F478010

General Info

Members Datasets Scaffolds Average Seq Length
732 379 706 454

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100063204|Ga0070706_1000632042
Length 531
Sequence MGLLRTFPRGGVGILRGGCGRAKGSGACTIPGDLKSVAILVDASGREEQPLRAASARNKQDGQSRSATKLSSLDPVDRAVASGLERTGRFVNRHPRSITSAVMLALAGFGATAFGIAPLAPDAADLPSRIVTENVTPESIDSQLEALAAHELELYRSDLTRASDTADSLLRRLNVDDAQAAGFVRSDAAARRLLAGRAGKMVQVRTGANGELEELVARYAADNTEQFATHFTRLRITRAGGKFQTSVETAPLAAQVRLGSGTIRNSLFAATDEAHIPDAVASQIAEIFATDVDFHRELRRGDSFRVIYEALTADGEPITWNQSSGRVMAAEFINNGKTYTAVWFKDASGKGGYFDMNGQSKRRSFLAAPLEFSRVTSGFAMRFHPILQTWKQHNGVDYGAPSGTPVRTVGDGTVDFAGWQNGYGNVVSIKHSNDRSTVYAHLSRVDVRRGQHVDQGMRIGAVGMTGWATGPHLHFEVKQHGMQQNPLTIAKASETLTIAPAAKPQFAQLAQGVRAQLDAAQTVAGSAMYAE

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
7 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
8 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
9 2643221660 Methylibium sp. Root1272 Isolate Unclassified
10 2721755523 Delftia sp. HK171 Isolate Unclassified
11 2738543013 Variovorax sp. BT01 Isolate Unclassified
12 2831864461 Roseateles noduli HZ7 Isolate Nodule
13 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
14 2842677519 Variovorax sp. R-72495 Isolate Unclassified
15 2842733646 Variovorax sp. R-72446 Isolate Unclassified
16 2842747753 Variovorax sp. R-72060 Isolate Unclassified
17 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
18 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
19 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
20 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
21 2904456579 Variovorax sp. 2002 Isolate Unclassified
22 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
23 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
24 2929520902 Variovorax beijingensis 502 Isolate Unclassified
25 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
26 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
27 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
28 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
29 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
30 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
36 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
37 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
38 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
39 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
40 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
41 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
42 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
43 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
108 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
135 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
138 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
143 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
144 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
145 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
148 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
149 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
207 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
208 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
212 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
216 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
217 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
218 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
219 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
220 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
221 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
222 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
223 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
224 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
225 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
226 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
227 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
228 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
229 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
230 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
231 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
232 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
233 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
250 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
251 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
252 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
253 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
254 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
255 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
256 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
257 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
258 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
259 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
260 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
261 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
262 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
263 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
264 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
265 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
266 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
267 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
268 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
269 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
270 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
271 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
272 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
273 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
274 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
275 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
276 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
277 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
278 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
279 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
280 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
281 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
282 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
283 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
284 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
285 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
286 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
287 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
288 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
289 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
290 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
291 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
294 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
295 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
296 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
297 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
298 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
299 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
302 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
303 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
304 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
307 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
308 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
309 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
312 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
313 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
314 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
315 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
316 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
319 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
320 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
323 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
324 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
325 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
326 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
327 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
328 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
329 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
330 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
331 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
334 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
347 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
348 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
349 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
353 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
354 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
355 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
356 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
357 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
358 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
359 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
360 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
361 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
362 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
363 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
366 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
367 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
368 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
369 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
370 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
371 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
372 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
373 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
374 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
375 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
376 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
377 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
378 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
379 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.9
Metatranscriptomes 0.41
Isolates 3.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.17
Nodule 0.82
Rhizoplane 2.87
Rhizosphere 67.08
Stem 0
Stem Tuber 0
Unclassified 8.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1002558 3300002705 Bacteria 6454
2 JGI25154J39366_1004695 3300002738 Bacteria 2366
3 JGI25157J39369_1000267 3300002741 Bacteria 38232
4 JGI25153J46596_10002860 3300003215 Bacteria 9807
5 rootH1_10012758 3300003316 Bacteria 8702
6 rootH1_10012758 3300003323 Bacteria 4964
7 rootH1_10083585 3300003316 Bacteria 3863
8 rootL2_10003381 3300003322 Bacteria 63123
9 rootL2_10087698 3300003322 Bacteria 3532
10 rootL2_10106425 3300003322 Bacteria 3907
11 rootH1_10013830 3300003323 Bacteria 3134
12 rootH1_10060360 3300003323 Bacteria 2463
13 rootH1_10069288 3300003323 Bacteria 2808
14 Ga0006562J51391_1042152 3300003578 Bacteria 3520
15 Ga0055539_1000550 3300003752 Bacteria 10874
16 Ga0055539_1001108 3300003752 Bacteria 5590
17 Ga0055533_1000045 3300003756 Bacteria 223637
18 Ga0055525_1000004 3300003759 Bacteria 888039
19 Ga0055525_1000632 3300003759 Bacteria 14353
20 Ga0055535_1000047 3300003761 Bacteria 139836
21 Ga0055529_1000148 3300003763 Bacteria 100809
22 Ga0055526_1001509 3300003771 Bacteria 16488
23 Ga0055526_1002656 3300003771 Bacteria 11933
24 Ga0055524_1000247 3300003775 Bacteria 56379
25 Ga0055524_1002449 3300003775 Bacteria 9548
26 Ga0055524_1003709 3300003775 Bacteria 7308
27 Ga0055534_1002527 3300003784 Bacteria 6276
28 Ga0055530_10003306 3300003791 Bacteria 9321
29 Ga0055540_1000260 3300003792 Bacteria 47714
30 Ga0055540_1006264 3300003792 Bacteria 4762
31 Ga0055540_1008623 3300003792 Bacteria 3649
32 Ga0055531_10004940 3300003794 Bacteria 7929
33 Ga0055531_10008285 3300003794 Bacteria 5520
34 Ga0055531_10009185 3300003794 Bacteria 5090
35 Ga0055543_1004417 3300004625 Bacteria 3851
36 Ga0065165_1000290 3300005262 Bacteria 85623
37 Ga0065165_1001688 3300005262 Bacteria 22283
38 Ga0065165_1005747 3300005262 Bacteria 6812
39 Ga0065714_10010259 3300005288 Bacteria 5056
40 Ga0070690_100004054 3300005330 Bacteria 8110
41 Ga0070690_100027300 3300005330 Bacteria 3529
42 Ga0070670_100005551 3300005331 Bacteria 10640
43 Ga0070670_100006917 3300005331 Bacteria 9615
44 Ga0070670_100010262 3300005331 Bacteria 7992
45 Ga0070670_100026772 3300005331 Bacteria 4960
46 Ga0070670_100044235 3300005331 Bacteria 3829
47 Ga0070670_100105924 3300005331 Bacteria 2423
48 Ga0070670_100118273 3300005331 Bacteria 2285
49 Ga0068869_100024040 3300005334 Bacteria 4218
50 Ga0070666_10032453 3300005335 Bacteria 3449
51 Ga0070680_100025814 3300005336 Bacteria 4697
52 Ga0068868_100022196 3300005338 Bacteria 4788
53 Ga0068868_100079731 3300005338 Bacteria 2623
54 Ga0068868_100111977 3300005338 Bacteria 2218
55 Ga0070660_100015360 3300005339 Bacteria 5525
56 Ga0070660_100023302 3300005339 Bacteria 4586
57 Ga0070660_100026833 3300005339 Bacteria 4292
58 Ga0070689_100012386 3300005340 Bacteria 6142
59 Ga0070691_10053453 3300005341 Bacteria 1932
60 Ga0070687_100013556 3300005343 Bacteria 3636
61 Ga0070661_100000361 3300005344 Bacteria 35932
62 Ga0070661_100025217 3300005344 Bacteria 4272
63 Ga0070692_10043595 3300005345 Bacteria 2308
64 Ga0070668_100003480 3300005347 Bacteria 11615
65 Ga0070668_100111676 3300005347 Bacteria 2176
66 Ga0070668_100112479 3300005347 Bacteria 2168
67 Ga0070669_100002701 3300005353 Bacteria 12795
68 Ga0070669_100013341 3300005353 Bacteria 5840
69 Ga0070675_100000703 3300005354 Bacteria 23209
70 Ga0070675_100002723 3300005354 Bacteria 13282
71 Ga0070675_100012549 3300005354 Bacteria 6642
72 Ga0070675_100034117 3300005354 Bacteria 4128
73 Ga0070675_100189509 3300005354 Bacteria 1781
74 Ga0070671_100002088 3300005355 Bacteria 15388
75 Ga0070671_100004115 3300005355 Bacteria 11486
76 Ga0070671_100018389 3300005355 Bacteria 5676
77 Ga0070671_100026675 3300005355 Bacteria 4751
78 Ga0070674_100001813 3300005356 Bacteria 11593
79 Ga0070674_100004415 3300005356 Bacteria 8019
80 Ga0070674_100004918 3300005356 Bacteria 7656
81 Ga0070674_100034797 3300005356 Bacteria 3367
82 Ga0070673_100009469 3300005364 Bacteria 6538
83 Ga0070673_100015757 3300005364 Bacteria 5321
84 Ga0070673_100040286 3300005364 Bacteria 3583
85 Ga0070673_100055040 3300005364 Bacteria 3133
86 Ga0070659_100001606 3300005366 Bacteria 16262
87 Ga0070659_100164693 3300005366 Bacteria 1814
88 Ga0070659_100188672 3300005366 Bacteria 1694
89 Ga0070659_100195089 3300005366 Bacteria 1665
90 Ga0070667_100006775 3300005367 Bacteria 9512
91 Ga0070667_100008119 3300005367 Bacteria 8705
92 Ga0070667_100036643 3300005367 Bacteria 4113
93 Ga0070663_100098121 3300005455 Bacteria 2182
94 Ga0070678_100009710 3300005456 Bacteria 5846
95 Ga0070678_100013404 3300005456 Bacteria 5139
96 Ga0070678_100051450 3300005456 Bacteria 2986
97 Ga0070678_100122314 3300005456 Bacteria 2054
98 Ga0070662_100022134 3300005457 Bacteria 4347
99 Ga0070662_100075344 3300005457 Bacteria 2498
100 Ga0070681_10062170 3300005458 Bacteria 3708
101 Ga0070681_10139067 3300005458 Bacteria 2358
102 Ga0068867_100000120 3300005459 Bacteria 49908
103 Ga0068867_100002943 3300005459 Bacteria 11989
104 Ga0068867_100007438 3300005459 Bacteria 7746
105 Ga0068867_100054036 3300005459 Bacteria 2967
106 Ga0070706_100063204 3300005467 Bacteria 3421
107 Ga0070679_100013044 3300005530 Bacteria 7957
108 Ga0070679_100062147 3300005530 Bacteria 3723
109 Ga0070672_100000177 3300005543 Bacteria 35110
110 Ga0070672_100005324 3300005543 Bacteria 8521
111 Ga0070672_100006490 3300005543 Bacteria 7862
112 Ga0070672_100020259 3300005543 Bacteria 4847
113 Ga0070672_100027809 3300005543 Bacteria 4222
114 Ga0070672_100079594 3300005543 Bacteria 2623
115 Ga0070672_100123912 3300005543 Bacteria 2118
116 Ga0070665_100009614 3300005548 Bacteria 9781
117 Ga0068855_100007548 3300005563 Bacteria 13156
118 Ga0068855_100048080 3300005563 Bacteria 5036
119 Ga0068855_100069769 3300005563 Bacteria 4089
120 Ga0068855_100072373 3300005563 Bacteria 4007
121 Ga0068855_100268088 3300005563 Bacteria 1900
122 Ga0068855_100275571 3300005563 Bacteria 1870
123 Ga0070664_100001095 3300005564 Bacteria 21389
124 Ga0070664_100043654 3300005564 Bacteria 3784
125 Ga0068857_100005597 3300005577 Bacteria 10734
126 Ga0068857_100040785 3300005577 Bacteria 4115
127 Ga0068857_100056953 3300005577 Bacteria 3469
128 Ga0068854_100006801 3300005578 Bacteria 7289
129 Ga0068854_100016734 3300005578 Bacteria 4893
130 Ga0068856_100001716 3300005614 Bacteria 22915
131 Ga0068856_100020622 3300005614 Bacteria 6404
132 Ga0068856_100023648 3300005614 Bacteria 5975
133 Ga0068852_100005336 3300005616 Bacteria 9178
134 Ga0068852_100140444 3300005616 Bacteria 2235
135 Ga0068859_100028219 3300005617 Bacteria 5626
136 Ga0068864_100002220 3300005618 Bacteria 16047
137 Ga0068864_100030433 3300005618 Bacteria 4575
138 Ga0068864_100106106 3300005618 Bacteria 2498
139 Ga0068861_100040043 3300005719 Bacteria 3502
140 Ga0068851_10011301 3300005834 Bacteria 4185
141 Ga0068851_10095902 3300005834 Bacteria 1568
142 Ga0068863_100003043 3300005841 Bacteria 16570
143 Ga0068863_100045751 3300005841 Bacteria 4154
144 Ga0068858_100002003 3300005842 Bacteria 20846
145 Ga0068858_100004297 3300005842 Bacteria 14008
146 Ga0068860_100005401 3300005843 Bacteria 12967
147 Ga0068860_100084500 3300005843 Bacteria 3020
148 Ga0068862_100064969 3300005844 Bacteria 3142
149 Ga0068862_100101762 3300005844 Bacteria 2514
150 Ga0075365_10010955 3300006038 Bacteria 5311
151 Ga0075365_10011610 3300006038 Bacteria 5189
152 Ga0075363_100005295 3300006048 Bacteria 5725
153 Ga0075363_100009657 3300006048 Bacteria 4544
154 Ga0075364_10079311 3300006051 Bacteria 2169
155 Ga0075362_10001230 3300006177 Bacteria 8064
156 Ga0075362_10002845 3300006177 Bacteria 5909
157 Ga0075362_10004591 3300006177 Bacteria 4976
158 Ga0075362_10005426 3300006177 Bacteria 4663
159 Ga0075362_10026936 3300006177 Bacteria 2458
160 Ga0075367_10009945 3300006178 Bacteria 4984
161 Ga0075367_10025245 3300006178 Bacteria 3359
162 Ga0075369_10003566 3300006186 Bacteria 5669
163 Ga0075369_10037162 3300006186 Bacteria 2074
164 Ga0075369_10055871 3300006186 Bacteria 1716
165 Ga0075366_10000488 3300006195 Bacteria 18352
166 Ga0075366_10000512 3300006195 Bacteria 17914
167 Ga0075366_10000833 3300006195 Bacteria 14815
168 Ga0075366_10001615 3300006195 Bacteria 11295
169 Ga0075366_10002670 3300006195 Bacteria 9196
170 Ga0075366_10009487 3300006195 Bacteria 5432
171 Ga0075366_10013295 3300006195 Bacteria 4682
172 Ga0075366_10020444 3300006195 Bacteria 3842
173 Ga0075366_10036444 3300006195 Bacteria 2900
174 Ga0075366_10043068 3300006195 Bacteria 2674
175 Ga0075366_10073830 3300006195 Bacteria 2033
176 Ga0097621_100013906 3300006237 Bacteria 6011
177 Ga0075370_10001163 3300006353 Bacteria 11056
178 Ga0075370_10001599 3300006353 Bacteria 9986
179 Ga0075370_10001843 3300006353 Bacteria 9495
180 Ga0075370_10002011 3300006353 Bacteria 9216
181 Ga0075370_10002147 3300006353 Bacteria 9019
182 Ga0075370_10003491 3300006353 Bacteria 7490
183 Ga0075370_10008222 3300006353 Bacteria 5356
184 Ga0075370_10012954 3300006353 Bacteria 4421
185 Ga0068871_100013329 3300006358 Bacteria 6100
186 Ga0068871_100032334 3300006358 Bacteria 4132
187 Ga0075430_100014313 3300006846 Bacteria 6760
188 Ga0075429_100045567 3300006880 Bacteria 3815
189 Ga0068865_100004212 3300006881 Bacteria 8668
190 Ga0068865_100036159 3300006881 Bacteria 3327
191 Ga0068865_100051203 3300006881 Bacteria 2857
192 Ga0097620_100028217 3300006931 Bacteria 5626
193 Ga0099823_1000065 3300006944 Bacteria 50323
194 Ga0079104_1000711 3300006946 Bacteria 30224
195 Ga0079104_1013480 3300006946 Bacteria 2515
196 Ga0105240_10019194 3300009093 Bacteria 9138
197 Ga0105240_10030649 3300009093 Bacteria 6987
198 Ga0105240_10110593 3300009093 Bacteria 3325
199 Ga0105240_10160491 3300009093 Bacteria 2671
200 Ga0105240_10199500 3300009093 Bacteria 2346
201 Ga0105245_10012950 3300009098 Bacteria 7271
202 Ga0105245_10037642 3300009098 Bacteria 4301
203 Ga0105243_10006470 3300009148 Bacteria 9059
204 Ga0105243_10020659 3300009148 Bacteria 4993
205 Ga0105243_10298387 3300009148 Bacteria 1459
206 Ga0105242_10001200 3300009176 Bacteria 20452
207 Ga0105242_10029895 3300009176 Bacteria 4348
208 Ga0105248_10024656 3300009177 Bacteria 6688
209 Ga0105248_10036212 3300009177 Bacteria 5519
210 Ga0105248_10103720 3300009177 Bacteria 3206
211 Ga0105248_10270413 3300009177 Bacteria 1914
212 Ga0105237_10000646 3300009545 Bacteria 48623
213 Ga0105237_10007873 3300009545 Bacteria 11614
214 Ga0105237_10055655 3300009545 Bacteria 3962
215 Ga0105238_10013724 3300009551 Bacteria 8186
216 Ga0105249_10075709 3300009553 Bacteria 3117
217 Ga0105239_10002203 3300010375 Bacteria 25060
218 Ga0105239_10034573 3300010375 Bacteria 5550
219 Ga0105246_10139525 3300011119 Bacteria 1821
220 Ga0157319_1000005 3300012497 Bacteria 372810
221 Ga0157373_10012300 3300013100 Bacteria 6292
222 Ga0157373_10051815 3300013100 Bacteria 2922
223 Ga0157371_10139560 3300013102 Bacteria 1726
224 Ga0157369_10051064 3300013105 Bacteria 4476
225 Ga0157374_10048229 3300013296 Bacteria 3952
226 Ga0157374_10071539 3300013296 Bacteria 3270
227 Ga0157378_10122419 3300013297 Bacteria 2400
228 Ga0163162_10006139 3300013306 Bacteria 11629
229 Ga0163162_10019585 3300013306 Bacteria 6642
230 Ga0163162_10051927 3300013306 Bacteria 4115
231 Ga0157372_10011552 3300013307 Bacteria 9393
232 Ga0157375_10010413 3300013308 Bacteria 8188
233 Ga0157375_10016070 3300013308 Bacteria 6714
234 Ga0157375_10035829 3300013308 Bacteria 4741
235 Ga0157375_10036344 3300013308 Bacteria 4711
236 Ga0157375_10060447 3300013308 Bacteria 3758
237 Ga0157375_10098903 3300013308 Bacteria 2995
238 Ga0163163_10035773 3300014325 Bacteria 4820
239 Ga0163163_10243940 3300014325 Bacteria 1847
240 Ga0182008_10002992 3300014497 Bacteria 10403
241 Ga0182008_10006547 3300014497 Bacteria 6504
242 Ga0157377_10000044 3300014745 Bacteria 100420
243 Ga0157379_10008058 3300014968 Bacteria 9148
244 Ga0157379_10022724 3300014968 Bacteria 5557
245 Ga0157379_10030665 3300014968 Bacteria 4788
246 Ga0157379_10038113 3300014968 Bacteria 4289
247 Ga0157376_10026761 3300014969 Bacteria 4562
248 Ga0157376_10061714 3300014969 Bacteria 3152
249 Ga0157376_10064408 3300014969 Bacteria 3092
250 Ga0157376_10177582 3300014969 Bacteria 1944
251 Ga0182007_10004423 3300015262 Bacteria 6368
252 Ga0182005_1007578 3300015265 Bacteria 3247
253 Ga0183362_10005 3300015683 Bacteria 437616
254 Ga0163161_10006497 3300017792 Bacteria 8093
255 Ga0163161_10019147 3300017792 Bacteria 4800
256 Ga0163161_10039817 3300017792 Bacteria 3375
257 Ga0213872_10000007 3300021361 Bacteria 228206
258 Ga0213872_10000067 3300021361 Bacteria 92410
259 Ga0213872_10000131 3300021361 Bacteria 68632
260 Ga0213872_10000233 3300021361 Bacteria 48866
261 Ga0213872_10019666 3300021361 Bacteria 3110
262 Ga0213872_10025078 3300021361 Bacteria 2742
263 Ga0209674_100073 3300025226 Bacteria 223689
264 Ga0209563_100013 3300025230 Bacteria 941463
265 Ga0209563_100061 3300025230 Bacteria 274295
266 Ga0207427_101037 3300025231 Bacteria 11594
267 Ga0209258_100072 3300025242 Bacteria 274355
268 Ga0209258_103059 3300025242 Bacteria 3833
269 Ga0209258_103479 3300025242 Bacteria 3373
270 Ga0207425_1000426 3300025245 Bacteria 28024
271 Ga0209646_1000076 3300025246 Bacteria 212891
272 Ga0209026_1000011 3300025250 Bacteria 507291
273 Ga0209677_100070 3300025253 Bacteria 143311
274 Ga0209677_100751 3300025253 Bacteria 16421
275 Ga0209677_105485 3300025253 Bacteria 3294
276 Ga0209148_1002371 3300025254 Bacteria 6612
277 Ga0209759_1000034 3300025256 Bacteria 271209
278 Ga0209759_1001263 3300025256 Bacteria 15243
279 Ga0209759_1001427 3300025256 Bacteria 13561
280 Ga0209129_1000269 3300025258 Bacteria 51170
281 Ga0209455_1000053 3300025272 Bacteria 365949
282 Ga0209673_1003690 3300025273 Bacteria 8809
283 Ga0209673_1011942 3300025273 Bacteria 3538
284 Ga0209673_1029399 3300025273 Bacteria 1750
285 Ga0209675_1000911 3300025291 Bacteria 18891
286 Ga0209676_1011605 3300025292 Bacteria 3536
287 Ga0209564_1000008 3300025295 Bacteria 953227
288 Ga0209564_1000300 3300025295 Bacteria 98386
289 Ga0209758_1000605 3300025297 Bacteria 55552
290 Ga0209758_1027675 3300025297 Bacteria 2416
291 Ga0209050_1000770 3300025298 Bacteria 46024
292 Ga0209050_1004597 3300025298 Bacteria 9232
293 Ga0209050_1008492 3300025298 Bacteria 5472
294 Ga0209050_1010621 3300025298 Bacteria 4506
295 Ga0209256_1000049 3300025299 Bacteria 310696
296 Ga0209256_1003918 3300025299 Bacteria 9824
297 Ga0209256_1004159 3300025299 Bacteria 9342
298 Ga0209051_1000247 3300025303 Bacteria 91122
299 Ga0209051_1003902 3300025303 Bacteria 9515
300 Ga0209051_1004626 3300025303 Bacteria 8381
301 Ga0209051_1007075 3300025303 Bacteria 6206
302 Ga0209051_1008990 3300025303 Bacteria 5203
303 Ga0209051_1015628 3300025303 Bacteria 3481
304 Ga0209051_1026222 3300025303 Bacteria 2355
305 Ga0209257_1000141 3300025304 Bacteria 201130
306 Ga0209257_1001704 3300025304 Bacteria 24663
307 Ga0209257_1004727 3300025304 Bacteria 10192
308 Ga0209257_1006810 3300025304 Bacteria 7187
309 Ga0209257_1024286 3300025304 Bacteria 2103
310 Ga0207688_10022598 3300025901 Bacteria 3442
311 Ga0207680_10028440 3300025903 Bacteria 3127
312 Ga0207647_10073527 3300025904 Bacteria 2060
313 Ga0207645_10004343 3300025907 Bacteria 10500
314 Ga0207645_10027832 3300025907 Bacteria 3650
315 Ga0207645_10028492 3300025907 Bacteria 3605
316 Ga0207645_10054409 3300025907 Bacteria 2556
317 Ga0207705_10027738 3300025909 Bacteria 4039
318 Ga0207705_10050908 3300025909 Bacteria 2982
319 Ga0207705_10136076 3300025909 Bacteria 1832
320 Ga0207684_10101912 3300025910 Bacteria 2454
321 Ga0207707_10120457 3300025912 Bacteria 2294
322 Ga0207695_10028147 3300025913 Bacteria 6239
323 Ga0207695_10034025 3300025913 Bacteria 5548
324 Ga0207671_10007157 3300025914 Bacteria 9732
325 Ga0207671_10026506 3300025914 Bacteria 4342
326 Ga0207660_10001454 3300025917 Bacteria 15902
327 Ga0207660_10117650 3300025917 Bacteria 2009
328 Ga0207657_10018081 3300025919 Bacteria 6744
329 Ga0207657_10023991 3300025919 Bacteria 5663
330 Ga0207657_10029766 3300025919 Bacteria 4964
331 Ga0207649_10000335 3300025920 Bacteria 35710
332 Ga0207649_10027585 3300025920 Bacteria 3334
333 Ga0207652_10051225 3300025921 Bacteria 3539
334 Ga0207652_10110056 3300025921 Bacteria 2442
335 Ga0207646_10069488 3300025922 Bacteria 3145
336 Ga0207681_10001008 3300025923 Bacteria 18376
337 Ga0207681_10002578 3300025923 Bacteria 11488
338 Ga0207681_10042266 3300025923 Bacteria 3044
339 Ga0207681_10071123 3300025923 Bacteria 2425
340 Ga0207694_10016495 3300025924 Bacteria 5578
341 Ga0207694_10034410 3300025924 Bacteria 3884
342 Ga0207650_10001346 3300025925 Bacteria 17761
343 Ga0207650_10003269 3300025925 Bacteria 11170
344 Ga0207650_10077599 3300025925 Bacteria 2511
345 Ga0207659_10000207 3300025926 Bacteria 35338
346 Ga0207659_10019315 3300025926 Bacteria 4483
347 Ga0207659_10040934 3300025926 Bacteria 3243
348 Ga0207644_10003278 3300025931 Bacteria 10459
349 Ga0207644_10005018 3300025931 Bacteria 8640
350 Ga0207644_10017333 3300025931 Bacteria 4862
351 Ga0207644_10020439 3300025931 Bacteria 4502
352 Ga0207690_10000176 3300025932 Bacteria 49560
353 Ga0207706_10061609 3300025933 Bacteria 3304
354 Ga0207686_10004163 3300025934 Bacteria 7764
355 Ga0207686_10014698 3300025934 Bacteria 4365
356 Ga0207686_10103781 3300025934 Bacteria 1903
357 Ga0207709_10007539 3300025935 Bacteria 6046
358 Ga0207709_10012409 3300025935 Bacteria 4695
359 Ga0207669_10002599 3300025937 Bacteria 7721
360 Ga0207669_10005642 3300025937 Bacteria 5641
361 Ga0207704_10037050 3300025938 Bacteria 2813
362 Ga0207704_10040842 3300025938 Bacteria 2715
363 Ga0207665_10069689 3300025939 Bacteria 2398
364 Ga0207691_10002895 3300025940 Bacteria 16737
365 Ga0207691_10003449 3300025940 Bacteria 15379
366 Ga0207691_10008177 3300025940 Bacteria 10044
367 Ga0207691_10009917 3300025940 Bacteria 9143
368 Ga0207711_10019739 3300025941 Bacteria 5614
369 Ga0207711_10033268 3300025941 Bacteria 4361
370 Ga0207689_10003961 3300025942 Bacteria 13485
371 Ga0207689_10070714 3300025942 Bacteria 2867
372 Ga0207661_10012579 3300025944 Bacteria 6155
373 Ga0207679_10001472 3300025945 Bacteria 14754
374 Ga0207679_10050636 3300025945 Bacteria 3036
375 Ga0207679_10158714 3300025945 Bacteria 1849
376 Ga0207667_10027618 3300025949 Bacteria 6174
377 Ga0207667_10051160 3300025949 Bacteria 4357
378 Ga0207667_10058267 3300025949 Bacteria 4052
379 Ga0207667_10131052 3300025949 Bacteria 2582
380 Ga0207651_10008453 3300025960 Bacteria 5562
381 Ga0207651_10009387 3300025960 Bacteria 5353
382 Ga0207651_10040524 3300025960 Bacteria 3082
383 Ga0207651_10041282 3300025960 Bacteria 3061
384 Ga0207712_10013724 3300025961 Bacteria 5195
385 Ga0207668_10013756 3300025972 Bacteria 4992
386 Ga0207640_10012952 3300025981 Bacteria 4765
387 Ga0207640_10024457 3300025981 Bacteria 3644
388 Ga0207658_10012147 3300025986 Bacteria 5874
389 Ga0207658_10028406 3300025986 Bacteria 3938
390 Ga0207677_10055029 3300026023 Bacteria 2718
391 Ga0207703_10004229 3300026035 Bacteria 11831
392 Ga0207703_10011615 3300026035 Bacteria 6846
393 Ga0207703_10065459 3300026035 Bacteria 2987
394 Ga0207678_10007570 3300026067 Bacteria 9599
395 Ga0207702_10001565 3300026078 Bacteria 22647
396 Ga0207641_10006229 3300026088 Bacteria 10091
397 Ga0207641_10011103 3300026088 Bacteria 7389
398 Ga0207641_10032121 3300026088 Bacteria 4358
399 Ga0207648_10001584 3300026089 Bacteria 24952
400 Ga0207648_10010452 3300026089 Bacteria 8794
401 Ga0207648_10010854 3300026089 Bacteria 8610
402 Ga0207648_10011167 3300026089 Bacteria 8473
403 Ga0207648_10061480 3300026089 Bacteria 3275
404 Ga0207676_10095831 3300026095 Bacteria 2448
405 Ga0207675_100042444 3300026118 Bacteria 4247
406 Ga0207675_100058322 3300026118 Bacteria 3602
407 Ga0207683_10012763 3300026121 Bacteria 7170
408 Ga0207683_10038257 3300026121 Bacteria 4180
409 Ga0207683_10098453 3300026121 Bacteria 2609
410 Ga0207683_10154519 3300026121 Bacteria 2072
411 Ga0207698_10073054 3300026142 Bacteria 2729
412 Ga0207698_10142335 3300026142 Bacteria 2068
413 Ga0209281_1000395 3300027111 Bacteria 67983
414 Ga0209389_1010868 3300027296 Bacteria 8227
415 Ga0209968_1000906 3300027526 Bacteria 4594
416 Ga0209999_1007707 3300027543 Bacteria 1936
417 Ga0209966_1000017 3300027695 Bacteria 71183
418 Ga0209813_10012578 3300027866 Bacteria 2241
419 Ga0209974_10000608 3300027876 Bacteria 12020
420 Ga0209974_10017019 3300027876 Bacteria 2412
421 Ga0268265_10158359 3300028380 Bacteria 1919
422 Ga0268264_10010530 3300028381 Bacteria 7647
423 Ga0268264_10034363 3300028381 Bacteria 4170
424 Ga0265336_10000036 3300028666 Bacteria 154609
425 Ga0307517_10072690 3300028786 Bacteria 3061
426 Ga0307515_10000011 3300028794 Bacteria 633903
427 Ga0307515_10000281 3300028794 Bacteria 125306
428 Ga0307515_10000419 3300028794 Bacteria 102271
429 Ga0307515_10031865 3300028794 Bacteria 8758
430 Ga0307515_10073207 3300028794 Bacteria 4609
431 Ga0265324_10000136 3300029957 Bacteria 57490
432 Ga0307512_10040205 3300030522 Bacteria 3907
433 Ga0316178_1131179 3300030735 Bacteria 1797
434 Ga0265330_10000052 3300031235 Bacteria 102771
435 Ga0265332_10000001 3300031238 Bacteria 863783
436 Ga0265325_10010139 3300031241 Bacteria 5470
437 Ga0265340_10059587 3300031247 Bacteria 1831
438 Ga0265331_10003008 3300031250 Bacteria 11082
439 Ga0265327_10000035 3300031251 Bacteria 314419
440 Ga0265327_10016534 3300031251 Bacteria 4678
441 Ga0307513_10025768 3300031456 Bacteria 6801
442 Ga0307513_10034575 3300031456 Bacteria 5669
443 Ga0307513_10075354 3300031456 Bacteria 3504
444 Ga0307509_10020572 3300031507 Bacteria 7484
445 Ga0307408_100032911 3300031548 Bacteria 3618
446 Ga0307408_100056443 3300031548 Bacteria 2847
447 Ga0307408_100064624 3300031548 Bacteria 2681
448 Ga0307514_10000355 3300031649 Bacteria 106758
449 Ga0307514_10006320 3300031649 Bacteria 10353
450 Ga0265314_10000013 3300031711 Bacteria 403405
451 Ga0307516_10000054 3300031730 Bacteria 126288
452 Ga0307516_10001808 3300031730 Bacteria 29384
453 Ga0307516_10001961 3300031730 Bacteria 28186
454 Ga0307516_10005578 3300031730 Bacteria 14995
455 Ga0307405_10034443 3300031731 Bacteria 3013
456 Ga0307405_10061018 3300031731 Bacteria 2381
457 Ga0307405_10100625 3300031731 Bacteria 1937
458 Ga0307406_10007227 3300031901 Bacteria 6152
459 Ga0307406_10056239 3300031901 Bacteria 2518
460 Ga0307407_10016230 3300031903 Bacteria 3703
461 Ga0307412_10015031 3300031911 Bacteria 4578
462 Ga0307412_10026896 3300031911 Bacteria 3582
463 Ga0307412_10138233 3300031911 Bacteria 1780
464 Ga0307409_100004999 3300031995 Bacteria 7550
465 Ga0307416_100077835 3300032002 Bacteria 2787
466 Ga0307414_10038560 3300032004 Bacteria 3210
467 Ga0307411_10003141 3300032005 Bacteria 7576
468 Ga0307411_10090769 3300032005 Bacteria 2132
469 Ga0307415_100047717 3300032126 Bacteria 2884
470 Ga0373931_0002648 3300035691 Bacteria 7967
471 Ga0373937_0016810 3300036401 Bacteria 6504
472 Ga0373937_0090530 3300036401 Bacteria 2833
473 Ga0373925_0048624 3300037068 Bacteria 3161
474 Ga0395900_0001686 3300037418 Bacteria 25712
475 Ga0395900_0032417 3300037418 Bacteria 5373
476 Ga0395898_0002642 3300037466 Bacteria 20848
477 Ga0395898_0005142 3300037466 Bacteria 14155
478 Ga0395905_0014064 3300037471 Bacteria 7651
479 Ga0395905_0109466 3300037471 Bacteria 2594
480 Ga0395905_0147587 3300037471 Bacteria 2213
481 Ga0395901_0040745 3300038443 Bacteria 4810
482 Ga0395901_0072660 3300038443 Bacteria 3586
483 Ga0436361_0028732 3300039447 Bacteria 3225
484 Ga0436361_0099386 3300039447 Bacteria 7920
485 Ga0436361_0479314 3300039447 Bacteria 9473
486 Ga0436361_0504982 3300039447 Bacteria 102576
487 Ga0436361_0816515 3300039447 Bacteria 4479
488 Ga0436361_1043865 3300039447 Bacteria 11886
489 Ga0436361_1149866 3300039447 Bacteria 37566
490 Ga0439436_0009572 3300041404 Bacteria 2971
491 Ga0439436_0016190 3300041404 Bacteria 2239
492 Ga0439439_0002335 3300041406 Bacteria 4011
493 Ga0439466_0006336 3300041411 Bacteria 4503
494 Ga0439466_0013342 3300041411 Bacteria 3009
495 Ga0439466_0019082 3300041411 Bacteria 2456
496 Ga0439465_0006744 3300041413 Bacteria 3646
497 Ga0439431_0001021 3300041997 Bacteria 6074
498 Ga0439433_0007805 3300041999 Bacteria 2312
499 Ga0439442_003465 3300042002 Bacteria 3120
500 Ga0439442_004829 3300042002 Bacteria 2682
501 Ga0439442_008074 3300042002 Bacteria 2126
502 Ga0439445_0000222 3300042004 Bacteria 10552
503 Ga0439445_0012752 3300042004 Bacteria 2024
504 Ga0439432_005922 3300042006 Bacteria 4389
505 Ga0439432_021684 3300042006 Bacteria 2127
506 Ga0439449_0005925 3300042007 Bacteria 4667
507 Ga0439449_0011708 3300042007 Bacteria 3297
508 Ga0439449_0012922 3300042007 Bacteria 3139
509 Ga0439452_012584 3300042010 Bacteria 2400
510 Ga0439457_009566 3300042014 Bacteria 2252
511 Ga0439457_009633 3300042014 Bacteria 2244
512 Ga0439462_0004249 3300042015 Bacteria 3485
513 Ga0439462_0006720 3300042015 Bacteria 2869
514 Ga0450911_004418 3300042115 Bacteria 2306
515 Ga0450919_000965 3300042121 Bacteria 3723
516 Ga0450921_000014 3300042123 Bacteria 4316
517 Ga0450923_001529 3300042125 Bacteria 3100
518 Ga0450890_002246 3300042127 Bacteria 2684
519 Ga0450894_002457 3300042131 Bacteria 2489
520 Ga0450906_004008 3300042145 Bacteria 3115
521 Ga0439446_0017256 3300042156 Bacteria 2015
522 Ga0439446_0018498 3300042156 Bacteria 1952
523 Ga0450908_000591 3300042184 Bacteria 6952
524 Ga0450908_009850 3300042184 Bacteria 1768
525 Ga0450909_003138 3300042185 Bacteria 2351
526 Ga0439434_0011742 3300042435 Bacteria 2591
527 Ga0439434_0015589 3300042435 Bacteria 2266
528 Ga0439460_0009792 3300042461 Bacteria 2441
529 Ga0450918_000077 3300042531 Bacteria 20527
530 Ga0450918_003796 3300042531 Bacteria 2784
531 Ga0451577_0003515 3300042876 Bacteria 17370
532 Ga0451577_0009895 3300042876 Bacteria 9139
533 Ga0451577_0014500 3300042876 Bacteria 7347
534 Ga0451577_0024419 3300042876 Bacteria 5499
535 Ga0451577_0089473 3300042876 Bacteria 2747
536 Ga0451577_0125297 3300042876 Bacteria 2302
537 Ga0451577_0153188 3300042876 Bacteria 2074
538 Ga0466969_0000046 3300044656 Bacteria 63999
539 Ga0466969_0067627 3300044656 Bacteria 1723
540 Ga0453683_0035550 3300044673 Bacteria 3139
541 Ga0453683_0089176 3300044673 Bacteria 1933
542 Ga0466965_0008433 3300044683 Bacteria 4769
543 Ga0466965_0035916 3300044683 Bacteria 2429
544 Ga0466966_0003197 3300044684 Bacteria 10785
545 Ga0466966_0011921 3300044684 Bacteria 5761
546 Ga0466966_0016292 3300044684 Bacteria 4915
547 Ga0466961_0007180 3300044693 Bacteria 7087
548 Ga0466961_0147994 3300044693 Bacteria 1467
549 Ga0466963_0062885 3300044694 Bacteria 2483
550 Ga0466963_0086305 3300044694 Bacteria 2132
551 Ga0466964_0006544 3300044706 Bacteria 4344
552 Ga0453684_0000065 3300044712 Bacteria 468481
553 Ga0453684_0001131 3300044712 Bacteria 83523
554 Ga0453684_0010067 3300044712 Bacteria 16251
555 Ga0453684_0032339 3300044712 Bacteria 7325
556 Ga0453684_0082882 3300044712 Bacteria 3994
557 Ga0453684_0198002 3300044712 Bacteria 2344
558 Ga0466971_0043912 3300044719 Bacteria 2007
559 Ga0466957_0112722 3300044842 Bacteria 1726
560 Ga0466960_0042774 3300044901 Bacteria 2152
561 Ga0466959_0000174 3300045049 Bacteria 42543
562 Ga0466959_0026183 3300045049 Bacteria 4323
563 Ga0451576_0000526 3300045051 Bacteria 83427
564 Ga0451576_0003229 3300045051 Bacteria 22685
565 Ga0451576_0024150 3300045051 Bacteria 6569
566 Ga0451576_0049640 3300045051 Bacteria 4404
567 Ga0466958_0066533 3300045836 Bacteria 2200
568 Ga0495590_0033892 3300046457 Bacteria 1784
569 Ga0495629_0070447 3300046459 Bacteria 2440
570 Ga0495650_0017128 3300046471 Bacteria 3643
571 Ga0495580_0111528 3300046472 Bacteria 1899
572 Ga0495639_0004264 3300046475 Bacteria 6134
573 Ga0495585_0043320 3300046492 Bacteria 2518
574 Ga0495583_0000129 3300046506 Bacteria 126766
575 Ga0495606_0053792 3300046507 Bacteria 2610
576 Ga0495610_0007076 3300046512 Bacteria 7573
577 Ga0495630_0052261 3300046517 Bacteria 3059
578 Ga0495632_0004609 3300046519 Bacteria 9335
579 Ga0495643_0027317 3300046522 Bacteria 3210
580 Ga0495643_0030737 3300046522 Bacteria 2996
581 Ga0495642_0020287 3300046528 Bacteria 2610
582 Ga0495598_0005445 3300046537 Bacteria 2822
583 Ga0495645_0050111 3300046543 Bacteria 3040
584 Ga0495622_0020307 3300046557 Bacteria 3093
585 Ga0495633_0007721 3300046558 Bacteria 6152
586 Ga0495656_0002495 3300046615 Bacteria 6121
587 Ga0495625_0009857 3300046660 Bacteria 7947
588 Ga0495625_0012566 3300046660 Bacteria 6854
589 Ga0495625_0044634 3300046660 Bacteria 3208
590 Ga0495588_0060622 3300046674 Bacteria 1958
591 Ga0495624_0037876 3300046690 Bacteria 3101
592 Ga0495649_0000524 3300046694 Bacteria 32600
593 Ga0495589_0005373 3300046794 Bacteria 6760
594 Ga0495660_0016578 3300046810 Bacteria 4248
595 Ga0495674_0197156 3300047319 Bacteria 1672
596 Ga0495687_000174 3300047443 Bacteria 95031
597 Ga0495684_0038701 3300047471 Bacteria 3656
598 Ga0495686_0080121 3300047472 Bacteria 1996
599 Ga0495593_0045358 3300047673 Bacteria 2346
600 Ga0496101_0029043 3300048904 Bacteria 3866
601 Ga0496102_0009157 3300048905 Bacteria 8492
602 Ga0496102_0009561 3300048905 Bacteria 8339
603 Ga0496102_0011400 3300048905 Bacteria 7661
604 Ga0496103_0033383 3300048906 Bacteria 3143
605 Ga0496104_0106928 3300048907 Bacteria 2681
606 Ga0496104_0113229 3300048907 Bacteria 2602
607 Ga0496105_0032115 3300048908 Bacteria 4306
608 Ga0496105_0039421 3300048908 Bacteria 3894
609 Ga0496107_0109186 3300048910 Bacteria 2032
610 Ga0496108_0118815 3300048911 Bacteria 2266
611 Ga0496109_0047302 3300048912 Bacteria 3911
612 Ga0496109_0077567 3300048912 Bacteria 3058
613 Ga0496109_0155807 3300048912 Bacteria 2140
614 Ga0496109_0193157 3300048912 Bacteria 1913
615 Ga0496109_0232931 3300048912 Bacteria 1733
616 Ga0496110_0019147 3300048913 Bacteria 5755
617 Ga0496110_0153617 3300048913 Bacteria 2084
618 Ga0496111_0150933 3300048914 Bacteria 1723
619 Ga0496113_0089270 3300048916 Bacteria 2372
620 Ga0496114_0006241 3300048917 Bacteria 9381
621 Ga0496121_0023358 3300048924 Bacteria 5958
622 Ga0496122_0004537 3300048925 Bacteria 17119
623 Ga0496123_0000160 3300048926 Bacteria 135310
624 Ga0496124_0000108 3300048927 Bacteria 167473
625 Ga0496124_0031147 3300048927 Bacteria 4725
626 Ga0496124_0075218 3300048927 Bacteria 2790
627 Ga0496125_0004332 3300048928 Bacteria 16465
628 Ga0496125_0019117 3300048928 Bacteria 6476
629 Ga0496125_0074777 3300048928 Bacteria 2625
630 Ga0496125_0075095 3300048928 Bacteria 2617
631 Ga0496126_0146301 3300048929 Bacteria 2029
632 Ga0496126_0172256 3300048929 Bacteria 1843
633 Ga0501308_000901 3300049128 Bacteria 2177
634 Ga0501304_000399 3300049160 Bacteria 2177
635 Ga0501032_0037757 3300049569 Bacteria 3292
636 Ga0501034_0124759 3300049571 Bacteria 2560
637 Ga0501043_0000002 3300049579 Bacteria 351081
638 Ga0501043_0030215 3300049579 Bacteria 4257
639 Ga0501046_0000008 3300049580 Bacteria 351167
640 Ga0501047_0000003 3300049581 Bacteria 508375
641 Ga0501048_0004029 3300049582 Bacteria 11173
642 Ga0501198_000007 3300049649 Bacteria 129700
643 Ga0501222_000005 3300049662 Bacteria 129724
644 Ga0501257_015855 3300049686 Bacteria 1743
645 Ga0501265_002543 3300049762 Bacteria 2069
646 Ga0501035_0083199 3300049822 Bacteria 2824
647 Ga0501035_0111195 3300049822 Bacteria 2401
648 Ga0501044_0308243 3300049823 Bacteria 1510
649 nmdc:mga03683_13349_c1 3300050489 Bacteria 3021
650 nmdc:mga03683_15504_c1 3300050489 Bacteria 2845
651 nmdc:mga03683_6266_c1 3300050489 Bacteria 4063
652 nmdc:mga03683_7162_c1 3300050489 Bacteria 3858
653 nmdc:mga03n38_16652_c1 3300050490 Bacteria 2864
654 nmdc:mga03n38_26117_c1 3300050490 Bacteria 2408
655 nmdc:mga00v17_87387_c1 3300050491 Bacteria 1954
656 nmdc:mga0yw44_64343_c1 3300050492 Bacteria 2257
657 nmdc:mga0yw44_8074_c1 3300050492 Bacteria 5223
658 nmdc:mga0k408_1174_c1 3300050493 Bacteria 14328
659 nmdc:mga0k408_12497_c1 3300050493 Bacteria 4642
660 nmdc:mga0k408_35206_c1 3300050493 Bacteria 2871
661 nmdc:mga0k408_3759_c1 3300050493 Bacteria 8049
662 nmdc:mga0k408_396_c1 3300050493 Bacteria 23854
663 nmdc:mga0k408_47579_c1 3300050493 Bacteria 2479
664 nmdc:mga0k408_57467_c1 3300050493 Bacteria 2258
665 nmdc:mga0k408_729_c1 3300050493 Bacteria 18040
666 nmdc:mga0k408_7424_c1 3300050493 Bacteria 5853
667 nmdc:mga0k408_892_c1 3300050493 Bacteria 16353
668 nmdc:mga06z11_16470_c1 3300050494 Bacteria 3331
669 nmdc:mga06z11_63094_c1 3300050494 Bacteria 1938
670 nmdc:mga07m45_10995_c1 3300050496 Bacteria 4745
671 nmdc:mga07m45_11599_c1 3300050496 Bacteria 4634
672 nmdc:mga07m45_23016_c1 3300050496 Bacteria 3404
673 nmdc:mga07m45_27970_c1 3300050496 Bacteria 3111
674 nmdc:mga07m45_3610_c1 3300050496 Bacteria 7474
675 nmdc:mga07m45_4843_c1 3300050496 Bacteria 6621
676 nmdc:mga07m45_5171_c1 3300050496 Bacteria 6468
677 nmdc:mga07m45_55744_c1 3300050496 Bacteria 2234
678 nmdc:mga07m45_55905_c1 3300050496 Bacteria 2016
679 nmdc:mga07m45_6993_c1 3300050496 Bacteria 5740
680 nmdc:mga07m45_74089_c1 3300050496 Bacteria 1939
681 nmdc:mga07m45_7711_c1 3300050496 Bacteria 5510
682 nmdc:mga09592_2264_c1 3300050508 Bacteria 15188
683 nmdc:mga0qj67_10871_c1 3300050509 Bacteria 6808
684 nmdc:mga0sz30_14235_c1 3300050516 Bacteria 3127
685 Ga0495601_0023250 3300053077 Bacteria 3808
686 Ga0500635_0000030 3300053080 Bacteria 99936
687 Ga0495619_0022578 3300053085 Bacteria 4029
688 Ga0500578_0000025 3300053086 Bacteria 151485
689 Ga0500562_015236 3300053108 Bacteria 1972
690 Ga0500593_003896 3300053117 Bacteria 5722
691 Ga0500595_018156 3300053119 Bacteria 2578
692 Ga0500642_0032519 3300053130 Bacteria 2189
693 Ga0500658_0001460 3300053134 Bacteria 9460
694 Ga0500559_0005517 3300053136 Bacteria 5816
695 Ga0500559_0012959 3300053136 Bacteria 3537
696 Ga0500564_025252 3300053138 Bacteria 2729
697 Ga0500568_0011402 3300053139 Bacteria 4129
698 Ga0500568_0021802 3300053139 Bacteria 2752
699 Ga0500590_035532 3300053148 Bacteria 2579
700 Ga0500619_000014 3300053154 Bacteria 55951
701 Ga0500622_0000890 3300053156 Bacteria 25460
702 Ga0500622_0001306 3300053156 Bacteria 20253
703 Ga0500622_0010205 3300053156 Bacteria 5163
704 Ga0500636_0022800 3300053177 Bacteria 3700
705 Ga0500661_003126 3300055283 Bacteria 3110
706 Ga0466962_0002224 3300061719 Bacteria 9174

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10012758 rootH1_100127583 366
2 3300047673 Ga0495593_0045358 Ga0495593_0045358_1023_2315 382
3 3300006195 Ga0075366_10001615 Ga0075366_100016156 384
4 3300044712 Ga0453684_0001131 Ga0453684_0001131_80680_81936 389
5 3300042876 Ga0451577_0089473 Ga0451577_0089473_1390_2649 390
6 3300044673 Ga0453683_0089176 Ga0453683_0089176_199_1458 390
7 3300044712 Ga0453684_0010067 Ga0453684_0010067_1565_2824 390
8 3300045051 Ga0451576_0000526 Ga0451576_0000526_80604_81863 390
9 iso_pu_bacteria 2842733646 2842733898 394
10 3300050496 nmdc:mga07m45_55905_c1 nmdc:mga07m45_55905_c1_241_1530 396
11 3300005331 Ga0070670_100005551 Ga0070670_1000055519 397
12 3300005364 Ga0070673_100040286 Ga0070673_1000402862 397
13 3300042876 Ga0451577_0153188 Ga0451577_0153188_75_1445 397
14 3300005354 Ga0070675_100002723 Ga0070675_1000027235 400
15 3300005456 Ga0070678_100013404 Ga0070678_1000134042 400
16 3300005543 Ga0070672_100027809 Ga0070672_1000278091 400
17 3300005834 Ga0068851_10095902 Ga0068851_100959021 400
18 3300006358 Ga0068871_100032334 Ga0068871_1000323342 400
19 3300013308 Ga0157375_10036344 Ga0157375_100363442 400
20 3300014969 Ga0157376_10026761 Ga0157376_100267612 400
21 3300025926 Ga0207659_10019315 Ga0207659_100193153 400
22 3300025940 Ga0207691_10008177 Ga0207691_100081778 400
23 3300025960 Ga0207651_10041282 Ga0207651_100412822 400
24 3300026121 Ga0207683_10038257 Ga0207683_100382575 400
25 3300025921 Ga0207652_10110056 Ga0207652_101100562 402
26 3300025949 Ga0207667_10058267 Ga0207667_100582672 402
27 3300044842 Ga0466957_0112722 Ga0466957_0112722_75_1427 404
28 3300048924 Ga0496121_0023358 Ga0496121_0023358_818_2161 406
29 3300048928 Ga0496125_0019117 Ga0496125_0019117_436_1779 406
30 3300053139 Ga0500568_0021802 Ga0500568_0021802_519_1877 406
31 3300005344 Ga0070661_100000361 Ga0070661_10000036130 407
32 3300005366 Ga0070659_100001606 Ga0070659_1000016067 407
33 3300005564 Ga0070664_100001095 Ga0070664_1000010955 407
34 3300005617 Ga0068859_100028219 Ga0068859_1000282192 407
35 3300005618 Ga0068864_100002220 Ga0068864_1000022205 407
36 3300005841 Ga0068863_100003043 Ga0068863_10000304312 407
37 3300005844 Ga0068862_100064969 Ga0068862_1000649693 407
38 3300006881 Ga0068865_100036159 Ga0068865_1000361592 407
39 3300006931 Ga0097620_100028217 Ga0097620_1000282172 407
40 3300025907 Ga0207645_10027832 Ga0207645_100278324 407
41 3300025920 Ga0207649_10000335 Ga0207649_100003353 407
42 3300025923 Ga0207681_10071123 Ga0207681_100711232 407
43 3300025931 Ga0207644_10003278 Ga0207644_1000327810 407
44 3300025932 Ga0207690_10000176 Ga0207690_1000017612 407
45 3300025945 Ga0207679_10001472 Ga0207679_100014724 407
46 3300026088 Ga0207641_10006229 Ga0207641_100062292 407
47 3300046519 Ga0495632_0004609 Ga0495632_0004609_7703_9061 407
48 3300046660 Ga0495625_0012566 Ga0495625_0012566_136_1494 407
49 3300037471 Ga0395905_0147587 Ga0395905_0147587_14_1288 408
50 3300042876 Ga0451577_0003515 Ga0451577_0003515_13419_14738 409
51 3300044712 Ga0453684_0000065 Ga0453684_0000065_465670_466989 409
52 iso_pu_bacteria 2839138175 2839144792 410
53 3300005347 Ga0070668_100112479 Ga0070668_1001124791 411
54 3300025273 Ga0209673_1029399 Ga0209673_10293992 411
55 3300025297 Ga0209758_1027675 Ga0209758_10276752 411
56 3300046506 Ga0495583_0000129 Ga0495583_0000129_14539_15990 411
57 3300046794 Ga0495589_0005373 Ga0495589_0005373_588_2039 411
58 3300003322 rootL2_10087698 rootL2_100876984 412
59 3300003791 Ga0055530_10003306 Ga0055530_100033062 412
60 3300003792 Ga0055540_1000260 Ga0055540_100026047 412
61 3300003794 Ga0055531_10009185 Ga0055531_100091853 412
62 3300005455 Ga0070663_100098121 Ga0070663_1000981212 412
63 3300006178 Ga0075367_10009945 Ga0075367_100099455 412
64 3300025922 Ga0207646_10069488 Ga0207646_100694883 412
65 iso_pu_bacteria 2919462493 2919463614 412
66 iso_pu_bacteria 2929520902 2929525735 412
67 3300027876 Ga0209974_10000608 Ga0209974_100006083 413
68 3300044673 Ga0453683_0035550 Ga0453683_0035550_316_1650 413
69 3300028786 Ga0307517_10072690 Ga0307517_100726902 414
70 3300031730 Ga0307516_10001808 Ga0307516_100018083 414
71 3300046457 Ga0495590_0033892 Ga0495590_0033892_113_1408 414
72 3300046660 Ga0495625_0044634 Ga0495625_0044634_1174_2625 414
73 3300047443 Ga0495687_000174 Ga0495687_000174_67880_69259 414
74 3300053134 Ga0500658_0001460 Ga0500658_0001460_1354_2733 414
75 3300005543 Ga0070672_100006490 Ga0070672_1000064906 415
76 3300025903 Ga0207680_10028440 Ga0207680_100284401 415
77 3300025940 Ga0207691_10003449 Ga0207691_100034495 415
78 3300025986 Ga0207658_10012147 Ga0207658_100121472 415
79 3300026035 Ga0207703_10004229 Ga0207703_100042299 415
80 3300028381 Ga0268264_10034363 Ga0268264_100343633 415
81 3300046507 Ga0495606_0053792 Ga0495606_0053792_312_1763 415
82 3300046517 Ga0495630_0052261 Ga0495630_0052261_617_2008 415
83 3300046557 Ga0495622_0020307 Ga0495622_0020307_158_1549 415
84 3300046690 Ga0495624_0037876 Ga0495624_0037876_520_1911 415
85 3300046694 Ga0495649_0000524 Ga0495649_0000524_18428_19879 415
86 3300005459 Ga0068867_100000120 Ga0068867_10000012040 417
87 3300006195 Ga0075366_10000488 Ga0075366_100004886 417
88 3300006353 Ga0075370_10001163 Ga0075370_100011634 417
89 3300026089 Ga0207648_10001584 Ga0207648_1000158416 417
90 3300045051 Ga0451576_0049640 Ga0451576_0049640_2215_3513 417
91 3300046810 Ga0495660_0016578 Ga0495660_0016578_641_2122 417
92 3300050493 nmdc:mga0k408_1174_c1 nmdc:mga0k408_1174_c1_3404_4792 417
93 3300050493 nmdc:mga0k408_729_c1 nmdc:mga0k408_729_c1_9326_10759 417
94 3300050496 nmdc:mga07m45_27970_c1 nmdc:mga07m45_27970_c1_1300_2733 417
95 3300005331 Ga0070670_100118273 Ga0070670_1001182732 419
96 3300005354 Ga0070675_100189509 Ga0070675_1001895092 419
97 3300025904 Ga0207647_10073527 Ga0207647_100735272 419
98 3300025925 Ga0207650_10077599 Ga0207650_100775992 419
99 3300037418 Ga0395900_0032417 Ga0395900_0032417_2298_3650 419
100 3300037466 Ga0395898_0005142 Ga0395898_0005142_8746_10098 419
101 3300038443 Ga0395901_0040745 Ga0395901_0040745_2522_3874 419
102 3300005331 Ga0070670_100006917 Ga0070670_1000069178 420
103 3300005364 Ga0070673_100055040 Ga0070673_1000550401 420
104 3300006353 Ga0075370_10002147 Ga0075370_100021477 420
105 3300013306 Ga0163162_10051927 Ga0163162_100519273 420
106 3300014325 Ga0163163_10243940 Ga0163163_102439402 420
107 3300025923 Ga0207681_10042266 Ga0207681_100422662 420
108 3300025925 Ga0207650_10001346 Ga0207650_1000134613 420
109 3300042115 Ga0450911_004418 Ga0450911_004418_272_1615 420
110 3300048927 Ga0496124_0031147 Ga0496124_0031147_2914_4257 420
111 3300048928 Ga0496125_0074777 Ga0496125_0074777_656_1999 420
112 3300048929 Ga0496126_0146301 Ga0496126_0146301_634_1977 420
113 3300053154 Ga0500619_000014 Ga0500619_000014_9220_10611 420
114 3300005563 Ga0068855_100048080 Ga0068855_1000480805 421
115 3300025949 Ga0207667_10027618 Ga0207667_100276182 421
116 3300039447 Ga0436361_1043865 Ga0436361_1043865_1862_3229 421
117 3300005336 Ga0070680_100025814 Ga0070680_1000258145 422
118 3300005457 Ga0070662_100022134 Ga0070662_1000221343 422
119 3300005458 Ga0070681_10062170 Ga0070681_100621702 422
120 3300005530 Ga0070679_100013044 Ga0070679_1000130443 422
121 3300005543 Ga0070672_100079594 Ga0070672_1000795942 422
122 3300025909 Ga0207705_10136076 Ga0207705_101360762 422
123 3300025917 Ga0207660_10001454 Ga0207660_1000145412 422
124 3300025921 Ga0207652_10051225 Ga0207652_100512252 422
125 3300026121 Ga0207683_10154519 Ga0207683_101545192 422
126 3300042461 Ga0439460_0009792 Ga0439460_0009792_335_1723 422
127 3300003775 Ga0055524_1000247 Ga0055524_10002477 423
128 3300031507 Ga0307509_10020572 Ga0307509_100205726 423
129 3300031548 Ga0307408_100032911 Ga0307408_1000329113 423
130 3300005338 Ga0068868_100111977 Ga0068868_1001119773 424
131 3300005563 Ga0068855_100072373 Ga0068855_1000723733 424
132 3300005563 Ga0068855_100268088 Ga0068855_1002680881 424
133 3300005614 Ga0068856_100023648 Ga0068856_1000236487 424
134 3300006038 Ga0075365_10011610 Ga0075365_100116106 424
135 3300006177 Ga0075362_10026936 Ga0075362_100269362 424
136 3300006195 Ga0075366_10036444 Ga0075366_100364442 424
137 3300009098 Ga0105245_10012950 Ga0105245_100129504 424
138 3300025949 Ga0207667_10131052 Ga0207667_101310522 424
139 3300050489 nmdc:mga03683_15504_c1 nmdc:mga03683_15504_c1_742_2100 424
140 3300050492 nmdc:mga0yw44_64343_c1 nmdc:mga0yw44_64343_c1_765_2123 424
141 3300050493 nmdc:mga0k408_47579_c1 nmdc:mga0k408_47579_c1_337_1695 424
142 3300050496 nmdc:mga07m45_74089_c1 nmdc:mga07m45_74089_c1_548_1906 424
143 3300028794 Ga0307515_10000011 Ga0307515_100000116 425
144 3300028794 Ga0307515_10000281 Ga0307515_100002816 425
145 3300031730 Ga0307516_10005578 Ga0307516_1000557814 425
146 3300015683 Ga0183362_10005 Ga0183362_10005134 426
147 3300031456 Ga0307513_10025768 Ga0307513_100257683 426
148 3300042876 Ga0451577_0014500 Ga0451577_0014500_99_1469 426
149 3300049579 Ga0501043_0030215 Ga0501043_0030215_2241_3617 426
150 iso_pu_bacteria 2932422444 2932424491 426
151 3300005331 Ga0070670_100044235 Ga0070670_1000442353 427
152 3300005338 Ga0068868_100022196 Ga0068868_1000221962 427
153 3300005340 Ga0070689_100012386 Ga0070689_1000123864 427
154 3300005354 Ga0070675_100012549 Ga0070675_1000125496 427
155 3300005355 Ga0070671_100004115 Ga0070671_10000411510 427
156 3300005364 Ga0070673_100009469 Ga0070673_1000094695 427
157 3300005367 Ga0070667_100008119 Ga0070667_1000081198 427
158 3300005456 Ga0070678_100051450 Ga0070678_1000514501 427
159 3300005457 Ga0070662_100075344 Ga0070662_1000753442 427
160 3300005543 Ga0070672_100123912 Ga0070672_1001239122 427
161 3300005616 Ga0068852_100140444 Ga0068852_1001404442 427
162 3300005843 Ga0068860_100084500 Ga0068860_1000845002 427
163 3300013296 Ga0157374_10048229 Ga0157374_100482292 427
164 3300013306 Ga0163162_10006139 Ga0163162_100061395 427
165 3300013308 Ga0157375_10016070 Ga0157375_100160705 427
166 3300014325 Ga0163163_10035773 Ga0163163_100357732 427
167 3300014968 Ga0157379_10022724 Ga0157379_100227242 427
168 3300014969 Ga0157376_10061714 Ga0157376_100617142 427
169 3300025933 Ga0207706_10061609 Ga0207706_100616092 427
170 3300025960 Ga0207651_10009387 Ga0207651_100093875 427
171 3300026035 Ga0207703_10011615 Ga0207703_100116152 427
172 3300026142 Ga0207698_10073054 Ga0207698_100730542 427
173 3300027543 Ga0209999_1007707 Ga0209999_10077071 427
174 3300031995 Ga0307409_100004999 Ga0307409_1000049998 427
175 3300048911 Ga0496108_0118815 Ga0496108_0118815_241_1572 427
176 3300048912 Ga0496109_0155807 Ga0496109_0155807_421_1752 427
177 iso_pu_bacteria 2643221628 2644164023 427
178 iso_pu_bacteria 2842677519 2842678630 427
179 iso_pu_bacteria 2904449895 2904452766 427
180 iso_pu_bacteria 2904456579 2904460206 427
181 iso_pu_bacteria 2945945610 2945945702 427
182 iso_pu_bacteria 2945972063 2945975357 427
183 3300005331 Ga0070670_100105924 Ga0070670_1001059242 428
184 3300005355 Ga0070671_100018389 Ga0070671_1000183895 428
185 3300005618 Ga0068864_100030433 Ga0068864_1000304332 428
186 3300005841 Ga0068863_100045751 Ga0068863_1000457512 428
187 3300006358 Ga0068871_100013329 Ga0068871_1000133295 428
188 3300009093 Ga0105240_10160491 Ga0105240_101604912 428
189 3300009177 Ga0105248_10024656 Ga0105248_100246565 428
190 3300025931 Ga0207644_10017333 Ga0207644_100173335 428
191 3300025941 Ga0207711_10019739 Ga0207711_100197395 428
192 3300026088 Ga0207641_10011103 Ga0207641_100111037 428
193 3300048905 Ga0496102_0009157 Ga0496102_0009157_6389_7780 428
194 3300048912 Ga0496109_0193157 Ga0496109_0193157_88_1476 428
195 3300048916 Ga0496113_0089270 Ga0496113_0089270_998_2341 428
196 3300048928 Ga0496125_0075095 Ga0496125_0075095_410_1753 428
197 iso_pu_bacteria 2738543013 2739249703 428
198 iso_pu_bacteria 2842747753 2842752377 428
199 iso_pu_bacteria 2885192300 2885193210 428
200 3300025917 Ga0207660_10117650 Ga0207660_101176501 429
201 3300009176 Ga0105242_10001200 Ga0105242_1000120013 430
202 3300025934 Ga0207686_10004163 Ga0207686_100041638 430
203 3300003578 Ga0006562J51391_1042152 Ga0006562J51391_10421522 431
204 3300003792 Ga0055540_1008623 Ga0055540_10086232 431
205 3300005288 Ga0065714_10010259 Ga0065714_100102594 431
206 3300006051 Ga0075364_10079311 Ga0075364_100793111 431
207 3300006177 Ga0075362_10002845 Ga0075362_100028455 431
208 3300006177 Ga0075362_10005426 Ga0075362_100054263 431
209 3300006195 Ga0075366_10013295 Ga0075366_100132954 431
210 3300006195 Ga0075366_10020444 Ga0075366_100204442 431
211 3300006353 Ga0075370_10008222 Ga0075370_100082224 431
212 3300006946 Ga0079104_1013480 Ga0079104_10134802 431
213 3300013100 Ga0157373_10012300 Ga0157373_100123008 431
214 3300025273 Ga0209673_1003690 Ga0209673_10036909 431
215 3300025303 Ga0209051_1008990 Ga0209051_10089905 431
216 3300028794 Ga0307515_10000419 Ga0307515_100004196 431
217 3300030735 Ga0316178_1131179 Ga0316178_11311791 431
218 3300031251 Ga0265327_10016534 Ga0265327_100165344 431
219 3300031548 Ga0307408_100056443 Ga0307408_1000564432 431
220 3300031731 Ga0307405_10034443 Ga0307405_100344431 431
221 3300031901 Ga0307406_10007227 Ga0307406_100072275 431
222 3300041404 Ga0439436_0016190 Ga0439436_0016190_697_2037 431
223 3300041411 Ga0439466_0006336 Ga0439466_0006336_1436_2776 431
224 3300042002 Ga0439442_004829 Ga0439442_004829_1222_2562 431
225 3300042123 Ga0450921_000014 Ga0450921_000014_652_1992 431
226 3300042125 Ga0450923_001529 Ga0450923_001529_1343_2683 431
227 3300042156 Ga0439446_0017256 Ga0439446_0017256_508_1848 431
228 3300042184 Ga0450908_000591 Ga0450908_000591_4970_6310 431
229 3300042435 Ga0439434_0011742 Ga0439434_0011742_168_1508 431
230 3300042531 Ga0450918_003796 Ga0450918_003796_1197_2537 431
231 3300050489 nmdc:mga03683_13349_c1 nmdc:mga03683_13349_c1_1365_2705 431
232 3300050489 nmdc:mga03683_6266_c1 nmdc:mga03683_6266_c1_409_1749 431
233 3300050491 nmdc:mga00v17_87387_c1 nmdc:mga00v17_87387_c1_149_1489 431
234 3300050492 nmdc:mga0yw44_8074_c1 nmdc:mga0yw44_8074_c1_2424_3764 431
235 3300050493 nmdc:mga0k408_12497_c1 nmdc:mga0k408_12497_c1_739_2079 431
236 iso_pu_bacteria 2643221660 2644338646 431
237 iso_pu_bacteria 2881101125 2881103309 431
238 iso_pu_bacteria 2928115317 2928117980 431
239 3300003784 Ga0055534_1002527 Ga0055534_10025272 432
240 3300005353 Ga0070669_100002701 Ga0070669_1000027017 432
241 3300005456 Ga0070678_100122314 Ga0070678_1001223141 432
242 3300005543 Ga0070672_100020259 Ga0070672_1000202594 432
243 3300005548 Ga0070665_100009614 Ga0070665_1000096147 432
244 3300005577 Ga0068857_100040785 Ga0068857_1000407852 432
245 3300006038 Ga0075365_10010955 Ga0075365_100109557 432
246 3300006048 Ga0075363_100009657 Ga0075363_1000096572 432
247 3300006186 Ga0075369_10055871 Ga0075369_100558711 432
248 3300006195 Ga0075366_10043068 Ga0075366_100430682 432
249 3300006353 Ga0075370_10001843 Ga0075370_1000184311 432
250 3300006353 Ga0075370_10012954 Ga0075370_100129544 432
251 3300009177 Ga0105248_10270413 Ga0105248_102704131 432
252 3300013308 Ga0157375_10098903 Ga0157375_100989032 432
253 3300014497 Ga0182008_10002992 Ga0182008_100029928 432
254 3300014497 Ga0182008_10006547 Ga0182008_100065477 432
255 3300015262 Ga0182007_10004423 Ga0182007_100044232 432
256 3300015265 Ga0182005_1007578 Ga0182005_10075782 432
257 3300017792 Ga0163161_10019147 Ga0163161_100191473 432
258 3300017792 Ga0163161_10039817 Ga0163161_100398172 432
259 3300025291 Ga0209675_1000911 Ga0209675_10009112 432
260 3300025292 Ga0209676_1011605 Ga0209676_10116052 432
261 3300025303 Ga0209051_1026222 Ga0209051_10262222 432
262 3300025304 Ga0209257_1006810 Ga0209257_10068102 432
263 3300025923 Ga0207681_10002578 Ga0207681_1000257810 432
264 3300026121 Ga0207683_10098453 Ga0207683_100984532 432
265 3300027876 Ga0209974_10017019 Ga0209974_100170192 432
266 3300031235 Ga0265330_10000052 Ga0265330_1000005268 432
267 3300031238 Ga0265332_10000001 Ga0265332_10000001751 432
268 3300031241 Ga0265325_10010139 Ga0265325_100101395 432
269 3300031247 Ga0265340_10059587 Ga0265340_100595872 432
270 3300031711 Ga0265314_10000013 Ga0265314_1000001366 432
271 3300031731 Ga0307405_10061018 Ga0307405_100610182 432
272 3300031911 Ga0307412_10015031 Ga0307412_100150312 432
273 3300041404 Ga0439436_0009572 Ga0439436_0009572_537_1886 432
274 3300041406 Ga0439439_0002335 Ga0439439_0002335_2169_3518 432
275 3300041411 Ga0439466_0013342 Ga0439466_0013342_397_1746 432
276 3300041411 Ga0439466_0019082 Ga0439466_0019082_269_1618 432
277 3300041413 Ga0439465_0006744 Ga0439465_0006744_539_1888 432
278 3300041997 Ga0439431_0001021 Ga0439431_0001021_2884_4233 432
279 3300041999 Ga0439433_0007805 Ga0439433_0007805_25_1374 432
280 3300042002 Ga0439442_003465 Ga0439442_003465_1172_2521 432
281 3300042002 Ga0439442_008074 Ga0439442_008074_582_1931 432
282 3300042004 Ga0439445_0000222 Ga0439445_0000222_8583_9932 432
283 3300042004 Ga0439445_0012752 Ga0439445_0012752_472_1821 432
284 3300042006 Ga0439432_005922 Ga0439432_005922_2498_3847 432
285 3300042007 Ga0439449_0005925 Ga0439449_0005925_1924_3273 432
286 3300042007 Ga0439449_0012922 Ga0439449_0012922_653_2002 432
287 3300042010 Ga0439452_012584 Ga0439452_012584_693_2042 432
288 3300042014 Ga0439457_009566 Ga0439457_009566_674_2023 432
289 3300042014 Ga0439457_009633 Ga0439457_009633_546_1895 432
290 3300042015 Ga0439462_0004249 Ga0439462_0004249_463_1812 432
291 3300042015 Ga0439462_0006720 Ga0439462_0006720_561_1910 432
292 3300042131 Ga0450894_002457 Ga0450894_002457_511_1860 432
293 3300042145 Ga0450906_004008 Ga0450906_004008_743_2092 432
294 3300042156 Ga0439446_0018498 Ga0439446_0018498_67_1416 432
295 3300042184 Ga0450908_009850 Ga0450908_009850_260_1609 432
296 3300042185 Ga0450909_003138 Ga0450909_003138_960_2309 432
297 3300042435 Ga0439434_0015589 Ga0439434_0015589_518_1867 432
298 3300044683 Ga0466965_0008433 Ga0466965_0008433_526_1875 432
299 3300044901 Ga0466960_0042774 Ga0466960_0042774_422_1771 432
300 3300046459 Ga0495629_0070447 Ga0495629_0070447_582_1934 432
301 3300046471 Ga0495650_0017128 Ga0495650_0017128_207_1550 432
302 3300046475 Ga0495639_0004264 Ga0495639_0004264_870_2222 432
303 3300046522 Ga0495643_0027317 Ga0495643_0027317_611_1960 432
304 3300046528 Ga0495642_0020287 Ga0495642_0020287_228_1577 432
305 3300046615 Ga0495656_0002495 Ga0495656_0002495_822_2171 432
306 3300046674 Ga0495588_0060622 Ga0495588_0060622_105_1457 432
307 3300048904 Ga0496101_0029043 Ga0496101_0029043_508_1860 432
308 3300048905 Ga0496102_0009561 Ga0496102_0009561_4829_6181 432
309 3300048906 Ga0496103_0033383 Ga0496103_0033383_1438_2790 432
310 3300048908 Ga0496105_0032115 Ga0496105_0032115_2338_3690 432
311 3300048910 Ga0496107_0109186 Ga0496107_0109186_205_1557 432
312 3300048912 Ga0496109_0047302 Ga0496109_0047302_1872_3224 432
313 3300048913 Ga0496110_0153617 Ga0496110_0153617_207_1559 432
314 3300048914 Ga0496111_0150933 Ga0496111_0150933_211_1563 432
315 3300048925 Ga0496122_0004537 Ga0496122_0004537_11024_12379 432
316 3300048926 Ga0496123_0000160 Ga0496123_0000160_8563_9918 432
317 3300048929 Ga0496126_0172256 Ga0496126_0172256_68_1423 432
318 3300050490 nmdc:mga03n38_16652_c1 nmdc:mga03n38_16652_c1_1371_2720 432
319 3300050496 nmdc:mga07m45_4843_c1 nmdc:mga07m45_4843_c1_341_1690 432
320 3300050496 nmdc:mga07m45_55744_c1 nmdc:mga07m45_55744_c1_365_1711 432
321 3300053136 Ga0500559_0005517 Ga0500559_0005517_4062_5411 432
322 3300053136 Ga0500559_0012959 Ga0500559_0012959_1023_2372 432
323 3300003323 rootH1_10069288 rootH1_100692882 433
324 3300005345 Ga0070692_10043595 Ga0070692_100435952 433
325 3300005367 Ga0070667_100036643 Ga0070667_1000366432 433
326 3300005842 Ga0068858_100004297 Ga0068858_1000042972 433
327 3300046558 Ga0495633_0007721 Ga0495633_0007721_687_2051 433
328 3300049571 Ga0501034_0124759 Ga0501034_0124759_145_1503 433
329 3300049822 Ga0501035_0111195 Ga0501035_0111195_266_1624 433
330 3300049823 Ga0501044_0308243 Ga0501044_0308243_92_1447 433
331 3300053117 Ga0500593_003896 Ga0500593_003896_3548_4912 433
332 3300042006 Ga0439432_021684 Ga0439432_021684_386_1762 434
333 3300042007 Ga0439449_0011708 Ga0439449_0011708_1884_3260 434
334 3300042876 Ga0451577_0009895 Ga0451577_0009895_7078_8445 434
335 3300050493 nmdc:mga0k408_35206_c1 nmdc:mga0k408_35206_c1_227_1618 434
336 3300050496 nmdc:mga07m45_5171_c1 nmdc:mga07m45_5171_c1_754_2145 434
337 3300005355 Ga0070671_100026675 Ga0070671_1000266756 435
338 3300005618 Ga0068864_100106106 Ga0068864_1001061062 435
339 3300006353 Ga0075370_10003491 Ga0075370_100034912 435
340 3300009177 Ga0105248_10036212 Ga0105248_100362124 435
341 3300025941 Ga0207711_10033268 Ga0207711_100332684 435
342 3300026095 Ga0207676_10095831 Ga0207676_100958312 435
343 3300032005 Ga0307411_10090769 Ga0307411_100907692 435
344 3300048912 Ga0496109_0077567 Ga0496109_0077567_787_2157 435
345 3300050493 nmdc:mga0k408_892_c1 nmdc:mga0k408_892_c1_181_1539 435
346 3300050496 nmdc:mga07m45_6993_c1 nmdc:mga07m45_6993_c1_2935_4296 435
347 3300050496 nmdc:mga07m45_7711_c1 nmdc:mga07m45_7711_c1_370_1728 435
348 iso_pu_bacteria 2721755523 2722881536 435
349 3300005339 Ga0070660_100026833 Ga0070660_1000268334 436
350 3300005341 Ga0070691_10053453 Ga0070691_100534532 436
351 3300005458 Ga0070681_10139067 Ga0070681_101390672 436
352 3300005530 Ga0070679_100062147 Ga0070679_1000621472 436
353 3300005563 Ga0068855_100007548 Ga0068855_10000754814 436
354 3300006195 Ga0075366_10000512 Ga0075366_100005127 436
355 3300009093 Ga0105240_10019194 Ga0105240_100191942 436
356 3300025912 Ga0207707_10120457 Ga0207707_101204572 436
357 3300025919 Ga0207657_10023991 Ga0207657_100239917 436
358 3300027526 Ga0209968_1000906 Ga0209968_10009062 437
359 3300027695 Ga0209966_1000017 Ga0209966_100001720 437
360 3300031548 Ga0307408_100064624 Ga0307408_1000646242 437
361 3300031911 Ga0307412_10026896 Ga0307412_100268962 437
362 3300046543 Ga0495645_0050111 Ga0495645_0050111_1088_2467 437
363 iso_pu_bacteria 2643221644 2644244825 437
364 iso_pu_bacteria 2831864461 2831864583 438
365 iso_pu_bacteria 2886848708 2886851440 438
366 3300037471 Ga0395905_0014064 Ga0395905_0014064_2539_3909 439
367 3300037471 Ga0395905_0109466 Ga0395905_0109466_961_2328 439
368 3300048905 Ga0496102_0011400 Ga0496102_0011400_1262_2641 439
369 3300003316 rootH1_10083585 rootH1_100835853 440
370 3300003322 rootL2_10106425 rootL2_101064253 440
371 3300044684 Ga0466966_0003197 Ga0466966_0003197_6758_8125 440
372 3300044693 Ga0466961_0007180 Ga0466961_0007180_2610_3977 440
373 3300044706 Ga0466964_0006544 Ga0466964_0006544_963_2330 440
374 3300044719 Ga0466971_0043912 Ga0466971_0043912_175_1542 440
375 3300045049 Ga0466959_0000174 Ga0466959_0000174_36716_38083 440
376 3300048927 Ga0496124_0000108 Ga0496124_0000108_29813_31180 440
377 3300048928 Ga0496125_0004332 Ga0496125_0004332_14516_15883 440
378 iso_pu_bacteria 2585428057 2587725502 440
379 iso_pu_bacteria 2585428058 2587734972 440
380 iso_pu_bacteria 2588253510 2588290504 440
381 3300005262 Ga0065165_1005747 Ga0065165_10057472 441
382 3300006195 Ga0075366_10002670 Ga0075366_100026707 441
383 3300006195 Ga0075366_10073830 Ga0075366_100738302 441
384 3300006946 Ga0079104_1000711 Ga0079104_100071121 441
385 3300014745 Ga0157377_10000044 Ga0157377_1000004487 441
386 3300021361 Ga0213872_10000067 Ga0213872_100000677 441
387 3300021361 Ga0213872_10000131 Ga0213872_100001315 441
388 3300021361 Ga0213872_10000233 Ga0213872_1000023313 441
389 3300021361 Ga0213872_10025078 Ga0213872_100250782 441
390 3300025298 Ga0209050_1004597 Ga0209050_10045977 441
391 3300025298 Ga0209050_1008492 Ga0209050_10084925 441
392 3300025299 Ga0209256_1000049 Ga0209256_100004967 441
393 3300025303 Ga0209051_1000247 Ga0209051_100024747 441
394 3300025304 Ga0209257_1000141 Ga0209257_100014147 441
395 3300027111 Ga0209281_1000395 Ga0209281_100039548 441
396 3300028794 Ga0307515_10031865 Ga0307515_100318653 441
397 3300031250 Ga0265331_10003008 Ga0265331_100030083 441
398 3300031251 Ga0265327_10000035 Ga0265327_10000035152 441
399 3300031456 Ga0307513_10034575 Ga0307513_100345753 441
400 3300039447 Ga0436361_0479314 Ga0436361_0479314_2541_3923 441
401 3300039447 Ga0436361_0816515 Ga0436361_0816515_2126_3508 441
402 3300039447 Ga0436361_1149866 Ga0436361_1149866_3503_4885 441
403 3300042876 Ga0451577_0125297 Ga0451577_0125297_65_1438 441
404 3300048917 Ga0496114_0006241 Ga0496114_0006241_175_1557 441
405 3300049822 Ga0501035_0083199 Ga0501035_0083199_1059_2438 441
406 3300053086 Ga0500578_0000025 Ga0500578_0000025_13674_15053 441
407 3300053108 Ga0500562_015236 Ga0500562_015236_180_1559 441
408 3300053130 Ga0500642_0032519 Ga0500642_0032519_547_1926 441
409 3300053139 Ga0500568_0011402 Ga0500568_0011402_553_1932 441
410 3300053156 Ga0500622_0000890 Ga0500622_0000890_3893_5272 441
411 3300053156 Ga0500622_0010205 Ga0500622_0010205_3241_4620 441
412 3300003322 rootL2_10003381 rootL2_1000338116 442
413 3300003771 Ga0055526_1001509 Ga0055526_10015095 442
414 3300003775 Ga0055524_1002449 Ga0055524_10024494 442
415 3300003775 Ga0055524_1003709 Ga0055524_10037095 442
416 3300003794 Ga0055531_10004940 Ga0055531_100049405 442
417 3300003794 Ga0055531_10008285 Ga0055531_100082852 442
418 3300004625 Ga0055543_1004417 Ga0055543_10044175 442
419 3300005262 Ga0065165_1000290 Ga0065165_100029072 442
420 3300005262 Ga0065165_1001688 Ga0065165_10016884 442
421 3300005577 Ga0068857_100005597 Ga0068857_10000559711 442
422 3300006048 Ga0075363_100005295 Ga0075363_1000052954 442
423 3300006177 Ga0075362_10001230 Ga0075362_100012305 442
424 3300006186 Ga0075369_10003566 Ga0075369_100035666 442
425 3300006353 Ga0075370_10002011 Ga0075370_100020115 442
426 3300006944 Ga0099823_1000065 Ga0099823_10000655 442
427 3300009545 Ga0105237_10000646 Ga0105237_1000064610 442
428 3300012497 Ga0157319_1000005 Ga0157319_1000005268 442
429 3300013296 Ga0157374_10071539 Ga0157374_100715392 442
430 3300025242 Ga0209258_103059 Ga0209258_1030593 442
431 3300025273 Ga0209673_1011942 Ga0209673_10119421 442
432 3300025295 Ga0209564_1000008 Ga0209564_1000008217 442
433 3300025298 Ga0209050_1010621 Ga0209050_10106213 442
434 3300025299 Ga0209256_1003918 Ga0209256_10039185 442
435 3300025299 Ga0209256_1004159 Ga0209256_10041594 442
436 3300025303 Ga0209051_1003902 Ga0209051_10039023 442
437 3300025304 Ga0209257_1001704 Ga0209257_100170417 442
438 3300025304 Ga0209257_1004727 Ga0209257_10047275 442
439 3300025907 Ga0207645_10054409 Ga0207645_100544092 442
440 3300025914 Ga0207671_10007157 Ga0207671_100071573 442
441 3300027296 Ga0209389_1010868 Ga0209389_10108683 442
442 3300027866 Ga0209813_10012578 Ga0209813_100125782 442
443 3300042127 Ga0450890_002246 Ga0450890_002246_534_1919 442
444 3300044656 Ga0466969_0000046 Ga0466969_0000046_58804_60180 442
445 3300044684 Ga0466966_0016292 Ga0466966_0016292_297_1673 442
446 3300044694 Ga0466963_0062885 Ga0466963_0062885_795_2180 442
447 3300045049 Ga0466959_0026183 Ga0466959_0026183_62_1438 442
448 3300048912 Ga0496109_0232931 Ga0496109_0232931_279_1694 442
449 3300048913 Ga0496110_0019147 Ga0496110_0019147_3736_5151 442
450 3300048927 Ga0496124_0075218 Ga0496124_0075218_862_2247 442
451 3300050496 nmdc:mga07m45_3610_c1 nmdc:mga07m45_3610_c1_3535_4920 442
452 3300053156 Ga0500622_0001306 Ga0500622_0001306_16353_17780 442
453 3300005356 Ga0070674_100004415 Ga0070674_1000044156 443
454 3300025303 Ga0209051_1007075 Ga0209051_10070757 443
455 3300032002 Ga0307416_100077835 Ga0307416_1000778352 443
456 3300037418 Ga0395900_0001686 Ga0395900_0001686_4173_5549 443
457 3300037466 Ga0395898_0002642 Ga0395898_0002642_18107_19483 443
458 3300048907 Ga0496104_0113229 Ga0496104_0113229_666_2042 443
459 3300049686 Ga0501257_015855 Ga0501257_015855_69_1451 443
460 3300049762 Ga0501265_002543 Ga0501265_002543_149_1531 443
461 3300050496 nmdc:mga07m45_11599_c1 nmdc:mga07m45_11599_c1_1580_2971 443
462 3300003215 JGI25153J46596_10002860 JGI25153J46596_100028607 444
463 3300003323 rootH1_10013830 rootH1_100138302 444
464 3300003759 Ga0055525_1000004 Ga0055525_1000004130 444
465 3300003771 Ga0055526_1002656 Ga0055526_10026567 444
466 3300005331 Ga0070670_100026772 Ga0070670_1000267722 444
467 3300005343 Ga0070687_100013556 Ga0070687_1000135563 444
468 3300005356 Ga0070674_100034797 Ga0070674_1000347972 444
469 3300006177 Ga0075362_10004591 Ga0075362_100045915 444
470 3300006178 Ga0075367_10025245 Ga0075367_100252453 444
471 3300006186 Ga0075369_10037162 Ga0075369_100371622 444
472 3300006353 Ga0075370_10001599 Ga0075370_100015994 444
473 3300014968 Ga0157379_10038113 Ga0157379_100381133 444
474 3300025230 Ga0209563_100013 Ga0209563_100013130 444
475 3300025245 Ga0207425_1000426 Ga0207425_100042626 444
476 3300025258 Ga0209129_1000269 Ga0209129_100026926 444
477 3300025295 Ga0209564_1000300 Ga0209564_100030026 444
478 3300025297 Ga0209758_1000605 Ga0209758_10006057 444
479 3300025298 Ga0209050_1000770 Ga0209050_100077046 444
480 3300025303 Ga0209051_1015628 Ga0209051_10156283 444
481 3300026089 Ga0207648_10061480 Ga0207648_100614802 444
482 3300030522 Ga0307512_10040205 Ga0307512_100402054 444
483 3300031649 Ga0307514_10006320 Ga0307514_100063201 444
484 3300035691 Ga0373931_0002648 Ga0373931_0002648_3664_5064 444
485 3300036401 Ga0373937_0016810 Ga0373937_0016810_936_2318 444
486 3300039447 Ga0436361_0099386 Ga0436361_0099386_4039_5457 444
487 3300042121 Ga0450919_000965 Ga0450919_000965_730_2124 444
488 3300042531 Ga0450918_000077 Ga0450918_000077_1645_3039 444
489 3300044712 Ga0453684_0082882 Ga0453684_0082882_372_1811 444
490 3300044712 Ga0453684_0198002 Ga0453684_0198002_678_2087 444
491 3300046512 Ga0495610_0007076 Ga0495610_0007076_5303_6766 444
492 3300046522 Ga0495643_0030737 Ga0495643_0030737_388_1851 444
493 3300046537 Ga0495598_0005445 Ga0495598_0005445_828_2210 444
494 3300046660 Ga0495625_0009857 Ga0495625_0009857_3116_4579 444
495 3300049649 Ga0501198_000007 Ga0501198_000007_101761_103149 444
496 3300049662 Ga0501222_000005 Ga0501222_000005_26595_27983 444
497 3300050493 nmdc:mga0k408_7424_c1 nmdc:mga0k408_7424_c1_3618_5000 444
498 iso_pu_bacteria 2643221592 2643970018 444
499 iso_pu_bacteria 2643221625 2644143008 444
500 iso_pu_bacteria 2643221648 2644271932 444
501 3300005331 Ga0070670_100010262 Ga0070670_1000102622 445
502 3300005338 Ga0068868_100079731 Ga0068868_1000797311 445
503 3300005347 Ga0070668_100111676 Ga0070668_1001116762 445
504 3300005354 Ga0070675_100000703 Ga0070675_10000070317 445
505 3300005355 Ga0070671_100002088 Ga0070671_10000208816 445
506 3300005356 Ga0070674_100004918 Ga0070674_1000049181 445
507 3300005456 Ga0070678_100009710 Ga0070678_1000097101 445
508 3300005459 Ga0068867_100002943 Ga0068867_1000029436 445
509 3300005459 Ga0068867_100054036 Ga0068867_1000540362 445
510 3300005543 Ga0070672_100000177 Ga0070672_10000017720 445
511 3300005564 Ga0070664_100043654 Ga0070664_1000436542 445
512 3300005578 Ga0068854_100016734 Ga0068854_1000167342 445
513 3300006237 Ga0097621_100013906 Ga0097621_1000139062 445
514 3300006881 Ga0068865_100051203 Ga0068865_1000512032 445
515 3300009093 Ga0105240_10030649 Ga0105240_100306497 445
516 3300009545 Ga0105237_10007873 Ga0105237_100078732 445
517 3300009551 Ga0105238_10013724 Ga0105238_100137242 445
518 3300010375 Ga0105239_10002203 Ga0105239_1000220314 445
519 3300010375 Ga0105239_10034573 Ga0105239_100345732 445
520 3300013297 Ga0157378_10122419 Ga0157378_101224192 445
521 3300014969 Ga0157376_10064408 Ga0157376_100644082 445
522 3300017792 Ga0163161_10006497 Ga0163161_100064973 445
523 3300025304 Ga0209257_1024286 Ga0209257_10242861 445
524 3300025901 Ga0207688_10022598 Ga0207688_100225983 445
525 3300025907 Ga0207645_10028492 Ga0207645_100284922 445
526 3300025913 Ga0207695_10028147 Ga0207695_100281472 445
527 3300025914 Ga0207671_10026506 Ga0207671_100265064 445
528 3300025924 Ga0207694_10016495 Ga0207694_100164952 445
529 3300025925 Ga0207650_10003269 Ga0207650_100032692 445
530 3300025926 Ga0207659_10000207 Ga0207659_1000020726 445
531 3300025931 Ga0207644_10005018 Ga0207644_100050187 445
532 3300025931 Ga0207644_10020439 Ga0207644_100204392 445
533 3300025937 Ga0207669_10002599 Ga0207669_100025998 445
534 3300025938 Ga0207704_10037050 Ga0207704_100370502 445
535 3300025940 Ga0207691_10002895 Ga0207691_100028956 445
536 3300025945 Ga0207679_10158714 Ga0207679_101587142 445
537 3300025981 Ga0207640_10024457 Ga0207640_100244572 445
538 3300026089 Ga0207648_10010854 Ga0207648_100108543 445
539 3300026089 Ga0207648_10011167 Ga0207648_1001116710 445
540 3300026121 Ga0207683_10012763 Ga0207683_100127631 445
541 3300031649 Ga0307514_10000355 Ga0307514_1000035586 445
542 3300031731 Ga0307405_10100625 Ga0307405_101006252 445
543 3300031901 Ga0307406_10056239 Ga0307406_100562392 445
544 3300031903 Ga0307407_10016230 Ga0307407_100162302 445
545 3300031911 Ga0307412_10138233 Ga0307412_101382332 445
546 3300032004 Ga0307414_10038560 Ga0307414_100385601 445
547 3300032005 Ga0307411_10003141 Ga0307411_100031413 445
548 3300032126 Ga0307415_100047717 Ga0307415_1000477172 445
549 3300049569 Ga0501032_0037757 Ga0501032_0037757_1273_2658 445
550 3300049579 Ga0501043_0000002 Ga0501043_0000002_305058_306443 445
551 3300049580 Ga0501046_0000008 Ga0501046_0000008_305155_306540 445
552 3300049581 Ga0501047_0000003 Ga0501047_0000003_328323_329708 445
553 3300049582 Ga0501048_0004029 Ga0501048_0004029_2430_3815 445
554 3300050490 nmdc:mga03n38_26117_c1 nmdc:mga03n38_26117_c1_654_2042 445
555 3300050493 nmdc:mga0k408_3759_c1 nmdc:mga0k408_3759_c1_3065_4453 445
556 3300050494 nmdc:mga06z11_16470_c1 nmdc:mga06z11_16470_c1_897_2285 445
557 3300050494 nmdc:mga06z11_63094_c1 nmdc:mga06z11_63094_c1_409_1800 445
558 3300050496 nmdc:mga07m45_10995_c1 nmdc:mga07m45_10995_c1_1198_2589 445
559 3300050496 nmdc:mga07m45_23016_c1 nmdc:mga07m45_23016_c1_493_1881 445
560 3300050516 nmdc:mga0sz30_14235_c1 nmdc:mga0sz30_14235_c1_767_2155 445
561 3300005467 Ga0070706_100063204 Ga0070706_1000632042 446
562 3300006195 Ga0075366_10000833 Ga0075366_1000083313 446
563 3300006846 Ga0075430_100014313 Ga0075430_1000143132 446
564 3300006880 Ga0075429_100045567 Ga0075429_1000455672 446
565 3300009093 Ga0105240_10110593 Ga0105240_101105932 446
566 3300025231 Ga0207427_101037 Ga0207427_1010372 446
567 3300025910 Ga0207684_10101912 Ga0207684_101019122 446
568 3300026067 Ga0207678_10007570 Ga0207678_100075705 446
569 3300044712 Ga0453684_0032339 Ga0453684_0032339_490_1878 446
570 3300045051 Ga0451576_0003229 Ga0451576_0003229_13415_14803 446
571 3300050489 nmdc:mga03683_7162_c1 nmdc:mga03683_7162_c1_1110_2498 446
572 3300050493 nmdc:mga0k408_396_c1 nmdc:mga0k408_396_c1_20383_21771 446
573 3300050493 nmdc:mga0k408_57467_c1 nmdc:mga0k408_57467_c1_314_1702 446
574 3300050508 nmdc:mga09592_2264_c1 nmdc:mga09592_2264_c1_4345_5844 446
575 3300050509 nmdc:mga0qj67_10871_c1 nmdc:mga0qj67_10871_c1_112_1611 446
576 3300005330 Ga0070690_100004054 Ga0070690_10000405410 447
577 3300005330 Ga0070690_100027300 Ga0070690_1000273003 447
578 3300005334 Ga0068869_100024040 Ga0068869_1000240402 447
579 3300005335 Ga0070666_10032453 Ga0070666_100324532 447
580 3300005339 Ga0070660_100023302 Ga0070660_1000233025 447
581 3300005344 Ga0070661_100025217 Ga0070661_1000252175 447
582 3300005347 Ga0070668_100003480 Ga0070668_1000034809 447
583 3300005353 Ga0070669_100013341 Ga0070669_1000133415 447
584 3300005354 Ga0070675_100034117 Ga0070675_1000341174 447
585 3300005356 Ga0070674_100001813 Ga0070674_1000018135 447
586 3300005366 Ga0070659_100188672 Ga0070659_1001886721 447
587 3300005367 Ga0070667_100006775 Ga0070667_1000067758 447
588 3300005459 Ga0068867_100007438 Ga0068867_1000074385 447
589 3300005543 Ga0070672_100005324 Ga0070672_1000053246 447
590 3300005563 Ga0068855_100275571 Ga0068855_1002755711 447
591 3300005614 Ga0068856_100020622 Ga0068856_1000206223 447
592 3300005616 Ga0068852_100005336 Ga0068852_1000053367 447
593 3300005719 Ga0068861_100040043 Ga0068861_1000400432 447
594 3300005834 Ga0068851_10011301 Ga0068851_100113014 447
595 3300005842 Ga0068858_100002003 Ga0068858_10000200319 447
596 3300005843 Ga0068860_100005401 Ga0068860_1000054015 447
597 3300005844 Ga0068862_100101762 Ga0068862_1001017622 447
598 3300006881 Ga0068865_100004212 Ga0068865_1000042126 447
599 3300009098 Ga0105245_10037642 Ga0105245_100376422 447
600 3300009148 Ga0105243_10006470 Ga0105243_100064707 447
601 3300009176 Ga0105242_10029895 Ga0105242_100298953 447
602 3300009177 Ga0105248_10103720 Ga0105248_101037201 447
603 3300009553 Ga0105249_10075709 Ga0105249_100757092 447
604 3300011119 Ga0105246_10139525 Ga0105246_101395252 447
605 3300013100 Ga0157373_10051815 Ga0157373_100518152 447
606 3300013102 Ga0157371_10139560 Ga0157371_101395602 447
607 3300013306 Ga0163162_10019585 Ga0163162_100195855 447
608 3300013307 Ga0157372_10011552 Ga0157372_100115522 447
609 3300013308 Ga0157375_10010413 Ga0157375_100104135 447
610 3300013308 Ga0157375_10035829 Ga0157375_100358292 447
611 3300013308 Ga0157375_10060447 Ga0157375_100604474 447
612 3300014968 Ga0157379_10008058 Ga0157379_100080582 447
613 3300014968 Ga0157379_10030665 Ga0157379_100306655 447
614 3300014969 Ga0157376_10177582 Ga0157376_101775822 447
615 3300021361 Ga0213872_10019666 Ga0213872_100196662 447
616 3300025907 Ga0207645_10004343 Ga0207645_100043433 447
617 3300025909 Ga0207705_10027738 Ga0207705_100277383 447
618 3300025919 Ga0207657_10029766 Ga0207657_100297661 447
619 3300025920 Ga0207649_10027585 Ga0207649_100275852 447
620 3300025923 Ga0207681_10001008 Ga0207681_100010082 447
621 3300025924 Ga0207694_10034410 Ga0207694_100344103 447
622 3300025926 Ga0207659_10040934 Ga0207659_100409343 447
623 3300025934 Ga0207686_10014698 Ga0207686_100146982 447
624 3300025934 Ga0207686_10103781 Ga0207686_101037811 447
625 3300025935 Ga0207709_10007539 Ga0207709_100075394 447
626 3300025937 Ga0207669_10005642 Ga0207669_100056424 447
627 3300025938 Ga0207704_10040842 Ga0207704_100408422 447
628 3300025939 Ga0207665_10069689 Ga0207665_100696892 447
629 3300025940 Ga0207691_10009917 Ga0207691_100099177 447
630 3300025942 Ga0207689_10003961 Ga0207689_100039619 447
631 3300025942 Ga0207689_10070714 Ga0207689_100707142 447
632 3300025944 Ga0207661_10012579 Ga0207661_100125792 447
633 3300025945 Ga0207679_10050636 Ga0207679_100506362 447
634 3300025960 Ga0207651_10040524 Ga0207651_100405242 447
635 3300025961 Ga0207712_10013724 Ga0207712_100137243 447
636 3300025972 Ga0207668_10013756 Ga0207668_100137563 447
637 3300025986 Ga0207658_10028406 Ga0207658_100284064 447
638 3300026023 Ga0207677_10055029 Ga0207677_100550292 447
639 3300026035 Ga0207703_10065459 Ga0207703_100654592 447
640 3300026088 Ga0207641_10032121 Ga0207641_100321212 447
641 3300026089 Ga0207648_10010452 Ga0207648_100104524 447
642 3300026118 Ga0207675_100042444 Ga0207675_1000424441 447
643 3300026118 Ga0207675_100058322 Ga0207675_1000583222 447
644 3300028380 Ga0268265_10158359 Ga0268265_101583592 447
645 3300028381 Ga0268264_10010530 Ga0268264_100105306 447
646 3300031456 Ga0307513_10075354 Ga0307513_100753542 447
647 3300036401 Ga0373937_0090530 Ga0373937_0090530_697_2085 447
648 3300037068 Ga0373925_0048624 Ga0373925_0048624_935_2323 447
649 3300039447 Ga0436361_0028732 Ga0436361_0028732_1106_2578 447
650 3300042876 Ga0451577_0024419 Ga0451577_0024419_947_2356 447
651 3300045051 Ga0451576_0024150 Ga0451576_0024150_4854_6293 447
652 3300046472 Ga0495580_0111528 Ga0495580_0111528_383_1771 447
653 3300047319 Ga0495674_0197156 Ga0495674_0197156_243_1631 447
654 3300047471 Ga0495684_0038701 Ga0495684_0038701_1227_2615 447
655 3300048907 Ga0496104_0106928 Ga0496104_0106928_506_1897 447
656 3300048908 Ga0496105_0039421 Ga0496105_0039421_1400_2791 447
657 3300053077 Ga0495601_0023250 Ga0495601_0023250_1632_3020 447
658 3300053085 Ga0495619_0022578 Ga0495619_0022578_2547_3935 447
659 3300053138 Ga0500564_025252 Ga0500564_025252_456_1907 447
660 3300053148 Ga0500590_035532 Ga0500590_035532_495_1943 447
661 3300053177 Ga0500636_0022800 Ga0500636_0022800_68_1468 447
662 3300021361 Ga0213872_10000007 Ga0213872_100000074 448
663 3300039447 Ga0436361_0504982 Ga0436361_0504982_48265_49671 448
664 3300028794 Ga0307515_10073207 Ga0307515_100732072 449
665 3300049128 Ga0501308_000901 Ga0501308_000901_227_1633 449
666 3300049160 Ga0501304_000399 Ga0501304_000399_227_1633 449
667 3300009093 Ga0105240_10199500 Ga0105240_101995001 450
668 3300025242 Ga0209258_103479 Ga0209258_1034793 450
669 3300025913 Ga0207695_10034025 Ga0207695_100340256 450
670 3300031730 Ga0307516_10000054 Ga0307516_1000005424 450
671 3300002705 JGI25156J39149_1002558 JGI25156J39149_10025587 451
672 3300002738 JGI25154J39366_1004695 JGI25154J39366_10046952 451
673 3300002741 JGI25157J39369_1000267 JGI25157J39369_100026729 451
674 3300003323 rootH1_10060360 rootH1_100603602 451
675 3300003752 Ga0055539_1000550 Ga0055539_10005507 451
676 3300003752 Ga0055539_1001108 Ga0055539_10011084 451
677 3300003756 Ga0055533_1000045 Ga0055533_1000045100 451
678 3300003759 Ga0055525_1000632 Ga0055525_10006328 451
679 3300003761 Ga0055535_1000047 Ga0055535_100004721 451
680 3300003763 Ga0055529_1000148 Ga0055529_100014831 451
681 3300003792 Ga0055540_1006264 Ga0055540_10062644 451
682 3300005339 Ga0070660_100015360 Ga0070660_1000153606 451
683 3300005364 Ga0070673_100015757 Ga0070673_1000157576 451
684 3300005366 Ga0070659_100164693 Ga0070659_1001646931 451
685 3300005366 Ga0070659_100195089 Ga0070659_1001950891 451
686 3300005563 Ga0068855_100069769 Ga0068855_1000697693 451
687 3300005577 Ga0068857_100056953 Ga0068857_1000569533 451
688 3300005578 Ga0068854_100006801 Ga0068854_1000068018 451
689 3300005614 Ga0068856_100001716 Ga0068856_1000017167 451
690 3300006195 Ga0075366_10009487 Ga0075366_100094874 451
691 3300009148 Ga0105243_10020659 Ga0105243_100206592 451
692 3300009148 Ga0105243_10298387 Ga0105243_102983871 451
693 3300009545 Ga0105237_10055655 Ga0105237_100556552 451
694 3300013105 Ga0157369_10051064 Ga0157369_100510645 451
695 3300025226 Ga0209674_100073 Ga0209674_100073100 451
696 3300025230 Ga0209563_100061 Ga0209563_100061130 451
697 3300025242 Ga0209258_100072 Ga0209258_100072246 451
698 3300025246 Ga0209646_1000076 Ga0209646_1000076171 451
699 3300025250 Ga0209026_1000011 Ga0209026_1000011355 451
700 3300025253 Ga0209677_100070 Ga0209677_10007045 451
701 3300025253 Ga0209677_100751 Ga0209677_1007513 451
702 3300025253 Ga0209677_105485 Ga0209677_1054852 451
703 3300025254 Ga0209148_1002371 Ga0209148_10023718 451
704 3300025256 Ga0209759_1000034 Ga0209759_1000034121 451
705 3300025256 Ga0209759_1001263 Ga0209759_100126317 451
706 3300025256 Ga0209759_1001427 Ga0209759_100142715 451
707 3300025272 Ga0209455_1000053 Ga0209455_1000053326 451
708 3300025303 Ga0209051_1004626 Ga0209051_10046266 451
709 3300025909 Ga0207705_10050908 Ga0207705_100509082 451
710 3300025919 Ga0207657_10018081 Ga0207657_100180818 451
711 3300025935 Ga0207709_10012409 Ga0207709_100124093 451
712 3300025949 Ga0207667_10051160 Ga0207667_100511602 451
713 3300025960 Ga0207651_10008453 Ga0207651_100084532 451
714 3300025981 Ga0207640_10012952 Ga0207640_100129523 451
715 3300026078 Ga0207702_10001565 Ga0207702_1000156522 451
716 3300026142 Ga0207698_10142335 Ga0207698_101423352 451
717 3300028666 Ga0265336_10000036 Ga0265336_1000003634 451
718 3300029957 Ga0265324_10000136 Ga0265324_1000013647 451
719 3300031730 Ga0307516_10001961 Ga0307516_100019614 451
720 3300038443 Ga0395901_0072660 Ga0395901_0072660_2117_3517 451
721 3300044656 Ga0466969_0067627 Ga0466969_0067627_197_1606 451
722 3300044683 Ga0466965_0035916 Ga0466965_0035916_166_1575 451
723 3300044684 Ga0466966_0011921 Ga0466966_0011921_4249_5658 451
724 3300044693 Ga0466961_0147994 Ga0466961_0147994_23_1432 451
725 3300044694 Ga0466963_0086305 Ga0466963_0086305_510_1910 451
726 3300045836 Ga0466958_0066533 Ga0466958_0066533_493_1902 451
727 3300046492 Ga0495585_0043320 Ga0495585_0043320_534_1940 451
728 3300047472 Ga0495686_0080121 Ga0495686_0080121_552_1952 451
729 3300053080 Ga0500635_0000030 Ga0500635_0000030_15824_17224 451
730 3300053119 Ga0500595_018156 Ga0500595_018156_679_2079 451
731 3300055283 Ga0500661_003126 Ga0500661_003126_652_2124 451
732 3300061719 Ga0466962_0002224 Ga0466962_0002224_200_1609 451

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01551

Peptidase_M23

Peptidase family M23

391

486

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bh5-assembly4.cif.gz_D lytm domain of envc, an activator of cell wall amidases in escherichia coli 0.9574 311 406
4zyb-assembly3.cif.gz_C high resolution structure of m23 peptidase lytm with substrate analogue 0.9339 312 412
4qpb-assembly1.cif.gz_A catalytic domain of the antimicrobial peptidase lysostaphin from staphylococcus simulans crystallized in the absence of phosphate 0.9123 312 412
6tpi-assembly1.cif.gz_A envc bound to the ftsx periplasmic domain 0.8863 301 410
8tzl-assembly1.cif.gz_E cryo-em structure of vibrio cholerae ftse/ftsx/envc complex, full-length 0.8627 277 406
ID Description Score Start End Superfamily
4bh5D00 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9574 311 406 2.70.70.10
af_O33599_157_316_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9548 311 409 2.70.70.10
1qwyA02 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.953 311 409 2.70.70.10
4zybC00 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9339 312 412 2.70.70.10
3sluA02 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9247 172 280 3.10.450.350
ID Description Score Start End GO Terms
AF-A0A2S6U331-F1-model_v4 Peptidase M23 domain-containing protein 0.984 311 406 GO:0004222
AF-A0A1V2ZHL6-F1-model_v4 Peptidase M23 domain-containing protein 0.9788 313 405 GO:0004222
AF-A0A357N2G3-F1-model_v4 Peptidase M23 0.9773 331 406 GO:0004222
AF-A0A0G1P2M8-F1-model_v4 Peptidase M23 0.9752 332 406 GO:0004222
AF-A0A521UA26-F1-model_v4 M23 family metallopeptidase 0.9744 312 409 GO:0004222

Feature Viewer

pLDDT pTM Quality
83.18 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map