F478015

General Info

Members Datasets Scaffolds Average Seq Length
732 403 1464 419

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100002331|Ga0070696_10000233121
Length 419
Sequence MATLPNVGGQKYGDLKRRLLFLLGALVVFRIGAHIPVPGIDPVRLAELFSSQQGGILGPYISASIIMQLMTTVSPQLEQLRKEGESGRRKITQYTRYGTLFLALFQATGISFALETQSGLVLEPGLMFRITAVTTLVTGTMFLMWLGEQITERGLGNGISIIIFAGIAAGLPNAIAGTLELVRTGAMHPLTALLIAMAVLAVTGFVCFVERGQRKILVNYAKRQVGNRIYGGQSSHLPFKLNMSGVIPPIFASSLILFPATALNWFGSSTEGLTWLRDIAGTLSPGQPIYVMLYAALIIFFCFFYTALQYNPKETADNLKKSGAFVPGIRPGDQTARYLEKILTRLTLAGALYVTAVCLLPEFLILRWGVPFYFGGTSLLXXXXVTMDFMSQVQAYIMTHQYESLLRKANFKGGLPGVR

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
92 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
123 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
128 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
129 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
130 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
195 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
202 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
203 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
206 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
207 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
208 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
211 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
212 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
213 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
214 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
217 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
218 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
219 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
220 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
221 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
222 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
223 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
224 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
225 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
232 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
233 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
243 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
244 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
245 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
246 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
247 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
248 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
249 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
250 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
251 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
252 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
253 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
254 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
255 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
256 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
257 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
258 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
259 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
260 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
261 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
262 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
263 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
264 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
267 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
268 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
269 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
270 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
271 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
272 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
275 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
276 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
277 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
278 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
279 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
287 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
290 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
291 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
292 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
293 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
294 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
295 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
296 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
301 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
314 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
315 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
316 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
317 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
325 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
326 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
332 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
333 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
334 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
335 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
336 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
337 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
338 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
339 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
340 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
345 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
346 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
347 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
348 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
349 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
350 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
351 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
352 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
353 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
354 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
355 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
356 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
357 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
358 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
359 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
360 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
361 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
362 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
363 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
364 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
365 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
366 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
367 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
370 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
371 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
372 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
373 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
374 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
375 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
376 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
377 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
378 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
383 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
384 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
385 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
386 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
387 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
388 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
389 2643221585 Pelomonas sp. Root662 Isolate Unclassified
390 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
391 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
392 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
393 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
394 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
395 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
396 2643221656 Pelomonas sp. Root405 Isolate Unclassified
397 2643221660 Methylibium sp. Root1272 Isolate Unclassified
398 2738541337 Pelomonas sp. BT06 Isolate Unclassified
399 2831864461 Roseateles noduli HZ7 Isolate Nodule
400 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
401 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
402 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
403 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.99
Metatranscriptomes 3.14
Isolates 2.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.76
Nodule 0.96
Rhizoplane 2.73
Rhizosphere 72.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100002331 3300005546 Bacteria 12524
2 SwRhRL2b_contig_2192316 2162886007 Bacteria 1604
3 SwRhRL2b_contig_3781963 2162886007 Bacteria 2971
4 JGI25156J39149_1004911 3300002705 Bacteria 3967
5 JGI25154J39366_1000593 3300002738 Bacteria 17447
6 JGI25157J39369_1001134 3300002741 Bacteria 11672
7 JGI25152J39213_1001073 3300002773 Bacteria 12895
8 Ga0006759J45824_1058692 3300003163 Bacteria 1524
9 JGI25153J46596_10007740 3300003215 Bacteria 5229
10 JGI25153J46596_10008637 3300003215 Bacteria 4845
11 Ga0006770J48903_1001899 3300003305 Bacteria 11120
12 Ga0007417J51691_1035112 3300003544 Bacteria 4119
13 Ga0007417J51691_1049740 3300003544 Bacteria 2703
14 Ga0007409J51694_1024055 3300003575 Bacteria 9433
15 Ga0007409J51694_1054348 3300003575 Bacteria 2867
16 Ga0032354_1038706 3300003693 Bacteria 2108
17 Ga0055539_1002928 3300003752 Bacteria 2478
18 Ga0055533_1000043 3300003756 Bacteria 229262
19 Ga0055525_1000161 3300003759 Bacteria 87478
20 Ga0055525_1000641 3300003759 Bacteria 14040
21 Ga0055529_1000322 3300003763 Bacteria 54232
22 Ga0055526_1000791 3300003771 Bacteria 23567
23 Ga0055526_1003343 3300003771 Bacteria 10245
24 Ga0055524_1000140 3300003775 Bacteria 85990
25 Ga0055524_1014215 3300003775 Bacteria 2960
26 Ga0055524_1014222 3300003775 Bacteria 2960
27 Ga0055540_1000133 3300003792 Bacteria 75104
28 Ga0055531_10002079 3300003794 Bacteria 13764
29 Ga0055531_10002114 3300003794 Bacteria 13639
30 Ga0055531_10017353 3300003794 Bacteria 3044
31 Ga0055531_10018264 3300003794 Bacteria 2905
32 Ga0055543_1008713 3300004625 Bacteria 2229
33 Ga0065165_1001259 3300005262 Bacteria 28658
34 Ga0065165_1006303 3300005262 Bacteria 6283
35 Ga0065704_10084897 3300005289 Bacteria 3277
36 Ga0070676_10016655 3300005328 Bacteria 4064
37 Ga0070690_100004546 3300005330 Bacteria 7716
38 Ga0070690_100006927 3300005330 Bacteria 6450
39 Ga0070670_100113053 3300005331 Bacteria 2340
40 Ga0068869_100000239 3300005334 Bacteria 28911
41 Ga0068869_100006377 3300005334 Bacteria 7477
42 Ga0068869_100034548 3300005334 Bacteria 3577
43 Ga0068869_100086944 3300005334 Bacteria 2344
44 Ga0070666_10026200 3300005335 Bacteria 3806
45 Ga0070680_100024534 3300005336 Bacteria 4818
46 Ga0070680_100074249 3300005336 Bacteria 2798
47 Ga0070682_100010140 3300005337 Bacteria 5341
48 Ga0068868_100001937 3300005338 Bacteria 14202
49 Ga0068868_100019350 3300005338 Bacteria 5101
50 Ga0070689_100001590 3300005340 Bacteria 14486
51 Ga0070691_10001529 3300005341 Bacteria 9951
52 Ga0070687_100000486 3300005343 Bacteria 13224
53 Ga0070687_100026194 3300005343 Bacteria 2805
54 Ga0070661_100017861 3300005344 Bacteria 5036
55 Ga0070692_10002474 3300005345 Bacteria 7182
56 Ga0070692_10057319 3300005345 Bacteria 2042
57 Ga0070668_100037251 3300005347 Bacteria 3713
58 Ga0070668_100077806 3300005347 Bacteria 2593
59 Ga0070675_100031603 3300005354 Bacteria 4281
60 Ga0070675_100105361 3300005354 Bacteria 2379
61 Ga0070671_100128717 3300005355 Bacteria 2132
62 Ga0070674_100024935 3300005356 Bacteria 3885
63 Ga0070659_100031644 3300005366 Bacteria 4099
64 Ga0070659_100034805 3300005366 Bacteria 3919
65 Ga0070659_100099692 3300005366 Bacteria 2337
66 Ga0070667_100021984 3300005367 Bacteria 5294
67 Ga0070667_100065424 3300005367 Bacteria 3087
68 Ga0070703_10008050 3300005406 Bacteria 2963
69 Ga0070701_10002480 3300005438 Bacteria 7125
70 Ga0070701_10055948 3300005438 Bacteria 2062
71 Ga0070705_100003035 3300005440 Bacteria 8283
72 Ga0070705_100004302 3300005440 Bacteria 6941
73 Ga0070705_100021556 3300005440 Bacteria 3429
74 Ga0070700_100000762 3300005441 Bacteria 15905
75 Ga0070700_100006166 3300005441 Bacteria 6387
76 Ga0070694_100001615 3300005444 Bacteria 13236
77 Ga0070694_100016518 3300005444 Bacteria 4646
78 Ga0070663_100007236 3300005455 Bacteria 6743
79 Ga0070678_100025705 3300005456 Bacteria 3967
80 Ga0070678_100031069 3300005456 Bacteria 3679
81 Ga0070678_100045788 3300005456 Bacteria 3132
82 Ga0070678_100089312 3300005456 Bacteria 2358
83 Ga0070678_100156718 3300005456 Bacteria 1840
84 Ga0070678_100174405 3300005456 Bacteria 1754
85 Ga0070662_100029922 3300005457 Bacteria 3805
86 Ga0070662_100094760 3300005457 Bacteria 2248
87 Ga0070662_100118646 3300005457 Bacteria 2025
88 Ga0068867_100000552 3300005459 Bacteria 24723
89 Ga0068867_100002002 3300005459 Bacteria 14223
90 Ga0068867_100011425 3300005459 Bacteria 6266
91 Ga0068867_100020018 3300005459 Bacteria 4769
92 Ga0068867_100057427 3300005459 Bacteria 2882
93 Ga0068867_100111811 3300005459 Bacteria 2099
94 Ga0070706_100025301 3300005467 Bacteria 5463
95 Ga0070706_100221825 3300005467 Bacteria 1765
96 Ga0070707_100035242 3300005468 Bacteria 4774
97 Ga0070699_100093735 3300005518 Bacteria 2628
98 Ga0070679_100073605 3300005530 Bacteria 3407
99 Ga0070697_100081928 3300005536 Bacteria 2659
100 Ga0070672_100006187 3300005543 Bacteria 8016
101 Ga0070672_100080695 3300005543 Bacteria 2606
102 Ga0070686_100000984 3300005544 Bacteria 16449
103 Ga0070686_100008478 3300005544 Bacteria 5757
104 Ga0070686_100032410 3300005544 Bacteria 3204
105 Ga0070686_100067397 3300005544 Bacteria 2331
106 Ga0070695_100001266 3300005545 Bacteria 13913
107 Ga0070696_100004428 3300005546 Bacteria 9371
108 Ga0070696_100006223 3300005546 Bacteria 7986
109 Ga0070693_100000371 3300005547 Bacteria 20420
110 Ga0070704_100003415 3300005549 Bacteria 9103
111 Ga0068855_100025005 3300005563 Bacteria 7148
112 Ga0068855_100058607 3300005563 Bacteria 4509
113 Ga0070664_100052006 3300005564 Bacteria 3469
114 Ga0070664_100162212 3300005564 Bacteria 1978
115 Ga0068854_100013936 3300005578 Bacteria 5288
116 Ga0068854_100057142 3300005578 Bacteria 2814
117 Ga0068856_100020864 3300005614 Bacteria 6368
118 Ga0068856_100097613 3300005614 Bacteria 2927
119 Ga0070702_100010189 3300005615 Bacteria 4620
120 Ga0068852_100022501 3300005616 Bacteria 5056
121 Ga0068852_100128028 3300005616 Bacteria 2334
122 Ga0068859_100011503 3300005617 Bacteria 8897
123 Ga0068859_100026836 3300005617 Bacteria 5777
124 Ga0068859_100099187 3300005617 Bacteria 2968
125 Ga0068859_100257898 3300005617 Bacteria 1834
126 Ga0068864_100072837 3300005618 Bacteria 2995
127 Ga0068864_100075230 3300005618 Bacteria 2948
128 Ga0068866_10000800 3300005718 Bacteria 14106
129 Ga0068866_10025655 3300005718 Bacteria 2773
130 Ga0068866_10030317 3300005718 Bacteria 2595
131 Ga0068861_100001378 3300005719 Bacteria 15253
132 Ga0068851_10038775 3300005834 Bacteria 2391
133 Ga0068863_100043166 3300005841 Bacteria 4281
134 Ga0068863_100114566 3300005841 Bacteria 2568
135 Ga0068858_100003490 3300005842 Bacteria 15590
136 Ga0068858_100008125 3300005842 Bacteria 10091
137 Ga0068858_100013226 3300005842 Bacteria 7776
138 Ga0068860_100017732 3300005843 Bacteria 6935
139 Ga0068860_100210642 3300005843 Bacteria 1885
140 Ga0068862_100006216 3300005844 Bacteria 9947
141 Ga0075364_10006811 3300006051 Bacteria 6742
142 Ga0075367_10006379 3300006178 Bacteria 5953
143 Ga0075367_10139916 3300006178 Bacteria 1499
144 Ga0075369_10038643 3300006186 Bacteria 2037
145 Ga0075366_10000776 3300006195 Bacteria 15228
146 Ga0075366_10000795 3300006195 Bacteria 15124
147 Ga0075366_10014839 3300006195 Bacteria 4454
148 Ga0075366_10042212 3300006195 Bacteria 2700
149 Ga0075366_10049359 3300006195 Bacteria 2497
150 Ga0075366_10054872 3300006195 Bacteria 2366
151 Ga0075366_10057073 3300006195 Bacteria 2320
152 Ga0075366_10074063 3300006195 Bacteria 2030
153 Ga0097621_100006235 3300006237 Bacteria 8460
154 Ga0097621_100034891 3300006237 Bacteria 4015
155 Ga0075370_10000073 3300006353 Bacteria 30960
156 Ga0075370_10002824 3300006353 Bacteria 8149
157 Ga0075370_10017764 3300006353 Bacteria 3847
158 Ga0075370_10026837 3300006353 Bacteria 3192
159 Ga0075370_10029197 3300006353 Bacteria 3070
160 Ga0075370_10034187 3300006353 Bacteria 2850
161 Ga0075370_10050932 3300006353 Bacteria 2349
162 Ga0075370_10071693 3300006353 Bacteria 1982
163 Ga0068871_100001793 3300006358 Bacteria 14486
164 Ga0068871_100003989 3300006358 Bacteria 10207
165 Ga0068871_100019288 3300006358 Bacteria 5206
166 Ga0068871_100105535 3300006358 Bacteria 2364
167 Ga0075430_100025991 3300006846 Bacteria 4982
168 Ga0075431_100001591 3300006847 Bacteria 21135
169 Ga0075434_100012054 3300006871 Bacteria 8182
170 Ga0075434_100074019 3300006871 Bacteria 3399
171 Ga0075429_100000220 3300006880 Bacteria 38587
172 Ga0068865_100001223 3300006881 Bacteria 14933
173 Ga0068865_100015724 3300006881 Bacteria 4828
174 Ga0075436_100005646 3300006914 Bacteria 8587
175 Ga0075436_100021757 3300006914 Bacteria 4401
176 Ga0097620_100011503 3300006931 Bacteria 8897
177 Ga0097620_100026836 3300006931 Bacteria 5777
178 Ga0097620_100099189 3300006931 Bacteria 2968
179 Ga0097620_100257889 3300006931 Bacteria 1834
180 Ga0099823_1000064 3300006944 Bacteria 50328
181 Ga0079104_1000027 3300006946 Bacteria 212641
182 Ga0079104_1000053 3300006946 Bacteria 168604
183 Ga0075435_100005357 3300007076 Bacteria 8945
184 Ga0105250_10000154 3300009092 Bacteria 59676
185 Ga0105240_10094682 3300009093 Bacteria 3642
186 Ga0111539_10009725 3300009094 Bacteria 12138
187 Ga0111539_10068668 3300009094 Bacteria 4185
188 Ga0105245_10002556 3300009098 Bacteria 16384
189 Ga0105245_10041497 3300009098 Bacteria 4101
190 Ga0105247_10104494 3300009101 Bacteria 1815
191 Ga0114129_10011902 3300009147 Bacteria 12373
192 Ga0105243_10002265 3300009148 Bacteria 16169
193 Ga0105243_10003107 3300009148 Bacteria 13657
194 Ga0105243_10064706 3300009148 Bacteria 2935
195 Ga0105243_10286282 3300009148 Bacteria 1487
196 Ga0105241_10022719 3300009174 Bacteria 4649
197 Ga0105242_10002800 3300009176 Bacteria 13659
198 Ga0105242_10113993 3300009176 Bacteria 2309
199 Ga0105248_10006768 3300009177 Bacteria 12569
200 Ga0105248_10010314 3300009177 Bacteria 10284
201 Ga0105248_10051737 3300009177 Bacteria 4608
202 Ga0105248_10053048 3300009177 Bacteria 4550
203 Ga0105248_10210595 3300009177 Bacteria 2190
204 Ga0105237_10020609 3300009545 Bacteria 6794
205 Ga0105238_10156201 3300009551 Bacteria 2256
206 Ga0105249_10022359 3300009553 Bacteria 5664
207 Ga0105249_10094485 3300009553 Bacteria 2802
208 Ga0105239_10367525 3300010375 Bacteria 1625
209 Ga0157319_1000005 3300012497 Bacteria 372810
210 Ga0157369_10034850 3300013105 Bacteria 5521
211 Ga0157374_10001882 3300013296 Bacteria 17636
212 Ga0157374_10032559 3300013296 Bacteria 4748
213 Ga0157378_10007830 3300013297 Bacteria 9326
214 Ga0157378_10010736 3300013297 Bacteria 8006
215 Ga0157378_10021107 3300013297 Bacteria 5728
216 Ga0157372_10023087 3300013307 Bacteria 6740
217 Ga0157375_10119615 3300013308 Bacteria 2742
218 Ga0157375_10235679 3300013308 Bacteria 1989
219 Ga0163163_10035651 3300014325 Bacteria 4827
220 Ga0157380_10050662 3300014326 Bacteria 3281
221 Ga0157377_10000368 3300014745 Bacteria 20109
222 Ga0157377_10024611 3300014745 Bacteria 3202
223 Ga0157379_10060934 3300014968 Bacteria 3374
224 Ga0157379_10203335 3300014968 Bacteria 1791
225 Ga0157376_10008899 3300014969 Bacteria 7268
226 Ga0157376_10055495 3300014969 Bacteria 3306
227 Ga0182007_10001550 3300015262 Bacteria 12241
228 Ga0183362_10007 3300015683 Bacteria 240101
229 Ga0163161_10046651 3300017792 Bacteria 3126
230 Ga0163161_10180311 3300017792 Bacteria 1619
231 Ga0213872_10000672 3300021361 Bacteria 25868
232 Ga0213872_10001745 3300021361 Bacteria 13647
233 Ga0213872_10008389 3300021361 Bacteria 5002
234 Ga0209674_100067 3300025226 Bacteria 253824
235 Ga0209563_100068 3300025230 Bacteria 254802
236 Ga0209563_100088 3300025230 Bacteria 175375
237 Ga0207427_100260 3300025231 Bacteria 41435
238 Ga0209258_102113 3300025242 Bacteria 5574
239 Ga0207425_1000680 3300025245 Bacteria 18554
240 Ga0209646_1000127 3300025246 Bacteria 131920
241 Ga0209026_1000004 3300025250 Bacteria 949012
242 Ga0209677_100201 3300025253 Bacteria 47899
243 Ga0209148_1005675 3300025254 Bacteria 2815
244 Ga0209759_1000129 3300025256 Bacteria 131961
245 Ga0209129_1000158 3300025258 Bacteria 103711
246 Ga0207666_1001550 3300025271 Bacteria 2717
247 Ga0209673_1004093 3300025273 Bacteria 8026
248 Ga0209673_1013154 3300025273 Bacteria 3286
249 Ga0209673_1024966 3300025273 Bacteria 1997
250 Ga0209564_1000008 3300025295 Bacteria 953227
251 Ga0209564_1000282 3300025295 Bacteria 103837
252 Ga0209758_1000910 3300025297 Bacteria 40059
253 Ga0209758_1011080 3300025297 Bacteria 5275
254 Ga0209050_1000223 3300025298 Bacteria 125465
255 Ga0209050_1001097 3300025298 Bacteria 32856
256 Ga0209050_1004273 3300025298 Bacteria 9808
257 Ga0209256_1000045 3300025299 Bacteria 325506
258 Ga0209256_1013217 3300025299 Bacteria 3081
259 Ga0209256_1013663 3300025299 Bacteria 2997
260 Ga0209051_1000004 3300025303 Bacteria 1155596
261 Ga0209051_1000938 3300025303 Bacteria 28786
262 Ga0209051_1001129 3300025303 Bacteria 24438
263 Ga0209051_1005321 3300025303 Bacteria 7574
264 Ga0209257_1000047 3300025304 Bacteria 460507
265 Ga0209257_1000315 3300025304 Bacteria 102293
266 Ga0209257_1005397 3300025304 Bacteria 8999
267 Ga0209257_1016630 3300025304 Bacteria 2960
268 Ga0207696_1000388 3300025711 Bacteria 42044
269 Ga0207653_10008869 3300025885 Bacteria 3136
270 Ga0207682_10005373 3300025893 Bacteria 5221
271 Ga0207642_10002949 3300025899 Bacteria 5327
272 Ga0207688_10015650 3300025901 Bacteria 4114
273 Ga0207688_10017544 3300025901 Bacteria 3891
274 Ga0207680_10018346 3300025903 Bacteria 3717
275 Ga0207645_10012543 3300025907 Bacteria 5748
276 Ga0207705_10036816 3300025909 Bacteria 3501
277 Ga0207684_10083450 3300025910 Bacteria 2721
278 Ga0207654_10011744 3300025911 Bacteria 4471
279 Ga0207695_10071432 3300025913 Bacteria 3545
280 Ga0207660_10001979 3300025917 Bacteria 13656
281 Ga0207662_10000006 3300025918 Bacteria 105457
282 Ga0207662_10056037 3300025918 Bacteria 2353
283 Ga0207657_10113023 3300025919 Bacteria 2241
284 Ga0207649_10001794 3300025920 Bacteria 12285
285 Ga0207649_10004699 3300025920 Bacteria 7389
286 Ga0207652_10002940 3300025921 Bacteria 14249
287 Ga0207652_10016184 3300025921 Bacteria 6084
288 Ga0207646_10033831 3300025922 Bacteria 4620
289 Ga0207681_10005925 3300025923 Bacteria 7494
290 Ga0207650_10002454 3300025925 Bacteria 12900
291 Ga0207659_10009985 3300025926 Bacteria 5946
292 Ga0207659_10070736 3300025926 Bacteria 2545
293 Ga0207687_10005454 3300025927 Bacteria 8413
294 Ga0207644_10015416 3300025931 Bacteria 5129
295 Ga0207644_10105990 3300025931 Bacteria 2118
296 Ga0207690_10001731 3300025932 Bacteria 13411
297 Ga0207690_10053849 3300025932 Bacteria 2702
298 Ga0207706_10045417 3300025933 Bacteria 3892
299 Ga0207686_10001285 3300025934 Bacteria 14428
300 Ga0207709_10000514 3300025935 Bacteria 34009
301 Ga0207709_10001005 3300025935 Bacteria 20902
302 Ga0207709_10023017 3300025935 Bacteria 3541
303 Ga0207670_10005544 3300025936 Bacteria 6937
304 Ga0207669_10016743 3300025937 Bacteria 3736
305 Ga0207704_10000913 3300025938 Bacteria 13073
306 Ga0207665_10034250 3300025939 Bacteria 3370
307 Ga0207691_10002550 3300025940 Bacteria 17799
308 Ga0207691_10028424 3300025940 Bacteria 5236
309 Ga0207691_10029540 3300025940 Bacteria 5128
310 Ga0207691_10116257 3300025940 Bacteria 2374
311 Ga0207711_10009785 3300025941 Bacteria 7972
312 Ga0207711_10029255 3300025941 Bacteria 4645
313 Ga0207711_10049630 3300025941 Bacteria 3592
314 Ga0207711_10105192 3300025941 Bacteria 2502
315 Ga0207711_10145890 3300025941 Bacteria 2132
316 Ga0207689_10000292 3300025942 Bacteria 45545
317 Ga0207689_10000370 3300025942 Bacteria 42422
318 Ga0207689_10015223 3300025942 Bacteria 6512
319 Ga0207689_10019913 3300025942 Bacteria 5651
320 Ga0207689_10023735 3300025942 Bacteria 5145
321 Ga0207689_10025393 3300025942 Bacteria 4965
322 Ga0207661_10026944 3300025944 Bacteria 4386
323 Ga0207661_10248214 3300025944 Bacteria 1581
324 Ga0207679_10001498 3300025945 Bacteria 14638
325 Ga0207667_10002489 3300025949 Bacteria 22959
326 Ga0207651_10004839 3300025960 Bacteria 6859
327 Ga0207651_10052924 3300025960 Bacteria 2771
328 Ga0207712_10002872 3300025961 Bacteria 11017
329 Ga0207668_10008000 3300025972 Bacteria 6291
330 Ga0207668_10081268 3300025972 Bacteria 2350
331 Ga0207640_10005155 3300025981 Bacteria 7105
332 Ga0207658_10002481 3300025986 Bacteria 13444
333 Ga0207658_10004786 3300025986 Bacteria 9365
334 Ga0207677_10006249 3300026023 Bacteria 6514
335 Ga0207677_10018325 3300026023 Bacteria 4198
336 Ga0207677_10062254 3300026023 Bacteria 2587
337 Ga0207703_10002613 3300026035 Bacteria 15539
338 Ga0207703_10004381 3300026035 Bacteria 11604
339 Ga0207703_10023589 3300026035 Bacteria 4835
340 Ga0207703_10041315 3300026035 Bacteria 3694
341 Ga0207703_10060243 3300026035 Bacteria 3103
342 Ga0207708_10004151 3300026075 Bacteria 10655
343 Ga0207708_10010574 3300026075 Bacteria 6852
344 Ga0207708_10077488 3300026075 Bacteria 2551
345 Ga0207708_10095717 3300026075 Bacteria 2293
346 Ga0207702_10001875 3300026078 Bacteria 20626
347 Ga0207702_10004993 3300026078 Bacteria 11656
348 Ga0207702_10019596 3300026078 Bacteria 5598
349 Ga0207641_10028453 3300026088 Bacteria 4618
350 Ga0207648_10002176 3300026089 Bacteria 21281
351 Ga0207648_10004469 3300026089 Bacteria 14346
352 Ga0207648_10004560 3300026089 Bacteria 14202
353 Ga0207648_10015751 3300026089 Bacteria 6936
354 Ga0207648_10016373 3300026089 Bacteria 6775
355 Ga0207648_10017221 3300026089 Bacteria 6586
356 Ga0207676_10014207 3300026095 Bacteria 5721
357 Ga0207674_10004293 3300026116 Bacteria 17188
358 Ga0207675_100000184 3300026118 Bacteria 56705
359 Ga0207675_100024184 3300026118 Bacteria 5648
360 Ga0207683_10005923 3300026121 Bacteria 10474
361 Ga0207683_10176354 3300026121 Bacteria 1937
362 Ga0207698_10017410 3300026142 Bacteria 4874
363 Ga0207698_10022009 3300026142 Bacteria 4420
364 Ga0207698_10064301 3300026142 Bacteria 2875
365 Ga0207698_10084113 3300026142 Bacteria 2578
366 Ga0207698_10153668 3300026142 Bacteria 2002
367 Ga0209281_1000002 3300027111 Bacteria 1924012
368 Ga0209281_1000147 3300027111 Bacteria 168586
369 Ga0209389_1000305 3300027296 Bacteria 30534
370 Ga0209974_10000149 3300027876 Bacteria 21195
371 Ga0207428_10008382 3300027907 Bacteria 9335
372 Ga0207428_10081909 3300027907 Bacteria 2519
373 Ga0268266_10024735 3300028379 Bacteria 5109
374 Ga0268266_10125219 3300028379 Bacteria 2292
375 Ga0268266_10143537 3300028379 Bacteria 2144
376 Ga0268265_10004065 3300028380 Bacteria 10284
377 Ga0268265_10049769 3300028380 Bacteria 3153
378 Ga0268264_10002070 3300028381 Bacteria 17906
379 Ga0268264_10003087 3300028381 Bacteria 14417
380 Ga0268264_10023642 3300028381 Bacteria 5012
381 Ga0268264_10037499 3300028381 Bacteria 3996
382 Ga0265334_10036200 3300028573 Bacteria 1950
383 Ga0265323_10008261 3300028653 Bacteria 4299
384 Ga0265336_10000028 3300028666 Bacteria 179201
385 Ga0265336_10000618 3300028666 Bacteria 19547
386 Ga0307515_10000063 3300028794 Bacteria 245504
387 Ga0307515_10000096 3300028794 Bacteria 206366
388 Ga0307515_10008919 3300028794 Bacteria 19482
389 Ga0307515_10012540 3300028794 Bacteria 15942
390 Ga0307515_10144809 3300028794 Bacteria 2524
391 Ga0265324_10000002 3300029957 Bacteria 382754
392 Ga0265324_10000286 3300029957 Bacteria 37420
393 Ga0307511_10000653 3300030521 Bacteria 37038
394 Ga0265332_10000030 3300031238 Bacteria 175141
395 Ga0265328_10024135 3300031239 Bacteria 2300
396 Ga0265325_10002273 3300031241 Bacteria 13030
397 Ga0265331_10023731 3300031250 Bacteria 3111
398 Ga0265327_10000020 3300031251 Bacteria 424552
399 Ga0265327_10000077 3300031251 Bacteria 211850
400 Ga0265327_10000178 3300031251 Bacteria 135732
401 Ga0265327_10006182 3300031251 Bacteria 9662
402 Ga0265316_10000201 3300031344 Bacteria 69415
403 Ga0307513_10004080 3300031456 Bacteria 19563
404 Ga0307513_10019109 3300031456 Bacteria 8167
405 Ga0307513_10088851 3300031456 Bacteria 3157
406 Ga0307509_10000050 3300031507 Bacteria 165692
407 Ga0307509_10003616 3300031507 Bacteria 23221
408 Ga0307509_10036139 3300031507 Bacteria 5413
409 Ga0307509_10042288 3300031507 Bacteria 4940
410 Ga0307408_100000089 3300031548 Bacteria 100712
411 Ga0307408_100033743 3300031548 Bacteria 3578
412 Ga0307408_100037446 3300031548 Bacteria 3417
413 Ga0307508_10000392 3300031616 Bacteria 52650
414 Ga0307508_10012217 3300031616 Bacteria 7853
415 Ga0307514_10032734 3300031649 Bacteria 4156
416 Ga0307516_10000048 3300031730 Bacteria 130378
417 Ga0307516_10004016 3300031730 Bacteria 18444
418 Ga0307516_10005443 3300031730 Bacteria 15230
419 Ga0307516_10014003 3300031730 Bacteria 8506
420 Ga0307516_10019197 3300031730 Bacteria 7085
421 Ga0307405_10023807 3300031731 Bacteria 3487
422 Ga0307405_10034470 3300031731 Bacteria 3012
423 Ga0307413_10089570 3300031824 Bacteria 1999
424 Ga0307410_10138782 3300031852 Bacteria 1795
425 Ga0307406_10004866 3300031901 Bacteria 7314
426 Ga0307406_10149842 3300031901 Bacteria 1663
427 Ga0307407_10022057 3300031903 Bacteria 3296
428 Ga0307412_10011559 3300031911 Bacteria 5119
429 Ga0307409_100000577 3300031995 Bacteria 15970
430 Ga0307416_100002818 3300032002 Bacteria 10112
431 Ga0307416_100030487 3300032002 Bacteria 4047
432 Ga0307414_10054020 3300032004 Bacteria 2805
433 Ga0307411_10000085 3300032005 Bacteria 28904
434 Ga0307411_10053460 3300032005 Bacteria 2646
435 Ga0307411_10115775 3300032005 Bacteria 1929
436 Ga0307415_100016637 3300032126 Bacteria 4389
437 Ga0307510_10053339 3300033180 Bacteria 4251
438 Ga0307510_10081095 3300033180 Bacteria 3148
439 Ga0373952_0000408 3300035092 Bacteria 7385
440 Ga0373954_0000068 3300035118 Bacteria 37051
441 Ga0373960_0000482 3300035121 Bacteria 7922
442 Ga0373931_0000535 3300035691 Bacteria 15604
443 Ga0373931_0001474 3300035691 Bacteria 10131
444 Ga0373931_0008420 3300035691 Bacteria 4893
445 Ga0373933_0063556 3300035724 Bacteria 2231
446 Ga0373937_0002051 3300036401 Bacteria 16843
447 Ga0373937_0002498 3300036401 Bacteria 15273
448 Ga0373937_0003228 3300036401 Bacteria 13663
449 Ga0373937_0039449 3300036401 Bacteria 4304
450 Ga0373937_0127585 3300036401 Bacteria 2374
451 Ga0373925_0024012 3300037068 Bacteria 4449
452 Ga0395898_0012209 3300037466 Bacteria 8885
453 Ga0395905_0000084 3300037471 Bacteria 158046
454 Ga0395905_0002507 3300037471 Bacteria 20284
455 Ga0395905_0008972 3300037471 Bacteria 9813
456 Ga0395905_0013480 3300037471 Bacteria 7832
457 Ga0395905_0024456 3300037471 Bacteria 5700
458 Ga0395905_0043124 3300037471 Bacteria 4232
459 Ga0395901_0001925 3300038443 Bacteria 21375
460 Ga0436361_0021545 3300039447 Bacteria 2240
461 Ga0436361_0050017 3300039447 Bacteria 26618
462 Ga0436361_0148596 3300039447 Bacteria 3626
463 Ga0436361_0395777 3300039447 Bacteria 4542
464 Ga0436361_0402240 3300039447 Bacteria 25910
465 Ga0436361_0776332 3300039447 Bacteria 4883
466 Ga0439436_0003093 3300041404 Bacteria 5043
467 Ga0439466_0042966 3300041411 Bacteria 1503
468 Ga0439465_0010238 3300041413 Bacteria 2947
469 Ga0451800_0757929 3300041459 Bacteria 1584
470 Ga0439431_0002191 3300041997 Bacteria 4307
471 Ga0439433_0000255 3300041999 Bacteria 8970
472 Ga0439433_0002915 3300041999 Bacteria 3663
473 Ga0439442_016531 3300042002 Bacteria 1521
474 Ga0439432_001484 3300042006 Bacteria 8802
475 Ga0439449_0002613 3300042007 Bacteria 7017
476 Ga0439449_0013168 3300042007 Bacteria 3111
477 Ga0439449_0015300 3300042007 Bacteria 2882
478 Ga0439462_0009262 3300042015 Bacteria 2490
479 Ga0450917_000001 3300042120 Bacteria 12228
480 Ga0450919_000025 3300042121 Bacteria 12249
481 Ga0450890_000550 3300042127 Bacteria 5489
482 Ga0450891_000655 3300042129 Bacteria 3612
483 Ga0450892_001248 3300042130 Bacteria 2585
484 Ga0450889_000161 3300042144 Bacteria 6993
485 Ga0439464_0005574 3300042439 Bacteria 3259
486 Ga0450918_000123 3300042531 Bacteria 16624
487 Ga0451577_0000013 3300042876 Bacteria 550689
488 Ga0451577_0000191 3300042876 Bacteria 128991
489 Ga0451577_0003495 3300042876 Bacteria 17459
490 Ga0451577_0004247 3300042876 Bacteria 15249
491 Ga0451577_0004524 3300042876 Bacteria 14637
492 Ga0451577_0008554 3300042876 Bacteria 9952
493 Ga0451577_0010916 3300042876 Bacteria 8631
494 Ga0451577_0016336 3300042876 Bacteria 6877
495 Ga0451577_0027488 3300042876 Bacteria 5150
496 Ga0451577_0035504 3300042876 Bacteria 4490
497 Ga0451577_0040503 3300042876 Bacteria 4182
498 Ga0451577_0056781 3300042876 Bacteria 3492
499 Ga0451577_0252530 3300042876 Bacteria 1596
500 Ga0466969_0000018 3300044656 Bacteria 102911
501 Ga0466969_0001561 3300044656 Bacteria 12286
502 Ga0466969_0002589 3300044656 Bacteria 9661
503 Ga0466969_0011638 3300044656 Bacteria 4654
504 Ga0466972_0001480 3300044658 Bacteria 11423
505 Ga0466972_0008302 3300044658 Bacteria 5206
506 Ga0453683_0000059 3300044673 Bacteria 187158
507 Ga0453683_0003443 3300044673 Bacteria 11656
508 Ga0453683_0030645 3300044673 Bacteria 3400
509 Ga0453683_0101952 3300044673 Bacteria 1802
510 Ga0466965_0021276 3300044683 Bacteria 3120
511 Ga0466966_0003056 3300044684 Bacteria 11038
512 Ga0466966_0009766 3300044684 Bacteria 6359
513 Ga0466961_0000649 3300044693 Bacteria 21880
514 Ga0466961_0004306 3300044693 Bacteria 8909
515 Ga0466961_0005561 3300044693 Bacteria 7954
516 Ga0466961_0051858 3300044693 Bacteria 2619
517 Ga0466964_0000637 3300044706 Bacteria 11177
518 Ga0453684_0000014 3300044712 Bacteria 993311
519 Ga0453684_0000585 3300044712 Bacteria 135647
520 Ga0453684_0000590 3300044712 Bacteria 134718
521 Ga0453684_0000682 3300044712 Bacteria 121090
522 Ga0453684_0000989 3300044712 Bacteria 92793
523 Ga0453684_0002255 3300044712 Bacteria 47769
524 Ga0453684_0003526 3300044712 Bacteria 35001
525 Ga0453684_0004092 3300044712 Bacteria 31636
526 Ga0453684_0035225 3300044712 Bacteria 6924
527 Ga0453684_0040166 3300044712 Bacteria 6361
528 Ga0453684_0050212 3300044712 Bacteria 5490
529 Ga0453684_0052439 3300044712 Bacteria 5333
530 Ga0453684_0084439 3300044712 Bacteria 3948
531 Ga0453684_0199731 3300044712 Bacteria 2332
532 Ga0466971_0002433 3300044719 Bacteria 7857
533 Ga0466959_0003145 3300045049 Bacteria 10707
534 Ga0466959_0027088 3300045049 Bacteria 4251
535 Ga0466959_0071231 3300045049 Bacteria 2517
536 Ga0466959_0074705 3300045049 Bacteria 2450
537 Ga0451576_0000018 3300045051 Bacteria 550689
538 Ga0451576_0000096 3300045051 Bacteria 221078
539 Ga0451576_0000909 3300045051 Bacteria 56035
540 Ga0451576_0003670 3300045051 Bacteria 20832
541 Ga0451576_0005877 3300045051 Bacteria 15243
542 Ga0451576_0012409 3300045051 Bacteria 9570
543 Ga0451576_0031258 3300045051 Bacteria 5679
544 Ga0451576_0065178 3300045051 Bacteria 3793
545 Ga0451576_0087215 3300045051 Bacteria 3246
546 Ga0451576_0159884 3300045051 Bacteria 2350
547 Ga0466958_0002207 3300045836 Bacteria 9697
548 Ga0466967_0056667 3300045976 Bacteria 3456
549 Ga0495592_0000203 3300046454 Bacteria 50733
550 Ga0495592_0002237 3300046454 Bacteria 13646
551 Ga0495590_0004188 3300046457 Bacteria 5838
552 Ga0495639_0019706 3300046475 Bacteria 2943
553 Ga0495662_0003778 3300046476 Bacteria 7636
554 Ga0495583_0000510 3300046506 Bacteria 55787
555 Ga0495606_0100121 3300046507 Bacteria 1766
556 Ga0495608_0001279 3300046511 Bacteria 17865
557 Ga0495610_0007369 3300046512 Bacteria 7341
558 Ga0495628_0004691 3300046516 Bacteria 12056
559 Ga0495630_0008576 3300046517 Bacteria 7334
560 Ga0495666_0008444 3300046526 Bacteria 5165
561 Ga0495640_0002705 3300046533 Bacteria 14256
562 Ga0495667_0004473 3300046559 Bacteria 9428
563 Ga0495634_0003763 3300046642 Bacteria 12066
564 Ga0495625_0006868 3300046660 Bacteria 10052
565 Ga0495588_0009938 3300046674 Bacteria 4411
566 Ga0495588_0039664 3300046674 Bacteria 2400
567 Ga0495599_0025758 3300046678 Bacteria 3684
568 Ga0495658_0042037 3300046683 Bacteria 2550
569 Ga0495624_0015133 3300046690 Bacteria 5218
570 Ga0495649_0000961 3300046694 Bacteria 22764
571 Ga0495589_0004694 3300046794 Bacteria 7256
572 Ga0495600_0002534 3300046809 Bacteria 10512
573 Ga0495660_0020694 3300046810 Bacteria 3771
574 Ga0495680_0001155 3300047322 Bacteria 29117
575 Ga0495680_0056613 3300047322 Bacteria 3035
576 Ga0495687_005633 3300047443 Bacteria 7913
577 Ga0495684_0047749 3300047471 Bacteria 3274
578 Ga0495684_0086098 3300047471 Bacteria 2382
579 Ga0495686_0004619 3300047472 Bacteria 11207
580 Ga0495686_0045988 3300047472 Bacteria 2761
581 Ga0495615_0006925 3300048090 Bacteria 2127
582 Ga0496100_0027093 3300048903 Bacteria 3520
583 Ga0496102_0007579 3300048905 Bacteria 9273
584 Ga0496104_0008378 3300048907 Bacteria 9189
585 Ga0496104_0032222 3300048907 Bacteria 4877
586 Ga0496105_0009457 3300048908 Bacteria 7626
587 Ga0496106_0019165 3300048909 Bacteria 5073
588 Ga0496106_0081769 3300048909 Bacteria 2482
589 Ga0496107_0175168 3300048910 Bacteria 1592
590 Ga0496108_0005999 3300048911 Bacteria 9840
591 Ga0496108_0009350 3300048911 Bacteria 7937
592 Ga0496108_0085225 3300048911 Bacteria 2682
593 Ga0496108_0087672 3300048911 Bacteria 2643
594 Ga0496109_0029780 3300048912 Bacteria 4891
595 Ga0496109_0116713 3300048912 Bacteria 2484
596 Ga0496109_0402236 3300048912 Bacteria 1293
597 Ga0496111_0004330 3300048914 Bacteria 8955
598 Ga0496113_0078179 3300048916 Bacteria 2531
599 Ga0496114_0018690 3300048917 Bacteria 5608
600 Ga0496114_0109050 3300048917 Bacteria 2370
601 Ga0496122_0000317 3300048925 Bacteria 105883
602 Ga0496123_0000264 3300048926 Bacteria 105015
603 Ga0496124_0001830 3300048927 Bacteria 29398
604 Ga0496124_0018476 3300048927 Bacteria 6527
605 Ga0496124_0054047 3300048927 Bacteria 3401
606 Ga0496125_0013937 3300048928 Bacteria 7862
607 Ga0501306_000065 3300049127 Bacteria 5503
608 Ga0501308_000024 3300049128 Bacteria 6782
609 Ga0501309_000014 3300049129 Bacteria 8867
610 Ga0501310_000059 3300049130 Bacteria 10166
611 Ga0501304_000014 3300049160 Bacteria 8417
612 Ga0501305_000004 3300049161 Bacteria 13267
613 Ga0501307_000035 3300049162 Bacteria 5016
614 Ga0501307_000768 3300049162 Bacteria 2407
615 Ga0501290_001164 3300049513 Bacteria 3692
616 Ga0501300_000354 3300049523 Bacteria 6950
617 Ga0501312_000016 3300049528 Bacteria 9244
618 Ga0501314_000017 3300049530 Bacteria 8558
619 Ga0501320_000736 3300049536 Bacteria 2073
620 Ga0501323_000391 3300049539 Bacteria 3165
621 Ga0501034_0002599 3300049571 Bacteria 21472
622 Ga0501034_0058119 3300049571 Bacteria 3887
623 Ga0501072_0005915 3300049588 Bacteria 9317
624 Ga0501211_000022 3300049658 Bacteria 11753
625 Ga0501233_000911 3300049668 Bacteria 4997
626 Ga0501253_000109 3300049683 Bacteria 5987
627 Ga0501221_000628 3300049704 Bacteria 5661
628 Ga0501234_002259 3300049707 Bacteria 3045
629 Ga0501267_000154 3300049764 Bacteria 4538
630 Ga0501280_000425 3300049776 Bacteria 10117
631 Ga0501282_003978 3300049778 Bacteria 1584
632 nmdc:mga03683_4530_c1 3300050489 Bacteria 4624
633 nmdc:mga00v17_3171_c1 3300050491 Bacteria 8473
634 nmdc:mga0yw44_23737_c1 3300050492 Bacteria 3459
635 nmdc:mga0k408_148478_c1 3300050493 Bacteria 1396
636 nmdc:mga0k408_15101_c1 3300050493 Bacteria 4268
637 nmdc:mga0k408_18100_c1 3300050493 Bacteria 3929
638 nmdc:mga0k408_18596_c1 3300050493 Bacteria 3880
639 nmdc:mga0k408_18793_c1 3300050493 Bacteria 3859
640 nmdc:mga0k408_219_c1 3300050493 Bacteria 23656
641 nmdc:mga0k408_26729_c1 3300050493 Bacteria 3274
642 nmdc:mga0k408_26934_c1 3300050493 Bacteria 3262
643 nmdc:mga0k408_27847_c1 3300050493 Bacteria 3211
644 nmdc:mga0k408_28221_c1 3300050493 Bacteria 3191
645 nmdc:mga0k408_29491_c1 3300050493 Bacteria 3123
646 nmdc:mga0k408_32503_c2 3300050493 Bacteria 2525
647 nmdc:mga0k408_36444_c1 3300050493 Bacteria 2824
648 nmdc:mga0k408_3994_c1 3300050493 Bacteria 7820
649 nmdc:mga0k408_57205_c1 3300050493 Bacteria 2264
650 nmdc:mga0k408_71261_c1 3300050493 Bacteria 2029
651 nmdc:mga0k408_712_c1 3300050493 Bacteria 18213
652 nmdc:mga0k408_8169_c1 3300050493 Bacteria 5608
653 nmdc:mga06z11_25710_c1 3300050494 Bacteria 2794
654 nmdc:mga04h51_7776_c1 3300050495 Bacteria 2844
655 nmdc:mga07m45_13904_c1 3300050496 Bacteria 4278
656 nmdc:mga07m45_15177_c1 3300050496 Bacteria 4113
657 nmdc:mga07m45_15265_c1 3300050496 Bacteria 4101
658 nmdc:mga07m45_17717_c1 3300050496 Bacteria 3832
659 nmdc:mga07m45_27655_c1 3300050496 Bacteria 3126
660 nmdc:mga07m45_2931_c1 3300050496 Bacteria 8100
661 nmdc:mga07m45_29374_c1 3300050496 Bacteria 3040
662 nmdc:mga07m45_45157_c1 3300050496 Bacteria 2474
663 nmdc:mga07m45_670_c1 3300050496 Bacteria 14551
664 nmdc:mga07m45_96172_c1 3300050496 Bacteria 1700
665 nmdc:mga05p37_431_c1 3300050507 Bacteria 45404
666 nmdc:mga09592_229_c1 3300050508 Bacteria 40458
667 nmdc:mga0qj67_126143_c1 3300050509 Bacteria 2071
668 nmdc:mga06r32_2818_c1 3300050510 Bacteria 15588
669 nmdc:mga06r32_75350_c1 3300050510 Bacteria 3274
670 nmdc:mga08y16_20591_c1 3300050511 Bacteria 6962
671 nmdc:mga08y16_217775_c1 3300050511 Bacteria 1977
672 nmdc:mga08y16_83182_c1 3300050511 Bacteria 3336
673 nmdc:mga0n895_2822_c1 3300050512 Bacteria 13752
674 nmdc:mga0n895_30950_c1 3300050512 Bacteria 5119
675 nmdc:mga0rr50_301_c1 3300050513 Bacteria 26775
676 nmdc:mga0rr50_74236_c1 3300050513 Bacteria 2602
677 nmdc:mga08x19_20089_c1 3300050514 Bacteria 4111
678 nmdc:mga0a205_217_c1 3300050515 Bacteria 40547
679 nmdc:mga0a205_68874_c1 3300050515 Bacteria 2674
680 Ga0495601_0088649 3300053077 Bacteria 1989
681 Ga0500635_0000036 3300053080 Bacteria 94740
682 Ga0500578_0000292 3300053086 Bacteria 61943
683 Ga0500578_0087572 3300053086 Bacteria 1978
684 Ga0500583_0002645 3300053092 Bacteria 5434
685 Ga0500651_0000274 3300053093 Bacteria 30518
686 Ga0500651_0021092 3300053093 Bacteria 4060
687 Ga0500594_0002998 3300053118 Bacteria 3691
688 Ga0500607_007242 3300053121 Bacteria 6883
689 Ga0500642_0007842 3300053130 Bacteria 3612
690 Ga0500652_000400 3300053131 Bacteria 15538
691 Ga0500658_0032701 3300053134 Bacteria 2041
692 Ga0500559_0000097 3300053136 Bacteria 70124
693 Ga0500559_0024900 3300053136 Bacteria 2547
694 Ga0500561_0004276 3300053137 Bacteria 2565
695 Ga0500568_0025695 3300053139 Bacteria 2481
696 Ga0500590_007064 3300053148 Bacteria 5517
697 Ga0500604_0000352 3300053151 Bacteria 12731
698 Ga0500619_000012 3300053154 Bacteria 57280
699 Ga0500622_0000198 3300053156 Bacteria 63633
700 Ga0500622_0000978 3300053156 Bacteria 24237
701 Ga0500622_0001316 3300053156 Bacteria 20204
702 Ga0500636_0000546 3300053177 Bacteria 20487
703 Ga0500637_0049141 3300053178 Bacteria 2400
704 Ga0500570_017506 3300053724 Bacteria 4012
705 Ga0500625_003794 3300053729 Bacteria 6042
706 Ga0500645_005101 3300053730 Bacteria 4901
707 Ga0587084_000161 3300059477 Bacteria 4157
708 Ga0587077_004690 3300059493 Bacteria 1816
709 Ga0587083_0000179 3300059505 Bacteria 4486
710 Ga0587091_002613 3300059511 Bacteria 2162
711 Ga0466962_0000718 3300061719 Bacteria 14786
712 2526214051 2526164512 Bacteria 4025691
713 2587725916 2585428057 Bacteria 6737412
714 2587735567 2585428058 Bacteria 6853932
715 2587758994 2585428062 Bacteria 6842168
716 2588292871 2588253510 Bacteria 6901809
717 2643746680 2643221544 Bacteria 5886209
718 2643937428 2643221585 Bacteria 5812563
719 2643967980 2643221592 Bacteria 6608788
720 2644143120 2643221625 Bacteria 6512927
721 2644218746 2643221639 Bacteria 6649903
722 2644247744 2643221644 Bacteria 6865017
723 2644256833 2643221646 Bacteria 6433402
724 2644271792 2643221648 Bacteria 6521465
725 2644314966 2643221656 Bacteria 5809961
726 2644338017 2643221660 Bacteria 4208257
727 2739057979 2738541337 Bacteria 6183410
728 2831867521 2831864461 Bacteria 6502356
729 2843691342 2843690924 Bacteria 5169057
730 2846041881 2846037992 Bacteria 4526407
731 2886854497 2886848708 Bacteria 5632523
732 2998344565 2998344455 Bacteria 4222996
733 Ga0070696_100002331
734 SwRhRL2b_contig_2192316
735 SwRhRL2b_contig_3781963
736 JGI25156J39149_1004911
737 JGI25154J39366_1000593
738 JGI25157J39369_1001134
739 JGI25152J39213_1001073
740 Ga0006759J45824_1058692
741 JGI25153J46596_10007740
742 JGI25153J46596_10008637
743 Ga0006770J48903_1001899
744 Ga0007417J51691_1035112
745 Ga0007417J51691_1049740
746 Ga0007409J51694_1024055
747 Ga0007409J51694_1054348
748 Ga0032354_1038706
749 Ga0055539_1002928
750 Ga0055533_1000043
751 Ga0055525_1000161
752 Ga0055525_1000641
753 Ga0055529_1000322
754 Ga0055526_1000791
755 Ga0055526_1003343
756 Ga0055524_1000140
757 Ga0055524_1014215
758 Ga0055524_1014222
759 Ga0055540_1000133
760 Ga0055531_10002079
761 Ga0055531_10002114
762 Ga0055531_10017353
763 Ga0055531_10018264
764 Ga0055543_1008713
765 Ga0065165_1001259
766 Ga0065165_1006303
767 Ga0065704_10084897
768 Ga0070676_10016655
769 Ga0070690_100004546
770 Ga0070690_100006927
771 Ga0070670_100113053
772 Ga0068869_100000239
773 Ga0068869_100006377
774 Ga0068869_100034548
775 Ga0068869_100086944
776 Ga0070666_10026200
777 Ga0070680_100024534
778 Ga0070680_100074249
779 Ga0070682_100010140
780 Ga0068868_100001937
781 Ga0068868_100019350
782 Ga0070689_100001590
783 Ga0070691_10001529
784 Ga0070687_100000486
785 Ga0070687_100026194
786 Ga0070661_100017861
787 Ga0070692_10002474
788 Ga0070692_10057319
789 Ga0070668_100037251
790 Ga0070668_100077806
791 Ga0070675_100031603
792 Ga0070675_100105361
793 Ga0070671_100128717
794 Ga0070674_100024935
795 Ga0070659_100031644
796 Ga0070659_100034805
797 Ga0070659_100099692
798 Ga0070667_100021984
799 Ga0070667_100065424
800 Ga0070703_10008050
801 Ga0070701_10002480
802 Ga0070701_10055948
803 Ga0070705_100003035
804 Ga0070705_100004302
805 Ga0070705_100021556
806 Ga0070700_100000762
807 Ga0070700_100006166
808 Ga0070694_100001615
809 Ga0070694_100016518
810 Ga0070663_100007236
811 Ga0070678_100025705
812 Ga0070678_100031069
813 Ga0070678_100045788
814 Ga0070678_100089312
815 Ga0070678_100156718
816 Ga0070678_100174405
817 Ga0070662_100029922
818 Ga0070662_100094760
819 Ga0070662_100118646
820 Ga0068867_100000552
821 Ga0068867_100002002
822 Ga0068867_100011425
823 Ga0068867_100020018
824 Ga0068867_100057427
825 Ga0068867_100111811
826 Ga0070706_100025301
827 Ga0070706_100221825
828 Ga0070707_100035242
829 Ga0070699_100093735
830 Ga0070679_100073605
831 Ga0070697_100081928
832 Ga0070672_100006187
833 Ga0070672_100080695
834 Ga0070686_100000984
835 Ga0070686_100008478
836 Ga0070686_100032410
837 Ga0070686_100067397
838 Ga0070695_100001266
839 Ga0070696_100004428
840 Ga0070696_100006223
841 Ga0070693_100000371
842 Ga0070704_100003415
843 Ga0068855_100025005
844 Ga0068855_100058607
845 Ga0070664_100052006
846 Ga0070664_100162212
847 Ga0068854_100013936
848 Ga0068854_100057142
849 Ga0068856_100020864
850 Ga0068856_100097613
851 Ga0070702_100010189
852 Ga0068852_100022501
853 Ga0068852_100128028
854 Ga0068859_100011503
855 Ga0068859_100026836
856 Ga0068859_100099187
857 Ga0068859_100257898
858 Ga0068864_100072837
859 Ga0068864_100075230
860 Ga0068866_10000800
861 Ga0068866_10025655
862 Ga0068866_10030317
863 Ga0068861_100001378
864 Ga0068851_10038775
865 Ga0068863_100043166
866 Ga0068863_100114566
867 Ga0068858_100003490
868 Ga0068858_100008125
869 Ga0068858_100013226
870 Ga0068860_100017732
871 Ga0068860_100210642
872 Ga0068862_100006216
873 Ga0075364_10006811
874 Ga0075367_10006379
875 Ga0075367_10139916
876 Ga0075369_10038643
877 Ga0075366_10000776
878 Ga0075366_10000795
879 Ga0075366_10014839
880 Ga0075366_10042212
881 Ga0075366_10049359
882 Ga0075366_10054872
883 Ga0075366_10057073
884 Ga0075366_10074063
885 Ga0097621_100006235
886 Ga0097621_100034891
887 Ga0075370_10000073
888 Ga0075370_10002824
889 Ga0075370_10017764
890 Ga0075370_10026837
891 Ga0075370_10029197
892 Ga0075370_10034187
893 Ga0075370_10050932
894 Ga0075370_10071693
895 Ga0068871_100001793
896 Ga0068871_100003989
897 Ga0068871_100019288
898 Ga0068871_100105535
899 Ga0075430_100025991
900 Ga0075431_100001591
901 Ga0075434_100012054
902 Ga0075434_100074019
903 Ga0075429_100000220
904 Ga0068865_100001223
905 Ga0068865_100015724
906 Ga0075436_100005646
907 Ga0075436_100021757
908 Ga0097620_100011503
909 Ga0097620_100026836
910 Ga0097620_100099189
911 Ga0097620_100257889
912 Ga0099823_1000064
913 Ga0079104_1000027
914 Ga0079104_1000053
915 Ga0075435_100005357
916 Ga0105250_10000154
917 Ga0105240_10094682
918 Ga0111539_10009725
919 Ga0111539_10068668
920 Ga0105245_10002556
921 Ga0105245_10041497
922 Ga0105247_10104494
923 Ga0114129_10011902
924 Ga0105243_10002265
925 Ga0105243_10003107
926 Ga0105243_10064706
927 Ga0105243_10286282
928 Ga0105241_10022719
929 Ga0105242_10002800
930 Ga0105242_10113993
931 Ga0105248_10006768
932 Ga0105248_10010314
933 Ga0105248_10051737
934 Ga0105248_10053048
935 Ga0105248_10210595
936 Ga0105237_10020609
937 Ga0105238_10156201
938 Ga0105249_10022359
939 Ga0105249_10094485
940 Ga0105239_10367525
941 Ga0157319_1000005
942 Ga0157369_10034850
943 Ga0157374_10001882
944 Ga0157374_10032559
945 Ga0157378_10007830
946 Ga0157378_10010736
947 Ga0157378_10021107
948 Ga0157372_10023087
949 Ga0157375_10119615
950 Ga0157375_10235679
951 Ga0163163_10035651
952 Ga0157380_10050662
953 Ga0157377_10000368
954 Ga0157377_10024611
955 Ga0157379_10060934
956 Ga0157379_10203335
957 Ga0157376_10008899
958 Ga0157376_10055495
959 Ga0182007_10001550
960 Ga0183362_10007
961 Ga0163161_10046651
962 Ga0163161_10180311
963 Ga0213872_10000672
964 Ga0213872_10001745
965 Ga0213872_10008389
966 Ga0209674_100067
967 Ga0209563_100068
968 Ga0209563_100088
969 Ga0207427_100260
970 Ga0209258_102113
971 Ga0207425_1000680
972 Ga0209646_1000127
973 Ga0209026_1000004
974 Ga0209677_100201
975 Ga0209148_1005675
976 Ga0209759_1000129
977 Ga0209129_1000158
978 Ga0207666_1001550
979 Ga0209673_1004093
980 Ga0209673_1013154
981 Ga0209673_1024966
982 Ga0209564_1000008
983 Ga0209564_1000282
984 Ga0209758_1000910
985 Ga0209758_1011080
986 Ga0209050_1000223
987 Ga0209050_1001097
988 Ga0209050_1004273
989 Ga0209256_1000045
990 Ga0209256_1013217
991 Ga0209256_1013663
992 Ga0209051_1000004
993 Ga0209051_1000938
994 Ga0209051_1001129
995 Ga0209051_1005321
996 Ga0209257_1000047
997 Ga0209257_1000315
998 Ga0209257_1005397
999 Ga0209257_1016630
1000 Ga0207696_1000388
1001 Ga0207653_10008869
1002 Ga0207682_10005373
1003 Ga0207642_10002949
1004 Ga0207688_10015650
1005 Ga0207688_10017544
1006 Ga0207680_10018346
1007 Ga0207645_10012543
1008 Ga0207705_10036816
1009 Ga0207684_10083450
1010 Ga0207654_10011744
1011 Ga0207695_10071432
1012 Ga0207660_10001979
1013 Ga0207662_10000006
1014 Ga0207662_10056037
1015 Ga0207657_10113023
1016 Ga0207649_10001794
1017 Ga0207649_10004699
1018 Ga0207652_10002940
1019 Ga0207652_10016184
1020 Ga0207646_10033831
1021 Ga0207681_10005925
1022 Ga0207650_10002454
1023 Ga0207659_10009985
1024 Ga0207659_10070736
1025 Ga0207687_10005454
1026 Ga0207644_10015416
1027 Ga0207644_10105990
1028 Ga0207690_10001731
1029 Ga0207690_10053849
1030 Ga0207706_10045417
1031 Ga0207686_10001285
1032 Ga0207709_10000514
1033 Ga0207709_10001005
1034 Ga0207709_10023017
1035 Ga0207670_10005544
1036 Ga0207669_10016743
1037 Ga0207704_10000913
1038 Ga0207665_10034250
1039 Ga0207691_10002550
1040 Ga0207691_10028424
1041 Ga0207691_10029540
1042 Ga0207691_10116257
1043 Ga0207711_10009785
1044 Ga0207711_10029255
1045 Ga0207711_10049630
1046 Ga0207711_10105192
1047 Ga0207711_10145890
1048 Ga0207689_10000292
1049 Ga0207689_10000370
1050 Ga0207689_10015223
1051 Ga0207689_10019913
1052 Ga0207689_10023735
1053 Ga0207689_10025393
1054 Ga0207661_10026944
1055 Ga0207661_10248214
1056 Ga0207679_10001498
1057 Ga0207667_10002489
1058 Ga0207651_10004839
1059 Ga0207651_10052924
1060 Ga0207712_10002872
1061 Ga0207668_10008000
1062 Ga0207668_10081268
1063 Ga0207640_10005155
1064 Ga0207658_10002481
1065 Ga0207658_10004786
1066 Ga0207677_10006249
1067 Ga0207677_10018325
1068 Ga0207677_10062254
1069 Ga0207703_10002613
1070 Ga0207703_10004381
1071 Ga0207703_10023589
1072 Ga0207703_10041315
1073 Ga0207703_10060243
1074 Ga0207708_10004151
1075 Ga0207708_10010574
1076 Ga0207708_10077488
1077 Ga0207708_10095717
1078 Ga0207702_10001875
1079 Ga0207702_10004993
1080 Ga0207702_10019596
1081 Ga0207641_10028453
1082 Ga0207648_10002176
1083 Ga0207648_10004469
1084 Ga0207648_10004560
1085 Ga0207648_10015751
1086 Ga0207648_10016373
1087 Ga0207648_10017221
1088 Ga0207676_10014207
1089 Ga0207674_10004293
1090 Ga0207675_100000184
1091 Ga0207675_100024184
1092 Ga0207683_10005923
1093 Ga0207683_10176354
1094 Ga0207698_10017410
1095 Ga0207698_10022009
1096 Ga0207698_10064301
1097 Ga0207698_10084113
1098 Ga0207698_10153668
1099 Ga0209281_1000002
1100 Ga0209281_1000147
1101 Ga0209389_1000305
1102 Ga0209974_10000149
1103 Ga0207428_10008382
1104 Ga0207428_10081909
1105 Ga0268266_10024735
1106 Ga0268266_10125219
1107 Ga0268266_10143537
1108 Ga0268265_10004065
1109 Ga0268265_10049769
1110 Ga0268264_10002070
1111 Ga0268264_10003087
1112 Ga0268264_10023642
1113 Ga0268264_10037499
1114 Ga0265334_10036200
1115 Ga0265323_10008261
1116 Ga0265336_10000028
1117 Ga0265336_10000618
1118 Ga0307515_10000063
1119 Ga0307515_10000096
1120 Ga0307515_10008919
1121 Ga0307515_10012540
1122 Ga0307515_10144809
1123 Ga0265324_10000002
1124 Ga0265324_10000286
1125 Ga0307511_10000653
1126 Ga0265332_10000030
1127 Ga0265328_10024135
1128 Ga0265325_10002273
1129 Ga0265331_10023731
1130 Ga0265327_10000020
1131 Ga0265327_10000077
1132 Ga0265327_10000178
1133 Ga0265327_10006182
1134 Ga0265316_10000201
1135 Ga0307513_10004080
1136 Ga0307513_10019109
1137 Ga0307513_10088851
1138 Ga0307509_10000050
1139 Ga0307509_10003616
1140 Ga0307509_10036139
1141 Ga0307509_10042288
1142 Ga0307408_100000089
1143 Ga0307408_100033743
1144 Ga0307408_100037446
1145 Ga0307508_10000392
1146 Ga0307508_10012217
1147 Ga0307514_10032734
1148 Ga0307516_10000048
1149 Ga0307516_10004016
1150 Ga0307516_10005443
1151 Ga0307516_10014003
1152 Ga0307516_10019197
1153 Ga0307405_10023807
1154 Ga0307405_10034470
1155 Ga0307413_10089570
1156 Ga0307410_10138782
1157 Ga0307406_10004866
1158 Ga0307406_10149842
1159 Ga0307407_10022057
1160 Ga0307412_10011559
1161 Ga0307409_100000577
1162 Ga0307416_100002818
1163 Ga0307416_100030487
1164 Ga0307414_10054020
1165 Ga0307411_10000085
1166 Ga0307411_10053460
1167 Ga0307411_10115775
1168 Ga0307415_100016637
1169 Ga0307510_10053339
1170 Ga0307510_10081095
1171 Ga0373952_0000408
1172 Ga0373954_0000068
1173 Ga0373960_0000482
1174 Ga0373931_0000535
1175 Ga0373931_0001474
1176 Ga0373931_0008420
1177 Ga0373933_0063556
1178 Ga0373937_0002051
1179 Ga0373937_0002498
1180 Ga0373937_0003228
1181 Ga0373937_0039449
1182 Ga0373937_0127585
1183 Ga0373925_0024012
1184 Ga0395898_0012209
1185 Ga0395905_0000084
1186 Ga0395905_0002507
1187 Ga0395905_0008972
1188 Ga0395905_0013480
1189 Ga0395905_0024456
1190 Ga0395905_0043124
1191 Ga0395901_0001925
1192 Ga0436361_0021545
1193 Ga0436361_0050017
1194 Ga0436361_0148596
1195 Ga0436361_0395777
1196 Ga0436361_0402240
1197 Ga0436361_0776332
1198 Ga0439436_0003093
1199 Ga0439466_0042966
1200 Ga0439465_0010238
1201 Ga0451800_0757929
1202 Ga0439431_0002191
1203 Ga0439433_0000255
1204 Ga0439433_0002915
1205 Ga0439442_016531
1206 Ga0439432_001484
1207 Ga0439449_0002613
1208 Ga0439449_0013168
1209 Ga0439449_0015300
1210 Ga0439462_0009262
1211 Ga0450917_000001
1212 Ga0450919_000025
1213 Ga0450890_000550
1214 Ga0450891_000655
1215 Ga0450892_001248
1216 Ga0450889_000161
1217 Ga0439464_0005574
1218 Ga0450918_000123
1219 Ga0451577_0000013
1220 Ga0451577_0000191
1221 Ga0451577_0003495
1222 Ga0451577_0004247
1223 Ga0451577_0004524
1224 Ga0451577_0008554
1225 Ga0451577_0010916
1226 Ga0451577_0016336
1227 Ga0451577_0027488
1228 Ga0451577_0035504
1229 Ga0451577_0040503
1230 Ga0451577_0056781
1231 Ga0451577_0252530
1232 Ga0466969_0000018
1233 Ga0466969_0001561
1234 Ga0466969_0002589
1235 Ga0466969_0011638
1236 Ga0466972_0001480
1237 Ga0466972_0008302
1238 Ga0453683_0000059
1239 Ga0453683_0003443
1240 Ga0453683_0030645
1241 Ga0453683_0101952
1242 Ga0466965_0021276
1243 Ga0466966_0003056
1244 Ga0466966_0009766
1245 Ga0466961_0000649
1246 Ga0466961_0004306
1247 Ga0466961_0005561
1248 Ga0466961_0051858
1249 Ga0466964_0000637
1250 Ga0453684_0000014
1251 Ga0453684_0000585
1252 Ga0453684_0000590
1253 Ga0453684_0000682
1254 Ga0453684_0000989
1255 Ga0453684_0002255
1256 Ga0453684_0003526
1257 Ga0453684_0004092
1258 Ga0453684_0035225
1259 Ga0453684_0040166
1260 Ga0453684_0050212
1261 Ga0453684_0052439
1262 Ga0453684_0084439
1263 Ga0453684_0199731
1264 Ga0466971_0002433
1265 Ga0466959_0003145
1266 Ga0466959_0027088
1267 Ga0466959_0071231
1268 Ga0466959_0074705
1269 Ga0451576_0000018
1270 Ga0451576_0000096
1271 Ga0451576_0000909
1272 Ga0451576_0003670
1273 Ga0451576_0005877
1274 Ga0451576_0012409
1275 Ga0451576_0031258
1276 Ga0451576_0065178
1277 Ga0451576_0087215
1278 Ga0451576_0159884
1279 Ga0466958_0002207
1280 Ga0466967_0056667
1281 Ga0495592_0000203
1282 Ga0495592_0002237
1283 Ga0495590_0004188
1284 Ga0495639_0019706
1285 Ga0495662_0003778
1286 Ga0495583_0000510
1287 Ga0495606_0100121
1288 Ga0495608_0001279
1289 Ga0495610_0007369
1290 Ga0495628_0004691
1291 Ga0495630_0008576
1292 Ga0495666_0008444
1293 Ga0495640_0002705
1294 Ga0495667_0004473
1295 Ga0495634_0003763
1296 Ga0495625_0006868
1297 Ga0495588_0009938
1298 Ga0495588_0039664
1299 Ga0495599_0025758
1300 Ga0495658_0042037
1301 Ga0495624_0015133
1302 Ga0495649_0000961
1303 Ga0495589_0004694
1304 Ga0495600_0002534
1305 Ga0495660_0020694
1306 Ga0495680_0001155
1307 Ga0495680_0056613
1308 Ga0495687_005633
1309 Ga0495684_0047749
1310 Ga0495684_0086098
1311 Ga0495686_0004619
1312 Ga0495686_0045988
1313 Ga0495615_0006925
1314 Ga0496100_0027093
1315 Ga0496102_0007579
1316 Ga0496104_0008378
1317 Ga0496104_0032222
1318 Ga0496105_0009457
1319 Ga0496106_0019165
1320 Ga0496106_0081769
1321 Ga0496107_0175168
1322 Ga0496108_0005999
1323 Ga0496108_0009350
1324 Ga0496108_0085225
1325 Ga0496108_0087672
1326 Ga0496109_0029780
1327 Ga0496109_0116713
1328 Ga0496109_0402236
1329 Ga0496111_0004330
1330 Ga0496113_0078179
1331 Ga0496114_0018690
1332 Ga0496114_0109050
1333 Ga0496122_0000317
1334 Ga0496123_0000264
1335 Ga0496124_0001830
1336 Ga0496124_0018476
1337 Ga0496124_0054047
1338 Ga0496125_0013937
1339 Ga0501306_000065
1340 Ga0501308_000024
1341 Ga0501309_000014
1342 Ga0501310_000059
1343 Ga0501304_000014
1344 Ga0501305_000004
1345 Ga0501307_000035
1346 Ga0501307_000768
1347 Ga0501290_001164
1348 Ga0501300_000354
1349 Ga0501312_000016
1350 Ga0501314_000017
1351 Ga0501320_000736
1352 Ga0501323_000391
1353 Ga0501034_0002599
1354 Ga0501034_0058119
1355 Ga0501072_0005915
1356 Ga0501211_000022
1357 Ga0501233_000911
1358 Ga0501253_000109
1359 Ga0501221_000628
1360 Ga0501234_002259
1361 Ga0501267_000154
1362 Ga0501280_000425
1363 Ga0501282_003978
1364 nmdc:mga03683_4530_c1
1365 nmdc:mga00v17_3171_c1
1366 nmdc:mga0yw44_23737_c1
1367 nmdc:mga0k408_148478_c1
1368 nmdc:mga0k408_15101_c1
1369 nmdc:mga0k408_18100_c1
1370 nmdc:mga0k408_18596_c1
1371 nmdc:mga0k408_18793_c1
1372 nmdc:mga0k408_219_c1
1373 nmdc:mga0k408_26729_c1
1374 nmdc:mga0k408_26934_c1
1375 nmdc:mga0k408_27847_c1
1376 nmdc:mga0k408_28221_c1
1377 nmdc:mga0k408_29491_c1
1378 nmdc:mga0k408_32503_c2
1379 nmdc:mga0k408_36444_c1
1380 nmdc:mga0k408_3994_c1
1381 nmdc:mga0k408_57205_c1
1382 nmdc:mga0k408_71261_c1
1383 nmdc:mga0k408_712_c1
1384 nmdc:mga0k408_8169_c1
1385 nmdc:mga06z11_25710_c1
1386 nmdc:mga04h51_7776_c1
1387 nmdc:mga07m45_13904_c1
1388 nmdc:mga07m45_15177_c1
1389 nmdc:mga07m45_15265_c1
1390 nmdc:mga07m45_17717_c1
1391 nmdc:mga07m45_27655_c1
1392 nmdc:mga07m45_2931_c1
1393 nmdc:mga07m45_29374_c1
1394 nmdc:mga07m45_45157_c1
1395 nmdc:mga07m45_670_c1
1396 nmdc:mga07m45_96172_c1
1397 nmdc:mga05p37_431_c1
1398 nmdc:mga09592_229_c1
1399 nmdc:mga0qj67_126143_c1
1400 nmdc:mga06r32_2818_c1
1401 nmdc:mga06r32_75350_c1
1402 nmdc:mga08y16_20591_c1
1403 nmdc:mga08y16_217775_c1
1404 nmdc:mga08y16_83182_c1
1405 nmdc:mga0n895_2822_c1
1406 nmdc:mga0n895_30950_c1
1407 nmdc:mga0rr50_301_c1
1408 nmdc:mga0rr50_74236_c1
1409 nmdc:mga08x19_20089_c1
1410 nmdc:mga0a205_217_c1
1411 nmdc:mga0a205_68874_c1
1412 Ga0495601_0088649
1413 Ga0500635_0000036
1414 Ga0500578_0000292
1415 Ga0500578_0087572
1416 Ga0500583_0002645
1417 Ga0500651_0000274
1418 Ga0500651_0021092
1419 Ga0500594_0002998
1420 Ga0500607_007242
1421 Ga0500642_0007842
1422 Ga0500652_000400
1423 Ga0500658_0032701
1424 Ga0500559_0000097
1425 Ga0500559_0024900
1426 Ga0500561_0004276
1427 Ga0500568_0025695
1428 Ga0500590_007064
1429 Ga0500604_0000352
1430 Ga0500619_000012
1431 Ga0500622_0000198
1432 Ga0500622_0000978
1433 Ga0500622_0001316
1434 Ga0500636_0000546
1435 Ga0500637_0049141
1436 Ga0500570_017506
1437 Ga0500625_003794
1438 Ga0500645_005101
1439 Ga0587084_000161
1440 Ga0587077_004690
1441 Ga0587083_0000179
1442 Ga0587091_002613
1443 Ga0466962_0000718
1444 2526214051
1445 2587725916
1446 2587735567
1447 2587758994
1448 2588292871
1449 2643746680
1450 2643937428
1451 2643967980
1452 2644143120
1453 2644218746
1454 2644247744
1455 2644256833
1456 2644271792
1457 2644314966
1458 2644338017
1459 2739057979
1460 2831867521
1461 2843691342
1462 2846041881
1463 2886854497
1464 2998344565

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00344

SecY

SecY

55

390

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nco-assembly1.cif.gz_g quaternary complex between srp, sr, and secyeg bound to the translating ribosome 0.8375 15 396
5aww-assembly1.cif.gz_Y precise resting state of thermus thermophilus secyeg 0.8304 16 398
5ch4-assembly1.cif.gz_Y peptide-bound state of thermus thermophilus secyeg 0.8079 3 398
5gae-assembly1.cif.gz_g rnc in complex with a translocating secyeg 0.807 12 393
2zqp-assembly1.cif.gz_Y crystal structure of secye translocon from thermus thermophilus 0.8067 15 396
ID Description Score Start End Superfamily
af_P0AGA2_15_429_1.10.3370.10 Mainly Alpha;Orthogonal Bundle;Preprotein translocase SecY subunit;SecY subunit domain 0.8953 14 396 1.10.3370.10
af_P9WGN3_1_436_1.10.3370.10 Mainly Alpha;Orthogonal Bundle;Preprotein translocase SecY subunit;SecY subunit domain 0.8585 16 396 1.10.3370.10
af_P0AGA2_15_429_1.10.3370.10 Mainly Alpha;Orthogonal Bundle;Preprotein translocase SecY subunit;SecY subunit domain 0.8362 14 396 1.10.3370.10
af_O08387_1_424_1.10.3370.10 Mainly Alpha;Orthogonal Bundle;Preprotein translocase SecY subunit;SecY subunit domain 0.836 16 403 1.10.3370.10
af_K7KK87_7_168_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8358 241 396 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A376S1L6-F1-model_v4 deleted 0.963 193 366
AF-A0A3D5UYY6-F1-model_v4 Preprotein translocase subunit SecY 0.9473 245 370 GO:0015031
GO:0016020
AF-A0A376S1L6-F1-model_v4 deleted 0.9472 193 366
AF-K1Z7S7-F1-model_v4 Preprotein translocase subunit SecY 0.9412 175 333 GO:0015031
GO:0016020
AF-A0A3D5UYY6-F1-model_v4 Preprotein translocase subunit SecY 0.94 245 370 GO:0015031
GO:0016020

Map