070664_1021253892 | 89 |
| 18 | 3300005578 | Ga0068854_100122530 | Ga0068854_1001225302 | 89 |
| 19 | 3300005614 | Ga0068856_100057926 | Ga0068856_1000579266 | 89 |
| 20 | 3300005614 | Ga0068856_100341471 | Ga0068856_1003414712 | 89 |
| 21 | 3300005614 | Ga0068856_100348956 | Ga0068856_1003489563 | 89 |
| 22 | 3300005614 | Ga0068856_100604280 | Ga0068856_1006042802 | 89 |
| 23 | 3300005616 | Ga0068852_100363553 | Ga0068852_1003635534 | 89 |
| 24 | 3300005841 | Ga0068863_100189364 | Ga0068863_1001893644 | 89 |
| 25 | 3300005841 | Ga0068863_102298631 | Ga0068863_1022986311 | 89 |
| 26 | 3300005937 | Ga0081455_10008248 | Ga0081455_100082484 | 89 |
| 27 | 3300005983 | Ga0081540_1001786 | Ga0081540_100178611 | 89 |
| 28 | 3300006048 | Ga0075363_100229570 | Ga0075363_1002295702 | 89 |
| 29 | 3300006175 | Ga0070712_101894269 | Ga0070712_1018942692 | 89 |
| 30 | 3300006871 | Ga0075434_102203227 | Ga0075434_1022032271 | 89 |
| 31 | 3300006881 | Ga0068865_100614730 | Ga0068865_1006147302 | 89 |
| 32 | 3300009098 | Ga0105245_10880466 | Ga0105245_108804662 | 89 |
| 33 | 3300009553 | Ga0105249_10895176 | Ga0105249_108951763 | 89 |
| 34 | 3300010375 | Ga0105239_10591738 | Ga0105239_105917384 | 89 |
| 35 | 3300010375 | Ga0105239_12022260 | Ga0105239_120222601 | 89 |
| 36 | 3300011119 | Ga0105246_10794609 | Ga0105246_107946092 | 89 |
| 37 | 3300013102 | Ga0157371_10654874 | Ga0157371_106548742 | 89 |
| 38 | 3300013296 | Ga0157374_12709569 | Ga0157374_127095692 | 89 |
| 39 | 3300013307 | Ga0157372_10625884 | Ga0157372_106258842 | 89 |
| 40 | 3300013308 | Ga0157375_10532724 | Ga0157375_105327243 | 89 |
| 41 | 3300014497 | Ga0182008_10142544 | Ga0182008_101425442 | 89 |
| 42 | 3300014745 | Ga0157377_10612768 | Ga0157377_106127682 | 89 |
| 43 | 3300014745 | Ga0157377_11070264 | Ga0157377_110702642 | 89 |
| 44 | 3300014968 | Ga0157379_10266864 | Ga0157379_102668644 | 89 |
| 45 | 3300020069 | Ga0197907_10615912 | Ga0197907_106159122 | 89 |
| 46 | 3300020075 | Ga0206349_1231240 | Ga0206349_12312402 | 89 |
| 47 | 3300025901 | Ga0207688_10136005 | Ga0207688_101360052 | 89 |
| 48 | 3300025912 | Ga0207707_10429276 | Ga0207707_104292761 | 89 |
| 49 | 3300025917 | Ga0207660_11398269 | Ga0207660_113982691 | 89 |
| 50 | 3300025918 | Ga0207662_10252368 | Ga0207662_102523682 | 89 |
| 51 | 3300025921 | Ga0207652_10093457 | Ga0207652_100934572 | 89 |
| 52 | 3300025932 | Ga0207690_10733290 | Ga0207690_107332903 | 89 |
| 53 | 3300025932 | Ga0207690_10846286 | Ga0207690_108462862 | 89 |
| 54 | 3300025938 | Ga0207704_10476749 | Ga0207704_104767492 | 89 |
| 55 | 3300025944 | Ga0207661_11578741 | Ga0207661_115787411 | 89 |
| 56 | 3300025949 | Ga0207667_11702590 | Ga0207667_117025902 | 89 |
| 57 | 3300025961 | Ga0207712_11999224 | Ga0207712_119992242 | 89 |
| 58 | 3300025981 | Ga0207640_11333372 | Ga0207640_113333721 | 89 |
| 59 | 3300026023 | Ga0207677_10070256 | Ga0207677_100702561 | 89 |
| 60 | 3300026023 | Ga0207677_12242083 | Ga0207677_122420832 | 89 |
| 61 | 3300026067 | Ga0207678_11299408 | Ga0207678_112994082 | 89 |
| 62 | 3300026075 | Ga0207708_10503588 | Ga0207708_105035882 | 89 |
| 63 | 3300026078 | Ga0207702_10248857 | Ga0207702_102488574 | 89 |
| 64 | 3300026078 | Ga0207702_10308922 | Ga0207702_103089222 | 89 |
| 65 | 3300026088 | Ga0207641_10289497 | Ga0207641_102894972 | 89 |
| 66 | 3300026088 | Ga0207641_11985241 | Ga0207641_119852411 | 89 |
| 67 | 3300026095 | Ga0207676_10441982 | Ga0207676_104419822 | 89 |
| 68 | 3300026118 | Ga0207675_100212850 | Ga0207675_1002128502 | 89 |
| 69 | 3300026118 | Ga0207675_100641902 | Ga0207675_1006419021 | 89 |
| 70 | 3300026142 | Ga0207698_10373185 | Ga0207698_103731852 | 89 |
| 71 | 3300032126 | Ga0307415_100053661 | Ga0307415_1000536612 | 89 |
| 72 | 3300035089 | Ga0373944_0059204 | Ga0373944_0059204_746_1027 | 89 |
| 73 | 3300035170 | Ga0373943_0026167 | Ga0373943_0026167_662_943 | 89 |
| 74 | 3300035691 | Ga0373931_0908810 | Ga0373931_0908810_116_397 | 89 |
| 75 | 3300035692 | Ga0373935_0448338 | Ga0373935_0448338_157_438 | 89 |
| 76 | 3300035725 | Ga0373947_0192034 | Ga0373947_0192034_659_940 | 89 |
| 77 | 3300037068 | Ga0373925_1221299 | Ga0373925_1221299_203_484 | 89 |
| 78 | 3300037418 | Ga0395900_0106720 | Ga0395900_0106720_1264_1548 | 89 |
| 79 | 3300037418 | Ga0395900_0806991 | Ga0395900_0806991_240_521 | 89 |
| 80 | 3300037466 | Ga0395898_0234206 | Ga0395898_0234206_452_736 | 89 |
| 81 | 3300037466 | Ga0395898_0620157 | Ga0395898_0620157_229_510 | 89 |
| 82 | 3300037466 | Ga0395898_1355335 | Ga0395898_1355335_111_392 | 89 |
| 83 | 3300037471 | Ga0395905_0768554 | Ga0395905_0768554_246_530 | 89 |
| 84 | 3300038443 | Ga0395901_0179675 | Ga0395901_0179675_1228_1509 | 89 |
| 85 | 3300038443 | Ga0395901_0218353 | Ga0395901_0218353_651_935 | 89 |
| 86 | 3300038443 | Ga0395901_1023908 | Ga0395901_1023908_288_569 | 89 |
| 87 | 3300041452 | Ga0451793_0439203 | Ga0451793_0439203_206_487 | 89 |
| 88 | 3300041453 | Ga0451797_0069996 | Ga0451797_0069996_100_381 | 89 |
| 89 | 3300041459 | Ga0451800_0592877 | Ga0451800_0592877_419_700 | 89 |
| 90 | 3300041496 | Ga0451839_1363326 | Ga0451839_1363326_25_306 | 89 |
| 91 | 3300041512 | Ga0451853_2965079 | Ga0451853_2965079_505_786 | 89 |
| 92 | 3300044684 | Ga0466966_0452250 | Ga0466966_0452250_17_310 | 89 |
| 93 | 3300044901 | Ga0466960_0248728 | Ga0466960_0248728_241_522 | 89 |
| 94 | 3300045049 | Ga0466959_0992765 | Ga0466959_0992765_125_406 | 89 |
| 95 | 3300046455 | Ga0495603_0095519 | Ga0495603_0095519_705_986 | 89 |
| 96 | 3300046461 | Ga0495641_0495293 | Ga0495641_0495293_95_376 | 89 |
| 97 | 3300046471 | Ga0495650_0000398 | Ga0495650_0000398_51460_51741 | 89 |
| 98 | 3300046473 | Ga0495582_0096920 | Ga0495582_0096920_833_1114 | 89 |
| 99 | 3300047315 | Ga0495581_0269671 | Ga0495581_0269671_91_372 | 89 |
| 100 | 3300048903 | Ga0496100_0424892 | Ga0496100_0424892_663_944 | 89 |
| 101 | 3300048904 | Ga0496101_0030126 | Ga0496101_0030126_2257_2538 | 89 |
| 102 | 3300048904 | Ga0496101_0095311 | Ga0496101_0095311_986_1267 | 89 |
| 103 | 3300048904 | Ga0496101_1318884 | Ga0496101_1318884_27_308 | 89 |
| 104 | 3300048905 | Ga0496102_0124870 | Ga0496102_0124870_110_391 | 89 |
| 105 | 3300048905 | Ga0496102_0135736 | Ga0496102_0135736_1191_1472 | 89 |
| 106 | 3300048907 | Ga0496104_0010231 | Ga0496104_0010231_1840_2121 | 89 |
| 107 | 3300048907 | Ga0496104_0080428 | Ga0496104_0080428_2149_2430 | 89 |
| 108 | 3300048908 | Ga0496105_0147973 | Ga0496105_0147973_626_907 | 89 |
| 109 | 3300048909 | Ga0496106_0012233 | Ga0496106_0012233_5778_6059 | 89 |
| 110 | 3300048910 | Ga0496107_0258404 | Ga0496107_0258404_461_742 | 89 |
| 111 | 3300048911 | Ga0496108_0002318 | Ga0496108_0002318_2282_2563 | 89 |
| 112 | 3300048911 | Ga0496108_0033301 | Ga0496108_0033301_1441_1722 | 89 |
| 113 | 3300048911 | Ga0496108_0278659 | Ga0496108_0278659_993_1286 | 89 |
| 114 | 3300048912 | Ga0496109_0000757 | Ga0496109_0000757_3722_4003 | 89 |
| 115 | 3300048912 | Ga0496109_0060451 | Ga0496109_0060451_1608_1889 | 89 |
| 116 | 3300048913 | Ga0496110_0000630 | Ga0496110_0000630_21597_21878 | 89 |
| 117 | 3300048913 | Ga0496110_0100084 | Ga0496110_0100084_419_700 | 89 |
| 118 | 3300048914 | Ga0496111_0018084 | Ga0496111_0018084_2365_2646 | 89 |
| 119 | 3300048914 | Ga0496111_0174935 | Ga0496111_0174935_910_1191 | 89 |
| 120 | 3300048915 | Ga0496112_0031510 | Ga0496112_0031510_2673_2954 | 89 |
| 121 | 3300048915 | Ga0496112_0059519 | Ga0496112_0059519_3277_3558 | 89 |
| 122 | 3300048915 | Ga0496112_0098263 | Ga0496112_0098263_292_573 | 89 |
| 123 | 3300048915 | Ga0496112_0618573 | Ga0496112_0618573_281_562 | 89 |
| 124 | 3300048916 | Ga0496113_0017090 | Ga0496113_0017090_2232_2513 | 89 |
| 125 | 3300048916 | Ga0496113_0284274 | Ga0496113_0284274_199_480 | 89 |
| 126 | 3300048917 | Ga0496114_0070676 | Ga0496114_0070676_2303_2584 | 89 |
| 127 | 3300048917 | Ga0496114_0518202 | Ga0496114_0518202_414_695 | 89 |
| 128 | 3300048918 | Ga0496115_0739487 | Ga0496115_0739487_175_456 | 89 |
| 129 | 3300049575 | Ga0501039_0680880 | Ga0501039_0680880_461_790 | 89 |
| 130 | 3300049582 | Ga0501048_0320114 | Ga0501048_0320114_510_839 | 89 |
| 131 | 3300049585 | Ga0501069_0710559 | Ga0501069_0710559_22_309 | 89 |
| 132 | 3300049592 | Ga0501076_0755323 | Ga0501076_0755323_23_319 | 89 |
| 133 | 3300049741 | Ga0501079_0706836 | Ga0501079_0706836_41_370 | 89 |
| 134 | 3300049743 | Ga0501081_0999958 | Ga0501081_0999958_84_413 | 89 |
| 135 | 3300050491 | nmdc:mga00v17_449506_c1 | nmdc:mga00v17_449506_c1_74_352 | 89 |
| 136 | 3300050492 | nmdc:mga0yw44_726562_c1 | nmdc:mga0yw44_726562_c1_272_550 | 89 |
| 137 | 3300059492 | Ga0587073_0319924 | Ga0587073_0319924_151_432 | 89 |
| 138 | 3300013307 | Ga0157372_10420739 | Ga0157372_104207393 | 90 |
| 139 | 3300020081 | Ga0206354_11362747 | Ga0206354_113627471 | 90 |
| 140 | 3300020082 | Ga0206353_10800325 | Ga0206353_108003252 | 90 |
| 141 | 3300025914 | Ga0207671_10003194 | Ga0207671_100031948 | 90 |
| 142 | 3300044901 | Ga0466960_1059276 | Ga0466960_1059276_168_455 | 90 |
| 143 | 3300048909 | Ga0496106_0695084 | Ga0496106_0695084_498_779 | 90 |
| 144 | 3300048911 | Ga0496108_1317119 | Ga0496108_1317119_172_453 | 90 |
| 145 | 3300048915 | Ga0496112_0140696 | Ga0496112_0140696_18_299 | 90 |
| 146 | 3300048916 | Ga0496113_1204680 | Ga0496113_1204680_121_402 | 90 |
| 147 | 3300005434 | Ga0070709_10159646 | Ga0070709_101596461 | 91 |
| 148 | 3300005437 | Ga0070710_10072659 | Ga0070710_100726593 | 91 |
| 149 | 3300005439 | Ga0070711_101542976 | Ga0070711_1015429762 | 91 |
| 150 | 3300005456 | Ga0070678_102189983 | Ga0070678_1021899831 | 91 |
| 151 | 3300005545 | Ga0070695_100930995 | Ga0070695_1009309952 | 91 |
| 152 | 3300006028 | Ga0070717_10766660 | Ga0070717_107666602 | 91 |
| 153 | 3300006175 | Ga0070712_100000050 | Ga0070712_10000005036 | 91 |
| 154 | 3300006175 | Ga0070712_100231458 | Ga0070712_1002314583 | 91 |
| 155 | 3300006914 | Ga0075436_101544708 | Ga0075436_1015447082 | 91 |
| 156 | 3300009545 | Ga0105237_12726160 | Ga0105237_127261601 | 91 |
| 157 | 3300014325 | Ga0163163_12977000 | Ga0163163_129770001 | 91 |
| 158 | 3300021358 | Ga0213873_10041941 | Ga0213873_100419414 | 91 |
| 159 | 3300021377 | Ga0213874_10018585 | Ga0213874_100185851 | 91 |
| 160 | 3300021384 | Ga0213876_10003709 | Ga0213876_100037097 | 91 |
| 161 | 3300021384 | Ga0213876_10007820 | Ga0213876_100078209 | 91 |
| 162 | 3300021384 | Ga0213876_10014352 | Ga0213876_100143525 | 91 |
| 163 | 3300021384 | Ga0213876_10073210 | Ga0213876_100732104 | 91 |
| 164 | 3300021384 | Ga0213876_10277713 | Ga0213876_102777133 | 91 |
| 165 | 3300021388 | Ga0213875_10014955 | Ga0213875_100149558 | 91 |
| 166 | 3300021388 | Ga0213875_10041759 | Ga0213875_100417591 | 91 |
| 167 | 3300021388 | Ga0213875_10058999 | Ga0213875_100589992 | 91 |
| 168 | 3300021388 | Ga0213875_10473011 | Ga0213875_104730111 | 91 |
| 169 | 3300025898 | Ga0207692_10065462 | Ga0207692_100654622 | 91 |
| 170 | 3300025906 | Ga0207699_10202180 | Ga0207699_102021803 | 91 |
| 171 | 3300025915 | Ga0207693_10000151 | Ga0207693_1000015135 | 91 |
| 172 | 3300025915 | Ga0207693_10732879 | Ga0207693_107328792 | 91 |
| 173 | 3300025916 | Ga0207663_10458954 | Ga0207663_104589542 | 91 |
| 174 | 3300025929 | Ga0207664_10493781 | Ga0207664_104937811 | 91 |
| 175 | 3300028556 | Ga0265337_1018502 | Ga0265337_10185023 | 91 |
| 176 | 3300028558 | Ga0265326_10015531 | Ga0265326_100155312 | 91 |
| 177 | 3300028563 | Ga0265319_1000147 | Ga0265319_100014745 | 91 |
| 178 | 3300028563 | Ga0265319_1257873 | Ga0265319_12578732 | 91 |
| 179 | 3300028573 | Ga0265334_10049903 | Ga0265334_100499033 | 91 |
| 180 | 3300028577 | Ga0265318_10003281 | Ga0265318_100032817 | 91 |
| 181 | 3300028666 | Ga0265336_10000004 | Ga0265336_1000000412 | 91 |
| 182 | 3300028800 | Ga0265338_10000012 | Ga0265338_10000012417 | 91 |
| 183 | 3300030877 | Ga0265777_123614 | Ga0265777_1236142 | 91 |
| 184 | 3300030879 | Ga0265765_1031362 | Ga0265765_10313622 | 91 |
| 185 | 3300031247 | Ga0265340_10000001 | Ga0265340_100000011211 | 91 |
| 186 | 3300031251 | Ga0265327_10024549 | Ga0265327_100245494 | 91 |
| 187 | 3300031344 | Ga0265316_10122406 | Ga0265316_101224063 | 91 |
| 188 | 3300031711 | Ga0265314_10469534 | Ga0265314_104695342 | 91 |
| 189 | 3300031712 | Ga0265342_10240145 | Ga0265342_102401452 | 91 |
| 190 | 3300037853 | Ga0436364_0069035 | Ga0436364_0069035_377_676 | 91 |
| 191 | 3300037853 | Ga0436364_0083442 | Ga0436364_0083442_12378_12680 | 91 |
| 192 | 3300037853 | Ga0436364_0143594 | Ga0436364_0143594_398_700 | 91 |
| 193 | 3300037853 | Ga0436364_0253679 | Ga0436364_0253679_28794_29102 | 91 |
| 194 | 3300037853 | Ga0436364_0696536 | Ga0436364_0696536_364_672 | 91 |
| 195 | 3300037853 | Ga0436364_0711358 | Ga0436364_0711358_99_407 | 91 |
| 196 | 3300037853 | Ga0436364_1236778 | Ga0436364_1236778_151_450 | 91 |
| 197 | 3300037853 | Ga0436364_1506247 | Ga0436364_1506247_4267_4566 | 91 |
| 198 | 3300039437 | Ga0436365_0047645 | Ga0436365_0047645_399_707 | 91 |
| 199 | 3300039437 | Ga0436365_0300577 | Ga0436365_0300577_5804_6106 | 91 |
| 200 | 3300039437 | Ga0436365_0644636 | Ga0436365_0644636_1068_1376 | 91 |
| 201 | 3300039437 | Ga0436365_0914767 | Ga0436365_0914767_42_332 | 91 |
| 202 | 3300039437 | Ga0436365_1188153 | Ga0436365_1188153_15141_15449 | 91 |
| 203 | 3300039447 | Ga0436361_1073365 | Ga0436361_1073365_1137_1448 | 91 |
| 204 | 3300039450 | Ga0436363_0202603 | Ga0436363_0202603_1042_1350 | 91 |
| 205 | 3300039450 | Ga0436363_0702773 | Ga0436363_0702773_916_1224 | 91 |
| 206 | 3300039450 | Ga0436363_0771235 | Ga0436363_0771235_867_1175 | 91 |
| 207 | 3300039450 | Ga0436363_0991270 | Ga0436363_0991270_624_923 | 91 |
| 208 | 3300039450 | Ga0436363_1384290 | Ga0436363_1384290_1301_1609 | 91 |
| 209 | 3300039450 | Ga0436363_1523944 | Ga0436363_1523944_1482_1790 | 91 |
| 210 | 3300039453 | Ga0436362_0786700 | Ga0436362_0786700_793_1101 | 91 |
| 211 | 3300039453 | Ga0436362_0791856 | Ga0436362_0791856_463_771 | 91 |
| 212 | 3300044684 | Ga0466966_0239222 | Ga0466966_0239222_610_900 | 91 |
| 213 | 3300044684 | Ga0466966_0725518 | Ga0466966_0725518_177_488 | 91 |
| 214 | 3300044693 | Ga0466961_0098052 | Ga0466961_0098052_1412_1717 | 91 |
| 215 | 3300044693 | Ga0466961_0101439 | Ga0466961_0101439_660_971 | 91 |
| 216 | 3300044693 | Ga0466961_0768401 | Ga0466961_0768401_32_322 | 91 |
| 217 | 3300044694 | Ga0466963_0011113 | Ga0466963_0011113_5024_5335 | 91 |
| 218 | 3300044694 | Ga0466963_0033768 | Ga0466963_0033768_2154_2438 | 91 |
| 219 | 3300044694 | Ga0466963_0405309 | Ga0466963_0405309_484_792 | 91 |
| 220 | 3300044694 | Ga0466963_0949701 | Ga0466963_0949701_71_385 | 91 |
| 221 | 3300044694 | Ga0466963_0959413 | Ga0466963_0959413_103_399 | 91 |
| 222 | 3300044694 | Ga0466963_1042400 | Ga0466963_1042400_221_538 | 91 |
| 223 | 3300044719 | Ga0466971_0341886 | Ga0466971_0341886_185_487 | 91 |
| 224 | 3300044735 | Ga0466968_0045560 | Ga0466968_0045560_1126_1425 | 91 |
| 225 | 3300044765 | Ga0466970_0120321 | Ga0466970_0120321_569_859 | 91 |
| 226 | 3300044765 | Ga0466970_0602189 | Ga0466970_0602189_68_379 | 91 |
| 227 | 3300044765 | Ga0466970_0902112 | Ga0466970_0902112_130_429 | 91 |
| 228 | 3300044842 | Ga0466957_0847608 | Ga0466957_0847608_208_519 | 91 |
| 229 | 3300044901 | Ga0466960_0951418 | Ga0466960_0951418_110_391 | 91 |
| 230 | 3300045049 | Ga0466959_0068304 | Ga0466959_0068304_129_440 | 91 |
| 231 | 3300045049 | Ga0466959_0136602 | Ga0466959_0136602_968_1258 | 91 |
| 232 | 3300045049 | Ga0466959_0175035 | Ga0466959_0175035_257_559 | 91 |
| 233 | 3300045049 | Ga0466959_0878112 | Ga0466959_0878112_20_325 | 91 |
| 234 | 3300045836 | Ga0466958_0010792 | Ga0466958_0010792_2256_2567 | 91 |
| 235 | 3300045836 | Ga0466958_0645792 | Ga0466958_0645792_330_632 | 91 |
| 236 | 3300045836 | Ga0466958_1057031 | Ga0466958_1057031_38_322 | 91 |
| 237 | 3300045976 | Ga0466967_0060637 | Ga0466967_0060637_163_471 | 91 |
| 238 | 3300046462 | Ga0495651_0673594 | Ga0495651_0673594_73_366 | 91 |
| 239 | 3300046463 | Ga0495653_0001695 | Ga0495653_0001695_2834_3115 | 91 |
| 240 | 3300046511 | Ga0495608_0225185 | Ga0495608_0225185_84_377 | 91 |
| 241 | 3300046515 | Ga0495620_0056131 | Ga0495620_0056131_992_1303 | 91 |
| 242 | 3300046517 | Ga0495630_1475543 | Ga0495630_1475543_176_484 | 91 |
| 243 | 3300046529 | Ga0495652_0404348 | Ga0495652_0404348_418_729 | 91 |
| 244 | 3300046538 | Ga0495609_0143532 | Ga0495609_0143532_87_398 | 91 |
| 245 | 3300046683 | Ga0495658_0373348 | Ga0495658_0373348_344_637 | 91 |
| 246 | 3300048903 | Ga0496100_0002493 | Ga0496100_0002493_1868_2161 | 91 |
| 247 | 3300048906 | Ga0496103_0143445 | Ga0496103_0143445_853_1194 | 91 |
| 248 | 3300048907 | Ga0496104_0265996 | Ga0496104_0265996_891_1184 | 91 |
| 249 | 3300048910 | Ga0496107_1097481 | Ga0496107_1097481_258_551 | 91 |
| 250 | 3300048914 | Ga0496111_0842689 | Ga0496111_0842689_330_623 | 91 |
| 251 | 3300048918 | Ga0496115_0000680 | Ga0496115_0000680_331_621 | 91 |
| 252 | 3300048925 | Ga0496122_0155324 | Ga0496122_0155324_893_1183 | 91 |
| 253 | 3300053077 | Ga0495601_0007254 | Ga0495601_0007254_4932_5213 | 91 |
| 254 | 3300053077 | Ga0495601_0468977 | Ga0495601_0468977_306_617 | 91 |
| 255 | 3300053085 | Ga0495619_1116297 | Ga0495619_1116297_113_409 | 91 |
| 256 | 3300061719 | Ga0466962_0448288 | Ga0466962_0448288_185_469 | 91 |
| 257 | 3300005435 | Ga0070714_100689243 | Ga0070714_1006892432 | 92 |
| 258 | 3300005468 | Ga0070707_100976409 | Ga0070707_1009764091 | 92 |
| 259 | 3300021377 | Ga0213874_10156658 | Ga0213874_101566582 | 92 |
| 260 | 3300025898 | Ga0207692_10655782 | Ga0207692_106557823 | 92 |
| 261 | 3300025922 | Ga0207646_10848867 | Ga0207646_108488672 | 92 |
| 262 | 3300025928 | Ga0207700_10613221 | Ga0207700_106132211 | 92 |
| 263 | 3300025929 | Ga0207664_11431398 | Ga0207664_114313981 | 92 |
| 264 | 3300025939 | Ga0207665_11436162 | Ga0207665_114361622 | 92 |
| 265 | 3300038443 | Ga0395901_0216600 | Ga0395901_0216600_27_314 | 92 |
| 266 | 3300039450 | Ga0436363_0115300 | Ga0436363_0115300_1223_1522 | 92 |
| 267 | 3300044693 | Ga0466961_0038116 | Ga0466961_0038116_891_1199 | 92 |
| 268 | 3300044694 | Ga0466963_0660745 | Ga0466963_0660745_139_438 | 92 |
| 269 | 3300045049 | Ga0466959_0148462 | Ga0466959_0148462_108_416 | 92 |
| 270 | 3300045836 | Ga0466958_0101731 | Ga0466958_0101731_361_669 | 92 |
| 271 | 3300045976 | Ga0466967_0702264 | Ga0466967_0702264_496_777 | 92 |
| 272 | 3300045976 | Ga0466967_1667427 | Ga0466967_1667427_74_373 | 92 |
| 273 | 3300045976 | Ga0466967_2027541 | Ga0466967_2027541_20_322 | 92 |
| 274 | 3300046514 | Ga0495618_0000149 | Ga0495618_0000149_40324_40626 | 92 |
| 275 | 3300046517 | Ga0495630_0000182 | Ga0495630_0000182_29635_29943 | 92 |
| 276 | 3300046543 | Ga0495645_0000181 | Ga0495645_0000181_37433_37717 | 92 |
| 277 | 3300046675 | Ga0495657_0000213 | Ga0495657_0000213_33241_33549 | 92 |
| 278 | 3300048905 | Ga0496102_1100917 | Ga0496102_1100917_413_700 | 92 |
| 279 | 3300048912 | Ga0496109_0214678 | Ga0496109_0214678_984_1283 | 92 |
| 280 | 3300053078 | Ga0495612_0000057 | Ga0495612_0000057_32815_33120 | 92 |
| 281 | 3300005328 | Ga0070676_10668009 | Ga0070676_106680092 | 93 |
| 282 | 3300005334 | Ga0068869_100126415 | Ga0068869_1001264152 | 93 |
| 283 | 3300005334 | Ga0068869_101530324 | Ga0068869_1015303242 | 93 |
| 284 | 3300005339 | Ga0070660_100062883 | Ga0070660_1000628832 | 93 |
| 285 | 3300005339 | Ga0070660_100756855 | Ga0070660_1007568553 | 93 |
| 286 | 3300005339 | Ga0070660_101755487 | Ga0070660_1017554871 | 93 |
| 287 | 3300005341 | Ga0070691_10416026 | Ga0070691_104160262 | 93 |
| 288 | 3300005344 | Ga0070661_100415333 | Ga0070661_1004153333 | 93 |
| 289 | 3300005347 | Ga0070668_100009317 | Ga0070668_1000093171 | 93 |
| 290 | 3300005354 | Ga0070675_100725845 | Ga0070675_1007258451 | 93 |
| 291 | 3300005356 | Ga0070674_100081739 | Ga0070674_1000817392 | 93 |
| 292 | 3300005366 | Ga0070659_101261614 | Ga0070659_1012616141 | 93 |
| 293 | 3300005455 | Ga0070663_100328115 | Ga0070663_1003281151 | 93 |
| 294 | 3300005457 | Ga0070662_100155907 | Ga0070662_1001559072 | 93 |
| 295 | 3300005535 | Ga0070684_100440613 | Ga0070684_1004406132 | 93 |
| 296 | 3300005535 | Ga0070684_100913694 | Ga0070684_1009136941 | 93 |
| 297 | 3300005564 | Ga0070664_100347314 | Ga0070664_1003473144 | 93 |
| 298 | 3300005577 | Ga0068857_100202462 | Ga0068857_1002024624 | 93 |
| 299 | 3300005618 | Ga0068864_102643525 | Ga0068864_1026435251 | 93 |
| 300 | 3300005719 | Ga0068861_100163036 | Ga0068861_1001630362 | 93 |
| 301 | 3300005841 | Ga0068863_100607301 | Ga0068863_1006073014 | 93 |
| 302 | 3300005937 | Ga0081455_10328824 | Ga0081455_103288242 | 93 |
| 303 | 3300005981 | Ga0081538_10005959 | Ga0081538_100059596 | 93 |
| 304 | 3300005981 | Ga0081538_10039395 | Ga0081538_100393954 | 93 |
| 305 | 3300005981 | Ga0081538_10108952 | Ga0081538_101089523 | 93 |
| 306 | 3300006173 | Ga0070716_100186428 | Ga0070716_1001864283 | 93 |
| 307 | 3300006175 | Ga0070712_100005314 | Ga0070712_1000053144 | 93 |
| 308 | 3300006847 | Ga0075431_101628941 | Ga0075431_1016289412 | 93 |
| 309 | 3300009094 | Ga0111539_10759020 | Ga0111539_107590204 | 93 |
| 310 | 3300009098 | Ga0105245_10186449 | Ga0105245_101864496 | 93 |
| 311 | 3300009098 | Ga0105245_11649917 | Ga0105245_116499172 | 93 |
| 312 | 3300009148 | Ga0105243_10112983 | Ga0105243_101129832 | 93 |
| 313 | 3300009176 | Ga0105242_10647438 | Ga0105242_106474383 | 93 |
| 314 | 3300009545 | Ga0105237_10940816 | Ga0105237_109408162 | 93 |
| 315 | 3300009551 | Ga0105238_11473074 | Ga0105238_114730742 | 93 |
| 316 | 3300009553 | Ga0105249_11251769 | Ga0105249_112517692 | 93 |
| 317 | 3300010375 | Ga0105239_10772591 | Ga0105239_107725914 | 93 |
| 318 | 3300010375 | Ga0105239_12148879 | Ga0105239_121488792 | 93 |
| 319 | 3300011119 | Ga0105246_11536054 | Ga0105246_115360542 | 93 |
| 320 | 3300011119 | Ga0105246_11814375 | Ga0105246_118143752 | 93 |
| 321 | 3300013102 | Ga0157371_11181823 | Ga0157371_111818232 | 93 |
| 322 | 3300014325 | Ga0163163_10255761 | Ga0163163_102557612 | 93 |
| 323 | 3300014326 | Ga0157380_12643295 | Ga0157380_126432952 | 93 |
| 324 | 3300025901 | Ga0207688_10170646 | Ga0207688_101706462 | 93 |
| 325 | 3300025906 | Ga0207699_10885595 | Ga0207699_108855952 | 93 |
| 326 | 3300025907 | Ga0207645_10430680 | Ga0207645_104306802 | 93 |
| 327 | 3300025915 | Ga0207693_10008924 | Ga0207693_100089248 | 93 |
| 328 | 3300025916 | Ga0207663_10313510 | Ga0207663_103135103 | 93 |
| 329 | 3300025919 | Ga0207657_10216511 | Ga0207657_102165112 | 93 |
| 330 | 3300025919 | Ga0207657_10305119 | Ga0207657_103051192 | 93 |
| 331 | 3300025920 | Ga0207649_10323696 | Ga0207649_103236962 | 93 |
| 332 | 3300025927 | Ga0207687_10313926 | Ga0207687_103139262 | 93 |
| 333 | 3300025933 | Ga0207706_10030392 | Ga0207706_100303924 | 93 |
| 334 | 3300025937 | Ga0207669_10449055 | Ga0207669_104490552 | 93 |
| 335 | 3300025938 | Ga0207704_11309152 | Ga0207704_113091521 | 93 |
| 336 | 3300025941 | Ga0207711_10566640 | Ga0207711_105666402 | 93 |
| 337 | 3300025942 | Ga0207689_10270215 | Ga0207689_102702154 | 93 |
| 338 | 3300025944 | Ga0207661_10107025 | Ga0207661_101070254 | 93 |
| 339 | 3300025945 | Ga0207679_10582222 | Ga0207679_105822221 | 93 |
| 340 | 3300026023 | Ga0207677_10316583 | Ga0207677_103165832 | 93 |
| 341 | 3300026067 | Ga0207678_10367638 | Ga0207678_103676382 | 93 |
| 342 | 3300026089 | Ga0207648_10654727 | Ga0207648_106547272 | 93 |
| 343 | 3300026116 | Ga0207674_10472681 | Ga0207674_104726812 | 93 |
| 344 | 3300026118 | Ga0207675_100102172 | Ga0207675_1001021724 | 93 |
| 345 | 3300026142 | Ga0207698_10189328 | Ga0207698_101893282 | 93 |
| 346 | 3300031548 | Ga0307408_100377914 | Ga0307408_1003779142 | 93 |
| 347 | 3300031852 | Ga0307410_10015235 | Ga0307410_100152357 | 93 |
| 348 | 3300031903 | Ga0307407_10080421 | Ga0307407_100804212 | 93 |
| 349 | 3300031911 | Ga0307412_10093308 | Ga0307412_100933083 | 93 |
| 350 | 3300031995 | Ga0307409_100144232 | Ga0307409_1001442324 | 93 |
| 351 | 3300032002 | Ga0307416_100116805 | Ga0307416_1001168052 | 93 |
| 352 | 3300032005 | Ga0307411_11198637 | Ga0307411_111986372 | 93 |
| 353 | 3300032126 | Ga0307415_100242201 | Ga0307415_1002422012 | 93 |
| 354 | 3300041491 | Ga0451833_0898710 | Ga0451833_0898710_454_750 | 93 |
| 355 | 3300044683 | Ga0466965_0379640 | Ga0466965_0379640_109_393 | 93 |
| 356 | 3300044694 | Ga0466963_0242055 | Ga0466963_0242055_435_719 | 93 |
| 357 | 3300045049 | Ga0466959_0197771 | Ga0466959_0197771_164_475 | 93 |
| 358 | 3300045976 | Ga0466967_0184093 | Ga0466967_0184093_1108_1392 | 93 |
| 359 | 3300045976 | Ga0466967_1070291 | Ga0466967_1070291_258_542 | 93 |
| 360 | 3300048903 | Ga0496100_0000650 | Ga0496100_0000650_4647_4955 | 93 |
| 361 | 3300048904 | Ga0496101_0002222 | Ga0496101_0002222_4882_5190 | 93 |
| 362 | 3300048912 | Ga0496109_0682075 | Ga0496109_0682075_593_877 | 93 |
| 363 | 3300048912 | Ga0496109_0927063 | Ga0496109_0927063_277_561 | 93 |
| 364 | 3300048913 | Ga0496110_0168645 | Ga0496110_0168645_1282_1566 | 93 |
| 365 | 3300048914 | Ga0496111_0508290 | Ga0496111_0508290_159_467 | 93 |
| 366 | 3300048915 | Ga0496112_0576116 | Ga0496112_0576116_256_540 | 93 |
| 367 | 3300048915 | Ga0496112_1110581 | Ga0496112_1110581_316_600 | 93 |
| 368 | 3300048916 | Ga0496113_0936555 | Ga0496113_0936555_316_600 | 93 |
| 369 | 3300049649 | Ga0501198_078525 | Ga0501198_078525_153_437 | 93 |
| 370 | 3300050511 | nmdc:mga08y16_463984_c1 | nmdc:mga08y16_463984_c1_238_522 | 93 |
| 371 | 3300061719 | Ga0466962_0597895 | Ga0466962_0597895_32_316 | 93 |
| 372 | 2149837012 | _GD4IA4401A3XHU | LJQ_0955.00000100 | 94 |
| 373 | 3300001991 | JGI24743J22301_10143661 | JGI24743J22301_101436612 | 94 |
| 374 | 3300003308 | Ga0006777J48905_1111430 | Ga0006777J48905_11114302 | 94 |
| 375 | 3300003568 | Ga0006781J51513_1011970 | Ga0006781J51513_10119702 | 94 |
| 376 | 3300003568 | Ga0006781J51513_1028949 | Ga0006781J51513_10289492 | 94 |
| 377 | 3300003575 | Ga0007409J51694_1045270 | Ga0007409J51694_10452701 | 94 |
| 378 | 3300003577 | Ga0007416J51690_1096729 | Ga0007416J51690_10967291 | 94 |
| 379 | 3300003579 | Ga0007429J51699_1035403 | Ga0007429J51699_10354032 | 94 |
| 380 | 3300003579 | Ga0007429J51699_1040535 | Ga0007429J51699_10405352 | 94 |
| 381 | 3300003693 | Ga0032354_1047956 | Ga0032354_10479562 | 94 |
| 382 | 3300004785 | Ga0058858_1310944 | Ga0058858_13109441 | 94 |
| 383 | 3300004800 | Ga0058861_11833874 | Ga0058861_118338742 | 94 |
| 384 | 3300005327 | Ga0070658_10631770 | Ga0070658_106317702 | 94 |
| 385 | 3300005327 | Ga0070658_11911632 | Ga0070658_119116321 | 94 |
| 386 | 3300005328 | Ga0070676_10792425 | Ga0070676_107924251 | 94 |
| 387 | 3300005329 | Ga0070683_100580273 | Ga0070683_1005802733 | 94 |
| 388 | 3300005329 | Ga0070683_101080481 | Ga0070683_1010804812 | 94 |
| 389 | 3300005329 | Ga0070683_101941040 | Ga0070683_1019410402 | 94 |
| 390 | 3300005330 | Ga0070690_100238365 | Ga0070690_1002383652 | 94 |
| 391 | 3300005331 | Ga0070670_100751674 | Ga0070670_1007516742 | 94 |
| 392 | 3300005333 | Ga0070677_10584891 | Ga0070677_105848911 | 94 |
| 393 | 3300005334 | Ga0068869_100992120 | Ga0068869_1009921202 | 94 |
| 394 | 3300005337 | Ga0070682_100078491 | Ga0070682_1000784912 | 94 |
| 395 | 3300005337 | Ga0070682_100362283 | Ga0070682_1003622832 | 94 |
| 396 | 3300005337 | Ga0070682_100363563 | Ga0070682_1003635633 | 94 |
| 397 | 3300005338 | Ga0068868_100288252 | Ga0068868_1002882523 | 94 |
| 398 | 3300005338 | Ga0068868_100512834 | Ga0068868_1005128343 | 94 |
| 399 | 3300005338 | Ga0068868_100834889 | Ga0068868_1008348891 | 94 |
| 400 | 3300005338 | Ga0068868_102116808 | Ga0068868_1021168081 | 94 |
| 401 | 3300005339 | Ga0070660_101286061 | Ga0070660_1012860611 | 94 |
| 402 | 3300005341 | Ga0070691_10121148 | Ga0070691_101211482 | 94 |
| 403 | 3300005343 | Ga0070687_100215026 | Ga0070687_1002150261 | 94 |
| 404 | 3300005343 | Ga0070687_100557317 | Ga0070687_1005573171 | 94 |
| 405 | 3300005343 | Ga0070687_101031909 | Ga0070687_1010319092 | 94 |
| 406 | 3300005344 | Ga0070661_100114771 | Ga0070661_1001147715 | 94 |
| 407 | 3300005344 | Ga0070661_101301942 | Ga0070661_1013019422 | 94 |
| 408 | 3300005345 | Ga0070692_10006061 | Ga0070692_100060615 | 94 |
| 409 | 3300005345 | Ga0070692_10131587 | Ga0070692_101315872 | 94 |
| 410 | 3300005345 | Ga0070692_10454149 | Ga0070692_104541492 | 94 |
| 411 | 3300005347 | Ga0070668_100393005 | Ga0070668_1003930051 | 94 |
| 412 | 3300005353 | Ga0070669_100019002 | Ga0070669_1000190022 | 94 |
| 413 | 3300005353 | Ga0070669_100123071 | Ga0070669_1001230714 | 94 |
| 414 | 3300005353 | Ga0070669_100260043 | Ga0070669_1002600432 | 94 |
| 415 | 3300005355 | Ga0070671_100517563 | Ga0070671_1005175632 | 94 |
| 416 | 3300005355 | Ga0070671_102088493 | Ga0070671_1020884932 | 94 |
| 417 | 3300005356 | Ga0070674_100126134 | Ga0070674_1001261344 | 94 |
| 418 | 3300005356 | Ga0070674_101185433 | Ga0070674_1011854331 | 94 |
| 419 | 3300005364 | Ga0070673_100651938 | Ga0070673_1006519381 | 94 |
| 420 | 3300005366 | Ga0070659_100000132 | Ga0070659_10000013232 | 94 |
| 421 | 3300005366 | Ga0070659_100697675 | Ga0070659_1006976751 | 94 |
| 422 | 3300005366 | Ga0070659_101196954 | Ga0070659_1011969541 | 94 |
| 423 | 3300005367 | Ga0070667_102252154 | Ga0070667_1022521541 | 94 |
| 424 | 3300005435 | Ga0070714_100036859 | Ga0070714_1000368596 | 94 |
| 425 | 3300005435 | Ga0070714_101165883 | Ga0070714_1011658832 | 94 |
| 426 | 3300005435 | Ga0070714_102512313 | Ga0070714_1025123131 | 94 |
| 427 | 3300005437 | Ga0070710_10000015 | Ga0070710_1000001531 | 94 |
| 428 | 3300005438 | Ga0070701_11112316 | Ga0070701_111123162 | 94 |
| 429 | 3300005440 | Ga0070705_100000870 | Ga0070705_1000008707 | 94 |
| 430 | 3300005441 | Ga0070700_100203413 | Ga0070700_1002034132 | 94 |
| 431 | 3300005441 | Ga0070700_100428098 | Ga0070700_1004280982 | 94 |
| 432 | 3300005441 | Ga0070700_100441879 | Ga0070700_1004418792 | 94 |
| 433 | 3300005441 | Ga0070700_100742331 | Ga0070700_1007423312 | 94 |
| 434 | 3300005444 | Ga0070694_101020497 | Ga0070694_1010204972 | 94 |
| 435 | 3300005455 | Ga0070663_100378738 | Ga0070663_1003787382 | 94 |
| 436 | 3300005455 | Ga0070663_100718233 | Ga0070663_1007182332 | 94 |
| 437 | 3300005455 | Ga0070663_101422804 | Ga0070663_1014228042 | 94 |
| 438 | 3300005456 | Ga0070678_100512875 | Ga0070678_1005128752 | 94 |
| 439 | 3300005456 | Ga0070678_101264686 | Ga0070678_1012646862 | 94 |
| 440 | 3300005456 | Ga0070678_101648816 | Ga0070678_1016488161 | 94 |
| 441 | 3300005456 | Ga0070678_102278535 | Ga0070678_1022785351 | 94 |
| 442 | 3300005457 | Ga0070662_100192532 | Ga0070662_1001925324 | 94 |
| 443 | 3300005457 | Ga0070662_100423397 | Ga0070662_1004233972 | 94 |
| 444 | 3300005457 | Ga0070662_100604428 | Ga0070662_1006044282 | 94 |
| 445 | 3300005458 | Ga0070681_10231584 | Ga0070681_102315843 | 94 |
| 446 | 3300005459 | Ga0068867_100062732 | Ga0068867_1000627326 | 94 |
| 447 | 3300005459 | Ga0068867_100132843 | Ga0068867_1001328434 | 94 |
| 448 | 3300005459 | Ga0068867_100649339 | Ga0068867_1006493392 | 94 |
| 449 | 3300005459 | Ga0068867_101022725 | Ga0068867_1010227251 | 94 |
| 450 | 3300005459 | Ga0068867_101116497 | Ga0068867_1011164971 | 94 |
| 451 | 3300005466 | Ga0070685_10147419 | Ga0070685_101474194 | 94 |
| 452 | 3300005466 | Ga0070685_10377747 | Ga0070685_103777472 | 94 |
| 453 | 3300005518 | Ga0070699_101171855 | Ga0070699_1011718551 | 94 |
| 454 | 3300005530 | Ga0070679_100465416 | Ga0070679_1004654162 | 94 |
| 455 | 3300005535 | Ga0070684_100052037 | Ga0070684_1000520374 | 94 |
| 456 | 3300005535 | Ga0070684_100330197 | Ga0070684_1003301974 | 94 |
| 457 | 3300005535 | Ga0070684_100380680 | Ga0070684_1003806802 | 94 |
| 458 | 3300005535 | Ga0070684_101155906 | Ga0070684_1011559061 | 94 |
| 459 | 3300005539 | Ga0068853_100363500 | Ga0068853_1003635002 | 94 |
| 460 | 3300005543 | Ga0070672_100180153 | Ga0070672_1001801533 | 94 |
| 461 | 3300005543 | Ga0070672_100677811 | Ga0070672_1006778112 | 94 |
| 462 | 3300005543 | Ga0070672_101203469 | Ga0070672_1012034692 | 94 |
| 463 | 3300005544 | Ga0070686_100688889 | Ga0070686_1006888891 | 94 |
| 464 | 3300005546 | Ga0070696_101462389 | Ga0070696_1014623892 | 94 |
| 465 | 3300005547 | Ga0070693_100303082 | Ga0070693_1003030822 | 94 |
| 466 | 3300005548 | Ga0070665_100976063 | Ga0070665_1009760633 | 94 |
| 467 | 3300005549 | Ga0070704_100424783 | Ga0070704_1004247833 | 94 |
| 468 | 3300005564 | Ga0070664_100140859 | Ga0070664_1001408596 | 94 |
| 469 | 3300005564 | Ga0070664_100441651 | Ga0070664_1004416512 | 94 |
| 470 | 3300005564 | Ga0070664_101515251 | Ga0070664_1015152512 | 94 |
| 471 | 3300005564 | Ga0070664_101995701 | Ga0070664_1019957012 | 94 |
| 472 | 3300005578 | Ga0068854_100299802 | Ga0068854_1002998021 | 94 |
| 473 | 3300005615 | Ga0070702_100066914 | Ga0070702_1000669142 | 94 |
| 474 | 3300005615 | Ga0070702_100393994 | Ga0070702_1003939941 | 94 |
| 475 | 3300005616 | Ga0068852_101338922 | Ga0068852_1013389222 | 94 |
| 476 | 3300005616 | Ga0068852_102553635 | Ga0068852_1025536352 | 94 |
| 477 | 3300005617 | Ga0068859_100582315 | Ga0068859_1005823152 | 94 |
| 478 | 3300005618 | Ga0068864_100080512 | Ga0068864_1000805125 | 94 |
| 479 | 3300005618 | Ga0068864_100573671 | Ga0068864_1005736713 | 94 |
| 480 | 3300005618 | Ga0068864_100636263 | Ga0068864_1006362634 | 94 |
| 481 | 3300005718 | Ga0068866_10193882 | Ga0068866_101938822 | 94 |
| 482 | 3300005719 | Ga0068861_100056451 | Ga0068861_1000564516 | 94 |
| 483 | 3300005719 | Ga0068861_100270455 | Ga0068861_1002704553 | 94 |
| 484 | 3300005719 | Ga0068861_100376757 | Ga0068861_1003767572 | 94 |
| 485 | 3300005834 | Ga0068851_10120789 | Ga0068851_101207892 | 94 |
| 486 | 3300005834 | Ga0068851_10284994 | Ga0068851_102849942 | 94 |
| 487 | 3300005840 | Ga0068870_10162962 | Ga0068870_101629624 | 94 |
| 488 | 3300005840 | Ga0068870_10432294 | Ga0068870_104322942 | 94 |
| 489 | 3300005842 | Ga0068858_100350611 | Ga0068858_1003506112 | 94 |
| 490 | 3300005842 | Ga0068858_100573021 | Ga0068858_1005730212 | 94 |
| 491 | 3300005843 | Ga0068860_100920606 | Ga0068860_1009206062 | 94 |
| 492 | 3300005844 | Ga0068862_100627060 | Ga0068862_1006270603 | 94 |
| 493 | 3300005844 | Ga0068862_101120603 | Ga0068862_1011206031 | 94 |
| 494 | 3300005937 | Ga0081455_10242847 | Ga0081455_102428472 | 94 |
| 495 | 3300006237 | Ga0097621_100880548 | Ga0097621_1008805482 | 94 |
| 496 | 3300006844 | Ga0075428_100500182 | Ga0075428_1005001822 | 94 |
| 497 | 3300006844 | Ga0075428_101867641 | Ga0075428_1018676412 | 94 |
| 498 | 3300006844 | Ga0075428_102368142 | Ga0075428_1023681422 | 94 |
| 499 | 3300006871 | Ga0075434_100681937 | Ga0075434_1006819372 | 94 |
| 500 | 3300006871 | Ga0075434_101036197 | Ga0075434_1010361973 | 94 |
| 501 | 3300006880 | Ga0075429_100014611 | Ga0075429_1000146115 | 94 |
| 502 | 3300006881 | Ga0068865_100051211 | Ga0068865_1000512113 | 94 |
| 503 | 3300006881 | Ga0068865_100156795 | Ga0068865_1001567951 | 94 |
| 504 | 3300006881 | Ga0068865_100630702 | Ga0068865_1006307024 | 94 |
| 505 | 3300006881 | Ga0068865_100987428 | Ga0068865_1009874282 | 94 |
| 506 | 3300006914 | Ga0075436_100226694 | Ga0075436_1002266943 | 94 |
| 507 | 3300006931 | Ga0097620_100582335 | Ga0097620_1005823352 | 94 |
| 508 | 3300007076 | Ga0075435_101897065 | Ga0075435_1018970651 | 94 |
| 509 | 3300009093 | Ga0105240_10151435 | Ga0105240_101514354 | 94 |
| 510 | 3300009094 | Ga0111539_10721274 | Ga0111539_107212743 | 94 |
| 511 | 3300009094 | Ga0111539_11060218 | Ga0111539_110602182 | 94 |
| 512 | 3300009098 | Ga0105245_10046340 | Ga0105245_100463402 | 94 |
| 513 | 3300009098 | Ga0105245_10314713 | Ga0105245_103147131 | 94 |
| 514 | 3300009098 | Ga0105245_10834036 | Ga0105245_108340362 | 94 |
| 515 | 3300009098 | Ga0105245_12736864 | Ga0105245_127368641 | 94 |
| 516 | 3300009101 | Ga0105247_10459527 | Ga0105247_104595272 | 94 |
| 517 | 3300009147 | Ga0114129_11668578 | Ga0114129_116685781 | 94 |
| 518 | 3300009147 | Ga0114129_13297100 | Ga0114129_132971001 | 94 |
| 519 | 3300009148 | Ga0105243_10058843 | Ga0105243_100588437 | 94 |
| 520 | 3300009148 | Ga0105243_10177918 | Ga0105243_101779184 | 94 |
| 521 | 3300009148 | Ga0105243_10284846 | Ga0105243_102848464 | 94 |
| 522 | 3300009148 | Ga0105243_10873284 | Ga0105243_108732842 | 94 |
| 523 | 3300009148 | Ga0105243_11187441 | Ga0105243_111874412 | 94 |
| 524 | 3300009176 | Ga0105242_12389713 | Ga0105242_123897132 | 94 |
| 525 | 3300009176 | Ga0105242_12432958 | Ga0105242_124329581 | 94 |
| 526 | 3300009553 | Ga0105249_10139754 | Ga0105249_101397543 | 94 |
| 527 | 3300009553 | Ga0105249_11078219 | Ga0105249_110782192 | 94 |
| 528 | 3300009553 | Ga0105249_11091829 | Ga0105249_110918292 | 94 |
| 529 | 3300009553 | Ga0105249_11408934 | Ga0105249_114089342 | 94 |
| 530 | 3300010375 | Ga0105239_10233083 | Ga0105239_102330832 | 94 |
| 531 | 3300010375 | Ga0105239_10594287 | Ga0105239_105942874 | 94 |
| 532 | 3300010375 | Ga0105239_11922601 | Ga0105239_119226011 | 94 |
| 533 | 3300010375 | Ga0105239_13245451 | Ga0105239_132454512 | 94 |
| 534 | 3300011119 | Ga0105246_10023374 | Ga0105246_100233746 | 94 |
| 535 | 3300011119 | Ga0105246_10233122 | Ga0105246_102331223 | 94 |
| 536 | 3300011119 | Ga0105246_10968446 | Ga0105246_109684461 | 94 |
| 537 | 3300011119 | Ga0105246_11065201 | Ga0105246_110652012 | 94 |
| 538 | 3300013102 | Ga0157371_10284213 | Ga0157371_102842132 | 94 |
| 539 | 3300013306 | Ga0163162_10500585 | Ga0163162_105005852 | 94 |
| 540 | 3300013307 | Ga0157372_10490485 | Ga0157372_104904852 | 94 |
| 541 | 3300013307 | Ga0157372_10739756 | Ga0157372_107397562 | 94 |
| 542 | 3300014326 | Ga0157380_10435996 | Ga0157380_104359963 | 94 |
| 543 | 3300014326 | Ga0157380_10594023 | Ga0157380_105940232 | 94 |
| 544 | 3300014326 | Ga0157380_10717023 | Ga0157380_107170232 | 94 |
| 545 | 3300014326 | Ga0157380_11610236 | Ga0157380_116102362 | 94 |
| 546 | 3300014326 | Ga0157380_12935800 | Ga0157380_129358002 | 94 |
| 547 | 3300014497 | Ga0182008_10287607 | Ga0182008_102876072 | 94 |
| 548 | 3300014745 | Ga0157377_10250499 | Ga0157377_102504992 | 94 |
| 549 | 3300014745 | Ga0157377_10380456 | Ga0157377_103804562 | 94 |
| 550 | 3300014745 | Ga0157377_11350959 | Ga0157377_113509592 | 94 |
| 551 | 3300014968 | Ga0157379_11840792 | Ga0157379_118407922 | 94 |
| 552 | 3300020080 | Ga0206350_11164447 | Ga0206350_111644472 | 94 |
| 553 | 3300020080 | Ga0206350_11482167 | Ga0206350_114821672 | 94 |
| 554 | 3300020610 | Ga0154015_1115475 | Ga0154015_11154751 | 94 |
| 555 | 3300020610 | Ga0154015_1516197 | Ga0154015_15161972 | 94 |
| 556 | 3300025898 | Ga0207692_10000013 | Ga0207692_1000001368 | 94 |
| 557 | 3300025899 | Ga0207642_10076269 | Ga0207642_100762692 | 94 |
| 558 | 3300025901 | Ga0207688_10333832 | Ga0207688_103338322 | 94 |
| 559 | 3300025901 | Ga0207688_10344447 | Ga0207688_103444472 | 94 |
| 560 | 3300025901 | Ga0207688_10361112 | Ga0207688_103611122 | 94 |
| 561 | 3300025901 | Ga0207688_10427849 | Ga0207688_104278492 | 94 |
| 562 | 3300025903 | Ga0207680_10856616 | Ga0207680_108566163 | 94 |
| 563 | 3300025907 | Ga0207645_10112564 | Ga0207645_101125642 | 94 |
| 564 | 3300025908 | Ga0207643_10284500 | Ga0207643_102845002 | 94 |
| 565 | 3300025908 | Ga0207643_10518784 | Ga0207643_105187842 | 94 |
| 566 | 3300025909 | Ga0207705_10547475 | Ga0207705_105474752 | 94 |
| 567 | 3300025912 | Ga0207707_10284321 | Ga0207707_102843212 | 94 |
| 568 | 3300025913 | Ga0207695_10113274 | Ga0207695_101132742 | 94 |
| 569 | 3300025918 | Ga0207662_10136404 | Ga0207662_101364041 | 94 |
| 570 | 3300025920 | Ga0207649_10132712 | Ga0207649_101327121 | 94 |
| 571 | 3300025920 | Ga0207649_10803619 | Ga0207649_108036191 | 94 |
| 572 | 3300025920 | Ga0207649_11372976 | Ga0207649_113729762 | 94 |
| 573 | 3300025923 | Ga0207681_10003336 | Ga0207681_100033365 | 94 |
| 574 | 3300025923 | Ga0207681_10287351 | Ga0207681_102873512 | 94 |
| 575 | 3300025925 | Ga0207650_10944823 | Ga0207650_109448232 | 94 |
| 576 | 3300025926 | Ga0207659_10822432 | Ga0207659_108224322 | 94 |
| 577 | 3300025927 | Ga0207687_10208186 | Ga0207687_102081863 | 94 |
| 578 | 3300025927 | Ga0207687_10533650 | Ga0207687_105336504 | 94 |
| 579 | 3300025927 | Ga0207687_10617331 | Ga0207687_106173313 | 94 |
| 580 | 3300025929 | Ga0207664_10000331 | Ga0207664_1000033130 | 94 |
| 581 | 3300025929 | Ga0207664_10005338 | Ga0207664_1000533811 | 94 |
| 582 | 3300025929 | Ga0207664_11883171 | Ga0207664_118831711 | 94 |
| 583 | 3300025932 | Ga0207690_10000075 | Ga0207690_1000007511 | 94 |
| 584 | 3300025932 | Ga0207690_11154395 | Ga0207690_111543952 | 94 |
| 585 | 3300025932 | Ga0207690_11661987 | Ga0207690_116619872 | 94 |
| 586 | 3300025933 | Ga0207706_10414635 | Ga0207706_104146354 | 94 |
| 587 | 3300025934 | Ga0207686_10641335 | Ga0207686_106413351 | 94 |
| 588 | 3300025934 | Ga0207686_11438443 | Ga0207686_114384431 | 94 |
| 589 | 3300025935 | Ga0207709_10034617 | Ga0207709_100346176 | 94 |
| 590 | 3300025935 | Ga0207709_10052158 | Ga0207709_100521587 | 94 |
| 591 | 3300025935 | Ga0207709_10202100 | Ga0207709_102021004 | 94 |
| 592 | 3300025935 | Ga0207709_10679633 | Ga0207709_106796332 | 94 |
| 593 | 3300025937 | Ga0207669_10679593 | Ga0207669_106795932 | 94 |
| 594 | 3300025937 | Ga0207669_10865200 | Ga0207669_108652002 | 94 |
| 595 | 3300025937 | Ga0207669_11455513 | Ga0207669_114555131 | 94 |
| 596 | 3300025938 | Ga0207704_10032117 | Ga0207704_100321173 | 94 |
| 597 | 3300025938 | Ga0207704_10181495 | Ga0207704_101814954 | 94 |
| 598 | 3300025938 | Ga0207704_10669427 | Ga0207704_106694272 | 94 |
| 599 | 3300025940 | Ga0207691_10153831 | Ga0207691_101538314 | 94 |
| 600 | 3300025942 | Ga0207689_10582832 | Ga0207689_105828323 | 94 |
| 601 | 3300025944 | Ga0207661_10014965 | Ga0207661_100149656 | 94 |
| 602 | 3300025944 | Ga0207661_10171655 | Ga0207661_101716556 | 94 |
| 603 | 3300025944 | Ga0207661_10284218 | Ga0207661_102842183 | 94 |
| 604 | 3300025944 | Ga0207661_10861347 | Ga0207661_108613472 | 94 |
| 605 | 3300025944 | Ga0207661_10876172 | Ga0207661_108761723 | 94 |
| 606 | 3300025945 | Ga0207679_10231580 | Ga0207679_102315804 | 94 |
| 607 | 3300025945 | Ga0207679_10379518 | Ga0207679_103795182 | 94 |
| 608 | 3300025945 | Ga0207679_10699890 | Ga0207679_106998902 | 94 |
| 609 | 3300025945 | Ga0207679_11496555 | Ga0207679_114965552 | 94 |
| 610 | 3300025960 | Ga0207651_11004114 | Ga0207651_110041142 | 94 |
| 611 | 3300025961 | Ga0207712_10574550 | Ga0207712_105745502 | 94 |
| 612 | 3300025972 | Ga0207668_10401469 | Ga0207668_104014694 | 94 |
| 613 | 3300025981 | Ga0207640_10566785 | Ga0207640_105667853 | 94 |
| 614 | 3300025986 | Ga0207658_11139563 | Ga0207658_111395631 | 94 |
| 615 | 3300026023 | Ga0207677_10122676 | Ga0207677_101226762 | 94 |
| 616 | 3300026023 | Ga0207677_10291079 | Ga0207677_102910792 | 94 |
| 617 | 3300026023 | Ga0207677_10738834 | Ga0207677_107388342 | 94 |
| 618 | 3300026023 | Ga0207677_11792327 | Ga0207677_117923272 | 94 |
| 619 | 3300026035 | Ga0207703_10968933 | Ga0207703_109689332 | 94 |
| 620 | 3300026041 | Ga0207639_11524487 | Ga0207639_115244872 | 94 |
| 621 | 3300026067 | Ga0207678_10279433 | Ga0207678_102794333 | 94 |
| 622 | 3300026067 | Ga0207678_10475697 | Ga0207678_104756972 | 94 |
| 623 | 3300026075 | Ga0207708_10000878 | Ga0207708_100008782 | 94 |
| 624 | 3300026075 | Ga0207708_10219419 | Ga0207708_102194192 | 94 |
| 625 | 3300026075 | Ga0207708_10480163 | Ga0207708_104801631 | 94 |
| 626 | 3300026075 | Ga0207708_10922232 | Ga0207708_109222322 | 94 |
| 627 | 3300026089 | Ga0207648_10112472 | Ga0207648_101124722 | 94 |
| 628 | 3300026089 | Ga0207648_10142390 | Ga0207648_101423902 | 94 |
| 629 | 3300026089 | Ga0207648_10204040 | Ga0207648_102040402 | 94 |
| 630 | 3300026089 | Ga0207648_12150188 | Ga0207648_121501881 | 94 |
| 631 | 3300026095 | Ga0207676_10524474 | Ga0207676_105244744 | 94 |
| 632 | 3300026095 | Ga0207676_10694976 | Ga0207676_106949762 | 94 |
| 633 | 3300026095 | Ga0207676_10893744 | Ga0207676_108937441 | 94 |
| 634 | 3300026118 | Ga0207675_100158112 | Ga0207675_1001581124 | 94 |
| 635 | 3300026118 | Ga0207675_100169805 | Ga0207675_1001698052 | 94 |
| 636 | 3300026118 | Ga0207675_100237773 | Ga0207675_1002377732 | 94 |
| 637 | 3300026121 | Ga0207683_10498305 | Ga0207683_104983054 | 94 |
| 638 | 3300026121 | Ga0207683_10568260 | Ga0207683_105682602 | 94 |
| 639 | 3300026142 | Ga0207698_10479279 | Ga0207698_104792792 | 94 |
| 640 | 3300026142 | Ga0207698_10971009 | Ga0207698_109710092 | 94 |
| 641 | 3300026142 | Ga0207698_11017943 | Ga0207698_110179432 | 94 |
| 642 | 3300026142 | Ga0207698_11111563 | Ga0207698_111115632 | 94 |
| 643 | 3300027907 | Ga0207428_10569871 | Ga0207428_105698712 | 94 |
| 644 | 3300028379 | Ga0268266_10203971 | Ga0268266_102039712 | 94 |
| 645 | 3300028380 | Ga0268265_11182120 | Ga0268265_111821202 | 94 |
| 646 | 3300028558 | Ga0265326_10000023 | Ga0265326_1000002356 | 94 |
| 647 | 3300028573 | Ga0265334_10000135 | Ga0265334_100001358 | 94 |
| 648 | 3300028573 | Ga0265334_10170953 | Ga0265334_101709532 | 94 |
| 649 | 3300028666 | Ga0265336_10009601 | Ga0265336_100096013 | 94 |
| 650 | 3300028800 | Ga0265338_10000902 | Ga0265338_1000090213 | 94 |
| 651 | 3300028800 | Ga0265338_10216133 | Ga0265338_102161333 | 94 |
| 652 | 3300029957 | Ga0265324_10002787 | Ga0265324_100027872 | 94 |
| 653 | 3300031240 | Ga0265320_10091945 | Ga0265320_100919452 | 94 |
| 654 | 3300031251 | Ga0265327_10217830 | Ga0265327_102178301 | 94 |
| 655 | 3300031548 | Ga0307408_101042289 | Ga0307408_1010422892 | 94 |
| 656 | 3300031711 | Ga0265314_10091338 | Ga0265314_100913382 | 94 |
| 657 | 3300031731 | Ga0307405_11063814 | Ga0307405_110638142 | 94 |
| 658 | 3300031824 | Ga0307413_11240298 | Ga0307413_112402982 | 94 |
| 659 | 3300031852 | Ga0307410_10123587 | Ga0307410_101235872 | 94 |
| 660 | 3300031852 | Ga0307410_10358893 | Ga0307410_103588933 | 94 |
| 661 | 3300031903 | Ga0307407_10104721 | Ga0307407_101047214 | 94 |
| 662 | 3300031903 | Ga0307407_10629598 | Ga0307407_106295981 | 94 |
| 663 | 3300031903 | Ga0307407_10973942 | Ga0307407_109739421 | 94 |
| 664 | 3300031911 | Ga0307412_10419701 | Ga0307412_104197013 | 94 |
| 665 | 3300031911 | Ga0307412_10532219 | Ga0307412_105322192 | 94 |
| 666 | 3300031911 | Ga0307412_11595944 | Ga0307412_115959442 | 94 |
| 667 | 3300031995 | Ga0307409_100569943 | Ga0307409_1005699433 | 94 |
| 668 | 3300031995 | Ga0307409_100978965 | Ga0307409_1009789651 | 94 |
| 669 | 3300031995 | Ga0307409_101099425 | Ga0307409_1010994252 | 94 |
| 670 | 3300031995 | Ga0307409_101541596 | Ga0307409_1015415962 | 94 |
| 671 | 3300031995 | Ga0307409_102949935 | Ga0307409_1029499351 | 94 |
| 672 | 3300032002 | Ga0307416_100064502 | Ga0307416_1000645023 | 94 |
| 673 | 3300032002 | Ga0307416_100109289 | Ga0307416_1001092892 | 94 |
| 674 | 3300032002 | Ga0307416_100254575 | Ga0307416_1002545753 | 94 |
| 675 | 3300032002 | Ga0307416_100542396 | Ga0307416_1005423962 | 94 |
| 676 | 3300032002 | Ga0307416_100596589 | Ga0307416_1005965891 | 94 |
| 677 | 3300032004 | Ga0307414_10441703 | Ga0307414_104417033 | 94 |
| 678 | 3300032126 | Ga0307415_100004333 | Ga0307415_1000043333 | 94 |
| 679 | 3300032126 | Ga0307415_100063811 | Ga0307415_1000638112 | 94 |
| 680 | 3300037312 | Ga0395899_0922616 | Ga0395899_0922616_202_489 | 94 |
| 681 | 3300038443 | Ga0395901_1104003 | Ga0395901_1104003_296_589 | 94 |
| 682 | 3300041512 | Ga0451853_3353689 | Ga0451853_3353689_616_903 | 94 |
| 683 | 3300042008 | Ga0439450_040958 | Ga0439450_040958_421_705 | 94 |
| 684 | 3300042011 | Ga0439454_110961 | Ga0439454_110961_221_505 | 94 |
| 685 | 3300042126 | Ga0450888_033760 | Ga0450888_033760_381_665 | 94 |
| 686 | 3300042137 | Ga0450902_041476 | Ga0450902_041476_189_473 | 94 |
| 687 | 3300042439 | Ga0439464_0026506 | Ga0439464_0026506_326_610 | 94 |
| 688 | 3300042993 | Ga0439440_0173325 | Ga0439440_0173325_150_434 | 94 |
| 689 | 3300044658 | Ga0466972_0209235 | Ga0466972_0209235_429_752 | 94 |
| 690 | 3300044693 | Ga0466961_0479169 | Ga0466961_0479169_217_510 | 94 |
| 691 | 3300044694 | Ga0466963_0081636 | Ga0466963_0081636_1618_1905 | 94 |
| 692 | 3300044694 | Ga0466963_0343239 | Ga0466963_0343239_107_394 | 94 |
| 693 | 3300044694 | Ga0466963_0890961 | Ga0466963_0890961_319_606 | 94 |
| 694 | 3300044706 | Ga0466964_0014898 | Ga0466964_0014898_960_1247 | 94 |
| 695 | 3300044706 | Ga0466964_0361280 | Ga0466964_0361280_11_298 | 94 |
| 696 | 3300044706 | Ga0466964_0383124 | Ga0466964_0383124_173_460 | 94 |
| 697 | 3300044765 | Ga0466970_0252482 | Ga0466970_0252482_456_785 | 94 |
| 698 | 3300044901 | Ga0466960_0114928 | Ga0466960_0114928_693_980 | 94 |
| 699 | 3300044901 | Ga0466960_0263040 | Ga0466960_0263040_304_591 | 94 |
| 700 | 3300044901 | Ga0466960_0357698 | Ga0466960_0357698_184_471 | 94 |
| 701 | 3300045049 | Ga0466959_0060127 | Ga0466959_0060127_2378_2707 | 94 |
| 702 | 3300045976 | Ga0466967_0030588 | Ga0466967_0030588_3818_4111 | 94 |
| 703 | 3300045976 | Ga0466967_0034138 | Ga0466967_0034138_3215_3502 | 94 |
| 704 | 3300045976 | Ga0466967_0145748 | Ga0466967_0145748_1633_1920 | 94 |
| 705 | 3300045976 | Ga0466967_0570363 | Ga0466967_0570363_188_475 | 94 |
| 706 | 3300045976 | Ga0466967_1393236 | Ga0466967_1393236_15_302 | 94 |
| 707 | 3300045976 | Ga0466967_1654833 | Ga0466967_1654833_299_586 | 94 |
| 708 | 3300046491 | Ga0495584_0308504 | Ga0495584_0308504_469_753 | 94 |
| 709 | 3300046538 | Ga0495609_0377076 | Ga0495609_0377076_60_344 | 94 |
| 710 | 3300047320 | Ga0495672_0018594 | Ga0495672_0018594_1740_2060 | 94 |
| 711 | 3300048905 | Ga0496102_0547606 | Ga0496102_0547606_583_867 | 94 |
| 712 | 3300048905 | Ga0496102_0672192 | Ga0496102_0672192_190_477 | 94 |
| 713 | 3300048909 | Ga0496106_0065193 | Ga0496106_0065193_197_481 | 94 |
| 714 | 3300048910 | Ga0496107_0457202 | Ga0496107_0457202_216_500 | 94 |
| 715 | 3300048910 | Ga0496107_0481661 | Ga0496107_0481661_182_466 | 94 |
| 716 | 3300048911 | Ga0496108_0240798 | Ga0496108_0240798_644_928 | 94 |
| 717 | 3300048912 | Ga0496109_1163521 | Ga0496109_1163521_266_550 | 94 |
| 718 | 3300048913 | Ga0496110_0475068 | Ga0496110_0475068_568_852 | 94 |
| 719 | 3300048915 | Ga0496112_0000308 | Ga0496112_0000308_3151_3465 | 94 |
| 720 | 3300048915 | Ga0496112_1314997 | Ga0496112_1314997_123_425 | 94 |
| 721 | 3300048916 | Ga0496113_0043441 | Ga0496113_0043441_2522_2845 | 94 |
| 722 | 3300048924 | Ga0496121_0100779 | Ga0496121_0100779_355_642 | 94 |
| 723 | 3300048929 | Ga0496126_0475004 | Ga0496126_0475004_13_300 | 94 |
| 724 | 3300049533 | Ga0501317_105810 | Ga0501317_105810_36_323 | 94 |
| 725 | 3300049534 | Ga0501318_008980 | Ga0501318_008980_441_725 | 94 |
| 726 | 3300049541 | Ga0501325_049548 | Ga0501325_049548_47_331 | 94 |
| 727 | 3300049574 | Ga0501038_1076730 | Ga0501038_1076730_163_453 | 94 |
| 728 | 3300049581 | Ga0501047_0275459 | Ga0501047_0275459_1066_1356 | 94 |
| 729 | 3300049663 | Ga0501223_111771 | Ga0501223_111771_54_338 | 94 |
| 730 | 3300050507 | nmdc:mga05p37_695082_c1 | nmdc:mga05p37_695082_c1_251_538 | 94 |
| 731 | 3300050508 | nmdc:mga09592_10356_c1 | nmdc:mga09592_10356_c1_2746_3072 | 94 |
| 732 | 3300050508 | nmdc:mga09592_1043764_c1 | nmdc:mga09592_1043764_c1_170_454 | 94 |
| 733 | 3300050510 | nmdc:mga06r32_1495464_c1 | nmdc:mga06r32_1495464_c1_243_530 | 94 |
| 734 | 3300050511 | nmdc:mga08y16_610241_c1 | nmdc:mga08y16_610241_c1_603_887 | 94 |
| 735 | 3300050513 | nmdc:mga0rr50_1301770_c1 | nmdc:mga0rr50_1301770_c1_96_440 | 94 |
| 736 | 3300050513 | nmdc:mga0rr50_590773_c1 | nmdc:mga0rr50_590773_c1_642_929 | 94 |
| 737 | 3300050513 | nmdc:mga0rr50_595799_c1 | nmdc:mga0rr50_595799_c1_67_393 | 94 |
| 738 | 3300053146 | Ga0500588_0029025 | Ga0500588_0029025_745_1032 | 94 |
| 739 | 3300059645 | Ga0587076_152923 | Ga0587076_152923_53_340 | 94 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4s1z-assembly2.cif.gz_I | crystal structure of trabid nzf1 in complex with k29 linked di-ubiquitin | 0.8627 | 54 | 78 |
| 4s1z-assembly1.cif.gz_G | crystal structure of trabid nzf1 in complex with k29 linked di-ubiquitin | 0.8559 | 54 | 79 |
| 7r7j-assembly1.cif.gz_A | crystal structure of radd with adp | 0.8538 | 54 | 82 |
| 4s1z-assembly5.cif.gz_H | crystal structure of trabid nzf1 in complex with k29 linked di-ubiquitin | 0.8535 | 54 | 77 |
| 7r7j-assembly2.cif.gz_B | crystal structure of radd with adp | 0.8491 | 54 | 82 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q86K78_118_315_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8953 | 3 | 46 | 1.20.1260.10 |
| af_Q54UQ6_98_225_1.10.287.110 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.8929 | 54 | 82 | 1.10.287.110 |
| af_Q54H42_48_275_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8496 | 7 | 45 | 1.20.1260.10 |
| af_Q4DHR8_1_892_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.7798 | 49 | 80 | 1.25.10.10 |
| 4xxbB00 | Mainly Beta;Roll;SH3 type barrels.;Zn-finger domain of Sec23/24 | 0.7712 | 54 | 79 | 2.30.30.380 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5E6N886-F1-model_v4 | Uncharacterized protein | 0.9474 | 7 | 39 |
|
| AF-A0A4Q2ZMR8-F1-model_v4 | deleted | 0.9371 | 7 | 42 |
|
| AF-A0A5E6NQA2-F1-model_v4 | Uncharacterized protein | 0.9342 | 2 | 39 |
|
| AF-A0A1J8PRH6-F1-model_v4 | Uncharacterized protein | 0.9305 | 7 | 39 |
|
| AF-U1KPK7-F1-model_v4 | deleted | 0.9282 | 2 | 41 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar