F478448

General Info

Members Datasets Scaffolds Average Seq Length
739 318 739 96

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_101995701|Ga0070664_1019957012
Length 114
Sequence MAYLFIALSFAIAGGIVGRIKGSSFFIWFLISGIVPVIGLAAALLYRWDRNELRRQCPGCGRVVKLHDTLCTRCGTELYFPEVAIASEADLADRRAAGAAANAANRLSSGKIRW

Samples

Sample ID Description Type Environment
1 2149837012 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
183 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
184 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
185 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
186 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
187 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
190 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
223 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
224 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
225 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
226 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
227 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
228 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
229 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
230 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
233 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
234 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
235 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
236 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
237 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
240 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
241 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
244 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
245 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
246 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
247 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
248 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
259 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
260 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
261 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
265 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
266 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
297 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
298 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
299 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
300 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
306 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
316 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.62
Metatranscriptomes 3.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 8.66
Rhizosphere 85.39
Stem 0
Stem Tuber 0
Unclassified 5.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 _GD4IA4401A3XHU 2149837012 Bacteria 501
2 JGI24743J22301_10143661 3300001991 Bacteria 532
3 Ga0006777J48905_1111430 3300003308 Bacteria 621
4 Ga0006781J51513_1011970 3300003568 Bacteria 522
5 Ga0006781J51513_1028949 3300003568 Bacteria 605
6 Ga0007409J51694_1045270 3300003575 Bacteria 551
7 Ga0007416J51690_1096729 3300003577 Bacteria 546
8 Ga0007429J51699_1035403 3300003579 Bacteria 617
9 Ga0007429J51699_1040535 3300003579 Bacteria 757
10 Ga0032354_1047956 3300003693 Bacteria 667
11 Ga0058858_1310944 3300004785 Bacteria 571
12 Ga0058861_11833874 3300004800 Bacteria 861
13 Ga0070658_10631770 3300005327 Bacteria 929
14 Ga0070658_11911632 3300005327 Bacteria 513
15 Ga0070676_10668009 3300005328 Bacteria 756
16 Ga0070676_10792425 3300005328 Bacteria 699
17 Ga0070683_100580273 3300005329 Bacteria 1072
18 Ga0070683_101080481 3300005329 Bacteria 771
19 Ga0070683_101941040 3300005329 Bacteria 566
20 Ga0070690_100238365 3300005330 Bacteria 1282
21 Ga0070670_100751674 3300005331 Bacteria 879
22 Ga0070677_10584891 3300005333 Bacteria 616
23 Ga0068869_100126415 3300005334 Bacteria 1961
24 Ga0068869_100992120 3300005334 Bacteria 731
25 Ga0068869_101530324 3300005334 Bacteria 593
26 Ga0070682_100078491 3300005337 Bacteria 2130
27 Ga0070682_100362283 3300005337 Bacteria 1084
28 Ga0070682_100363563 3300005337 Bacteria 1083
29 Ga0068868_100282928 3300005338 Bacteria 1404
30 Ga0068868_100288252 3300005338 Bacteria 1391
31 Ga0068868_100392579 3300005338 Bacteria 1196
32 Ga0068868_100512834 3300005338 Bacteria 1052
33 Ga0068868_100834889 3300005338 Bacteria 834
34 Ga0068868_102116808 3300005338 Bacteria 535
35 Ga0070660_100062883 3300005339 Bacteria 2885
36 Ga0070660_100073022 3300005339 Bacteria 2682
37 Ga0070660_100756855 3300005339 Bacteria 816
38 Ga0070660_101286061 3300005339 Unclassified 621
39 Ga0070660_101755487 3300005339 Bacteria 529
40 Ga0070691_10121148 3300005341 Bacteria 1317
41 Ga0070691_10416026 3300005341 Bacteria 761
42 Ga0070687_100215026 3300005343 Bacteria 1174
43 Ga0070687_100557317 3300005343 Bacteria 781
44 Ga0070687_100876307 3300005343 Bacteria 642
45 Ga0070687_101031909 3300005343 Unclassified 598
46 Ga0070661_100114771 3300005344 Bacteria 2014
47 Ga0070661_100415333 3300005344 Bacteria 1066
48 Ga0070661_101301942 3300005344 Bacteria 610
49 Ga0070692_10006061 3300005345 Bacteria 5217
50 Ga0070692_10131587 3300005345 Bacteria 1406
51 Ga0070692_10454149 3300005345 Bacteria 821
52 Ga0070668_100009317 3300005347 Bacteria 7284
53 Ga0070668_100393005 3300005347 Bacteria 1183
54 Ga0070669_100019002 3300005353 Bacteria 4912
55 Ga0070669_100123071 3300005353 Bacteria 1982
56 Ga0070669_100260043 3300005353 Bacteria 1385
57 Ga0070675_100725845 3300005354 Bacteria 906
58 Ga0070671_100517563 3300005355 Bacteria 1027
59 Ga0070671_102088493 3300005355 Bacteria 505
60 Ga0070674_100081739 3300005356 Bacteria 2309
61 Ga0070674_100126134 3300005356 Bacteria 1901
62 Ga0070674_101185433 3300005356 Bacteria 677
63 Ga0070673_100651938 3300005364 Bacteria 964
64 Ga0070659_100000132 3300005366 Bacteria 56931
65 Ga0070659_100697675 3300005366 Bacteria 877
66 Ga0070659_100726915 3300005366 Bacteria 860
67 Ga0070659_100934861 3300005366 Bacteria 759
68 Ga0070659_100976914 3300005366 Bacteria 743
69 Ga0070659_101196954 3300005366 Bacteria 672
70 Ga0070659_101261614 3300005366 Bacteria 655
71 Ga0070667_102252154 3300005367 Bacteria 513
72 Ga0070709_10159646 3300005434 Bacteria 1566
73 Ga0070714_100036859 3300005435 Bacteria 4105
74 Ga0070714_100689243 3300005435 Unclassified 985
75 Ga0070714_101165883 3300005435 Bacteria 751
76 Ga0070714_102512313 3300005435 Bacteria 500
77 Ga0070710_10000015 3300005437 Bacteria 103891
78 Ga0070710_10072659 3300005437 Bacteria 1987
79 Ga0070701_11112316 3300005438 Bacteria 557
80 Ga0070711_101542976 3300005439 Bacteria 580
81 Ga0070705_100000870 3300005440 Bacteria 16885
82 Ga0070700_100203413 3300005441 Bacteria 1392
83 Ga0070700_100428098 3300005441 Bacteria 1002
84 Ga0070700_100441879 3300005441 Bacteria 988
85 Ga0070700_100742331 3300005441 Bacteria 785
86 Ga0070694_101020497 3300005444 Bacteria 687
87 Ga0070663_100328115 3300005455 Bacteria 1232
88 Ga0070663_100378738 3300005455 Bacteria 1152
89 Ga0070663_100718233 3300005455 Bacteria 851
90 Ga0070663_101422804 3300005455 Bacteria 614
91 Ga0070678_100512875 3300005456 Bacteria 1060
92 Ga0070678_100932872 3300005456 Bacteria 795
93 Ga0070678_101264686 3300005456 Bacteria 686
94 Ga0070678_101648816 3300005456 Bacteria 603
95 Ga0070678_102189983 3300005456 Bacteria 524
96 Ga0070678_102278535 3300005456 Bacteria 514
97 Ga0070662_100155907 3300005457 Bacteria 1782
98 Ga0070662_100192532 3300005457 Bacteria 1614
99 Ga0070662_100423397 3300005457 Bacteria 1102
100 Ga0070662_100604428 3300005457 Bacteria 923
101 Ga0070681_10231584 3300005458 Bacteria 1762
102 Ga0068867_100062732 3300005459 Bacteria 2762
103 Ga0068867_100132843 3300005459 Bacteria 1936
104 Ga0068867_100649339 3300005459 Bacteria 926
105 Ga0068867_101022725 3300005459 Bacteria 750
106 Ga0068867_101116497 3300005459 Unclassified 720
107 Ga0070685_10147419 3300005466 Bacteria 1488
108 Ga0070685_10377747 3300005466 Bacteria 975
109 Ga0070707_100976409 3300005468 Unclassified 812
110 Ga0070699_101171855 3300005518 Bacteria 705
111 Ga0070679_100062457 3300005530 Bacteria 3714
112 Ga0070679_100465416 3300005530 Bacteria 1209
113 Ga0070684_100052037 3300005535 Bacteria 3559
114 Ga0070684_100330197 3300005535 Bacteria 1401
115 Ga0070684_100380680 3300005535 Bacteria 1300
116 Ga0070684_100440613 3300005535 Bacteria 1203
117 Ga0070684_100913694 3300005535 Bacteria 823
118 Ga0070684_101155906 3300005535 Bacteria 728
119 Ga0068853_100363500 3300005539 Bacteria 1349
120 Ga0070672_100180153 3300005543 Bacteria 1761
121 Ga0070672_100677811 3300005543 Bacteria 902
122 Ga0070672_101203469 3300005543 Bacteria 675
123 Ga0070686_100688889 3300005544 Bacteria 814
124 Ga0070695_100930995 3300005545 Archaea 703
125 Ga0070696_101462389 3300005546 Bacteria 584
126 Ga0070693_100303082 3300005547 Bacteria 1078
127 Ga0070665_100976063 3300005548 Bacteria 860
128 Ga0070704_100424783 3300005549 Bacteria 1139
129 Ga0070664_100140859 3300005564 Bacteria 2123
130 Ga0070664_100347314 3300005564 Bacteria 1349
131 Ga0070664_100441651 3300005564 Bacteria 1193
132 Ga0070664_101515251 3300005564 Unclassified 635
133 Ga0070664_101995701 3300005564 Bacteria 551
134 Ga0070664_102125389 3300005564 Bacteria 533
135 Ga0068857_100202462 3300005577 Bacteria 1810
136 Ga0068854_100122530 3300005578 Bacteria 1976
137 Ga0068854_100299802 3300005578 Bacteria 1300
138 Ga0068856_100057926 3300005614 Bacteria 3826
139 Ga0068856_100341471 3300005614 Bacteria 1516
140 Ga0068856_100348956 3300005614 Unclassified 1498
141 Ga0068856_100604280 3300005614 Bacteria 1118
142 Ga0070702_100066914 3300005615 Bacteria 2109
143 Ga0070702_100393994 3300005615 Bacteria 988
144 Ga0068852_100363553 3300005616 Bacteria 1416
145 Ga0068852_101338922 3300005616 Bacteria 738
146 Ga0068852_102553635 3300005616 Bacteria 531
147 Ga0068859_100582315 3300005617 Bacteria 1213
148 Ga0068864_100080512 3300005618 Bacteria 2854
149 Ga0068864_100573671 3300005618 Bacteria 1092
150 Ga0068864_100636263 3300005618 Bacteria 1038
151 Ga0068864_102643525 3300005618 Bacteria 508
152 Ga0068866_10193882 3300005718 Bacteria 1209
153 Ga0068861_100056451 3300005719 Bacteria 2998
154 Ga0068861_100163036 3300005719 Bacteria 1840
155 Ga0068861_100270455 3300005719 Bacteria 1459
156 Ga0068861_100376757 3300005719 Bacteria 1252
157 Ga0068851_10120789 3300005834 Bacteria 1408
158 Ga0068851_10284994 3300005834 Bacteria 946
159 Ga0068870_10162962 3300005840 Bacteria 1324
160 Ga0068870_10432294 3300005840 Bacteria 864
161 Ga0068863_100189364 3300005841 Bacteria 1977
162 Ga0068863_100607301 3300005841 Unclassified 1083
163 Ga0068863_102298631 3300005841 Bacteria 549
164 Ga0068858_100350611 3300005842 Bacteria 1414
165 Ga0068858_100573021 3300005842 Bacteria 1094
166 Ga0068860_100920606 3300005843 Bacteria 891
167 Ga0068862_100627060 3300005844 Unclassified 1035
168 Ga0068862_101120603 3300005844 Bacteria 783
169 Ga0081455_10008248 3300005937 Bacteria 10860
170 Ga0081455_10242847 3300005937 Bacteria 1322
171 Ga0081455_10328824 3300005937 Bacteria 1086
172 Ga0081538_10005959 3300005981 Bacteria 10848
173 Ga0081538_10039395 3300005981 Bacteria 3032
174 Ga0081538_10108952 3300005981 Bacteria 1366
175 Ga0081540_1001786 3300005983 Bacteria 18030
176 Ga0070717_10766660 3300006028 Unclassified 877
177 Ga0075363_100229570 3300006048 Bacteria 1065
178 Ga0070716_100186428 3300006173 Bacteria 1367
179 Ga0070712_100000050 3300006175 Bacteria 63870
180 Ga0070712_100005314 3300006175 Bacteria 7971
181 Ga0070712_100231458 3300006175 Unclassified 1468
182 Ga0070712_101894269 3300006175 Bacteria 522
183 Ga0097621_100880548 3300006237 Bacteria 833
184 Ga0075428_100500182 3300006844 Bacteria 1300
185 Ga0075428_101867641 3300006844 Bacteria 624
186 Ga0075428_102368142 3300006844 Bacteria 546
187 Ga0075431_101628941 3300006847 Unclassified 603
188 Ga0075434_100681937 3300006871 Bacteria 1045
189 Ga0075434_101036197 3300006871 Bacteria 834
190 Ga0075434_102203227 3300006871 Bacteria 555
191 Ga0075429_100014611 3300006880 Bacteria 6806
192 Ga0068865_100051211 3300006881 Bacteria 2857
193 Ga0068865_100156795 3300006881 Bacteria 1732
194 Ga0068865_100614730 3300006881 Bacteria 920
195 Ga0068865_100630702 3300006881 Unclassified 909
196 Ga0068865_100987428 3300006881 Bacteria 737
197 Ga0075436_100226694 3300006914 Bacteria 1327
198 Ga0075436_101544708 3300006914 Bacteria 504
199 Ga0097620_100582335 3300006931 Bacteria 1213
200 Ga0075435_101897065 3300007076 Unclassified 523
201 Ga0105240_10151435 3300009093 Bacteria 2762
202 Ga0111539_10721274 3300009094 Bacteria 1160
203 Ga0111539_10759020 3300009094 Bacteria 1129
204 Ga0111539_11060218 3300009094 Bacteria 942
205 Ga0105245_10046340 3300009098 Bacteria 3885
206 Ga0105245_10186449 3300009098 Bacteria 1985
207 Ga0105245_10314713 3300009098 Bacteria 1540
208 Ga0105245_10834036 3300009098 Bacteria 961
209 Ga0105245_10880466 3300009098 Bacteria 936
210 Ga0105245_11649917 3300009098 Bacteria 693
211 Ga0105245_12736864 3300009098 Unclassified 546
212 Ga0105247_10459527 3300009101 Bacteria 919
213 Ga0114129_11668578 3300009147 Bacteria 778
214 Ga0114129_13297100 3300009147 Unclassified 522
215 Ga0105243_10058843 3300009148 Bacteria 3064
216 Ga0105243_10112983 3300009148 Bacteria 2277
217 Ga0105243_10177918 3300009148 Bacteria 1848
218 Ga0105243_10284846 3300009148 Bacteria 1490
219 Ga0105243_10873284 3300009148 Bacteria 892
220 Ga0105243_11187441 3300009148 Bacteria 775
221 Ga0105242_10647438 3300009176 Bacteria 1027
222 Ga0105242_12389713 3300009176 Bacteria 576
223 Ga0105242_12432958 3300009176 Bacteria 571
224 Ga0105237_10940816 3300009545 Bacteria 871
225 Ga0105237_12726160 3300009545 Unclassified 505
226 Ga0105238_11473074 3300009551 Bacteria 709
227 Ga0105249_10139754 3300009553 Bacteria 2321
228 Ga0105249_10895176 3300009553 Unclassified 954
229 Ga0105249_11078219 3300009553 Bacteria 873
230 Ga0105249_11091829 3300009553 Bacteria 868
231 Ga0105249_11251769 3300009553 Bacteria 813
232 Ga0105249_11408934 3300009553 Bacteria 769
233 Ga0105239_10233083 3300010375 Bacteria 2066
234 Ga0105239_10591738 3300010375 Bacteria 1265
235 Ga0105239_10594287 3300010375 Unclassified 1262
236 Ga0105239_10772591 3300010375 Bacteria 1100
237 Ga0105239_11922601 3300010375 Bacteria 686
238 Ga0105239_12022260 3300010375 Bacteria 669
239 Ga0105239_12148879 3300010375 Bacteria 649
240 Ga0105239_13245451 3300010375 Bacteria 529
241 Ga0105246_10023374 3300011119 Bacteria 3999
242 Ga0105246_10233122 3300011119 Bacteria 1451
243 Ga0105246_10794609 3300011119 Bacteria 839
244 Ga0105246_10968446 3300011119 Bacteria 768
245 Ga0105246_11065201 3300011119 Bacteria 736
246 Ga0105246_11536054 3300011119 Bacteria 627
247 Ga0105246_11814375 3300011119 Bacteria 583
248 Ga0157371_10284213 3300013102 Bacteria 1196
249 Ga0157371_10654874 3300013102 Bacteria 784
250 Ga0157371_11181823 3300013102 Unclassified 589
251 Ga0157374_12709569 3300013296 Unclassified 523
252 Ga0163162_10500585 3300013306 Bacteria 1345
253 Ga0157372_10420739 3300013307 Bacteria 1557
254 Ga0157372_10490485 3300013307 Bacteria 1432
255 Ga0157372_10625884 3300013307 Bacteria 1254
256 Ga0157372_10739756 3300013307 Bacteria 1144
257 Ga0157375_10532724 3300013308 Bacteria 1337
258 Ga0163163_10255761 3300014325 Bacteria 1802
259 Ga0163163_12977000 3300014325 Bacteria 528
260 Ga0157380_10435996 3300014326 Bacteria 1254
261 Ga0157380_10594023 3300014326 Bacteria 1094
262 Ga0157380_10717023 3300014326 Bacteria 1007
263 Ga0157380_11610236 3300014326 Unclassified 705
264 Ga0157380_12643295 3300014326 Bacteria 568
265 Ga0157380_12935800 3300014326 Bacteria 543
266 Ga0182008_10142544 3300014497 Bacteria 1199
267 Ga0182008_10287607 3300014497 Bacteria 857
268 Ga0157377_10250499 3300014745 Bacteria 1148
269 Ga0157377_10380456 3300014745 Bacteria 955
270 Ga0157377_10612768 3300014745 Bacteria 778
271 Ga0157377_11070264 3300014745 Bacteria 616
272 Ga0157377_11350959 3300014745 Bacteria 559
273 Ga0157379_10266864 3300014968 Bacteria 1556
274 Ga0157379_11840792 3300014968 Bacteria 595
275 Ga0197907_10615912 3300020069 Bacteria 1061
276 Ga0206349_1231240 3300020075 Bacteria 523
277 Ga0206350_11164447 3300020080 Bacteria 1157
278 Ga0206350_11482167 3300020080 Bacteria 775
279 Ga0206354_11362747 3300020081 Bacteria 628
280 Ga0206353_10800325 3300020082 Bacteria 900
281 Ga0154015_1115475 3300020610 Bacteria 545
282 Ga0154015_1516197 3300020610 Bacteria 1295
283 Ga0213873_10041941 3300021358 Unclassified 1182
284 Ga0213874_10018585 3300021377 Bacteria 1880
285 Ga0213874_10156658 3300021377 Bacteria 798
286 Ga0213876_10003709 3300021384 Bacteria 8663
287 Ga0213876_10007820 3300021384 Bacteria 5799
288 Ga0213876_10014352 3300021384 Bacteria 4198
289 Ga0213876_10073210 3300021384 Bacteria 1809
290 Ga0213876_10277713 3300021384 Bacteria 890
291 Ga0213875_10014955 3300021388 Bacteria 3780
292 Ga0213875_10041759 3300021388 Bacteria 2157
293 Ga0213875_10058999 3300021388 Bacteria 1796
294 Ga0213875_10473011 3300021388 Bacteria 601
295 Ga0207692_10000013 3300025898 Bacteria 103819
296 Ga0207692_10065462 3300025898 Bacteria 1896
297 Ga0207692_10655782 3300025898 Bacteria 678
298 Ga0207642_10076269 3300025899 Bacteria 1613
299 Ga0207688_10136005 3300025901 Bacteria 1443
300 Ga0207688_10170646 3300025901 Bacteria 1293
301 Ga0207688_10333832 3300025901 Bacteria 932
302 Ga0207688_10344447 3300025901 Bacteria 917
303 Ga0207688_10361112 3300025901 Bacteria 896
304 Ga0207688_10427849 3300025901 Bacteria 823
305 Ga0207680_10856616 3300025903 Unclassified 651
306 Ga0207699_10202180 3300025906 Bacteria 1347
307 Ga0207699_10885595 3300025906 Unclassified 658
308 Ga0207645_10112564 3300025907 Bacteria 1763
309 Ga0207645_10430680 3300025907 Bacteria 889
310 Ga0207643_10284500 3300025908 Bacteria 1026
311 Ga0207643_10518784 3300025908 Bacteria 763
312 Ga0207705_10547475 3300025909 Bacteria 899
313 Ga0207707_10284321 3300025912 Bacteria 1432
314 Ga0207707_10429276 3300025912 Bacteria 1132
315 Ga0207695_10113274 3300025913 Bacteria 2689
316 Ga0207671_10003194 3300025914 Bacteria 16519
317 Ga0207693_10000151 3300025915 Bacteria 64033
318 Ga0207693_10008924 3300025915 Bacteria 8184
319 Ga0207693_10732879 3300025915 Unclassified 764
320 Ga0207663_10313510 3300025916 Bacteria 1176
321 Ga0207663_10458954 3300025916 Unclassified 984
322 Ga0207660_11398269 3300025917 Bacteria 567
323 Ga0207662_10136404 3300025918 Bacteria 1551
324 Ga0207662_10252368 3300025918 Bacteria 1158
325 Ga0207657_10216511 3300025919 Bacteria 1536
326 Ga0207657_10305119 3300025919 Bacteria 1261
327 Ga0207649_10132712 3300025920 Bacteria 1694
328 Ga0207649_10323696 3300025920 Bacteria 1133
329 Ga0207649_10803619 3300025920 Unclassified 734
330 Ga0207649_11372976 3300025920 Bacteria 559
331 Ga0207652_10093457 3300025921 Bacteria 2647
332 Ga0207646_10848867 3300025922 Unclassified 812
333 Ga0207681_10003336 3300025923 Bacteria 10055
334 Ga0207681_10287351 3300025923 Bacteria 1297
335 Ga0207650_10944823 3300025925 Bacteria 733
336 Ga0207659_10822432 3300025926 Bacteria 798
337 Ga0207687_10208186 3300025927 Bacteria 1533
338 Ga0207687_10313926 3300025927 Bacteria 1267
339 Ga0207687_10533650 3300025927 Unclassified 983
340 Ga0207687_10617331 3300025927 Bacteria 915
341 Ga0207700_10613221 3300025928 Bacteria 969
342 Ga0207664_10000331 3300025929 Bacteria 35072
343 Ga0207664_10005338 3300025929 Bacteria 8777
344 Ga0207664_10493781 3300025929 Bacteria 1096
345 Ga0207664_11431398 3300025929 Unclassified 612
346 Ga0207664_11883171 3300025929 Bacteria 521
347 Ga0207690_10000075 3300025932 Bacteria 85885
348 Ga0207690_10733290 3300025932 Bacteria 814
349 Ga0207690_10846286 3300025932 Unclassified 757
350 Ga0207690_11154395 3300025932 Unclassified 646
351 Ga0207690_11661987 3300025932 Unclassified 534
352 Ga0207706_10030392 3300025933 Bacteria 4819
353 Ga0207706_10414635 3300025933 Bacteria 1167
354 Ga0207686_10641335 3300025934 Bacteria 839
355 Ga0207686_11438443 3300025934 Bacteria 568
356 Ga0207709_10034617 3300025935 Bacteria 2978
357 Ga0207709_10052158 3300025935 Bacteria 2510
358 Ga0207709_10202100 3300025935 Bacteria 1420
359 Ga0207709_10679633 3300025935 Bacteria 822
360 Ga0207669_10449055 3300025937 Bacteria 1021
361 Ga0207669_10679593 3300025937 Bacteria 844
362 Ga0207669_10865200 3300025937 Bacteria 753
363 Ga0207669_11455513 3300025937 Bacteria 584
364 Ga0207704_10032117 3300025938 Bacteria 2967
365 Ga0207704_10181495 3300025938 Bacteria 1521
366 Ga0207704_10476749 3300025938 Bacteria 1001
367 Ga0207704_10669427 3300025938 Bacteria 856
368 Ga0207704_11309152 3300025938 Bacteria 620
369 Ga0207665_11436162 3300025939 Bacteria 549
370 Ga0207691_10153831 3300025940 Bacteria 2021
371 Ga0207711_10566640 3300025941 Bacteria 1059
372 Ga0207689_10270215 3300025942 Bacteria 1408
373 Ga0207689_10582832 3300025942 Bacteria 940
374 Ga0207661_10014965 3300025944 Bacteria 5696
375 Ga0207661_10107025 3300025944 Bacteria 2358
376 Ga0207661_10171655 3300025944 Bacteria 1888
377 Ga0207661_10284218 3300025944 Bacteria 1479
378 Ga0207661_10861347 3300025944 Bacteria 834
379 Ga0207661_10876172 3300025944 Bacteria 827
380 Ga0207661_11578741 3300025944 Unclassified 601
381 Ga0207679_10231580 3300025945 Bacteria 1560
382 Ga0207679_10379518 3300025945 Bacteria 1239
383 Ga0207679_10582222 3300025945 Bacteria 1007
384 Ga0207679_10699890 3300025945 Bacteria 919
385 Ga0207679_11496555 3300025945 Bacteria 619
386 Ga0207667_11702590 3300025949 Bacteria 597
387 Ga0207651_11004114 3300025960 Bacteria 746
388 Ga0207712_10574550 3300025961 Bacteria 972
389 Ga0207712_11999224 3300025961 Bacteria 519
390 Ga0207668_10401469 3300025972 Bacteria 1159
391 Ga0207640_10566785 3300025981 Unclassified 957
392 Ga0207640_11333372 3300025981 Bacteria 641
393 Ga0207658_11139563 3300025986 Bacteria 713
394 Ga0207677_10070256 3300026023 Bacteria 2467
395 Ga0207677_10122676 3300026023 Bacteria 1958
396 Ga0207677_10291079 3300026023 Bacteria 1345
397 Ga0207677_10316583 3300026023 Bacteria 1295
398 Ga0207677_10738834 3300026023 Bacteria 876
399 Ga0207677_11792327 3300026023 Bacteria 570
400 Ga0207677_12242083 3300026023 Bacteria 508
401 Ga0207703_10968933 3300026035 Bacteria 816
402 Ga0207639_11524487 3300026041 Bacteria 627
403 Ga0207678_10279433 3300026067 Bacteria 1433
404 Ga0207678_10367638 3300026067 Bacteria 1242
405 Ga0207678_10475697 3300026067 Bacteria 1088
406 Ga0207678_11299408 3300026067 Bacteria 644
407 Ga0207708_10000878 3300026075 Bacteria 22588
408 Ga0207708_10219419 3300026075 Bacteria 1523
409 Ga0207708_10480163 3300026075 Bacteria 1039
410 Ga0207708_10503588 3300026075 Bacteria 1015
411 Ga0207708_10922232 3300026075 Bacteria 757
412 Ga0207702_10248857 3300026078 Bacteria 1668
413 Ga0207702_10308922 3300026078 Unclassified 1503
414 Ga0207641_10289497 3300026088 Bacteria 1544
415 Ga0207641_11985241 3300026088 Bacteria 583
416 Ga0207648_10112472 3300026089 Bacteria 2391
417 Ga0207648_10142390 3300026089 Bacteria 2114
418 Ga0207648_10204040 3300026089 Bacteria 1754
419 Ga0207648_10654727 3300026089 Bacteria 971
420 Ga0207648_12150188 3300026089 Bacteria 519
421 Ga0207676_10441982 3300026095 Bacteria 1224
422 Ga0207676_10524474 3300026095 Bacteria 1128
423 Ga0207676_10694976 3300026095 Bacteria 985
424 Ga0207676_10893744 3300026095 Unclassified 871
425 Ga0207674_10472681 3300026116 Bacteria 1212
426 Ga0207675_100102172 3300026118 Bacteria 2701
427 Ga0207675_100158112 3300026118 Bacteria 2160
428 Ga0207675_100169805 3300026118 Bacteria 2084
429 Ga0207675_100212850 3300026118 Bacteria 1860
430 Ga0207675_100237773 3300026118 Bacteria 1759
431 Ga0207675_100641902 3300026118 Bacteria 1067
432 Ga0207683_10498305 3300026121 Unclassified 1125
433 Ga0207683_10568260 3300026121 Bacteria 1049
434 Ga0207698_10189328 3300026142 Bacteria 1831
435 Ga0207698_10373185 3300026142 Bacteria 1355
436 Ga0207698_10479279 3300026142 Bacteria 1206
437 Ga0207698_10971009 3300026142 Unclassified 859
438 Ga0207698_11017943 3300026142 Bacteria 839
439 Ga0207698_11111563 3300026142 Bacteria 803
440 Ga0207428_10569871 3300027907 Bacteria 818
441 Ga0268266_10203971 3300028379 Bacteria 1811
442 Ga0268265_11182120 3300028380 Unclassified 762
443 Ga0265337_1018502 3300028556 Bacteria 2211
444 Ga0265326_10000023 3300028558 Bacteria 113142
445 Ga0265326_10015531 3300028558 Bacteria 2207
446 Ga0265319_1000147 3300028563 Bacteria 52278
447 Ga0265319_1257873 3300028563 Unclassified 531
448 Ga0265334_10000135 3300028573 Bacteria 46602
449 Ga0265334_10049903 3300028573 Bacteria 1609
450 Ga0265334_10170953 3300028573 Bacteria 761
451 Ga0265318_10003281 3300028577 Bacteria 8221
452 Ga0265336_10000004 3300028666 Bacteria 418303
453 Ga0265336_10009601 3300028666 Bacteria 3338
454 Ga0265338_10000012 3300028800 Bacteria 418599
455 Ga0265338_10000902 3300028800 Bacteria 49948
456 Ga0265338_10216133 3300028800 Bacteria 1435
457 Ga0265324_10002787 3300029957 Bacteria 8634
458 Ga0265777_123614 3300030877 Unclassified 519
459 Ga0265765_1031362 3300030879 Bacteria 679
460 Ga0265320_10091945 3300031240 Bacteria 1405
461 Ga0265340_10000001 3300031247 Bacteria 1647668
462 Ga0265327_10024549 3300031251 Bacteria 3538
463 Ga0265327_10217830 3300031251 Unclassified 859
464 Ga0265316_10122406 3300031344 Bacteria 1964
465 Ga0307408_100377914 3300031548 Bacteria 1210
466 Ga0307408_101042289 3300031548 Bacteria 756
467 Ga0265314_10091338 3300031711 Bacteria 1982
468 Ga0265314_10469534 3300031711 Unclassified 667
469 Ga0265342_10240145 3300031712 Unclassified 970
470 Ga0307405_11063814 3300031731 Bacteria 693
471 Ga0307413_11240298 3300031824 Unclassified 650
472 Ga0307410_10015235 3300031852 Bacteria 4554
473 Ga0307410_10123587 3300031852 Bacteria 1891
474 Ga0307410_10358893 3300031852 Bacteria 1167
475 Ga0307407_10080421 3300031903 Bacteria 1969
476 Ga0307407_10104721 3300031903 Bacteria 1764
477 Ga0307407_10629598 3300031903 Bacteria 802
478 Ga0307407_10973942 3300031903 Bacteria 654
479 Ga0307412_10093308 3300031911 Bacteria 2111
480 Ga0307412_10419701 3300031911 Bacteria 1094
481 Ga0307412_10532219 3300031911 Bacteria 984
482 Ga0307412_11595944 3300031911 Bacteria 595
483 Ga0307409_100144232 3300031995 Bacteria 2056
484 Ga0307409_100569943 3300031995 Bacteria 1114
485 Ga0307409_100978965 3300031995 Bacteria 863
486 Ga0307409_101099425 3300031995 Bacteria 816
487 Ga0307409_101541596 3300031995 Bacteria 692
488 Ga0307409_102949935 3300031995 Unclassified 502
489 Ga0307416_100064502 3300032002 Bacteria 3005
490 Ga0307416_100109289 3300032002 Bacteria 2432
491 Ga0307416_100116805 3300032002 Bacteria 2366
492 Ga0307416_100254575 3300032002 Bacteria 1711
493 Ga0307416_100542396 3300032002 Bacteria 1235
494 Ga0307416_100596589 3300032002 Bacteria 1184
495 Ga0307414_10441703 3300032004 Bacteria 1139
496 Ga0307411_11198637 3300032005 Unclassified 688
497 Ga0307415_100004333 3300032126 Bacteria 7349
498 Ga0307415_100053661 3300032126 Bacteria 2748
499 Ga0307415_100063811 3300032126 Bacteria 2561
500 Ga0307415_100242201 3300032126 Bacteria 1459
501 Ga0373944_0059204 3300035089 Bacteria 1225
502 Ga0373943_0026167 3300035170 Bacteria 2732
503 Ga0373931_0908810 3300035691 Bacteria 592
504 Ga0373935_0448338 3300035692 Bacteria 932
505 Ga0373947_0192034 3300035725 Bacteria 1333
506 Ga0373925_1221299 3300037068 Bacteria 617
507 Ga0395899_0922616 3300037312 Bacteria 531
508 Ga0395900_0106720 3300037418 Bacteria 2877
509 Ga0395900_0806991 3300037418 Bacteria 866
510 Ga0395898_0234206 3300037466 Bacteria 1751
511 Ga0395898_0620157 3300037466 Bacteria 1024
512 Ga0395898_1355335 3300037466 Bacteria 640
513 Ga0395905_0406955 3300037471 Bacteria 1256
514 Ga0395905_0768554 3300037471 Bacteria 866
515 Ga0436364_0069035 3300037853 Bacteria 1276
516 Ga0436364_0083442 3300037853 Bacteria 20899
517 Ga0436364_0143594 3300037853 Bacteria 957
518 Ga0436364_0253679 3300037853 Bacteria 41160
519 Ga0436364_0696536 3300037853 Bacteria 1426
520 Ga0436364_0711358 3300037853 Bacteria 1581
521 Ga0436364_1236778 3300037853 Bacteria 581
522 Ga0436364_1506247 3300037853 Bacteria 6182
523 Ga0395901_0142972 3300038443 Bacteria 2515
524 Ga0395901_0179675 3300038443 Bacteria 2219
525 Ga0395901_0216600 3300038443 Bacteria 2003
526 Ga0395901_0218353 3300038443 Bacteria 1993
527 Ga0395901_1023908 3300038443 Bacteria 800
528 Ga0395901_1104003 3300038443 Bacteria 764
529 Ga0436365_0047645 3300039437 Bacteria 1134
530 Ga0436365_0300577 3300039437 Bacteria 7330
531 Ga0436365_0644636 3300039437 Bacteria 2316
532 Ga0436365_0914767 3300039437 Bacteria 1894
533 Ga0436365_1188153 3300039437 Bacteria 27546
534 Ga0436361_1073365 3300039447 Unclassified 1594
535 Ga0436363_0115300 3300039450 Bacteria 1694
536 Ga0436363_0202603 3300039450 Bacteria 1729
537 Ga0436363_0702773 3300039450 Bacteria 1298
538 Ga0436363_0771235 3300039450 Bacteria 1298
539 Ga0436363_0991270 3300039450 Bacteria 1481
540 Ga0436363_1384290 3300039450 Bacteria 1722
541 Ga0436363_1523944 3300039450 Bacteria 2634
542 Ga0436362_0786700 3300039453 Bacteria 2468
543 Ga0436362_0791856 3300039453 Bacteria 794
544 Ga0451793_0439203 3300041452 Unclassified 577
545 Ga0451797_0069996 3300041453 Bacteria 871
546 Ga0451800_0592877 3300041459 Bacteria 1035
547 Ga0451833_0898710 3300041491 Bacteria 1051
548 Ga0451839_1363326 3300041496 Bacteria 541
549 Ga0451849_0674714 3300041505 Bacteria 616
550 Ga0451853_2965079 3300041512 Bacteria 952
551 Ga0451853_3353689 3300041512 Bacteria 948
552 Ga0439450_040958 3300042008 Bacteria 1075
553 Ga0439454_110961 3300042011 Bacteria 523
554 Ga0450888_033760 3300042126 Bacteria 693
555 Ga0450902_041476 3300042137 Bacteria 784
556 Ga0439464_0026506 3300042439 Bacteria 1608
557 Ga0439440_0173325 3300042993 Bacteria 628
558 Ga0466972_0209235 3300044658 Bacteria 913
559 Ga0466965_0379640 3300044683 Bacteria 778
560 Ga0466966_0239222 3300044684 Bacteria 1095
561 Ga0466966_0452250 3300044684 Bacteria 772
562 Ga0466966_0725518 3300044684 Bacteria 599
563 Ga0466961_0038116 3300044693 Bacteria 3083
564 Ga0466961_0098052 3300044693 Bacteria 1848
565 Ga0466961_0101439 3300044693 Bacteria 1813
566 Ga0466961_0479169 3300044693 Bacteria 752
567 Ga0466961_0768401 3300044693 Bacteria 576
568 Ga0466963_0011113 3300044694 Bacteria 5475
569 Ga0466963_0033768 3300044694 Bacteria 3325
570 Ga0466963_0081636 3300044694 Bacteria 2190
571 Ga0466963_0242055 3300044694 Bacteria 1265
572 Ga0466963_0343239 3300044694 Bacteria 1051
573 Ga0466963_0405309 3300044694 Bacteria 962
574 Ga0466963_0660745 3300044694 Bacteria 738
575 Ga0466963_0890961 3300044694 Bacteria 627
576 Ga0466963_0949701 3300044694 Bacteria 606
577 Ga0466963_0959413 3300044694 Unclassified 602
578 Ga0466963_1042400 3300044694 Unclassified 576
579 Ga0466964_0014898 3300044706 Bacteria 2961
580 Ga0466964_0361280 3300044706 Bacteria 749
581 Ga0466964_0383124 3300044706 Bacteria 730
582 Ga0466971_0341886 3300044719 Archaea 723
583 Ga0466968_0045560 3300044735 Bacteria 1862
584 Ga0466970_0120321 3300044765 Bacteria 1438
585 Ga0466970_0252482 3300044765 Bacteria 988
586 Ga0466970_0602189 3300044765 Bacteria 637
587 Ga0466970_0902112 3300044765 Bacteria 520
588 Ga0466957_0847608 3300044842 Bacteria 651
589 Ga0466960_0114928 3300044901 Bacteria 1403
590 Ga0466960_0248728 3300044901 Bacteria 987
591 Ga0466960_0263040 3300044901 Bacteria 962
592 Ga0466960_0357698 3300044901 Bacteria 834
593 Ga0466960_0951418 3300044901 Unclassified 526
594 Ga0466960_1059276 3300044901 Bacteria 500
595 Ga0466959_0060127 3300045049 Bacteria 2765
596 Ga0466959_0068304 3300045049 Bacteria 2575
597 Ga0466959_0136602 3300045049 Bacteria 1735
598 Ga0466959_0148462 3300045049 Bacteria 1654
599 Ga0466959_0175035 3300045049 Bacteria 1504
600 Ga0466959_0197771 3300045049 Bacteria 1401
601 Ga0466959_0878112 3300045049 Bacteria 598
602 Ga0466959_0992765 3300045049 Bacteria 559
603 Ga0466958_0010792 3300045836 Bacteria 5127
604 Ga0466958_0101731 3300045836 Bacteria 1787
605 Ga0466958_0645792 3300045836 Bacteria 689
606 Ga0466958_1057031 3300045836 Unclassified 530
607 Ga0466967_0030588 3300045976 Bacteria 4520
608 Ga0466967_0034138 3300045976 Bacteria 4314
609 Ga0466967_0060637 3300045976 Bacteria 3353
610 Ga0466967_0145748 3300045976 Bacteria 2209
611 Ga0466967_0184093 3300045976 Bacteria 1971
612 Ga0466967_0570363 3300045976 Unclassified 1115
613 Ga0466967_0702264 3300045976 Bacteria 1002
614 Ga0466967_1070291 3300045976 Bacteria 803
615 Ga0466967_1393236 3300045976 Bacteria 698
616 Ga0466967_1654833 3300045976 Bacteria 637
617 Ga0466967_1667427 3300045976 Bacteria 635
618 Ga0466967_2027541 3300045976 Unclassified 572
619 Ga0495603_0095519 3300046455 Bacteria 1737
620 Ga0495641_0495293 3300046461 Bacteria 557
621 Ga0495651_0673594 3300046462 Unclassified 647
622 Ga0495653_0001695 3300046463 Bacteria 17331
623 Ga0495650_0000398 3300046471 Bacteria 72672
624 Ga0495582_0096920 3300046473 Bacteria 1649
625 Ga0495584_0308504 3300046491 Bacteria 804
626 Ga0495608_0225185 3300046511 Bacteria 1175
627 Ga0495618_0000149 3300046514 Bacteria 49623
628 Ga0495620_0056131 3300046515 Bacteria 1658
629 Ga0495630_0000182 3300046517 Bacteria 48697
630 Ga0495630_1475543 3300046517 Bacteria 511
631 Ga0495652_0404348 3300046529 Unclassified 966
632 Ga0495609_0143532 3300046538 Bacteria 1018
633 Ga0495609_0377076 3300046538 Bacteria 570
634 Ga0495645_0000181 3300046543 Bacteria 44474
635 Ga0495657_0000213 3300046675 Bacteria 52360
636 Ga0495658_0373348 3300046683 Unclassified 908
637 Ga0495581_0269671 3300047315 Bacteria 995
638 Ga0495672_0018594 3300047320 Bacteria 4608
639 Ga0496100_0000650 3300048903 Bacteria 16486
640 Ga0496100_0002493 3300048903 Bacteria 9367
641 Ga0496100_0424892 3300048903 Bacteria 1015
642 Ga0496101_0002222 3300048904 Bacteria 11860
643 Ga0496101_0030126 3300048904 Bacteria 3802
644 Ga0496101_0095311 3300048904 Bacteria 2220
645 Ga0496101_1318884 3300048904 Bacteria 564
646 Ga0496102_0124870 3300048905 Bacteria 2405
647 Ga0496102_0135736 3300048905 Bacteria 2305
648 Ga0496102_0547606 3300048905 Bacteria 1080
649 Ga0496102_0672192 3300048905 Bacteria 959
650 Ga0496102_1100917 3300048905 Bacteria 714
651 Ga0496103_0143445 3300048906 Bacteria 1528
652 Ga0496104_0010231 3300048907 Bacteria 8375
653 Ga0496104_0080428 3300048907 Bacteria 3107
654 Ga0496104_0265996 3300048907 Bacteria 1627
655 Ga0496105_0147973 3300048908 Bacteria 1931
656 Ga0496106_0012233 3300048909 Bacteria 6334
657 Ga0496106_0065193 3300048909 Bacteria 2773
658 Ga0496106_0695084 3300048909 Bacteria 811
659 Ga0496107_0258404 3300048910 Bacteria 1296
660 Ga0496107_0457202 3300048910 Bacteria 948
661 Ga0496107_0481661 3300048910 Bacteria 921
662 Ga0496107_1097481 3300048910 Unclassified 575
663 Ga0496108_0002318 3300048911 Bacteria 15233
664 Ga0496108_0033301 3300048911 Bacteria 4281
665 Ga0496108_0240798 3300048911 Bacteria 1574
666 Ga0496108_0278659 3300048911 Bacteria 1456
667 Ga0496108_1317119 3300048911 Bacteria 607
668 Ga0496109_0000757 3300048912 Bacteria 26932
669 Ga0496109_0060451 3300048912 Bacteria 3462
670 Ga0496109_0214678 3300048912 Bacteria 1809
671 Ga0496109_0682075 3300048912 Bacteria 965
672 Ga0496109_0927063 3300048912 Bacteria 809
673 Ga0496109_1163521 3300048912 Bacteria 708
674 Ga0496110_0000630 3300048913 Bacteria 24110
675 Ga0496110_0100084 3300048913 Bacteria 2598
676 Ga0496110_0168645 3300048913 Bacteria 1986
677 Ga0496110_0475068 3300048913 Bacteria 1139
678 Ga0496111_0018084 3300048914 Bacteria 4877
679 Ga0496111_0174935 3300048914 Bacteria 1595
680 Ga0496111_0508290 3300048914 Bacteria 886
681 Ga0496111_0842689 3300048914 Unclassified 662
682 Ga0496112_0000308 3300048915 Bacteria 31586
683 Ga0496112_0031510 3300048915 Bacteria 5144
684 Ga0496112_0059519 3300048915 Bacteria 3764
685 Ga0496112_0098263 3300048915 Bacteria 2897
686 Ga0496112_0140696 3300048915 Bacteria 2382
687 Ga0496112_0576116 3300048915 Bacteria 1058
688 Ga0496112_0618573 3300048915 Bacteria 1014
689 Ga0496112_1110581 3300048915 Bacteria 709
690 Ga0496112_1314997 3300048915 Bacteria 638
691 Ga0496113_0017090 3300048916 Bacteria 5029
692 Ga0496113_0043441 3300048916 Bacteria 3326
693 Ga0496113_0284274 3300048916 Bacteria 1323
694 Ga0496113_0936555 3300048916 Unclassified 684
695 Ga0496113_1204680 3300048916 Bacteria 591
696 Ga0496114_0070676 3300048917 Bacteria 2933
697 Ga0496114_0518202 3300048917 Bacteria 1054
698 Ga0496115_0000680 3300048918 Bacteria 25141
699 Ga0496115_0739487 3300048918 Bacteria 770
700 Ga0496121_0100779 3300048924 Bacteria 2229
701 Ga0496122_0155324 3300048925 Bacteria 1405
702 Ga0496126_0475004 3300048929 Bacteria 1003
703 Ga0501317_105810 3300049533 Bacteria 512
704 Ga0501318_008980 3300049534 Bacteria 1081
705 Ga0501325_049548 3300049541 Bacteria 531
706 Ga0501038_1076730 3300049574 Bacteria 588
707 Ga0501039_0680880 3300049575 Bacteria 805
708 Ga0501047_0275459 3300049581 Bacteria 1528
709 Ga0501048_0320114 3300049582 Bacteria 1105
710 Ga0501069_0710559 3300049585 Bacteria 607
711 Ga0501075_0891368 3300049591 Bacteria 676
712 Ga0501076_0755323 3300049592 Bacteria 803
713 Ga0501198_078525 3300049649 Bacteria 635
714 Ga0501223_111771 3300049663 Bacteria 571
715 Ga0501079_0706836 3300049741 Bacteria 793
716 Ga0501081_0999958 3300049743 Bacteria 632
717 Ga0501035_1205489 3300049822 Unclassified 587
718 Ga0501045_1065431 3300049824 Bacteria 592
719 nmdc:mga00v17_449506_c1 3300050491 Bacteria 836
720 nmdc:mga0yw44_726562_c1 3300050492 Bacteria 674
721 nmdc:mga05p37_695082_c1 3300050507 Bacteria 1131
722 nmdc:mga09592_10356_c1 3300050508 Bacteria 7587
723 nmdc:mga09592_1043764_c1 3300050508 Bacteria 681
724 nmdc:mga06r32_1495464_c1 3300050510 Bacteria 615
725 nmdc:mga08y16_463984_c1 3300050511 Bacteria 1290
726 nmdc:mga08y16_610241_c1 3300050511 Bacteria 1099
727 nmdc:mga0rr50_1301770_c1 3300050513 Bacteria 616
728 nmdc:mga0rr50_590773_c1 3300050513 Bacteria 946
729 nmdc:mga0rr50_595799_c1 3300050513 Unclassified 942
730 Ga0495601_0007254 3300053077 Bacteria 6502
731 Ga0495601_0468977 3300053077 Bacteria 814
732 Ga0495601_0699347 3300053077 Bacteria 647
733 Ga0495612_0000057 3300053078 Bacteria 49938
734 Ga0495619_1116297 3300053085 Unclassified 524
735 Ga0500588_0029025 3300053146 Bacteria 1574
736 Ga0587073_0319924 3300059492 Bacteria 511
737 Ga0587076_152923 3300059645 Unclassified 561
738 Ga0466962_0448288 3300061719 Bacteria 650
739 Ga0466962_0597895 3300061719 Bacteria 562

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_0891368 Ga0501075_0891368_51_338 82
2 3300049822 Ga0501035_1205489 Ga0501035_1205489_225_512 82
3 3300049824 Ga0501045_1065431 Ga0501045_1065431_124_411 82
4 3300037471 Ga0395905_0406955 Ga0395905_0406955_416_694 88
5 3300038443 Ga0395901_0142972 Ga0395901_0142972_142_420 88
6 3300041505 Ga0451849_0674714 Ga0451849_0674714_17_295 88
7 3300053077 Ga0495601_0699347 Ga0495601_0699347_267_545 88
8 3300005338 Ga0068868_100282928 Ga0068868_1002829284 89
9 3300005338 Ga0068868_100392579 Ga0068868_1003925792 89
10 3300005339 Ga0070660_100073022 Ga0070660_1000730222 89
11 3300005343 Ga0070687_100876307 Ga0070687_1008763072 89
12 3300005366 Ga0070659_100726915 Ga0070659_1007269152 89
13 3300005366 Ga0070659_100934861 Ga0070659_1009348612 89
14 3300005366 Ga0070659_100976914 Ga0070659_1009769143 89
15 3300005456 Ga0070678_100932872 Ga0070678_1009328722 89
16 3300005530 Ga0070679_100062457 Ga0070679_1000624573 89
17 3300005564 Ga0070664_102125389 Ga0070664_1021253892 89
18 3300005578 Ga0068854_100122530 Ga0068854_1001225302 89
19 3300005614 Ga0068856_100057926 Ga0068856_1000579266 89
20 3300005614 Ga0068856_100341471 Ga0068856_1003414712 89
21 3300005614 Ga0068856_100348956 Ga0068856_1003489563 89
22 3300005614 Ga0068856_100604280 Ga0068856_1006042802 89
23 3300005616 Ga0068852_100363553 Ga0068852_1003635534 89
24 3300005841 Ga0068863_100189364 Ga0068863_1001893644 89
25 3300005841 Ga0068863_102298631 Ga0068863_1022986311 89
26 3300005937 Ga0081455_10008248 Ga0081455_100082484 89
27 3300005983 Ga0081540_1001786 Ga0081540_100178611 89
28 3300006048 Ga0075363_100229570 Ga0075363_1002295702 89
29 3300006175 Ga0070712_101894269 Ga0070712_1018942692 89
30 3300006871 Ga0075434_102203227 Ga0075434_1022032271 89
31 3300006881 Ga0068865_100614730 Ga0068865_1006147302 89
32 3300009098 Ga0105245_10880466 Ga0105245_108804662 89
33 3300009553 Ga0105249_10895176 Ga0105249_108951763 89
34 3300010375 Ga0105239_10591738 Ga0105239_105917384 89
35 3300010375 Ga0105239_12022260 Ga0105239_120222601 89
36 3300011119 Ga0105246_10794609 Ga0105246_107946092 89
37 3300013102 Ga0157371_10654874 Ga0157371_106548742 89
38 3300013296 Ga0157374_12709569 Ga0157374_127095692 89
39 3300013307 Ga0157372_10625884 Ga0157372_106258842 89
40 3300013308 Ga0157375_10532724 Ga0157375_105327243 89
41 3300014497 Ga0182008_10142544 Ga0182008_101425442 89
42 3300014745 Ga0157377_10612768 Ga0157377_106127682 89
43 3300014745 Ga0157377_11070264 Ga0157377_110702642 89
44 3300014968 Ga0157379_10266864 Ga0157379_102668644 89
45 3300020069 Ga0197907_10615912 Ga0197907_106159122 89
46 3300020075 Ga0206349_1231240 Ga0206349_12312402 89
47 3300025901 Ga0207688_10136005 Ga0207688_101360052 89
48 3300025912 Ga0207707_10429276 Ga0207707_104292761 89
49 3300025917 Ga0207660_11398269 Ga0207660_113982691 89
50 3300025918 Ga0207662_10252368 Ga0207662_102523682 89
51 3300025921 Ga0207652_10093457 Ga0207652_100934572 89
52 3300025932 Ga0207690_10733290 Ga0207690_107332903 89
53 3300025932 Ga0207690_10846286 Ga0207690_108462862 89
54 3300025938 Ga0207704_10476749 Ga0207704_104767492 89
55 3300025944 Ga0207661_11578741 Ga0207661_115787411 89
56 3300025949 Ga0207667_11702590 Ga0207667_117025902 89
57 3300025961 Ga0207712_11999224 Ga0207712_119992242 89
58 3300025981 Ga0207640_11333372 Ga0207640_113333721 89
59 3300026023 Ga0207677_10070256 Ga0207677_100702561 89
60 3300026023 Ga0207677_12242083 Ga0207677_122420832 89
61 3300026067 Ga0207678_11299408 Ga0207678_112994082 89
62 3300026075 Ga0207708_10503588 Ga0207708_105035882 89
63 3300026078 Ga0207702_10248857 Ga0207702_102488574 89
64 3300026078 Ga0207702_10308922 Ga0207702_103089222 89
65 3300026088 Ga0207641_10289497 Ga0207641_102894972 89
66 3300026088 Ga0207641_11985241 Ga0207641_119852411 89
67 3300026095 Ga0207676_10441982 Ga0207676_104419822 89
68 3300026118 Ga0207675_100212850 Ga0207675_1002128502 89
69 3300026118 Ga0207675_100641902 Ga0207675_1006419021 89
70 3300026142 Ga0207698_10373185 Ga0207698_103731852 89
71 3300032126 Ga0307415_100053661 Ga0307415_1000536612 89
72 3300035089 Ga0373944_0059204 Ga0373944_0059204_746_1027 89
73 3300035170 Ga0373943_0026167 Ga0373943_0026167_662_943 89
74 3300035691 Ga0373931_0908810 Ga0373931_0908810_116_397 89
75 3300035692 Ga0373935_0448338 Ga0373935_0448338_157_438 89
76 3300035725 Ga0373947_0192034 Ga0373947_0192034_659_940 89
77 3300037068 Ga0373925_1221299 Ga0373925_1221299_203_484 89
78 3300037418 Ga0395900_0106720 Ga0395900_0106720_1264_1548 89
79 3300037418 Ga0395900_0806991 Ga0395900_0806991_240_521 89
80 3300037466 Ga0395898_0234206 Ga0395898_0234206_452_736 89
81 3300037466 Ga0395898_0620157 Ga0395898_0620157_229_510 89
82 3300037466 Ga0395898_1355335 Ga0395898_1355335_111_392 89
83 3300037471 Ga0395905_0768554 Ga0395905_0768554_246_530 89
84 3300038443 Ga0395901_0179675 Ga0395901_0179675_1228_1509 89
85 3300038443 Ga0395901_0218353 Ga0395901_0218353_651_935 89
86 3300038443 Ga0395901_1023908 Ga0395901_1023908_288_569 89
87 3300041452 Ga0451793_0439203 Ga0451793_0439203_206_487 89
88 3300041453 Ga0451797_0069996 Ga0451797_0069996_100_381 89
89 3300041459 Ga0451800_0592877 Ga0451800_0592877_419_700 89
90 3300041496 Ga0451839_1363326 Ga0451839_1363326_25_306 89
91 3300041512 Ga0451853_2965079 Ga0451853_2965079_505_786 89
92 3300044684 Ga0466966_0452250 Ga0466966_0452250_17_310 89
93 3300044901 Ga0466960_0248728 Ga0466960_0248728_241_522 89
94 3300045049 Ga0466959_0992765 Ga0466959_0992765_125_406 89
95 3300046455 Ga0495603_0095519 Ga0495603_0095519_705_986 89
96 3300046461 Ga0495641_0495293 Ga0495641_0495293_95_376 89
97 3300046471 Ga0495650_0000398 Ga0495650_0000398_51460_51741 89
98 3300046473 Ga0495582_0096920 Ga0495582_0096920_833_1114 89
99 3300047315 Ga0495581_0269671 Ga0495581_0269671_91_372 89
100 3300048903 Ga0496100_0424892 Ga0496100_0424892_663_944 89
101 3300048904 Ga0496101_0030126 Ga0496101_0030126_2257_2538 89
102 3300048904 Ga0496101_0095311 Ga0496101_0095311_986_1267 89
103 3300048904 Ga0496101_1318884 Ga0496101_1318884_27_308 89
104 3300048905 Ga0496102_0124870 Ga0496102_0124870_110_391 89
105 3300048905 Ga0496102_0135736 Ga0496102_0135736_1191_1472 89
106 3300048907 Ga0496104_0010231 Ga0496104_0010231_1840_2121 89
107 3300048907 Ga0496104_0080428 Ga0496104_0080428_2149_2430 89
108 3300048908 Ga0496105_0147973 Ga0496105_0147973_626_907 89
109 3300048909 Ga0496106_0012233 Ga0496106_0012233_5778_6059 89
110 3300048910 Ga0496107_0258404 Ga0496107_0258404_461_742 89
111 3300048911 Ga0496108_0002318 Ga0496108_0002318_2282_2563 89
112 3300048911 Ga0496108_0033301 Ga0496108_0033301_1441_1722 89
113 3300048911 Ga0496108_0278659 Ga0496108_0278659_993_1286 89
114 3300048912 Ga0496109_0000757 Ga0496109_0000757_3722_4003 89
115 3300048912 Ga0496109_0060451 Ga0496109_0060451_1608_1889 89
116 3300048913 Ga0496110_0000630 Ga0496110_0000630_21597_21878 89
117 3300048913 Ga0496110_0100084 Ga0496110_0100084_419_700 89
118 3300048914 Ga0496111_0018084 Ga0496111_0018084_2365_2646 89
119 3300048914 Ga0496111_0174935 Ga0496111_0174935_910_1191 89
120 3300048915 Ga0496112_0031510 Ga0496112_0031510_2673_2954 89
121 3300048915 Ga0496112_0059519 Ga0496112_0059519_3277_3558 89
122 3300048915 Ga0496112_0098263 Ga0496112_0098263_292_573 89
123 3300048915 Ga0496112_0618573 Ga0496112_0618573_281_562 89
124 3300048916 Ga0496113_0017090 Ga0496113_0017090_2232_2513 89
125 3300048916 Ga0496113_0284274 Ga0496113_0284274_199_480 89
126 3300048917 Ga0496114_0070676 Ga0496114_0070676_2303_2584 89
127 3300048917 Ga0496114_0518202 Ga0496114_0518202_414_695 89
128 3300048918 Ga0496115_0739487 Ga0496115_0739487_175_456 89
129 3300049575 Ga0501039_0680880 Ga0501039_0680880_461_790 89
130 3300049582 Ga0501048_0320114 Ga0501048_0320114_510_839 89
131 3300049585 Ga0501069_0710559 Ga0501069_0710559_22_309 89
132 3300049592 Ga0501076_0755323 Ga0501076_0755323_23_319 89
133 3300049741 Ga0501079_0706836 Ga0501079_0706836_41_370 89
134 3300049743 Ga0501081_0999958 Ga0501081_0999958_84_413 89
135 3300050491 nmdc:mga00v17_449506_c1 nmdc:mga00v17_449506_c1_74_352 89
136 3300050492 nmdc:mga0yw44_726562_c1 nmdc:mga0yw44_726562_c1_272_550 89
137 3300059492 Ga0587073_0319924 Ga0587073_0319924_151_432 89
138 3300013307 Ga0157372_10420739 Ga0157372_104207393 90
139 3300020081 Ga0206354_11362747 Ga0206354_113627471 90
140 3300020082 Ga0206353_10800325 Ga0206353_108003252 90
141 3300025914 Ga0207671_10003194 Ga0207671_100031948 90
142 3300044901 Ga0466960_1059276 Ga0466960_1059276_168_455 90
143 3300048909 Ga0496106_0695084 Ga0496106_0695084_498_779 90
144 3300048911 Ga0496108_1317119 Ga0496108_1317119_172_453 90
145 3300048915 Ga0496112_0140696 Ga0496112_0140696_18_299 90
146 3300048916 Ga0496113_1204680 Ga0496113_1204680_121_402 90
147 3300005434 Ga0070709_10159646 Ga0070709_101596461 91
148 3300005437 Ga0070710_10072659 Ga0070710_100726593 91
149 3300005439 Ga0070711_101542976 Ga0070711_1015429762 91
150 3300005456 Ga0070678_102189983 Ga0070678_1021899831 91
151 3300005545 Ga0070695_100930995 Ga0070695_1009309952 91
152 3300006028 Ga0070717_10766660 Ga0070717_107666602 91
153 3300006175 Ga0070712_100000050 Ga0070712_10000005036 91
154 3300006175 Ga0070712_100231458 Ga0070712_1002314583 91
155 3300006914 Ga0075436_101544708 Ga0075436_1015447082 91
156 3300009545 Ga0105237_12726160 Ga0105237_127261601 91
157 3300014325 Ga0163163_12977000 Ga0163163_129770001 91
158 3300021358 Ga0213873_10041941 Ga0213873_100419414 91
159 3300021377 Ga0213874_10018585 Ga0213874_100185851 91
160 3300021384 Ga0213876_10003709 Ga0213876_100037097 91
161 3300021384 Ga0213876_10007820 Ga0213876_100078209 91
162 3300021384 Ga0213876_10014352 Ga0213876_100143525 91
163 3300021384 Ga0213876_10073210 Ga0213876_100732104 91
164 3300021384 Ga0213876_10277713 Ga0213876_102777133 91
165 3300021388 Ga0213875_10014955 Ga0213875_100149558 91
166 3300021388 Ga0213875_10041759 Ga0213875_100417591 91
167 3300021388 Ga0213875_10058999 Ga0213875_100589992 91
168 3300021388 Ga0213875_10473011 Ga0213875_104730111 91
169 3300025898 Ga0207692_10065462 Ga0207692_100654622 91
170 3300025906 Ga0207699_10202180 Ga0207699_102021803 91
171 3300025915 Ga0207693_10000151 Ga0207693_1000015135 91
172 3300025915 Ga0207693_10732879 Ga0207693_107328792 91
173 3300025916 Ga0207663_10458954 Ga0207663_104589542 91
174 3300025929 Ga0207664_10493781 Ga0207664_104937811 91
175 3300028556 Ga0265337_1018502 Ga0265337_10185023 91
176 3300028558 Ga0265326_10015531 Ga0265326_100155312 91
177 3300028563 Ga0265319_1000147 Ga0265319_100014745 91
178 3300028563 Ga0265319_1257873 Ga0265319_12578732 91
179 3300028573 Ga0265334_10049903 Ga0265334_100499033 91
180 3300028577 Ga0265318_10003281 Ga0265318_100032817 91
181 3300028666 Ga0265336_10000004 Ga0265336_1000000412 91
182 3300028800 Ga0265338_10000012 Ga0265338_10000012417 91
183 3300030877 Ga0265777_123614 Ga0265777_1236142 91
184 3300030879 Ga0265765_1031362 Ga0265765_10313622 91
185 3300031247 Ga0265340_10000001 Ga0265340_100000011211 91
186 3300031251 Ga0265327_10024549 Ga0265327_100245494 91
187 3300031344 Ga0265316_10122406 Ga0265316_101224063 91
188 3300031711 Ga0265314_10469534 Ga0265314_104695342 91
189 3300031712 Ga0265342_10240145 Ga0265342_102401452 91
190 3300037853 Ga0436364_0069035 Ga0436364_0069035_377_676 91
191 3300037853 Ga0436364_0083442 Ga0436364_0083442_12378_12680 91
192 3300037853 Ga0436364_0143594 Ga0436364_0143594_398_700 91
193 3300037853 Ga0436364_0253679 Ga0436364_0253679_28794_29102 91
194 3300037853 Ga0436364_0696536 Ga0436364_0696536_364_672 91
195 3300037853 Ga0436364_0711358 Ga0436364_0711358_99_407 91
196 3300037853 Ga0436364_1236778 Ga0436364_1236778_151_450 91
197 3300037853 Ga0436364_1506247 Ga0436364_1506247_4267_4566 91
198 3300039437 Ga0436365_0047645 Ga0436365_0047645_399_707 91
199 3300039437 Ga0436365_0300577 Ga0436365_0300577_5804_6106 91
200 3300039437 Ga0436365_0644636 Ga0436365_0644636_1068_1376 91
201 3300039437 Ga0436365_0914767 Ga0436365_0914767_42_332 91
202 3300039437 Ga0436365_1188153 Ga0436365_1188153_15141_15449 91
203 3300039447 Ga0436361_1073365 Ga0436361_1073365_1137_1448 91
204 3300039450 Ga0436363_0202603 Ga0436363_0202603_1042_1350 91
205 3300039450 Ga0436363_0702773 Ga0436363_0702773_916_1224 91
206 3300039450 Ga0436363_0771235 Ga0436363_0771235_867_1175 91
207 3300039450 Ga0436363_0991270 Ga0436363_0991270_624_923 91
208 3300039450 Ga0436363_1384290 Ga0436363_1384290_1301_1609 91
209 3300039450 Ga0436363_1523944 Ga0436363_1523944_1482_1790 91
210 3300039453 Ga0436362_0786700 Ga0436362_0786700_793_1101 91
211 3300039453 Ga0436362_0791856 Ga0436362_0791856_463_771 91
212 3300044684 Ga0466966_0239222 Ga0466966_0239222_610_900 91
213 3300044684 Ga0466966_0725518 Ga0466966_0725518_177_488 91
214 3300044693 Ga0466961_0098052 Ga0466961_0098052_1412_1717 91
215 3300044693 Ga0466961_0101439 Ga0466961_0101439_660_971 91
216 3300044693 Ga0466961_0768401 Ga0466961_0768401_32_322 91
217 3300044694 Ga0466963_0011113 Ga0466963_0011113_5024_5335 91
218 3300044694 Ga0466963_0033768 Ga0466963_0033768_2154_2438 91
219 3300044694 Ga0466963_0405309 Ga0466963_0405309_484_792 91
220 3300044694 Ga0466963_0949701 Ga0466963_0949701_71_385 91
221 3300044694 Ga0466963_0959413 Ga0466963_0959413_103_399 91
222 3300044694 Ga0466963_1042400 Ga0466963_1042400_221_538 91
223 3300044719 Ga0466971_0341886 Ga0466971_0341886_185_487 91
224 3300044735 Ga0466968_0045560 Ga0466968_0045560_1126_1425 91
225 3300044765 Ga0466970_0120321 Ga0466970_0120321_569_859 91
226 3300044765 Ga0466970_0602189 Ga0466970_0602189_68_379 91
227 3300044765 Ga0466970_0902112 Ga0466970_0902112_130_429 91
228 3300044842 Ga0466957_0847608 Ga0466957_0847608_208_519 91
229 3300044901 Ga0466960_0951418 Ga0466960_0951418_110_391 91
230 3300045049 Ga0466959_0068304 Ga0466959_0068304_129_440 91
231 3300045049 Ga0466959_0136602 Ga0466959_0136602_968_1258 91
232 3300045049 Ga0466959_0175035 Ga0466959_0175035_257_559 91
233 3300045049 Ga0466959_0878112 Ga0466959_0878112_20_325 91
234 3300045836 Ga0466958_0010792 Ga0466958_0010792_2256_2567 91
235 3300045836 Ga0466958_0645792 Ga0466958_0645792_330_632 91
236 3300045836 Ga0466958_1057031 Ga0466958_1057031_38_322 91
237 3300045976 Ga0466967_0060637 Ga0466967_0060637_163_471 91
238 3300046462 Ga0495651_0673594 Ga0495651_0673594_73_366 91
239 3300046463 Ga0495653_0001695 Ga0495653_0001695_2834_3115 91
240 3300046511 Ga0495608_0225185 Ga0495608_0225185_84_377 91
241 3300046515 Ga0495620_0056131 Ga0495620_0056131_992_1303 91
242 3300046517 Ga0495630_1475543 Ga0495630_1475543_176_484 91
243 3300046529 Ga0495652_0404348 Ga0495652_0404348_418_729 91
244 3300046538 Ga0495609_0143532 Ga0495609_0143532_87_398 91
245 3300046683 Ga0495658_0373348 Ga0495658_0373348_344_637 91
246 3300048903 Ga0496100_0002493 Ga0496100_0002493_1868_2161 91
247 3300048906 Ga0496103_0143445 Ga0496103_0143445_853_1194 91
248 3300048907 Ga0496104_0265996 Ga0496104_0265996_891_1184 91
249 3300048910 Ga0496107_1097481 Ga0496107_1097481_258_551 91
250 3300048914 Ga0496111_0842689 Ga0496111_0842689_330_623 91
251 3300048918 Ga0496115_0000680 Ga0496115_0000680_331_621 91
252 3300048925 Ga0496122_0155324 Ga0496122_0155324_893_1183 91
253 3300053077 Ga0495601_0007254 Ga0495601_0007254_4932_5213 91
254 3300053077 Ga0495601_0468977 Ga0495601_0468977_306_617 91
255 3300053085 Ga0495619_1116297 Ga0495619_1116297_113_409 91
256 3300061719 Ga0466962_0448288 Ga0466962_0448288_185_469 91
257 3300005435 Ga0070714_100689243 Ga0070714_1006892432 92
258 3300005468 Ga0070707_100976409 Ga0070707_1009764091 92
259 3300021377 Ga0213874_10156658 Ga0213874_101566582 92
260 3300025898 Ga0207692_10655782 Ga0207692_106557823 92
261 3300025922 Ga0207646_10848867 Ga0207646_108488672 92
262 3300025928 Ga0207700_10613221 Ga0207700_106132211 92
263 3300025929 Ga0207664_11431398 Ga0207664_114313981 92
264 3300025939 Ga0207665_11436162 Ga0207665_114361622 92
265 3300038443 Ga0395901_0216600 Ga0395901_0216600_27_314 92
266 3300039450 Ga0436363_0115300 Ga0436363_0115300_1223_1522 92
267 3300044693 Ga0466961_0038116 Ga0466961_0038116_891_1199 92
268 3300044694 Ga0466963_0660745 Ga0466963_0660745_139_438 92
269 3300045049 Ga0466959_0148462 Ga0466959_0148462_108_416 92
270 3300045836 Ga0466958_0101731 Ga0466958_0101731_361_669 92
271 3300045976 Ga0466967_0702264 Ga0466967_0702264_496_777 92
272 3300045976 Ga0466967_1667427 Ga0466967_1667427_74_373 92
273 3300045976 Ga0466967_2027541 Ga0466967_2027541_20_322 92
274 3300046514 Ga0495618_0000149 Ga0495618_0000149_40324_40626 92
275 3300046517 Ga0495630_0000182 Ga0495630_0000182_29635_29943 92
276 3300046543 Ga0495645_0000181 Ga0495645_0000181_37433_37717 92
277 3300046675 Ga0495657_0000213 Ga0495657_0000213_33241_33549 92
278 3300048905 Ga0496102_1100917 Ga0496102_1100917_413_700 92
279 3300048912 Ga0496109_0214678 Ga0496109_0214678_984_1283 92
280 3300053078 Ga0495612_0000057 Ga0495612_0000057_32815_33120 92
281 3300005328 Ga0070676_10668009 Ga0070676_106680092 93
282 3300005334 Ga0068869_100126415 Ga0068869_1001264152 93
283 3300005334 Ga0068869_101530324 Ga0068869_1015303242 93
284 3300005339 Ga0070660_100062883 Ga0070660_1000628832 93
285 3300005339 Ga0070660_100756855 Ga0070660_1007568553 93
286 3300005339 Ga0070660_101755487 Ga0070660_1017554871 93
287 3300005341 Ga0070691_10416026 Ga0070691_104160262 93
288 3300005344 Ga0070661_100415333 Ga0070661_1004153333 93
289 3300005347 Ga0070668_100009317 Ga0070668_1000093171 93
290 3300005354 Ga0070675_100725845 Ga0070675_1007258451 93
291 3300005356 Ga0070674_100081739 Ga0070674_1000817392 93
292 3300005366 Ga0070659_101261614 Ga0070659_1012616141 93
293 3300005455 Ga0070663_100328115 Ga0070663_1003281151 93
294 3300005457 Ga0070662_100155907 Ga0070662_1001559072 93
295 3300005535 Ga0070684_100440613 Ga0070684_1004406132 93
296 3300005535 Ga0070684_100913694 Ga0070684_1009136941 93
297 3300005564 Ga0070664_100347314 Ga0070664_1003473144 93
298 3300005577 Ga0068857_100202462 Ga0068857_1002024624 93
299 3300005618 Ga0068864_102643525 Ga0068864_1026435251 93
300 3300005719 Ga0068861_100163036 Ga0068861_1001630362 93
301 3300005841 Ga0068863_100607301 Ga0068863_1006073014 93
302 3300005937 Ga0081455_10328824 Ga0081455_103288242 93
303 3300005981 Ga0081538_10005959 Ga0081538_100059596 93
304 3300005981 Ga0081538_10039395 Ga0081538_100393954 93
305 3300005981 Ga0081538_10108952 Ga0081538_101089523 93
306 3300006173 Ga0070716_100186428 Ga0070716_1001864283 93
307 3300006175 Ga0070712_100005314 Ga0070712_1000053144 93
308 3300006847 Ga0075431_101628941 Ga0075431_1016289412 93
309 3300009094 Ga0111539_10759020 Ga0111539_107590204 93
310 3300009098 Ga0105245_10186449 Ga0105245_101864496 93
311 3300009098 Ga0105245_11649917 Ga0105245_116499172 93
312 3300009148 Ga0105243_10112983 Ga0105243_101129832 93
313 3300009176 Ga0105242_10647438 Ga0105242_106474383 93
314 3300009545 Ga0105237_10940816 Ga0105237_109408162 93
315 3300009551 Ga0105238_11473074 Ga0105238_114730742 93
316 3300009553 Ga0105249_11251769 Ga0105249_112517692 93
317 3300010375 Ga0105239_10772591 Ga0105239_107725914 93
318 3300010375 Ga0105239_12148879 Ga0105239_121488792 93
319 3300011119 Ga0105246_11536054 Ga0105246_115360542 93
320 3300011119 Ga0105246_11814375 Ga0105246_118143752 93
321 3300013102 Ga0157371_11181823 Ga0157371_111818232 93
322 3300014325 Ga0163163_10255761 Ga0163163_102557612 93
323 3300014326 Ga0157380_12643295 Ga0157380_126432952 93
324 3300025901 Ga0207688_10170646 Ga0207688_101706462 93
325 3300025906 Ga0207699_10885595 Ga0207699_108855952 93
326 3300025907 Ga0207645_10430680 Ga0207645_104306802 93
327 3300025915 Ga0207693_10008924 Ga0207693_100089248 93
328 3300025916 Ga0207663_10313510 Ga0207663_103135103 93
329 3300025919 Ga0207657_10216511 Ga0207657_102165112 93
330 3300025919 Ga0207657_10305119 Ga0207657_103051192 93
331 3300025920 Ga0207649_10323696 Ga0207649_103236962 93
332 3300025927 Ga0207687_10313926 Ga0207687_103139262 93
333 3300025933 Ga0207706_10030392 Ga0207706_100303924 93
334 3300025937 Ga0207669_10449055 Ga0207669_104490552 93
335 3300025938 Ga0207704_11309152 Ga0207704_113091521 93
336 3300025941 Ga0207711_10566640 Ga0207711_105666402 93
337 3300025942 Ga0207689_10270215 Ga0207689_102702154 93
338 3300025944 Ga0207661_10107025 Ga0207661_101070254 93
339 3300025945 Ga0207679_10582222 Ga0207679_105822221 93
340 3300026023 Ga0207677_10316583 Ga0207677_103165832 93
341 3300026067 Ga0207678_10367638 Ga0207678_103676382 93
342 3300026089 Ga0207648_10654727 Ga0207648_106547272 93
343 3300026116 Ga0207674_10472681 Ga0207674_104726812 93
344 3300026118 Ga0207675_100102172 Ga0207675_1001021724 93
345 3300026142 Ga0207698_10189328 Ga0207698_101893282 93
346 3300031548 Ga0307408_100377914 Ga0307408_1003779142 93
347 3300031852 Ga0307410_10015235 Ga0307410_100152357 93
348 3300031903 Ga0307407_10080421 Ga0307407_100804212 93
349 3300031911 Ga0307412_10093308 Ga0307412_100933083 93
350 3300031995 Ga0307409_100144232 Ga0307409_1001442324 93
351 3300032002 Ga0307416_100116805 Ga0307416_1001168052 93
352 3300032005 Ga0307411_11198637 Ga0307411_111986372 93
353 3300032126 Ga0307415_100242201 Ga0307415_1002422012 93
354 3300041491 Ga0451833_0898710 Ga0451833_0898710_454_750 93
355 3300044683 Ga0466965_0379640 Ga0466965_0379640_109_393 93
356 3300044694 Ga0466963_0242055 Ga0466963_0242055_435_719 93
357 3300045049 Ga0466959_0197771 Ga0466959_0197771_164_475 93
358 3300045976 Ga0466967_0184093 Ga0466967_0184093_1108_1392 93
359 3300045976 Ga0466967_1070291 Ga0466967_1070291_258_542 93
360 3300048903 Ga0496100_0000650 Ga0496100_0000650_4647_4955 93
361 3300048904 Ga0496101_0002222 Ga0496101_0002222_4882_5190 93
362 3300048912 Ga0496109_0682075 Ga0496109_0682075_593_877 93
363 3300048912 Ga0496109_0927063 Ga0496109_0927063_277_561 93
364 3300048913 Ga0496110_0168645 Ga0496110_0168645_1282_1566 93
365 3300048914 Ga0496111_0508290 Ga0496111_0508290_159_467 93
366 3300048915 Ga0496112_0576116 Ga0496112_0576116_256_540 93
367 3300048915 Ga0496112_1110581 Ga0496112_1110581_316_600 93
368 3300048916 Ga0496113_0936555 Ga0496113_0936555_316_600 93
369 3300049649 Ga0501198_078525 Ga0501198_078525_153_437 93
370 3300050511 nmdc:mga08y16_463984_c1 nmdc:mga08y16_463984_c1_238_522 93
371 3300061719 Ga0466962_0597895 Ga0466962_0597895_32_316 93
372 2149837012 _GD4IA4401A3XHU LJQ_0955.00000100 94
373 3300001991 JGI24743J22301_10143661 JGI24743J22301_101436612 94
374 3300003308 Ga0006777J48905_1111430 Ga0006777J48905_11114302 94
375 3300003568 Ga0006781J51513_1011970 Ga0006781J51513_10119702 94
376 3300003568 Ga0006781J51513_1028949 Ga0006781J51513_10289492 94
377 3300003575 Ga0007409J51694_1045270 Ga0007409J51694_10452701 94
378 3300003577 Ga0007416J51690_1096729 Ga0007416J51690_10967291 94
379 3300003579 Ga0007429J51699_1035403 Ga0007429J51699_10354032 94
380 3300003579 Ga0007429J51699_1040535 Ga0007429J51699_10405352 94
381 3300003693 Ga0032354_1047956 Ga0032354_10479562 94
382 3300004785 Ga0058858_1310944 Ga0058858_13109441 94
383 3300004800 Ga0058861_11833874 Ga0058861_118338742 94
384 3300005327 Ga0070658_10631770 Ga0070658_106317702 94
385 3300005327 Ga0070658_11911632 Ga0070658_119116321 94
386 3300005328 Ga0070676_10792425 Ga0070676_107924251 94
387 3300005329 Ga0070683_100580273 Ga0070683_1005802733 94
388 3300005329 Ga0070683_101080481 Ga0070683_1010804812 94
389 3300005329 Ga0070683_101941040 Ga0070683_1019410402 94
390 3300005330 Ga0070690_100238365 Ga0070690_1002383652 94
391 3300005331 Ga0070670_100751674 Ga0070670_1007516742 94
392 3300005333 Ga0070677_10584891 Ga0070677_105848911 94
393 3300005334 Ga0068869_100992120 Ga0068869_1009921202 94
394 3300005337 Ga0070682_100078491 Ga0070682_1000784912 94
395 3300005337 Ga0070682_100362283 Ga0070682_1003622832 94
396 3300005337 Ga0070682_100363563 Ga0070682_1003635633 94
397 3300005338 Ga0068868_100288252 Ga0068868_1002882523 94
398 3300005338 Ga0068868_100512834 Ga0068868_1005128343 94
399 3300005338 Ga0068868_100834889 Ga0068868_1008348891 94
400 3300005338 Ga0068868_102116808 Ga0068868_1021168081 94
401 3300005339 Ga0070660_101286061 Ga0070660_1012860611 94
402 3300005341 Ga0070691_10121148 Ga0070691_101211482 94
403 3300005343 Ga0070687_100215026 Ga0070687_1002150261 94
404 3300005343 Ga0070687_100557317 Ga0070687_1005573171 94
405 3300005343 Ga0070687_101031909 Ga0070687_1010319092 94
406 3300005344 Ga0070661_100114771 Ga0070661_1001147715 94
407 3300005344 Ga0070661_101301942 Ga0070661_1013019422 94
408 3300005345 Ga0070692_10006061 Ga0070692_100060615 94
409 3300005345 Ga0070692_10131587 Ga0070692_101315872 94
410 3300005345 Ga0070692_10454149 Ga0070692_104541492 94
411 3300005347 Ga0070668_100393005 Ga0070668_1003930051 94
412 3300005353 Ga0070669_100019002 Ga0070669_1000190022 94
413 3300005353 Ga0070669_100123071 Ga0070669_1001230714 94
414 3300005353 Ga0070669_100260043 Ga0070669_1002600432 94
415 3300005355 Ga0070671_100517563 Ga0070671_1005175632 94
416 3300005355 Ga0070671_102088493 Ga0070671_1020884932 94
417 3300005356 Ga0070674_100126134 Ga0070674_1001261344 94
418 3300005356 Ga0070674_101185433 Ga0070674_1011854331 94
419 3300005364 Ga0070673_100651938 Ga0070673_1006519381 94
420 3300005366 Ga0070659_100000132 Ga0070659_10000013232 94
421 3300005366 Ga0070659_100697675 Ga0070659_1006976751 94
422 3300005366 Ga0070659_101196954 Ga0070659_1011969541 94
423 3300005367 Ga0070667_102252154 Ga0070667_1022521541 94
424 3300005435 Ga0070714_100036859 Ga0070714_1000368596 94
425 3300005435 Ga0070714_101165883 Ga0070714_1011658832 94
426 3300005435 Ga0070714_102512313 Ga0070714_1025123131 94
427 3300005437 Ga0070710_10000015 Ga0070710_1000001531 94
428 3300005438 Ga0070701_11112316 Ga0070701_111123162 94
429 3300005440 Ga0070705_100000870 Ga0070705_1000008707 94
430 3300005441 Ga0070700_100203413 Ga0070700_1002034132 94
431 3300005441 Ga0070700_100428098 Ga0070700_1004280982 94
432 3300005441 Ga0070700_100441879 Ga0070700_1004418792 94
433 3300005441 Ga0070700_100742331 Ga0070700_1007423312 94
434 3300005444 Ga0070694_101020497 Ga0070694_1010204972 94
435 3300005455 Ga0070663_100378738 Ga0070663_1003787382 94
436 3300005455 Ga0070663_100718233 Ga0070663_1007182332 94
437 3300005455 Ga0070663_101422804 Ga0070663_1014228042 94
438 3300005456 Ga0070678_100512875 Ga0070678_1005128752 94
439 3300005456 Ga0070678_101264686 Ga0070678_1012646862 94
440 3300005456 Ga0070678_101648816 Ga0070678_1016488161 94
441 3300005456 Ga0070678_102278535 Ga0070678_1022785351 94
442 3300005457 Ga0070662_100192532 Ga0070662_1001925324 94
443 3300005457 Ga0070662_100423397 Ga0070662_1004233972 94
444 3300005457 Ga0070662_100604428 Ga0070662_1006044282 94
445 3300005458 Ga0070681_10231584 Ga0070681_102315843 94
446 3300005459 Ga0068867_100062732 Ga0068867_1000627326 94
447 3300005459 Ga0068867_100132843 Ga0068867_1001328434 94
448 3300005459 Ga0068867_100649339 Ga0068867_1006493392 94
449 3300005459 Ga0068867_101022725 Ga0068867_1010227251 94
450 3300005459 Ga0068867_101116497 Ga0068867_1011164971 94
451 3300005466 Ga0070685_10147419 Ga0070685_101474194 94
452 3300005466 Ga0070685_10377747 Ga0070685_103777472 94
453 3300005518 Ga0070699_101171855 Ga0070699_1011718551 94
454 3300005530 Ga0070679_100465416 Ga0070679_1004654162 94
455 3300005535 Ga0070684_100052037 Ga0070684_1000520374 94
456 3300005535 Ga0070684_100330197 Ga0070684_1003301974 94
457 3300005535 Ga0070684_100380680 Ga0070684_1003806802 94
458 3300005535 Ga0070684_101155906 Ga0070684_1011559061 94
459 3300005539 Ga0068853_100363500 Ga0068853_1003635002 94
460 3300005543 Ga0070672_100180153 Ga0070672_1001801533 94
461 3300005543 Ga0070672_100677811 Ga0070672_1006778112 94
462 3300005543 Ga0070672_101203469 Ga0070672_1012034692 94
463 3300005544 Ga0070686_100688889 Ga0070686_1006888891 94
464 3300005546 Ga0070696_101462389 Ga0070696_1014623892 94
465 3300005547 Ga0070693_100303082 Ga0070693_1003030822 94
466 3300005548 Ga0070665_100976063 Ga0070665_1009760633 94
467 3300005549 Ga0070704_100424783 Ga0070704_1004247833 94
468 3300005564 Ga0070664_100140859 Ga0070664_1001408596 94
469 3300005564 Ga0070664_100441651 Ga0070664_1004416512 94
470 3300005564 Ga0070664_101515251 Ga0070664_1015152512 94
471 3300005564 Ga0070664_101995701 Ga0070664_1019957012 94
472 3300005578 Ga0068854_100299802 Ga0068854_1002998021 94
473 3300005615 Ga0070702_100066914 Ga0070702_1000669142 94
474 3300005615 Ga0070702_100393994 Ga0070702_1003939941 94
475 3300005616 Ga0068852_101338922 Ga0068852_1013389222 94
476 3300005616 Ga0068852_102553635 Ga0068852_1025536352 94
477 3300005617 Ga0068859_100582315 Ga0068859_1005823152 94
478 3300005618 Ga0068864_100080512 Ga0068864_1000805125 94
479 3300005618 Ga0068864_100573671 Ga0068864_1005736713 94
480 3300005618 Ga0068864_100636263 Ga0068864_1006362634 94
481 3300005718 Ga0068866_10193882 Ga0068866_101938822 94
482 3300005719 Ga0068861_100056451 Ga0068861_1000564516 94
483 3300005719 Ga0068861_100270455 Ga0068861_1002704553 94
484 3300005719 Ga0068861_100376757 Ga0068861_1003767572 94
485 3300005834 Ga0068851_10120789 Ga0068851_101207892 94
486 3300005834 Ga0068851_10284994 Ga0068851_102849942 94
487 3300005840 Ga0068870_10162962 Ga0068870_101629624 94
488 3300005840 Ga0068870_10432294 Ga0068870_104322942 94
489 3300005842 Ga0068858_100350611 Ga0068858_1003506112 94
490 3300005842 Ga0068858_100573021 Ga0068858_1005730212 94
491 3300005843 Ga0068860_100920606 Ga0068860_1009206062 94
492 3300005844 Ga0068862_100627060 Ga0068862_1006270603 94
493 3300005844 Ga0068862_101120603 Ga0068862_1011206031 94
494 3300005937 Ga0081455_10242847 Ga0081455_102428472 94
495 3300006237 Ga0097621_100880548 Ga0097621_1008805482 94
496 3300006844 Ga0075428_100500182 Ga0075428_1005001822 94
497 3300006844 Ga0075428_101867641 Ga0075428_1018676412 94
498 3300006844 Ga0075428_102368142 Ga0075428_1023681422 94
499 3300006871 Ga0075434_100681937 Ga0075434_1006819372 94
500 3300006871 Ga0075434_101036197 Ga0075434_1010361973 94
501 3300006880 Ga0075429_100014611 Ga0075429_1000146115 94
502 3300006881 Ga0068865_100051211 Ga0068865_1000512113 94
503 3300006881 Ga0068865_100156795 Ga0068865_1001567951 94
504 3300006881 Ga0068865_100630702 Ga0068865_1006307024 94
505 3300006881 Ga0068865_100987428 Ga0068865_1009874282 94
506 3300006914 Ga0075436_100226694 Ga0075436_1002266943 94
507 3300006931 Ga0097620_100582335 Ga0097620_1005823352 94
508 3300007076 Ga0075435_101897065 Ga0075435_1018970651 94
509 3300009093 Ga0105240_10151435 Ga0105240_101514354 94
510 3300009094 Ga0111539_10721274 Ga0111539_107212743 94
511 3300009094 Ga0111539_11060218 Ga0111539_110602182 94
512 3300009098 Ga0105245_10046340 Ga0105245_100463402 94
513 3300009098 Ga0105245_10314713 Ga0105245_103147131 94
514 3300009098 Ga0105245_10834036 Ga0105245_108340362 94
515 3300009098 Ga0105245_12736864 Ga0105245_127368641 94
516 3300009101 Ga0105247_10459527 Ga0105247_104595272 94
517 3300009147 Ga0114129_11668578 Ga0114129_116685781 94
518 3300009147 Ga0114129_13297100 Ga0114129_132971001 94
519 3300009148 Ga0105243_10058843 Ga0105243_100588437 94
520 3300009148 Ga0105243_10177918 Ga0105243_101779184 94
521 3300009148 Ga0105243_10284846 Ga0105243_102848464 94
522 3300009148 Ga0105243_10873284 Ga0105243_108732842 94
523 3300009148 Ga0105243_11187441 Ga0105243_111874412 94
524 3300009176 Ga0105242_12389713 Ga0105242_123897132 94
525 3300009176 Ga0105242_12432958 Ga0105242_124329581 94
526 3300009553 Ga0105249_10139754 Ga0105249_101397543 94
527 3300009553 Ga0105249_11078219 Ga0105249_110782192 94
528 3300009553 Ga0105249_11091829 Ga0105249_110918292 94
529 3300009553 Ga0105249_11408934 Ga0105249_114089342 94
530 3300010375 Ga0105239_10233083 Ga0105239_102330832 94
531 3300010375 Ga0105239_10594287 Ga0105239_105942874 94
532 3300010375 Ga0105239_11922601 Ga0105239_119226011 94
533 3300010375 Ga0105239_13245451 Ga0105239_132454512 94
534 3300011119 Ga0105246_10023374 Ga0105246_100233746 94
535 3300011119 Ga0105246_10233122 Ga0105246_102331223 94
536 3300011119 Ga0105246_10968446 Ga0105246_109684461 94
537 3300011119 Ga0105246_11065201 Ga0105246_110652012 94
538 3300013102 Ga0157371_10284213 Ga0157371_102842132 94
539 3300013306 Ga0163162_10500585 Ga0163162_105005852 94
540 3300013307 Ga0157372_10490485 Ga0157372_104904852 94
541 3300013307 Ga0157372_10739756 Ga0157372_107397562 94
542 3300014326 Ga0157380_10435996 Ga0157380_104359963 94
543 3300014326 Ga0157380_10594023 Ga0157380_105940232 94
544 3300014326 Ga0157380_10717023 Ga0157380_107170232 94
545 3300014326 Ga0157380_11610236 Ga0157380_116102362 94
546 3300014326 Ga0157380_12935800 Ga0157380_129358002 94
547 3300014497 Ga0182008_10287607 Ga0182008_102876072 94
548 3300014745 Ga0157377_10250499 Ga0157377_102504992 94
549 3300014745 Ga0157377_10380456 Ga0157377_103804562 94
550 3300014745 Ga0157377_11350959 Ga0157377_113509592 94
551 3300014968 Ga0157379_11840792 Ga0157379_118407922 94
552 3300020080 Ga0206350_11164447 Ga0206350_111644472 94
553 3300020080 Ga0206350_11482167 Ga0206350_114821672 94
554 3300020610 Ga0154015_1115475 Ga0154015_11154751 94
555 3300020610 Ga0154015_1516197 Ga0154015_15161972 94
556 3300025898 Ga0207692_10000013 Ga0207692_1000001368 94
557 3300025899 Ga0207642_10076269 Ga0207642_100762692 94
558 3300025901 Ga0207688_10333832 Ga0207688_103338322 94
559 3300025901 Ga0207688_10344447 Ga0207688_103444472 94
560 3300025901 Ga0207688_10361112 Ga0207688_103611122 94
561 3300025901 Ga0207688_10427849 Ga0207688_104278492 94
562 3300025903 Ga0207680_10856616 Ga0207680_108566163 94
563 3300025907 Ga0207645_10112564 Ga0207645_101125642 94
564 3300025908 Ga0207643_10284500 Ga0207643_102845002 94
565 3300025908 Ga0207643_10518784 Ga0207643_105187842 94
566 3300025909 Ga0207705_10547475 Ga0207705_105474752 94
567 3300025912 Ga0207707_10284321 Ga0207707_102843212 94
568 3300025913 Ga0207695_10113274 Ga0207695_101132742 94
569 3300025918 Ga0207662_10136404 Ga0207662_101364041 94
570 3300025920 Ga0207649_10132712 Ga0207649_101327121 94
571 3300025920 Ga0207649_10803619 Ga0207649_108036191 94
572 3300025920 Ga0207649_11372976 Ga0207649_113729762 94
573 3300025923 Ga0207681_10003336 Ga0207681_100033365 94
574 3300025923 Ga0207681_10287351 Ga0207681_102873512 94
575 3300025925 Ga0207650_10944823 Ga0207650_109448232 94
576 3300025926 Ga0207659_10822432 Ga0207659_108224322 94
577 3300025927 Ga0207687_10208186 Ga0207687_102081863 94
578 3300025927 Ga0207687_10533650 Ga0207687_105336504 94
579 3300025927 Ga0207687_10617331 Ga0207687_106173313 94
580 3300025929 Ga0207664_10000331 Ga0207664_1000033130 94
581 3300025929 Ga0207664_10005338 Ga0207664_1000533811 94
582 3300025929 Ga0207664_11883171 Ga0207664_118831711 94
583 3300025932 Ga0207690_10000075 Ga0207690_1000007511 94
584 3300025932 Ga0207690_11154395 Ga0207690_111543952 94
585 3300025932 Ga0207690_11661987 Ga0207690_116619872 94
586 3300025933 Ga0207706_10414635 Ga0207706_104146354 94
587 3300025934 Ga0207686_10641335 Ga0207686_106413351 94
588 3300025934 Ga0207686_11438443 Ga0207686_114384431 94
589 3300025935 Ga0207709_10034617 Ga0207709_100346176 94
590 3300025935 Ga0207709_10052158 Ga0207709_100521587 94
591 3300025935 Ga0207709_10202100 Ga0207709_102021004 94
592 3300025935 Ga0207709_10679633 Ga0207709_106796332 94
593 3300025937 Ga0207669_10679593 Ga0207669_106795932 94
594 3300025937 Ga0207669_10865200 Ga0207669_108652002 94
595 3300025937 Ga0207669_11455513 Ga0207669_114555131 94
596 3300025938 Ga0207704_10032117 Ga0207704_100321173 94
597 3300025938 Ga0207704_10181495 Ga0207704_101814954 94
598 3300025938 Ga0207704_10669427 Ga0207704_106694272 94
599 3300025940 Ga0207691_10153831 Ga0207691_101538314 94
600 3300025942 Ga0207689_10582832 Ga0207689_105828323 94
601 3300025944 Ga0207661_10014965 Ga0207661_100149656 94
602 3300025944 Ga0207661_10171655 Ga0207661_101716556 94
603 3300025944 Ga0207661_10284218 Ga0207661_102842183 94
604 3300025944 Ga0207661_10861347 Ga0207661_108613472 94
605 3300025944 Ga0207661_10876172 Ga0207661_108761723 94
606 3300025945 Ga0207679_10231580 Ga0207679_102315804 94
607 3300025945 Ga0207679_10379518 Ga0207679_103795182 94
608 3300025945 Ga0207679_10699890 Ga0207679_106998902 94
609 3300025945 Ga0207679_11496555 Ga0207679_114965552 94
610 3300025960 Ga0207651_11004114 Ga0207651_110041142 94
611 3300025961 Ga0207712_10574550 Ga0207712_105745502 94
612 3300025972 Ga0207668_10401469 Ga0207668_104014694 94
613 3300025981 Ga0207640_10566785 Ga0207640_105667853 94
614 3300025986 Ga0207658_11139563 Ga0207658_111395631 94
615 3300026023 Ga0207677_10122676 Ga0207677_101226762 94
616 3300026023 Ga0207677_10291079 Ga0207677_102910792 94
617 3300026023 Ga0207677_10738834 Ga0207677_107388342 94
618 3300026023 Ga0207677_11792327 Ga0207677_117923272 94
619 3300026035 Ga0207703_10968933 Ga0207703_109689332 94
620 3300026041 Ga0207639_11524487 Ga0207639_115244872 94
621 3300026067 Ga0207678_10279433 Ga0207678_102794333 94
622 3300026067 Ga0207678_10475697 Ga0207678_104756972 94
623 3300026075 Ga0207708_10000878 Ga0207708_100008782 94
624 3300026075 Ga0207708_10219419 Ga0207708_102194192 94
625 3300026075 Ga0207708_10480163 Ga0207708_104801631 94
626 3300026075 Ga0207708_10922232 Ga0207708_109222322 94
627 3300026089 Ga0207648_10112472 Ga0207648_101124722 94
628 3300026089 Ga0207648_10142390 Ga0207648_101423902 94
629 3300026089 Ga0207648_10204040 Ga0207648_102040402 94
630 3300026089 Ga0207648_12150188 Ga0207648_121501881 94
631 3300026095 Ga0207676_10524474 Ga0207676_105244744 94
632 3300026095 Ga0207676_10694976 Ga0207676_106949762 94
633 3300026095 Ga0207676_10893744 Ga0207676_108937441 94
634 3300026118 Ga0207675_100158112 Ga0207675_1001581124 94
635 3300026118 Ga0207675_100169805 Ga0207675_1001698052 94
636 3300026118 Ga0207675_100237773 Ga0207675_1002377732 94
637 3300026121 Ga0207683_10498305 Ga0207683_104983054 94
638 3300026121 Ga0207683_10568260 Ga0207683_105682602 94
639 3300026142 Ga0207698_10479279 Ga0207698_104792792 94
640 3300026142 Ga0207698_10971009 Ga0207698_109710092 94
641 3300026142 Ga0207698_11017943 Ga0207698_110179432 94
642 3300026142 Ga0207698_11111563 Ga0207698_111115632 94
643 3300027907 Ga0207428_10569871 Ga0207428_105698712 94
644 3300028379 Ga0268266_10203971 Ga0268266_102039712 94
645 3300028380 Ga0268265_11182120 Ga0268265_111821202 94
646 3300028558 Ga0265326_10000023 Ga0265326_1000002356 94
647 3300028573 Ga0265334_10000135 Ga0265334_100001358 94
648 3300028573 Ga0265334_10170953 Ga0265334_101709532 94
649 3300028666 Ga0265336_10009601 Ga0265336_100096013 94
650 3300028800 Ga0265338_10000902 Ga0265338_1000090213 94
651 3300028800 Ga0265338_10216133 Ga0265338_102161333 94
652 3300029957 Ga0265324_10002787 Ga0265324_100027872 94
653 3300031240 Ga0265320_10091945 Ga0265320_100919452 94
654 3300031251 Ga0265327_10217830 Ga0265327_102178301 94
655 3300031548 Ga0307408_101042289 Ga0307408_1010422892 94
656 3300031711 Ga0265314_10091338 Ga0265314_100913382 94
657 3300031731 Ga0307405_11063814 Ga0307405_110638142 94
658 3300031824 Ga0307413_11240298 Ga0307413_112402982 94
659 3300031852 Ga0307410_10123587 Ga0307410_101235872 94
660 3300031852 Ga0307410_10358893 Ga0307410_103588933 94
661 3300031903 Ga0307407_10104721 Ga0307407_101047214 94
662 3300031903 Ga0307407_10629598 Ga0307407_106295981 94
663 3300031903 Ga0307407_10973942 Ga0307407_109739421 94
664 3300031911 Ga0307412_10419701 Ga0307412_104197013 94
665 3300031911 Ga0307412_10532219 Ga0307412_105322192 94
666 3300031911 Ga0307412_11595944 Ga0307412_115959442 94
667 3300031995 Ga0307409_100569943 Ga0307409_1005699433 94
668 3300031995 Ga0307409_100978965 Ga0307409_1009789651 94
669 3300031995 Ga0307409_101099425 Ga0307409_1010994252 94
670 3300031995 Ga0307409_101541596 Ga0307409_1015415962 94
671 3300031995 Ga0307409_102949935 Ga0307409_1029499351 94
672 3300032002 Ga0307416_100064502 Ga0307416_1000645023 94
673 3300032002 Ga0307416_100109289 Ga0307416_1001092892 94
674 3300032002 Ga0307416_100254575 Ga0307416_1002545753 94
675 3300032002 Ga0307416_100542396 Ga0307416_1005423962 94
676 3300032002 Ga0307416_100596589 Ga0307416_1005965891 94
677 3300032004 Ga0307414_10441703 Ga0307414_104417033 94
678 3300032126 Ga0307415_100004333 Ga0307415_1000043333 94
679 3300032126 Ga0307415_100063811 Ga0307415_1000638112 94
680 3300037312 Ga0395899_0922616 Ga0395899_0922616_202_489 94
681 3300038443 Ga0395901_1104003 Ga0395901_1104003_296_589 94
682 3300041512 Ga0451853_3353689 Ga0451853_3353689_616_903 94
683 3300042008 Ga0439450_040958 Ga0439450_040958_421_705 94
684 3300042011 Ga0439454_110961 Ga0439454_110961_221_505 94
685 3300042126 Ga0450888_033760 Ga0450888_033760_381_665 94
686 3300042137 Ga0450902_041476 Ga0450902_041476_189_473 94
687 3300042439 Ga0439464_0026506 Ga0439464_0026506_326_610 94
688 3300042993 Ga0439440_0173325 Ga0439440_0173325_150_434 94
689 3300044658 Ga0466972_0209235 Ga0466972_0209235_429_752 94
690 3300044693 Ga0466961_0479169 Ga0466961_0479169_217_510 94
691 3300044694 Ga0466963_0081636 Ga0466963_0081636_1618_1905 94
692 3300044694 Ga0466963_0343239 Ga0466963_0343239_107_394 94
693 3300044694 Ga0466963_0890961 Ga0466963_0890961_319_606 94
694 3300044706 Ga0466964_0014898 Ga0466964_0014898_960_1247 94
695 3300044706 Ga0466964_0361280 Ga0466964_0361280_11_298 94
696 3300044706 Ga0466964_0383124 Ga0466964_0383124_173_460 94
697 3300044765 Ga0466970_0252482 Ga0466970_0252482_456_785 94
698 3300044901 Ga0466960_0114928 Ga0466960_0114928_693_980 94
699 3300044901 Ga0466960_0263040 Ga0466960_0263040_304_591 94
700 3300044901 Ga0466960_0357698 Ga0466960_0357698_184_471 94
701 3300045049 Ga0466959_0060127 Ga0466959_0060127_2378_2707 94
702 3300045976 Ga0466967_0030588 Ga0466967_0030588_3818_4111 94
703 3300045976 Ga0466967_0034138 Ga0466967_0034138_3215_3502 94
704 3300045976 Ga0466967_0145748 Ga0466967_0145748_1633_1920 94
705 3300045976 Ga0466967_0570363 Ga0466967_0570363_188_475 94
706 3300045976 Ga0466967_1393236 Ga0466967_1393236_15_302 94
707 3300045976 Ga0466967_1654833 Ga0466967_1654833_299_586 94
708 3300046491 Ga0495584_0308504 Ga0495584_0308504_469_753 94
709 3300046538 Ga0495609_0377076 Ga0495609_0377076_60_344 94
710 3300047320 Ga0495672_0018594 Ga0495672_0018594_1740_2060 94
711 3300048905 Ga0496102_0547606 Ga0496102_0547606_583_867 94
712 3300048905 Ga0496102_0672192 Ga0496102_0672192_190_477 94
713 3300048909 Ga0496106_0065193 Ga0496106_0065193_197_481 94
714 3300048910 Ga0496107_0457202 Ga0496107_0457202_216_500 94
715 3300048910 Ga0496107_0481661 Ga0496107_0481661_182_466 94
716 3300048911 Ga0496108_0240798 Ga0496108_0240798_644_928 94
717 3300048912 Ga0496109_1163521 Ga0496109_1163521_266_550 94
718 3300048913 Ga0496110_0475068 Ga0496110_0475068_568_852 94
719 3300048915 Ga0496112_0000308 Ga0496112_0000308_3151_3465 94
720 3300048915 Ga0496112_1314997 Ga0496112_1314997_123_425 94
721 3300048916 Ga0496113_0043441 Ga0496113_0043441_2522_2845 94
722 3300048924 Ga0496121_0100779 Ga0496121_0100779_355_642 94
723 3300048929 Ga0496126_0475004 Ga0496126_0475004_13_300 94
724 3300049533 Ga0501317_105810 Ga0501317_105810_36_323 94
725 3300049534 Ga0501318_008980 Ga0501318_008980_441_725 94
726 3300049541 Ga0501325_049548 Ga0501325_049548_47_331 94
727 3300049574 Ga0501038_1076730 Ga0501038_1076730_163_453 94
728 3300049581 Ga0501047_0275459 Ga0501047_0275459_1066_1356 94
729 3300049663 Ga0501223_111771 Ga0501223_111771_54_338 94
730 3300050507 nmdc:mga05p37_695082_c1 nmdc:mga05p37_695082_c1_251_538 94
731 3300050508 nmdc:mga09592_10356_c1 nmdc:mga09592_10356_c1_2746_3072 94
732 3300050508 nmdc:mga09592_1043764_c1 nmdc:mga09592_1043764_c1_170_454 94
733 3300050510 nmdc:mga06r32_1495464_c1 nmdc:mga06r32_1495464_c1_243_530 94
734 3300050511 nmdc:mga08y16_610241_c1 nmdc:mga08y16_610241_c1_603_887 94
735 3300050513 nmdc:mga0rr50_1301770_c1 nmdc:mga0rr50_1301770_c1_96_440 94
736 3300050513 nmdc:mga0rr50_590773_c1 nmdc:mga0rr50_590773_c1_642_929 94
737 3300050513 nmdc:mga0rr50_595799_c1 nmdc:mga0rr50_595799_c1_67_393 94
738 3300053146 Ga0500588_0029025 Ga0500588_0029025_745_1032 94
739 3300059645 Ga0587076_152923 Ga0587076_152923_53_340 94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4s1z-assembly2.cif.gz_I crystal structure of trabid nzf1 in complex with k29 linked di-ubiquitin 0.8627 54 78
4s1z-assembly1.cif.gz_G crystal structure of trabid nzf1 in complex with k29 linked di-ubiquitin 0.8559 54 79
7r7j-assembly1.cif.gz_A crystal structure of radd with adp 0.8538 54 82
4s1z-assembly5.cif.gz_H crystal structure of trabid nzf1 in complex with k29 linked di-ubiquitin 0.8535 54 77
7r7j-assembly2.cif.gz_B crystal structure of radd with adp 0.8491 54 82
ID Description Score Start End Superfamily
af_Q86K78_118_315_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8953 3 46 1.20.1260.10
af_Q54UQ6_98_225_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.8929 54 82 1.10.287.110
af_Q54H42_48_275_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8496 7 45 1.20.1260.10
af_Q4DHR8_1_892_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7798 49 80 1.25.10.10
4xxbB00 Mainly Beta;Roll;SH3 type barrels.;Zn-finger domain of Sec23/24 0.7712 54 79 2.30.30.380
ID Description Score Start End GO Terms
AF-A0A5E6N886-F1-model_v4 Uncharacterized protein 0.9474 7 39
AF-A0A4Q2ZMR8-F1-model_v4 deleted 0.9371 7 42
AF-A0A5E6NQA2-F1-model_v4 Uncharacterized protein 0.9342 2 39
AF-A0A1J8PRH6-F1-model_v4 Uncharacterized protein 0.9305 7 39
AF-U1KPK7-F1-model_v4 deleted 0.9282 2 41

Feature Viewer

pLDDT pTM Quality
88.61 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map