F478010
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 732 | 379 | 706 | 454 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100063204|Ga0070706_1000632042 |
| Length | 531 |
| Sequence | MGLLRTFPRGGVGILRGGCGRAKGSGACTIPGDLKSVAILVDASGREEQPLRAASARNKQDGQSRSATKLSSLDPVDRAVASGLERTGRFVNRHPRSITSAVMLALAGFGATAFGIAPLAPDAADLPSRIVTENVTPESIDSQLEALAAHELELYRSDLTRASDTADSLLRRLNVDDAQAAGFVRSDAAARRLLAGRAGKMVQVRTGANGELEELVARYAADNTEQFATHFTRLRITRAGGKFQTSVETAPLAAQVRLGSGTIRNSLFAATDEAHIPDAVASQIAEIFATDVDFHRELRRGDSFRVIYEALTADGEPITWNQSSGRVMAAEFINNGKTYTAVWFKDASGKGGYFDMNGQSKRRSFLAAPLEFSRVTSGFAMRFHPILQTWKQHNGVDYGAPSGTPVRTVGDGTVDFAGWQNGYGNVVSIKHSNDRSTVYAHLSRVDVRRGQHVDQGMRIGAVGMTGWATGPHLHFEVKQHGMQQNPLTIAKASETLTIAPAAKPQFAQLAQGVRAQLDAAQTVAGSAMYAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 4 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 5 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 6 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 7 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 8 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 9 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 10 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 11 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 12 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 13 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 14 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 15 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 16 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 17 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 18 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 19 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 20 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 21 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 22 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 23 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 24 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 25 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 26 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 27 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 28 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 29 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 30 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 33 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 34 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 35 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 36 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 48 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 49 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 53 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 108 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 138 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 207 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 217 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 218 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 220 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 221 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 224 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 227 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 228 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 229 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 230 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 231 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 233 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 236 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 238 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 239 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 240 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 241 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 242 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 247 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 250 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 251 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 252 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 253 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 254 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 255 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 256 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 257 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 258 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 259 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 260 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 261 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 262 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 263 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 264 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 265 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 266 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 267 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 268 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 269 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 270 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 271 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 272 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 273 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 274 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 275 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 276 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 277 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 278 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 279 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 280 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 281 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 282 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 283 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 284 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 285 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 286 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 287 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 288 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 289 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 290 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 291 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 322 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 323 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 324 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 325 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 326 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 329 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 330 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 331 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 332 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 333 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 334 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 335 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 336 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 337 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 338 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 347 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 348 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 349 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 350 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 353 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 354 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 355 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 356 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 357 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 358 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 359 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 362 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 364 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 366 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 367 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 368 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 369 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 370 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 372 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 373 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 374 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 375 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 376 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 377 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 378 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 379 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.9 |
| Metatranscriptomes | 0.41 |
| Isolates | 3.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.17 |
| Nodule | 0.82 |
| Rhizoplane | 2.87 |
| Rhizosphere | 67.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1002558 | 3300002705 | Bacteria | 6454 |
| 2 | JGI25154J39366_1004695 | 3300002738 | Bacteria | 2366 |
| 3 | JGI25157J39369_1000267 | 3300002741 | Bacteria | 38232 |
| 4 | JGI25153J46596_10002860 | 3300003215 | Bacteria | 9807 |
| 5 | rootH1_10012758 | 3300003316 | Bacteria | 8702 |
| 6 | rootH1_10012758 | 3300003323 | Bacteria | 4964 |
| 7 | rootH1_10083585 | 3300003316 | Bacteria | 3863 |
| 8 | rootL2_10003381 | 3300003322 | Bacteria | 63123 |
| 9 | rootL2_10087698 | 3300003322 | Bacteria | 3532 |
| 10 | rootL2_10106425 | 3300003322 | Bacteria | 3907 |
| 11 | rootH1_10013830 | 3300003323 | Bacteria | 3134 |
| 12 | rootH1_10060360 | 3300003323 | Bacteria | 2463 |
| 13 | rootH1_10069288 | 3300003323 | Bacteria | 2808 |
| 14 | Ga0006562J51391_1042152 | 3300003578 | Bacteria | 3520 |
| 15 | Ga0055539_1000550 | 3300003752 | Bacteria | 10874 |
| 16 | Ga0055539_1001108 | 3300003752 | Bacteria | 5590 |
| 17 | Ga0055533_1000045 | 3300003756 | Bacteria | 223637 |
| 18 | Ga0055525_1000004 | 3300003759 | Bacteria | 888039 |
| 19 | Ga0055525_1000632 | 3300003759 | Bacteria | 14353 |
| 20 | Ga0055535_1000047 | 3300003761 | Bacteria | 139836 |
| 21 | Ga0055529_1000148 | 3300003763 | Bacteria | 100809 |
| 22 | Ga0055526_1001509 | 3300003771 | Bacteria | 16488 |
| 23 | Ga0055526_1002656 | 3300003771 | Bacteria | 11933 |
| 24 | Ga0055524_1000247 | 3300003775 | Bacteria | 56379 |
| 25 | Ga0055524_1002449 | 3300003775 | Bacteria | 9548 |
| 26 | Ga0055524_1003709 | 3300003775 | Bacteria | 7308 |
| 27 | Ga0055534_1002527 | 3300003784 | Bacteria | 6276 |
| 28 | Ga0055530_10003306 | 3300003791 | Bacteria | 9321 |
| 29 | Ga0055540_1000260 | 3300003792 | Bacteria | 47714 |
| 30 | Ga0055540_1006264 | 3300003792 | Bacteria | 4762 |
| 31 | Ga0055540_1008623 | 3300003792 | Bacteria | 3649 |
| 32 | Ga0055531_10004940 | 3300003794 | Bacteria | 7929 |
| 33 | Ga0055531_10008285 | 3300003794 | Bacteria | 5520 |
| 34 | Ga0055531_10009185 | 3300003794 | Bacteria | 5090 |
| 35 | Ga0055543_1004417 | 3300004625 | Bacteria | 3851 |
| 36 | Ga0065165_1000290 | 3300005262 | Bacteria | 85623 |
| 37 | Ga0065165_1001688 | 3300005262 | Bacteria | 22283 |
| 38 | Ga0065165_1005747 | 3300005262 | Bacteria | 6812 |
| 39 | Ga0065714_10010259 | 3300005288 | Bacteria | 5056 |
| 40 | Ga0070690_100004054 | 3300005330 | Bacteria | 8110 |
| 41 | Ga0070690_100027300 | 3300005330 | Bacteria | 3529 |
| 42 | Ga0070670_100005551 | 3300005331 | Bacteria | 10640 |
| 43 | Ga0070670_100006917 | 3300005331 | Bacteria | 9615 |
| 44 | Ga0070670_100010262 | 3300005331 | Bacteria | 7992 |
| 45 | Ga0070670_100026772 | 3300005331 | Bacteria | 4960 |
| 46 | Ga0070670_100044235 | 3300005331 | Bacteria | 3829 |
| 47 | Ga0070670_100105924 | 3300005331 | Bacteria | 2423 |
| 48 | Ga0070670_100118273 | 3300005331 | Bacteria | 2285 |
| 49 | Ga0068869_100024040 | 3300005334 | Bacteria | 4218 |
| 50 | Ga0070666_10032453 | 3300005335 | Bacteria | 3449 |
| 51 | Ga0070680_100025814 | 3300005336 | Bacteria | 4697 |
| 52 | Ga0068868_100022196 | 3300005338 | Bacteria | 4788 |
| 53 | Ga0068868_100079731 | 3300005338 | Bacteria | 2623 |
| 54 | Ga0068868_100111977 | 3300005338 | Bacteria | 2218 |
| 55 | Ga0070660_100015360 | 3300005339 | Bacteria | 5525 |
| 56 | Ga0070660_100023302 | 3300005339 | Bacteria | 4586 |
| 57 | Ga0070660_100026833 | 3300005339 | Bacteria | 4292 |
| 58 | Ga0070689_100012386 | 3300005340 | Bacteria | 6142 |
| 59 | Ga0070691_10053453 | 3300005341 | Bacteria | 1932 |
| 60 | Ga0070687_100013556 | 3300005343 | Bacteria | 3636 |
| 61 | Ga0070661_100000361 | 3300005344 | Bacteria | 35932 |
| 62 | Ga0070661_100025217 | 3300005344 | Bacteria | 4272 |
| 63 | Ga0070692_10043595 | 3300005345 | Bacteria | 2308 |
| 64 | Ga0070668_100003480 | 3300005347 | Bacteria | 11615 |
| 65 | Ga0070668_100111676 | 3300005347 | Bacteria | 2176 |
| 66 | Ga0070668_100112479 | 3300005347 | Bacteria | 2168 |
| 67 | Ga0070669_100002701 | 3300005353 | Bacteria | 12795 |
| 68 | Ga0070669_100013341 | 3300005353 | Bacteria | 5840 |
| 69 | Ga0070675_100000703 | 3300005354 | Bacteria | 23209 |
| 70 | Ga0070675_100002723 | 3300005354 | Bacteria | 13282 |
| 71 | Ga0070675_100012549 | 3300005354 | Bacteria | 6642 |
| 72 | Ga0070675_100034117 | 3300005354 | Bacteria | 4128 |
| 73 | Ga0070675_100189509 | 3300005354 | Bacteria | 1781 |
| 74 | Ga0070671_100002088 | 3300005355 | Bacteria | 15388 |
| 75 | Ga0070671_100004115 | 3300005355 | Bacteria | 11486 |
| 76 | Ga0070671_100018389 | 3300005355 | Bacteria | 5676 |
| 77 | Ga0070671_100026675 | 3300005355 | Bacteria | 4751 |
| 78 | Ga0070674_100001813 | 3300005356 | Bacteria | 11593 |
| 79 | Ga0070674_100004415 | 3300005356 | Bacteria | 8019 |
| 80 | Ga0070674_100004918 | 3300005356 | Bacteria | 7656 |
| 81 | Ga0070674_100034797 | 3300005356 | Bacteria | 3367 |
| 82 | Ga0070673_100009469 | 3300005364 | Bacteria | 6538 |
| 83 | Ga0070673_100015757 | 3300005364 | Bacteria | 5321 |
| 84 | Ga0070673_100040286 | 3300005364 | Bacteria | 3583 |
| 85 | Ga0070673_100055040 | 3300005364 | Bacteria | 3133 |
| 86 | Ga0070659_100001606 | 3300005366 | Bacteria | 16262 |
| 87 | Ga0070659_100164693 | 3300005366 | Bacteria | 1814 |
| 88 | Ga0070659_100188672 | 3300005366 | Bacteria | 1694 |
| 89 | Ga0070659_100195089 | 3300005366 | Bacteria | 1665 |
| 90 | Ga0070667_100006775 | 3300005367 | Bacteria | 9512 |
| 91 | Ga0070667_100008119 | 3300005367 | Bacteria | 8705 |
| 92 | Ga0070667_100036643 | 3300005367 | Bacteria | 4113 |
| 93 | Ga0070663_100098121 | 3300005455 | Bacteria | 2182 |
| 94 | Ga0070678_100009710 | 3300005456 | Bacteria | 5846 |
| 95 | Ga0070678_100013404 | 3300005456 | Bacteria | 5139 |
| 96 | Ga0070678_100051450 | 3300005456 | Bacteria | 2986 |
| 97 | Ga0070678_100122314 | 3300005456 | Bacteria | 2054 |
| 98 | Ga0070662_100022134 | 3300005457 | Bacteria | 4347 |
| 99 | Ga0070662_100075344 | 3300005457 | Bacteria | 2498 |
| 100 | Ga0070681_10062170 | 3300005458 | Bacteria | 3708 |
| 101 | Ga0070681_10139067 | 3300005458 | Bacteria | 2358 |
| 102 | Ga0068867_100000120 | 3300005459 | Bacteria | 49908 |
| 103 | Ga0068867_100002943 | 3300005459 | Bacteria | 11989 |
| 104 | Ga0068867_100007438 | 3300005459 | Bacteria | 7746 |
| 105 | Ga0068867_100054036 | 3300005459 | Bacteria | 2967 |
| 106 | Ga0070706_100063204 | 3300005467 | Bacteria | 3421 |
| 107 | Ga0070679_100013044 | 3300005530 | Bacteria | 7957 |
| 108 | Ga0070679_100062147 | 3300005530 | Bacteria | 3723 |
| 109 | Ga0070672_100000177 | 3300005543 | Bacteria | 35110 |
| 110 | Ga0070672_100005324 | 3300005543 | Bacteria | 8521 |
| 111 | Ga0070672_100006490 | 3300005543 | Bacteria | 7862 |
| 112 | Ga0070672_100020259 | 3300005543 | Bacteria | 4847 |
| 113 | Ga0070672_100027809 | 3300005543 | Bacteria | 4222 |
| 114 | Ga0070672_100079594 | 3300005543 | Bacteria | 2623 |
| 115 | Ga0070672_100123912 | 3300005543 | Bacteria | 2118 |
| 116 | Ga0070665_100009614 | 3300005548 | Bacteria | 9781 |
| 117 | Ga0068855_100007548 | 3300005563 | Bacteria | 13156 |
| 118 | Ga0068855_100048080 | 3300005563 | Bacteria | 5036 |
| 119 | Ga0068855_100069769 | 3300005563 | Bacteria | 4089 |
| 120 | Ga0068855_100072373 | 3300005563 | Bacteria | 4007 |
| 121 | Ga0068855_100268088 | 3300005563 | Bacteria | 1900 |
| 122 | Ga0068855_100275571 | 3300005563 | Bacteria | 1870 |
| 123 | Ga0070664_100001095 | 3300005564 | Bacteria | 21389 |
| 124 | Ga0070664_100043654 | 3300005564 | Bacteria | 3784 |
| 125 | Ga0068857_100005597 | 3300005577 | Bacteria | 10734 |
| 126 | Ga0068857_100040785 | 3300005577 | Bacteria | 4115 |
| 127 | Ga0068857_100056953 | 3300005577 | Bacteria | 3469 |
| 128 | Ga0068854_100006801 | 3300005578 | Bacteria | 7289 |
| 129 | Ga0068854_100016734 | 3300005578 | Bacteria | 4893 |
| 130 | Ga0068856_100001716 | 3300005614 | Bacteria | 22915 |
| 131 | Ga0068856_100020622 | 3300005614 | Bacteria | 6404 |
| 132 | Ga0068856_100023648 | 3300005614 | Bacteria | 5975 |
| 133 | Ga0068852_100005336 | 3300005616 | Bacteria | 9178 |
| 134 | Ga0068852_100140444 | 3300005616 | Bacteria | 2235 |
| 135 | Ga0068859_100028219 | 3300005617 | Bacteria | 5626 |
| 136 | Ga0068864_100002220 | 3300005618 | Bacteria | 16047 |
| 137 | Ga0068864_100030433 | 3300005618 | Bacteria | 4575 |
| 138 | Ga0068864_100106106 | 3300005618 | Bacteria | 2498 |
| 139 | Ga0068861_100040043 | 3300005719 | Bacteria | 3502 |
| 140 | Ga0068851_10011301 | 3300005834 | Bacteria | 4185 |
| 141 | Ga0068851_10095902 | 3300005834 | Bacteria | 1568 |
| 142 | Ga0068863_100003043 | 3300005841 | Bacteria | 16570 |
| 143 | Ga0068863_100045751 | 3300005841 | Bacteria | 4154 |
| 144 | Ga0068858_100002003 | 3300005842 | Bacteria | 20846 |
| 145 | Ga0068858_100004297 | 3300005842 | Bacteria | 14008 |
| 146 | Ga0068860_100005401 | 3300005843 | Bacteria | 12967 |
| 147 | Ga0068860_100084500 | 3300005843 | Bacteria | 3020 |
| 148 | Ga0068862_100064969 | 3300005844 | Bacteria | 3142 |
| 149 | Ga0068862_100101762 | 3300005844 | Bacteria | 2514 |
| 150 | Ga0075365_10010955 | 3300006038 | Bacteria | 5311 |
| 151 | Ga0075365_10011610 | 3300006038 | Bacteria | 5189 |
| 152 | Ga0075363_100005295 | 3300006048 | Bacteria | 5725 |
| 153 | Ga0075363_100009657 | 3300006048 | Bacteria | 4544 |
| 154 | Ga0075364_10079311 | 3300006051 | Bacteria | 2169 |
| 155 | Ga0075362_10001230 | 3300006177 | Bacteria | 8064 |
| 156 | Ga0075362_10002845 | 3300006177 | Bacteria | 5909 |
| 157 | Ga0075362_10004591 | 3300006177 | Bacteria | 4976 |
| 158 | Ga0075362_10005426 | 3300006177 | Bacteria | 4663 |
| 159 | Ga0075362_10026936 | 3300006177 | Bacteria | 2458 |
| 160 | Ga0075367_10009945 | 3300006178 | Bacteria | 4984 |
| 161 | Ga0075367_10025245 | 3300006178 | Bacteria | 3359 |
| 162 | Ga0075369_10003566 | 3300006186 | Bacteria | 5669 |
| 163 | Ga0075369_10037162 | 3300006186 | Bacteria | 2074 |
| 164 | Ga0075369_10055871 | 3300006186 | Bacteria | 1716 |
| 165 | Ga0075366_10000488 | 3300006195 | Bacteria | 18352 |
| 166 | Ga0075366_10000512 | 3300006195 | Bacteria | 17914 |
| 167 | Ga0075366_10000833 | 3300006195 | Bacteria | 14815 |
| 168 | Ga0075366_10001615 | 3300006195 | Bacteria | 11295 |
| 169 | Ga0075366_10002670 | 3300006195 | Bacteria | 9196 |
| 170 | Ga0075366_10009487 | 3300006195 | Bacteria | 5432 |
| 171 | Ga0075366_10013295 | 3300006195 | Bacteria | 4682 |
| 172 | Ga0075366_10020444 | 3300006195 | Bacteria | 3842 |
| 173 | Ga0075366_10036444 | 3300006195 | Bacteria | 2900 |
| 174 | Ga0075366_10043068 | 3300006195 | Bacteria | 2674 |
| 175 | Ga0075366_10073830 | 3300006195 | Bacteria | 2033 |
| 176 | Ga0097621_100013906 | 3300006237 | Bacteria | 6011 |
| 177 | Ga0075370_10001163 | 3300006353 | Bacteria | 11056 |
| 178 | Ga0075370_10001599 | 3300006353 | Bacteria | 9986 |
| 179 | Ga0075370_10001843 | 3300006353 | Bacteria | 9495 |
| 180 | Ga0075370_10002011 | 3300006353 | Bacteria | 9216 |
| 181 | Ga0075370_10002147 | 3300006353 | Bacteria | 9019 |
| 182 | Ga0075370_10003491 | 3300006353 | Bacteria | 7490 |
| 183 | Ga0075370_10008222 | 3300006353 | Bacteria | 5356 |
| 184 | Ga0075370_10012954 | 3300006353 | Bacteria | 4421 |
| 185 | Ga0068871_100013329 | 3300006358 | Bacteria | 6100 |
| 186 | Ga0068871_100032334 | 3300006358 | Bacteria | 4132 |
| 187 | Ga0075430_100014313 | 3300006846 | Bacteria | 6760 |
| 188 | Ga0075429_100045567 | 3300006880 | Bacteria | 3815 |
| 189 | Ga0068865_100004212 | 3300006881 | Bacteria | 8668 |
| 190 | Ga0068865_100036159 | 3300006881 | Bacteria | 3327 |
| 191 | Ga0068865_100051203 | 3300006881 | Bacteria | 2857 |
| 192 | Ga0097620_100028217 | 3300006931 | Bacteria | 5626 |
| 193 | Ga0099823_1000065 | 3300006944 | Bacteria | 50323 |
| 194 | Ga0079104_1000711 | 3300006946 | Bacteria | 30224 |
| 195 | Ga0079104_1013480 | 3300006946 | Bacteria | 2515 |
| 196 | Ga0105240_10019194 | 3300009093 | Bacteria | 9138 |
| 197 | Ga0105240_10030649 | 3300009093 | Bacteria | 6987 |
| 198 | Ga0105240_10110593 | 3300009093 | Bacteria | 3325 |
| 199 | Ga0105240_10160491 | 3300009093 | Bacteria | 2671 |
| 200 | Ga0105240_10199500 | 3300009093 | Bacteria | 2346 |
| 201 | Ga0105245_10012950 | 3300009098 | Bacteria | 7271 |
| 202 | Ga0105245_10037642 | 3300009098 | Bacteria | 4301 |
| 203 | Ga0105243_10006470 | 3300009148 | Bacteria | 9059 |
| 204 | Ga0105243_10020659 | 3300009148 | Bacteria | 4993 |
| 205 | Ga0105243_10298387 | 3300009148 | Bacteria | 1459 |
| 206 | Ga0105242_10001200 | 3300009176 | Bacteria | 20452 |
| 207 | Ga0105242_10029895 | 3300009176 | Bacteria | 4348 |
| 208 | Ga0105248_10024656 | 3300009177 | Bacteria | 6688 |
| 209 | Ga0105248_10036212 | 3300009177 | Bacteria | 5519 |
| 210 | Ga0105248_10103720 | 3300009177 | Bacteria | 3206 |
| 211 | Ga0105248_10270413 | 3300009177 | Bacteria | 1914 |
| 212 | Ga0105237_10000646 | 3300009545 | Bacteria | 48623 |
| 213 | Ga0105237_10007873 | 3300009545 | Bacteria | 11614 |
| 214 | Ga0105237_10055655 | 3300009545 | Bacteria | 3962 |
| 215 | Ga0105238_10013724 | 3300009551 | Bacteria | 8186 |
| 216 | Ga0105249_10075709 | 3300009553 | Bacteria | 3117 |
| 217 | Ga0105239_10002203 | 3300010375 | Bacteria | 25060 |
| 218 | Ga0105239_10034573 | 3300010375 | Bacteria | 5550 |
| 219 | Ga0105246_10139525 | 3300011119 | Bacteria | 1821 |
| 220 | Ga0157319_1000005 | 3300012497 | Bacteria | 372810 |
| 221 | Ga0157373_10012300 | 3300013100 | Bacteria | 6292 |
| 222 | Ga0157373_10051815 | 3300013100 | Bacteria | 2922 |
| 223 | Ga0157371_10139560 | 3300013102 | Bacteria | 1726 |
| 224 | Ga0157369_10051064 | 3300013105 | Bacteria | 4476 |
| 225 | Ga0157374_10048229 | 3300013296 | Bacteria | 3952 |
| 226 | Ga0157374_10071539 | 3300013296 | Bacteria | 3270 |
| 227 | Ga0157378_10122419 | 3300013297 | Bacteria | 2400 |
| 228 | Ga0163162_10006139 | 3300013306 | Bacteria | 11629 |
| 229 | Ga0163162_10019585 | 3300013306 | Bacteria | 6642 |
| 230 | Ga0163162_10051927 | 3300013306 | Bacteria | 4115 |
| 231 | Ga0157372_10011552 | 3300013307 | Bacteria | 9393 |
| 232 | Ga0157375_10010413 | 3300013308 | Bacteria | 8188 |
| 233 | Ga0157375_10016070 | 3300013308 | Bacteria | 6714 |
| 234 | Ga0157375_10035829 | 3300013308 | Bacteria | 4741 |
| 235 | Ga0157375_10036344 | 3300013308 | Bacteria | 4711 |
| 236 | Ga0157375_10060447 | 3300013308 | Bacteria | 3758 |
| 237 | Ga0157375_10098903 | 3300013308 | Bacteria | 2995 |
| 238 | Ga0163163_10035773 | 3300014325 | Bacteria | 4820 |
| 239 | Ga0163163_10243940 | 3300014325 | Bacteria | 1847 |
| 240 | Ga0182008_10002992 | 3300014497 | Bacteria | 10403 |
| 241 | Ga0182008_10006547 | 3300014497 | Bacteria | 6504 |
| 242 | Ga0157377_10000044 | 3300014745 | Bacteria | 100420 |
| 243 | Ga0157379_10008058 | 3300014968 | Bacteria | 9148 |
| 244 | Ga0157379_10022724 | 3300014968 | Bacteria | 5557 |
| 245 | Ga0157379_10030665 | 3300014968 | Bacteria | 4788 |
| 246 | Ga0157379_10038113 | 3300014968 | Bacteria | 4289 |
| 247 | Ga0157376_10026761 | 3300014969 | Bacteria | 4562 |
| 248 | Ga0157376_10061714 | 3300014969 | Bacteria | 3152 |
| 249 | Ga0157376_10064408 | 3300014969 | Bacteria | 3092 |
| 250 | Ga0157376_10177582 | 3300014969 | Bacteria | 1944 |
| 251 | Ga0182007_10004423 | 3300015262 | Bacteria | 6368 |
| 252 | Ga0182005_1007578 | 3300015265 | Bacteria | 3247 |
| 253 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 254 | Ga0163161_10006497 | 3300017792 | Bacteria | 8093 |
| 255 | Ga0163161_10019147 | 3300017792 | Bacteria | 4800 |
| 256 | Ga0163161_10039817 | 3300017792 | Bacteria | 3375 |
| 257 | Ga0213872_10000007 | 3300021361 | Bacteria | 228206 |
| 258 | Ga0213872_10000067 | 3300021361 | Bacteria | 92410 |
| 259 | Ga0213872_10000131 | 3300021361 | Bacteria | 68632 |
| 260 | Ga0213872_10000233 | 3300021361 | Bacteria | 48866 |
| 261 | Ga0213872_10019666 | 3300021361 | Bacteria | 3110 |
| 262 | Ga0213872_10025078 | 3300021361 | Bacteria | 2742 |
| 263 | Ga0209674_100073 | 3300025226 | Bacteria | 223689 |
| 264 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 265 | Ga0209563_100061 | 3300025230 | Bacteria | 274295 |
| 266 | Ga0207427_101037 | 3300025231 | Bacteria | 11594 |
| 267 | Ga0209258_100072 | 3300025242 | Bacteria | 274355 |
| 268 | Ga0209258_103059 | 3300025242 | Bacteria | 3833 |
| 269 | Ga0209258_103479 | 3300025242 | Bacteria | 3373 |
| 270 | Ga0207425_1000426 | 3300025245 | Bacteria | 28024 |
| 271 | Ga0209646_1000076 | 3300025246 | Bacteria | 212891 |
| 272 | Ga0209026_1000011 | 3300025250 | Bacteria | 507291 |
| 273 | Ga0209677_100070 | 3300025253 | Bacteria | 143311 |
| 274 | Ga0209677_100751 | 3300025253 | Bacteria | 16421 |
| 275 | Ga0209677_105485 | 3300025253 | Bacteria | 3294 |
| 276 | Ga0209148_1002371 | 3300025254 | Bacteria | 6612 |
| 277 | Ga0209759_1000034 | 3300025256 | Bacteria | 271209 |
| 278 | Ga0209759_1001263 | 3300025256 | Bacteria | 15243 |
| 279 | Ga0209759_1001427 | 3300025256 | Bacteria | 13561 |
| 280 | Ga0209129_1000269 | 3300025258 | Bacteria | 51170 |
| 281 | Ga0209455_1000053 | 3300025272 | Bacteria | 365949 |
| 282 | Ga0209673_1003690 | 3300025273 | Bacteria | 8809 |
| 283 | Ga0209673_1011942 | 3300025273 | Bacteria | 3538 |
| 284 | Ga0209673_1029399 | 3300025273 | Bacteria | 1750 |
| 285 | Ga0209675_1000911 | 3300025291 | Bacteria | 18891 |
| 286 | Ga0209676_1011605 | 3300025292 | Bacteria | 3536 |
| 287 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 288 | Ga0209564_1000300 | 3300025295 | Bacteria | 98386 |
| 289 | Ga0209758_1000605 | 3300025297 | Bacteria | 55552 |
| 290 | Ga0209758_1027675 | 3300025297 | Bacteria | 2416 |
| 291 | Ga0209050_1000770 | 3300025298 | Bacteria | 46024 |
| 292 | Ga0209050_1004597 | 3300025298 | Bacteria | 9232 |
| 293 | Ga0209050_1008492 | 3300025298 | Bacteria | 5472 |
| 294 | Ga0209050_1010621 | 3300025298 | Bacteria | 4506 |
| 295 | Ga0209256_1000049 | 3300025299 | Bacteria | 310696 |
| 296 | Ga0209256_1003918 | 3300025299 | Bacteria | 9824 |
| 297 | Ga0209256_1004159 | 3300025299 | Bacteria | 9342 |
| 298 | Ga0209051_1000247 | 3300025303 | Bacteria | 91122 |
| 299 | Ga0209051_1003902 | 3300025303 | Bacteria | 9515 |
| 300 | Ga0209051_1004626 | 3300025303 | Bacteria | 8381 |
| 301 | Ga0209051_1007075 | 3300025303 | Bacteria | 6206 |
| 302 | Ga0209051_1008990 | 3300025303 | Bacteria | 5203 |
| 303 | Ga0209051_1015628 | 3300025303 | Bacteria | 3481 |
| 304 | Ga0209051_1026222 | 3300025303 | Bacteria | 2355 |
| 305 | Ga0209257_1000141 | 3300025304 | Bacteria | 201130 |
| 306 | Ga0209257_1001704 | 3300025304 | Bacteria | 24663 |
| 307 | Ga0209257_1004727 | 3300025304 | Bacteria | 10192 |
| 308 | Ga0209257_1006810 | 3300025304 | Bacteria | 7187 |
| 309 | Ga0209257_1024286 | 3300025304 | Bacteria | 2103 |
| 310 | Ga0207688_10022598 | 3300025901 | Bacteria | 3442 |
| 311 | Ga0207680_10028440 | 3300025903 | Bacteria | 3127 |
| 312 | Ga0207647_10073527 | 3300025904 | Bacteria | 2060 |
| 313 | Ga0207645_10004343 | 3300025907 | Bacteria | 10500 |
| 314 | Ga0207645_10027832 | 3300025907 | Bacteria | 3650 |
| 315 | Ga0207645_10028492 | 3300025907 | Bacteria | 3605 |
| 316 | Ga0207645_10054409 | 3300025907 | Bacteria | 2556 |
| 317 | Ga0207705_10027738 | 3300025909 | Bacteria | 4039 |
| 318 | Ga0207705_10050908 | 3300025909 | Bacteria | 2982 |
| 319 | Ga0207705_10136076 | 3300025909 | Bacteria | 1832 |
| 320 | Ga0207684_10101912 | 3300025910 | Bacteria | 2454 |
| 321 | Ga0207707_10120457 | 3300025912 | Bacteria | 2294 |
| 322 | Ga0207695_10028147 | 3300025913 | Bacteria | 6239 |
| 323 | Ga0207695_10034025 | 3300025913 | Bacteria | 5548 |
| 324 | Ga0207671_10007157 | 3300025914 | Bacteria | 9732 |
| 325 | Ga0207671_10026506 | 3300025914 | Bacteria | 4342 |
| 326 | Ga0207660_10001454 | 3300025917 | Bacteria | 15902 |
| 327 | Ga0207660_10117650 | 3300025917 | Bacteria | 2009 |
| 328 | Ga0207657_10018081 | 3300025919 | Bacteria | 6744 |
| 329 | Ga0207657_10023991 | 3300025919 | Bacteria | 5663 |
| 330 | Ga0207657_10029766 | 3300025919 | Bacteria | 4964 |
| 331 | Ga0207649_10000335 | 3300025920 | Bacteria | 35710 |
| 332 | Ga0207649_10027585 | 3300025920 | Bacteria | 3334 |
| 333 | Ga0207652_10051225 | 3300025921 | Bacteria | 3539 |
| 334 | Ga0207652_10110056 | 3300025921 | Bacteria | 2442 |
| 335 | Ga0207646_10069488 | 3300025922 | Bacteria | 3145 |
| 336 | Ga0207681_10001008 | 3300025923 | Bacteria | 18376 |
| 337 | Ga0207681_10002578 | 3300025923 | Bacteria | 11488 |
| 338 | Ga0207681_10042266 | 3300025923 | Bacteria | 3044 |
| 339 | Ga0207681_10071123 | 3300025923 | Bacteria | 2425 |
| 340 | Ga0207694_10016495 | 3300025924 | Bacteria | 5578 |
| 341 | Ga0207694_10034410 | 3300025924 | Bacteria | 3884 |
| 342 | Ga0207650_10001346 | 3300025925 | Bacteria | 17761 |
| 343 | Ga0207650_10003269 | 3300025925 | Bacteria | 11170 |
| 344 | Ga0207650_10077599 | 3300025925 | Bacteria | 2511 |
| 345 | Ga0207659_10000207 | 3300025926 | Bacteria | 35338 |
| 346 | Ga0207659_10019315 | 3300025926 | Bacteria | 4483 |
| 347 | Ga0207659_10040934 | 3300025926 | Bacteria | 3243 |
| 348 | Ga0207644_10003278 | 3300025931 | Bacteria | 10459 |
| 349 | Ga0207644_10005018 | 3300025931 | Bacteria | 8640 |
| 350 | Ga0207644_10017333 | 3300025931 | Bacteria | 4862 |
| 351 | Ga0207644_10020439 | 3300025931 | Bacteria | 4502 |
| 352 | Ga0207690_10000176 | 3300025932 | Bacteria | 49560 |
| 353 | Ga0207706_10061609 | 3300025933 | Bacteria | 3304 |
| 354 | Ga0207686_10004163 | 3300025934 | Bacteria | 7764 |
| 355 | Ga0207686_10014698 | 3300025934 | Bacteria | 4365 |
| 356 | Ga0207686_10103781 | 3300025934 | Bacteria | 1903 |
| 357 | Ga0207709_10007539 | 3300025935 | Bacteria | 6046 |
| 358 | Ga0207709_10012409 | 3300025935 | Bacteria | 4695 |
| 359 | Ga0207669_10002599 | 3300025937 | Bacteria | 7721 |
| 360 | Ga0207669_10005642 | 3300025937 | Bacteria | 5641 |
| 361 | Ga0207704_10037050 | 3300025938 | Bacteria | 2813 |
| 362 | Ga0207704_10040842 | 3300025938 | Bacteria | 2715 |
| 363 | Ga0207665_10069689 | 3300025939 | Bacteria | 2398 |
| 364 | Ga0207691_10002895 | 3300025940 | Bacteria | 16737 |
| 365 | Ga0207691_10003449 | 3300025940 | Bacteria | 15379 |
| 366 | Ga0207691_10008177 | 3300025940 | Bacteria | 10044 |
| 367 | Ga0207691_10009917 | 3300025940 | Bacteria | 9143 |
| 368 | Ga0207711_10019739 | 3300025941 | Bacteria | 5614 |
| 369 | Ga0207711_10033268 | 3300025941 | Bacteria | 4361 |
| 370 | Ga0207689_10003961 | 3300025942 | Bacteria | 13485 |
| 371 | Ga0207689_10070714 | 3300025942 | Bacteria | 2867 |
| 372 | Ga0207661_10012579 | 3300025944 | Bacteria | 6155 |
| 373 | Ga0207679_10001472 | 3300025945 | Bacteria | 14754 |
| 374 | Ga0207679_10050636 | 3300025945 | Bacteria | 3036 |
| 375 | Ga0207679_10158714 | 3300025945 | Bacteria | 1849 |
| 376 | Ga0207667_10027618 | 3300025949 | Bacteria | 6174 |
| 377 | Ga0207667_10051160 | 3300025949 | Bacteria | 4357 |
| 378 | Ga0207667_10058267 | 3300025949 | Bacteria | 4052 |
| 379 | Ga0207667_10131052 | 3300025949 | Bacteria | 2582 |
| 380 | Ga0207651_10008453 | 3300025960 | Bacteria | 5562 |
| 381 | Ga0207651_10009387 | 3300025960 | Bacteria | 5353 |
| 382 | Ga0207651_10040524 | 3300025960 | Bacteria | 3082 |
| 383 | Ga0207651_10041282 | 3300025960 | Bacteria | 3061 |
| 384 | Ga0207712_10013724 | 3300025961 | Bacteria | 5195 |
| 385 | Ga0207668_10013756 | 3300025972 | Bacteria | 4992 |
| 386 | Ga0207640_10012952 | 3300025981 | Bacteria | 4765 |
| 387 | Ga0207640_10024457 | 3300025981 | Bacteria | 3644 |
| 388 | Ga0207658_10012147 | 3300025986 | Bacteria | 5874 |
| 389 | Ga0207658_10028406 | 3300025986 | Bacteria | 3938 |
| 390 | Ga0207677_10055029 | 3300026023 | Bacteria | 2718 |
| 391 | Ga0207703_10004229 | 3300026035 | Bacteria | 11831 |
| 392 | Ga0207703_10011615 | 3300026035 | Bacteria | 6846 |
| 393 | Ga0207703_10065459 | 3300026035 | Bacteria | 2987 |
| 394 | Ga0207678_10007570 | 3300026067 | Bacteria | 9599 |
| 395 | Ga0207702_10001565 | 3300026078 | Bacteria | 22647 |
| 396 | Ga0207641_10006229 | 3300026088 | Bacteria | 10091 |
| 397 | Ga0207641_10011103 | 3300026088 | Bacteria | 7389 |
| 398 | Ga0207641_10032121 | 3300026088 | Bacteria | 4358 |
| 399 | Ga0207648_10001584 | 3300026089 | Bacteria | 24952 |
| 400 | Ga0207648_10010452 | 3300026089 | Bacteria | 8794 |
| 401 | Ga0207648_10010854 | 3300026089 | Bacteria | 8610 |
| 402 | Ga0207648_10011167 | 3300026089 | Bacteria | 8473 |
| 403 | Ga0207648_10061480 | 3300026089 | Bacteria | 3275 |
| 404 | Ga0207676_10095831 | 3300026095 | Bacteria | 2448 |
| 405 | Ga0207675_100042444 | 3300026118 | Bacteria | 4247 |
| 406 | Ga0207675_100058322 | 3300026118 | Bacteria | 3602 |
| 407 | Ga0207683_10012763 | 3300026121 | Bacteria | 7170 |
| 408 | Ga0207683_10038257 | 3300026121 | Bacteria | 4180 |
| 409 | Ga0207683_10098453 | 3300026121 | Bacteria | 2609 |
| 410 | Ga0207683_10154519 | 3300026121 | Bacteria | 2072 |
| 411 | Ga0207698_10073054 | 3300026142 | Bacteria | 2729 |
| 412 | Ga0207698_10142335 | 3300026142 | Bacteria | 2068 |
| 413 | Ga0209281_1000395 | 3300027111 | Bacteria | 67983 |
| 414 | Ga0209389_1010868 | 3300027296 | Bacteria | 8227 |
| 415 | Ga0209968_1000906 | 3300027526 | Bacteria | 4594 |
| 416 | Ga0209999_1007707 | 3300027543 | Bacteria | 1936 |
| 417 | Ga0209966_1000017 | 3300027695 | Bacteria | 71183 |
| 418 | Ga0209813_10012578 | 3300027866 | Bacteria | 2241 |
| 419 | Ga0209974_10000608 | 3300027876 | Bacteria | 12020 |
| 420 | Ga0209974_10017019 | 3300027876 | Bacteria | 2412 |
| 421 | Ga0268265_10158359 | 3300028380 | Bacteria | 1919 |
| 422 | Ga0268264_10010530 | 3300028381 | Bacteria | 7647 |
| 423 | Ga0268264_10034363 | 3300028381 | Bacteria | 4170 |
| 424 | Ga0265336_10000036 | 3300028666 | Bacteria | 154609 |
| 425 | Ga0307517_10072690 | 3300028786 | Bacteria | 3061 |
| 426 | Ga0307515_10000011 | 3300028794 | Bacteria | 633903 |
| 427 | Ga0307515_10000281 | 3300028794 | Bacteria | 125306 |
| 428 | Ga0307515_10000419 | 3300028794 | Bacteria | 102271 |
| 429 | Ga0307515_10031865 | 3300028794 | Bacteria | 8758 |
| 430 | Ga0307515_10073207 | 3300028794 | Bacteria | 4609 |
| 431 | Ga0265324_10000136 | 3300029957 | Bacteria | 57490 |
| 432 | Ga0307512_10040205 | 3300030522 | Bacteria | 3907 |
| 433 | Ga0316178_1131179 | 3300030735 | Bacteria | 1797 |
| 434 | Ga0265330_10000052 | 3300031235 | Bacteria | 102771 |
| 435 | Ga0265332_10000001 | 3300031238 | Bacteria | 863783 |
| 436 | Ga0265325_10010139 | 3300031241 | Bacteria | 5470 |
| 437 | Ga0265340_10059587 | 3300031247 | Bacteria | 1831 |
| 438 | Ga0265331_10003008 | 3300031250 | Bacteria | 11082 |
| 439 | Ga0265327_10000035 | 3300031251 | Bacteria | 314419 |
| 440 | Ga0265327_10016534 | 3300031251 | Bacteria | 4678 |
| 441 | Ga0307513_10025768 | 3300031456 | Bacteria | 6801 |
| 442 | Ga0307513_10034575 | 3300031456 | Bacteria | 5669 |
| 443 | Ga0307513_10075354 | 3300031456 | Bacteria | 3504 |
| 444 | Ga0307509_10020572 | 3300031507 | Bacteria | 7484 |
| 445 | Ga0307408_100032911 | 3300031548 | Bacteria | 3618 |
| 446 | Ga0307408_100056443 | 3300031548 | Bacteria | 2847 |
| 447 | Ga0307408_100064624 | 3300031548 | Bacteria | 2681 |
| 448 | Ga0307514_10000355 | 3300031649 | Bacteria | 106758 |
| 449 | Ga0307514_10006320 | 3300031649 | Bacteria | 10353 |
| 450 | Ga0265314_10000013 | 3300031711 | Bacteria | 403405 |
| 451 | Ga0307516_10000054 | 3300031730 | Bacteria | 126288 |
| 452 | Ga0307516_10001808 | 3300031730 | Bacteria | 29384 |
| 453 | Ga0307516_10001961 | 3300031730 | Bacteria | 28186 |
| 454 | Ga0307516_10005578 | 3300031730 | Bacteria | 14995 |
| 455 | Ga0307405_10034443 | 3300031731 | Bacteria | 3013 |
| 456 | Ga0307405_10061018 | 3300031731 | Bacteria | 2381 |
| 457 | Ga0307405_10100625 | 3300031731 | Bacteria | 1937 |
| 458 | Ga0307406_10007227 | 3300031901 | Bacteria | 6152 |
| 459 | Ga0307406_10056239 | 3300031901 | Bacteria | 2518 |
| 460 | Ga0307407_10016230 | 3300031903 | Bacteria | 3703 |
| 461 | Ga0307412_10015031 | 3300031911 | Bacteria | 4578 |
| 462 | Ga0307412_10026896 | 3300031911 | Bacteria | 3582 |
| 463 | Ga0307412_10138233 | 3300031911 | Bacteria | 1780 |
| 464 | Ga0307409_100004999 | 3300031995 | Bacteria | 7550 |
| 465 | Ga0307416_100077835 | 3300032002 | Bacteria | 2787 |
| 466 | Ga0307414_10038560 | 3300032004 | Bacteria | 3210 |
| 467 | Ga0307411_10003141 | 3300032005 | Bacteria | 7576 |
| 468 | Ga0307411_10090769 | 3300032005 | Bacteria | 2132 |
| 469 | Ga0307415_100047717 | 3300032126 | Bacteria | 2884 |
| 470 | Ga0373931_0002648 | 3300035691 | Bacteria | 7967 |
| 471 | Ga0373937_0016810 | 3300036401 | Bacteria | 6504 |
| 472 | Ga0373937_0090530 | 3300036401 | Bacteria | 2833 |
| 473 | Ga0373925_0048624 | 3300037068 | Bacteria | 3161 |
| 474 | Ga0395900_0001686 | 3300037418 | Bacteria | 25712 |
| 475 | Ga0395900_0032417 | 3300037418 | Bacteria | 5373 |
| 476 | Ga0395898_0002642 | 3300037466 | Bacteria | 20848 |
| 477 | Ga0395898_0005142 | 3300037466 | Bacteria | 14155 |
| 478 | Ga0395905_0014064 | 3300037471 | Bacteria | 7651 |
| 479 | Ga0395905_0109466 | 3300037471 | Bacteria | 2594 |
| 480 | Ga0395905_0147587 | 3300037471 | Bacteria | 2213 |
| 481 | Ga0395901_0040745 | 3300038443 | Bacteria | 4810 |
| 482 | Ga0395901_0072660 | 3300038443 | Bacteria | 3586 |
| 483 | Ga0436361_0028732 | 3300039447 | Bacteria | 3225 |
| 484 | Ga0436361_0099386 | 3300039447 | Bacteria | 7920 |
| 485 | Ga0436361_0479314 | 3300039447 | Bacteria | 9473 |
| 486 | Ga0436361_0504982 | 3300039447 | Bacteria | 102576 |
| 487 | Ga0436361_0816515 | 3300039447 | Bacteria | 4479 |
| 488 | Ga0436361_1043865 | 3300039447 | Bacteria | 11886 |
| 489 | Ga0436361_1149866 | 3300039447 | Bacteria | 37566 |
| 490 | Ga0439436_0009572 | 3300041404 | Bacteria | 2971 |
| 491 | Ga0439436_0016190 | 3300041404 | Bacteria | 2239 |
| 492 | Ga0439439_0002335 | 3300041406 | Bacteria | 4011 |
| 493 | Ga0439466_0006336 | 3300041411 | Bacteria | 4503 |
| 494 | Ga0439466_0013342 | 3300041411 | Bacteria | 3009 |
| 495 | Ga0439466_0019082 | 3300041411 | Bacteria | 2456 |
| 496 | Ga0439465_0006744 | 3300041413 | Bacteria | 3646 |
| 497 | Ga0439431_0001021 | 3300041997 | Bacteria | 6074 |
| 498 | Ga0439433_0007805 | 3300041999 | Bacteria | 2312 |
| 499 | Ga0439442_003465 | 3300042002 | Bacteria | 3120 |
| 500 | Ga0439442_004829 | 3300042002 | Bacteria | 2682 |
| 501 | Ga0439442_008074 | 3300042002 | Bacteria | 2126 |
| 502 | Ga0439445_0000222 | 3300042004 | Bacteria | 10552 |
| 503 | Ga0439445_0012752 | 3300042004 | Bacteria | 2024 |
| 504 | Ga0439432_005922 | 3300042006 | Bacteria | 4389 |
| 505 | Ga0439432_021684 | 3300042006 | Bacteria | 2127 |
| 506 | Ga0439449_0005925 | 3300042007 | Bacteria | 4667 |
| 507 | Ga0439449_0011708 | 3300042007 | Bacteria | 3297 |
| 508 | Ga0439449_0012922 | 3300042007 | Bacteria | 3139 |
| 509 | Ga0439452_012584 | 3300042010 | Bacteria | 2400 |
| 510 | Ga0439457_009566 | 3300042014 | Bacteria | 2252 |
| 511 | Ga0439457_009633 | 3300042014 | Bacteria | 2244 |
| 512 | Ga0439462_0004249 | 3300042015 | Bacteria | 3485 |
| 513 | Ga0439462_0006720 | 3300042015 | Bacteria | 2869 |
| 514 | Ga0450911_004418 | 3300042115 | Bacteria | 2306 |
| 515 | Ga0450919_000965 | 3300042121 | Bacteria | 3723 |
| 516 | Ga0450921_000014 | 3300042123 | Bacteria | 4316 |
| 517 | Ga0450923_001529 | 3300042125 | Bacteria | 3100 |
| 518 | Ga0450890_002246 | 3300042127 | Bacteria | 2684 |
| 519 | Ga0450894_002457 | 3300042131 | Bacteria | 2489 |
| 520 | Ga0450906_004008 | 3300042145 | Bacteria | 3115 |
| 521 | Ga0439446_0017256 | 3300042156 | Bacteria | 2015 |
| 522 | Ga0439446_0018498 | 3300042156 | Bacteria | 1952 |
| 523 | Ga0450908_000591 | 3300042184 | Bacteria | 6952 |
| 524 | Ga0450908_009850 | 3300042184 | Bacteria | 1768 |
| 525 | Ga0450909_003138 | 3300042185 | Bacteria | 2351 |
| 526 | Ga0439434_0011742 | 3300042435 | Bacteria | 2591 |
| 527 | Ga0439434_0015589 | 3300042435 | Bacteria | 2266 |
| 528 | Ga0439460_0009792 | 3300042461 | Bacteria | 2441 |
| 529 | Ga0450918_000077 | 3300042531 | Bacteria | 20527 |
| 530 | Ga0450918_003796 | 3300042531 | Bacteria | 2784 |
| 531 | Ga0451577_0003515 | 3300042876 | Bacteria | 17370 |
| 532 | Ga0451577_0009895 | 3300042876 | Bacteria | 9139 |
| 533 | Ga0451577_0014500 | 3300042876 | Bacteria | 7347 |
| 534 | Ga0451577_0024419 | 3300042876 | Bacteria | 5499 |
| 535 | Ga0451577_0089473 | 3300042876 | Bacteria | 2747 |
| 536 | Ga0451577_0125297 | 3300042876 | Bacteria | 2302 |
| 537 | Ga0451577_0153188 | 3300042876 | Bacteria | 2074 |
| 538 | Ga0466969_0000046 | 3300044656 | Bacteria | 63999 |
| 539 | Ga0466969_0067627 | 3300044656 | Bacteria | 1723 |
| 540 | Ga0453683_0035550 | 3300044673 | Bacteria | 3139 |
| 541 | Ga0453683_0089176 | 3300044673 | Bacteria | 1933 |
| 542 | Ga0466965_0008433 | 3300044683 | Bacteria | 4769 |
| 543 | Ga0466965_0035916 | 3300044683 | Bacteria | 2429 |
| 544 | Ga0466966_0003197 | 3300044684 | Bacteria | 10785 |
| 545 | Ga0466966_0011921 | 3300044684 | Bacteria | 5761 |
| 546 | Ga0466966_0016292 | 3300044684 | Bacteria | 4915 |
| 547 | Ga0466961_0007180 | 3300044693 | Bacteria | 7087 |
| 548 | Ga0466961_0147994 | 3300044693 | Bacteria | 1467 |
| 549 | Ga0466963_0062885 | 3300044694 | Bacteria | 2483 |
| 550 | Ga0466963_0086305 | 3300044694 | Bacteria | 2132 |
| 551 | Ga0466964_0006544 | 3300044706 | Bacteria | 4344 |
| 552 | Ga0453684_0000065 | 3300044712 | Bacteria | 468481 |
| 553 | Ga0453684_0001131 | 3300044712 | Bacteria | 83523 |
| 554 | Ga0453684_0010067 | 3300044712 | Bacteria | 16251 |
| 555 | Ga0453684_0032339 | 3300044712 | Bacteria | 7325 |
| 556 | Ga0453684_0082882 | 3300044712 | Bacteria | 3994 |
| 557 | Ga0453684_0198002 | 3300044712 | Bacteria | 2344 |
| 558 | Ga0466971_0043912 | 3300044719 | Bacteria | 2007 |
| 559 | Ga0466957_0112722 | 3300044842 | Bacteria | 1726 |
| 560 | Ga0466960_0042774 | 3300044901 | Bacteria | 2152 |
| 561 | Ga0466959_0000174 | 3300045049 | Bacteria | 42543 |
| 562 | Ga0466959_0026183 | 3300045049 | Bacteria | 4323 |
| 563 | Ga0451576_0000526 | 3300045051 | Bacteria | 83427 |
| 564 | Ga0451576_0003229 | 3300045051 | Bacteria | 22685 |
| 565 | Ga0451576_0024150 | 3300045051 | Bacteria | 6569 |
| 566 | Ga0451576_0049640 | 3300045051 | Bacteria | 4404 |
| 567 | Ga0466958_0066533 | 3300045836 | Bacteria | 2200 |
| 568 | Ga0495590_0033892 | 3300046457 | Bacteria | 1784 |
| 569 | Ga0495629_0070447 | 3300046459 | Bacteria | 2440 |
| 570 | Ga0495650_0017128 | 3300046471 | Bacteria | 3643 |
| 571 | Ga0495580_0111528 | 3300046472 | Bacteria | 1899 |
| 572 | Ga0495639_0004264 | 3300046475 | Bacteria | 6134 |
| 573 | Ga0495585_0043320 | 3300046492 | Bacteria | 2518 |
| 574 | Ga0495583_0000129 | 3300046506 | Bacteria | 126766 |
| 575 | Ga0495606_0053792 | 3300046507 | Bacteria | 2610 |
| 576 | Ga0495610_0007076 | 3300046512 | Bacteria | 7573 |
| 577 | Ga0495630_0052261 | 3300046517 | Bacteria | 3059 |
| 578 | Ga0495632_0004609 | 3300046519 | Bacteria | 9335 |
| 579 | Ga0495643_0027317 | 3300046522 | Bacteria | 3210 |
| 580 | Ga0495643_0030737 | 3300046522 | Bacteria | 2996 |
| 581 | Ga0495642_0020287 | 3300046528 | Bacteria | 2610 |
| 582 | Ga0495598_0005445 | 3300046537 | Bacteria | 2822 |
| 583 | Ga0495645_0050111 | 3300046543 | Bacteria | 3040 |
| 584 | Ga0495622_0020307 | 3300046557 | Bacteria | 3093 |
| 585 | Ga0495633_0007721 | 3300046558 | Bacteria | 6152 |
| 586 | Ga0495656_0002495 | 3300046615 | Bacteria | 6121 |
| 587 | Ga0495625_0009857 | 3300046660 | Bacteria | 7947 |
| 588 | Ga0495625_0012566 | 3300046660 | Bacteria | 6854 |
| 589 | Ga0495625_0044634 | 3300046660 | Bacteria | 3208 |
| 590 | Ga0495588_0060622 | 3300046674 | Bacteria | 1958 |
| 591 | Ga0495624_0037876 | 3300046690 | Bacteria | 3101 |
| 592 | Ga0495649_0000524 | 3300046694 | Bacteria | 32600 |
| 593 | Ga0495589_0005373 | 3300046794 | Bacteria | 6760 |
| 594 | Ga0495660_0016578 | 3300046810 | Bacteria | 4248 |
| 595 | Ga0495674_0197156 | 3300047319 | Bacteria | 1672 |
| 596 | Ga0495687_000174 | 3300047443 | Bacteria | 95031 |
| 597 | Ga0495684_0038701 | 3300047471 | Bacteria | 3656 |
| 598 | Ga0495686_0080121 | 3300047472 | Bacteria | 1996 |
| 599 | Ga0495593_0045358 | 3300047673 | Bacteria | 2346 |
| 600 | Ga0496101_0029043 | 3300048904 | Bacteria | 3866 |
| 601 | Ga0496102_0009157 | 3300048905 | Bacteria | 8492 |
| 602 | Ga0496102_0009561 | 3300048905 | Bacteria | 8339 |
| 603 | Ga0496102_0011400 | 3300048905 | Bacteria | 7661 |
| 604 | Ga0496103_0033383 | 3300048906 | Bacteria | 3143 |
| 605 | Ga0496104_0106928 | 3300048907 | Bacteria | 2681 |
| 606 | Ga0496104_0113229 | 3300048907 | Bacteria | 2602 |
| 607 | Ga0496105_0032115 | 3300048908 | Bacteria | 4306 |
| 608 | Ga0496105_0039421 | 3300048908 | Bacteria | 3894 |
| 609 | Ga0496107_0109186 | 3300048910 | Bacteria | 2032 |
| 610 | Ga0496108_0118815 | 3300048911 | Bacteria | 2266 |
| 611 | Ga0496109_0047302 | 3300048912 | Bacteria | 3911 |
| 612 | Ga0496109_0077567 | 3300048912 | Bacteria | 3058 |
| 613 | Ga0496109_0155807 | 3300048912 | Bacteria | 2140 |
| 614 | Ga0496109_0193157 | 3300048912 | Bacteria | 1913 |
| 615 | Ga0496109_0232931 | 3300048912 | Bacteria | 1733 |
| 616 | Ga0496110_0019147 | 3300048913 | Bacteria | 5755 |
| 617 | Ga0496110_0153617 | 3300048913 | Bacteria | 2084 |
| 618 | Ga0496111_0150933 | 3300048914 | Bacteria | 1723 |
| 619 | Ga0496113_0089270 | 3300048916 | Bacteria | 2372 |
| 620 | Ga0496114_0006241 | 3300048917 | Bacteria | 9381 |
| 621 | Ga0496121_0023358 | 3300048924 | Bacteria | 5958 |
| 622 | Ga0496122_0004537 | 3300048925 | Bacteria | 17119 |
| 623 | Ga0496123_0000160 | 3300048926 | Bacteria | 135310 |
| 624 | Ga0496124_0000108 | 3300048927 | Bacteria | 167473 |
| 625 | Ga0496124_0031147 | 3300048927 | Bacteria | 4725 |
| 626 | Ga0496124_0075218 | 3300048927 | Bacteria | 2790 |
| 627 | Ga0496125_0004332 | 3300048928 | Bacteria | 16465 |
| 628 | Ga0496125_0019117 | 3300048928 | Bacteria | 6476 |
| 629 | Ga0496125_0074777 | 3300048928 | Bacteria | 2625 |
| 630 | Ga0496125_0075095 | 3300048928 | Bacteria | 2617 |
| 631 | Ga0496126_0146301 | 3300048929 | Bacteria | 2029 |
| 632 | Ga0496126_0172256 | 3300048929 | Bacteria | 1843 |
| 633 | Ga0501308_000901 | 3300049128 | Bacteria | 2177 |
| 634 | Ga0501304_000399 | 3300049160 | Bacteria | 2177 |
| 635 | Ga0501032_0037757 | 3300049569 | Bacteria | 3292 |
| 636 | Ga0501034_0124759 | 3300049571 | Bacteria | 2560 |
| 637 | Ga0501043_0000002 | 3300049579 | Bacteria | 351081 |
| 638 | Ga0501043_0030215 | 3300049579 | Bacteria | 4257 |
| 639 | Ga0501046_0000008 | 3300049580 | Bacteria | 351167 |
| 640 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 641 | Ga0501048_0004029 | 3300049582 | Bacteria | 11173 |
| 642 | Ga0501198_000007 | 3300049649 | Bacteria | 129700 |
| 643 | Ga0501222_000005 | 3300049662 | Bacteria | 129724 |
| 644 | Ga0501257_015855 | 3300049686 | Bacteria | 1743 |
| 645 | Ga0501265_002543 | 3300049762 | Bacteria | 2069 |
| 646 | Ga0501035_0083199 | 3300049822 | Bacteria | 2824 |
| 647 | Ga0501035_0111195 | 3300049822 | Bacteria | 2401 |
| 648 | Ga0501044_0308243 | 3300049823 | Bacteria | 1510 |
| 649 | nmdc:mga03683_13349_c1 | 3300050489 | Bacteria | 3021 |
| 650 | nmdc:mga03683_15504_c1 | 3300050489 | Bacteria | 2845 |
| 651 | nmdc:mga03683_6266_c1 | 3300050489 | Bacteria | 4063 |
| 652 | nmdc:mga03683_7162_c1 | 3300050489 | Bacteria | 3858 |
| 653 | nmdc:mga03n38_16652_c1 | 3300050490 | Bacteria | 2864 |
| 654 | nmdc:mga03n38_26117_c1 | 3300050490 | Bacteria | 2408 |
| 655 | nmdc:mga00v17_87387_c1 | 3300050491 | Bacteria | 1954 |
| 656 | nmdc:mga0yw44_64343_c1 | 3300050492 | Bacteria | 2257 |
| 657 | nmdc:mga0yw44_8074_c1 | 3300050492 | Bacteria | 5223 |
| 658 | nmdc:mga0k408_1174_c1 | 3300050493 | Bacteria | 14328 |
| 659 | nmdc:mga0k408_12497_c1 | 3300050493 | Bacteria | 4642 |
| 660 | nmdc:mga0k408_35206_c1 | 3300050493 | Bacteria | 2871 |
| 661 | nmdc:mga0k408_3759_c1 | 3300050493 | Bacteria | 8049 |
| 662 | nmdc:mga0k408_396_c1 | 3300050493 | Bacteria | 23854 |
| 663 | nmdc:mga0k408_47579_c1 | 3300050493 | Bacteria | 2479 |
| 664 | nmdc:mga0k408_57467_c1 | 3300050493 | Bacteria | 2258 |
| 665 | nmdc:mga0k408_729_c1 | 3300050493 | Bacteria | 18040 |
| 666 | nmdc:mga0k408_7424_c1 | 3300050493 | Bacteria | 5853 |
| 667 | nmdc:mga0k408_892_c1 | 3300050493 | Bacteria | 16353 |
| 668 | nmdc:mga06z11_16470_c1 | 3300050494 | Bacteria | 3331 |
| 669 | nmdc:mga06z11_63094_c1 | 3300050494 | Bacteria | 1938 |
| 670 | nmdc:mga07m45_10995_c1 | 3300050496 | Bacteria | 4745 |
| 671 | nmdc:mga07m45_11599_c1 | 3300050496 | Bacteria | 4634 |
| 672 | nmdc:mga07m45_23016_c1 | 3300050496 | Bacteria | 3404 |
| 673 | nmdc:mga07m45_27970_c1 | 3300050496 | Bacteria | 3111 |
| 674 | nmdc:mga07m45_3610_c1 | 3300050496 | Bacteria | 7474 |
| 675 | nmdc:mga07m45_4843_c1 | 3300050496 | Bacteria | 6621 |
| 676 | nmdc:mga07m45_5171_c1 | 3300050496 | Bacteria | 6468 |
| 677 | nmdc:mga07m45_55744_c1 | 3300050496 | Bacteria | 2234 |
| 678 | nmdc:mga07m45_55905_c1 | 3300050496 | Bacteria | 2016 |
| 679 | nmdc:mga07m45_6993_c1 | 3300050496 | Bacteria | 5740 |
| 680 | nmdc:mga07m45_74089_c1 | 3300050496 | Bacteria | 1939 |
| 681 | nmdc:mga07m45_7711_c1 | 3300050496 | Bacteria | 5510 |
| 682 | nmdc:mga09592_2264_c1 | 3300050508 | Bacteria | 15188 |
| 683 | nmdc:mga0qj67_10871_c1 | 3300050509 | Bacteria | 6808 |
| 684 | nmdc:mga0sz30_14235_c1 | 3300050516 | Bacteria | 3127 |
| 685 | Ga0495601_0023250 | 3300053077 | Bacteria | 3808 |
| 686 | Ga0500635_0000030 | 3300053080 | Bacteria | 99936 |
| 687 | Ga0495619_0022578 | 3300053085 | Bacteria | 4029 |
| 688 | Ga0500578_0000025 | 3300053086 | Bacteria | 151485 |
| 689 | Ga0500562_015236 | 3300053108 | Bacteria | 1972 |
| 690 | Ga0500593_003896 | 3300053117 | Bacteria | 5722 |
| 691 | Ga0500595_018156 | 3300053119 | Bacteria | 2578 |
| 692 | Ga0500642_0032519 | 3300053130 | Bacteria | 2189 |
| 693 | Ga0500658_0001460 | 3300053134 | Bacteria | 9460 |
| 694 | Ga0500559_0005517 | 3300053136 | Bacteria | 5816 |
| 695 | Ga0500559_0012959 | 3300053136 | Bacteria | 3537 |
| 696 | Ga0500564_025252 | 3300053138 | Bacteria | 2729 |
| 697 | Ga0500568_0011402 | 3300053139 | Bacteria | 4129 |
| 698 | Ga0500568_0021802 | 3300053139 | Bacteria | 2752 |
| 699 | Ga0500590_035532 | 3300053148 | Bacteria | 2579 |
| 700 | Ga0500619_000014 | 3300053154 | Bacteria | 55951 |
| 701 | Ga0500622_0000890 | 3300053156 | Bacteria | 25460 |
| 702 | Ga0500622_0001306 | 3300053156 | Bacteria | 20253 |
| 703 | Ga0500622_0010205 | 3300053156 | Bacteria | 5163 |
| 704 | Ga0500636_0022800 | 3300053177 | Bacteria | 3700 |
| 705 | Ga0500661_003126 | 3300055283 | Bacteria | 3110 |
| 706 | Ga0466962_0002224 | 3300061719 | Bacteria | 9174 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003316 | rootH1_10012758 | rootH1_100127583 | 366 |
| 2 | 3300047673 | Ga0495593_0045358 | Ga0495593_0045358_1023_2315 | 382 |
| 3 | 3300006195 | Ga0075366_10001615 | Ga0075366_100016156 | 384 |
| 4 | 3300044712 | Ga0453684_0001131 | Ga0453684_0001131_80680_81936 | 389 |
| 5 | 3300042876 | Ga0451577_0089473 | Ga0451577_0089473_1390_2649 | 390 |
| 6 | 3300044673 | Ga0453683_0089176 | Ga0453683_0089176_199_1458 | 390 |
| 7 | 3300044712 | Ga0453684_0010067 | Ga0453684_0010067_1565_2824 | 390 |
| 8 | 3300045051 | Ga0451576_0000526 | Ga0451576_0000526_80604_81863 | 390 |
| 9 | iso_pu_bacteria | 2842733646 | 2842733898 | 394 |
| 10 | 3300050496 | nmdc:mga07m45_55905_c1 | nmdc:mga07m45_55905_c1_241_1530 | 396 |
| 11 | 3300005331 | Ga0070670_100005551 | Ga0070670_1000055519 | 397 |
| 12 | 3300005364 | Ga0070673_100040286 | Ga0070673_1000402862 | 397 |
| 13 | 3300042876 | Ga0451577_0153188 | Ga0451577_0153188_75_1445 | 397 |
| 14 | 3300005354 | Ga0070675_100002723 | Ga0070675_1000027235 | 400 |
| 15 | 3300005456 | Ga0070678_100013404 | Ga0070678_1000134042 | 400 |
| 16 | 3300005543 | Ga0070672_100027809 | Ga0070672_1000278091 | 400 |
| 17 | 3300005834 | Ga0068851_10095902 | Ga0068851_100959021 | 400 |
| 18 | 3300006358 | Ga0068871_100032334 | Ga0068871_1000323342 | 400 |
| 19 | 3300013308 | Ga0157375_10036344 | Ga0157375_100363442 | 400 |
| 20 | 3300014969 | Ga0157376_10026761 | Ga0157376_100267612 | 400 |
| 21 | 3300025926 | Ga0207659_10019315 | Ga0207659_100193153 | 400 |
| 22 | 3300025940 | Ga0207691_10008177 | Ga0207691_100081778 | 400 |
| 23 | 3300025960 | Ga0207651_10041282 | Ga0207651_100412822 | 400 |
| 24 | 3300026121 | Ga0207683_10038257 | Ga0207683_100382575 | 400 |
| 25 | 3300025921 | Ga0207652_10110056 | Ga0207652_101100562 | 402 |
| 26 | 3300025949 | Ga0207667_10058267 | Ga0207667_100582672 | 402 |
| 27 | 3300044842 | Ga0466957_0112722 | Ga0466957_0112722_75_1427 | 404 |
| 28 | 3300048924 | Ga0496121_0023358 | Ga0496121_0023358_818_2161 | 406 |
| 29 | 3300048928 | Ga0496125_0019117 | Ga0496125_0019117_436_1779 | 406 |
| 30 | 3300053139 | Ga0500568_0021802 | Ga0500568_0021802_519_1877 | 406 |
| 31 | 3300005344 | Ga0070661_100000361 | Ga0070661_10000036130 | 407 |
| 32 | 3300005366 | Ga0070659_100001606 | Ga0070659_1000016067 | 407 |
| 33 | 3300005564 | Ga0070664_100001095 | Ga0070664_1000010955 | 407 |
| 34 | 3300005617 | Ga0068859_100028219 | Ga0068859_1000282192 | 407 |
| 35 | 3300005618 | Ga0068864_100002220 | Ga0068864_1000022205 | 407 |
| 36 | 3300005841 | Ga0068863_100003043 | Ga0068863_10000304312 | 407 |
| 37 | 3300005844 | Ga0068862_100064969 | Ga0068862_1000649693 | 407 |
| 38 | 3300006881 | Ga0068865_100036159 | Ga0068865_1000361592 | 407 |
| 39 | 3300006931 | Ga0097620_100028217 | Ga0097620_1000282172 | 407 |
| 40 | 3300025907 | Ga0207645_10027832 | Ga0207645_100278324 | 407 |
| 41 | 3300025920 | Ga0207649_10000335 | Ga0207649_100003353 | 407 |
| 42 | 3300025923 | Ga0207681_10071123 | Ga0207681_100711232 | 407 |
| 43 | 3300025931 | Ga0207644_10003278 | Ga0207644_1000327810 | 407 |
| 44 | 3300025932 | Ga0207690_10000176 | Ga0207690_1000017612 | 407 |
| 45 | 3300025945 | Ga0207679_10001472 | Ga0207679_100014724 | 407 |
| 46 | 3300026088 | Ga0207641_10006229 | Ga0207641_100062292 | 407 |
| 47 | 3300046519 | Ga0495632_0004609 | Ga0495632_0004609_7703_9061 | 407 |
| 48 | 3300046660 | Ga0495625_0012566 | Ga0495625_0012566_136_1494 | 407 |
| 49 | 3300037471 | Ga0395905_0147587 | Ga0395905_0147587_14_1288 | 408 |
| 50 | 3300042876 | Ga0451577_0003515 | Ga0451577_0003515_13419_14738 | 409 |
| 51 | 3300044712 | Ga0453684_0000065 | Ga0453684_0000065_465670_466989 | 409 |
| 52 | iso_pu_bacteria | 2839138175 | 2839144792 | 410 |
| 53 | 3300005347 | Ga0070668_100112479 | Ga0070668_1001124791 | 411 |
| 54 | 3300025273 | Ga0209673_1029399 | Ga0209673_10293992 | 411 |
| 55 | 3300025297 | Ga0209758_1027675 | Ga0209758_10276752 | 411 |
| 56 | 3300046506 | Ga0495583_0000129 | Ga0495583_0000129_14539_15990 | 411 |
| 57 | 3300046794 | Ga0495589_0005373 | Ga0495589_0005373_588_2039 | 411 |
| 58 | 3300003322 | rootL2_10087698 | rootL2_100876984 | 412 |
| 59 | 3300003791 | Ga0055530_10003306 | Ga0055530_100033062 | 412 |
| 60 | 3300003792 | Ga0055540_1000260 | Ga0055540_100026047 | 412 |
| 61 | 3300003794 | Ga0055531_10009185 | Ga0055531_100091853 | 412 |
| 62 | 3300005455 | Ga0070663_100098121 | Ga0070663_1000981212 | 412 |
| 63 | 3300006178 | Ga0075367_10009945 | Ga0075367_100099455 | 412 |
| 64 | 3300025922 | Ga0207646_10069488 | Ga0207646_100694883 | 412 |
| 65 | iso_pu_bacteria | 2919462493 | 2919463614 | 412 |
| 66 | iso_pu_bacteria | 2929520902 | 2929525735 | 412 |
| 67 | 3300027876 | Ga0209974_10000608 | Ga0209974_100006083 | 413 |
| 68 | 3300044673 | Ga0453683_0035550 | Ga0453683_0035550_316_1650 | 413 |
| 69 | 3300028786 | Ga0307517_10072690 | Ga0307517_100726902 | 414 |
| 70 | 3300031730 | Ga0307516_10001808 | Ga0307516_100018083 | 414 |
| 71 | 3300046457 | Ga0495590_0033892 | Ga0495590_0033892_113_1408 | 414 |
| 72 | 3300046660 | Ga0495625_0044634 | Ga0495625_0044634_1174_2625 | 414 |
| 73 | 3300047443 | Ga0495687_000174 | Ga0495687_000174_67880_69259 | 414 |
| 74 | 3300053134 | Ga0500658_0001460 | Ga0500658_0001460_1354_2733 | 414 |
| 75 | 3300005543 | Ga0070672_100006490 | Ga0070672_1000064906 | 415 |
| 76 | 3300025903 | Ga0207680_10028440 | Ga0207680_100284401 | 415 |
| 77 | 3300025940 | Ga0207691_10003449 | Ga0207691_100034495 | 415 |
| 78 | 3300025986 | Ga0207658_10012147 | Ga0207658_100121472 | 415 |
| 79 | 3300026035 | Ga0207703_10004229 | Ga0207703_100042299 | 415 |
| 80 | 3300028381 | Ga0268264_10034363 | Ga0268264_100343633 | 415 |
| 81 | 3300046507 | Ga0495606_0053792 | Ga0495606_0053792_312_1763 | 415 |
| 82 | 3300046517 | Ga0495630_0052261 | Ga0495630_0052261_617_2008 | 415 |
| 83 | 3300046557 | Ga0495622_0020307 | Ga0495622_0020307_158_1549 | 415 |
| 84 | 3300046690 | Ga0495624_0037876 | Ga0495624_0037876_520_1911 | 415 |
| 85 | 3300046694 | Ga0495649_0000524 | Ga0495649_0000524_18428_19879 | 415 |
| 86 | 3300005459 | Ga0068867_100000120 | Ga0068867_10000012040 | 417 |
| 87 | 3300006195 | Ga0075366_10000488 | Ga0075366_100004886 | 417 |
| 88 | 3300006353 | Ga0075370_10001163 | Ga0075370_100011634 | 417 |
| 89 | 3300026089 | Ga0207648_10001584 | Ga0207648_1000158416 | 417 |
| 90 | 3300045051 | Ga0451576_0049640 | Ga0451576_0049640_2215_3513 | 417 |
| 91 | 3300046810 | Ga0495660_0016578 | Ga0495660_0016578_641_2122 | 417 |
| 92 | 3300050493 | nmdc:mga0k408_1174_c1 | nmdc:mga0k408_1174_c1_3404_4792 | 417 |
| 93 | 3300050493 | nmdc:mga0k408_729_c1 | nmdc:mga0k408_729_c1_9326_10759 | 417 |
| 94 | 3300050496 | nmdc:mga07m45_27970_c1 | nmdc:mga07m45_27970_c1_1300_2733 | 417 |
| 95 | 3300005331 | Ga0070670_100118273 | Ga0070670_1001182732 | 419 |
| 96 | 3300005354 | Ga0070675_100189509 | Ga0070675_1001895092 | 419 |
| 97 | 3300025904 | Ga0207647_10073527 | Ga0207647_100735272 | 419 |
| 98 | 3300025925 | Ga0207650_10077599 | Ga0207650_100775992 | 419 |
| 99 | 3300037418 | Ga0395900_0032417 | Ga0395900_0032417_2298_3650 | 419 |
| 100 | 3300037466 | Ga0395898_0005142 | Ga0395898_0005142_8746_10098 | 419 |
| 101 | 3300038443 | Ga0395901_0040745 | Ga0395901_0040745_2522_3874 | 419 |
| 102 | 3300005331 | Ga0070670_100006917 | Ga0070670_1000069178 | 420 |
| 103 | 3300005364 | Ga0070673_100055040 | Ga0070673_1000550401 | 420 |
| 104 | 3300006353 | Ga0075370_10002147 | Ga0075370_100021477 | 420 |
| 105 | 3300013306 | Ga0163162_10051927 | Ga0163162_100519273 | 420 |
| 106 | 3300014325 | Ga0163163_10243940 | Ga0163163_102439402 | 420 |
| 107 | 3300025923 | Ga0207681_10042266 | Ga0207681_100422662 | 420 |
| 108 | 3300025925 | Ga0207650_10001346 | Ga0207650_1000134613 | 420 |
| 109 | 3300042115 | Ga0450911_004418 | Ga0450911_004418_272_1615 | 420 |
| 110 | 3300048927 | Ga0496124_0031147 | Ga0496124_0031147_2914_4257 | 420 |
| 111 | 3300048928 | Ga0496125_0074777 | Ga0496125_0074777_656_1999 | 420 |
| 112 | 3300048929 | Ga0496126_0146301 | Ga0496126_0146301_634_1977 | 420 |
| 113 | 3300053154 | Ga0500619_000014 | Ga0500619_000014_9220_10611 | 420 |
| 114 | 3300005563 | Ga0068855_100048080 | Ga0068855_1000480805 | 421 |
| 115 | 3300025949 | Ga0207667_10027618 | Ga0207667_100276182 | 421 |
| 116 | 3300039447 | Ga0436361_1043865 | Ga0436361_1043865_1862_3229 | 421 |
| 117 | 3300005336 | Ga0070680_100025814 | Ga0070680_1000258145 | 422 |
| 118 | 3300005457 | Ga0070662_100022134 | Ga0070662_1000221343 | 422 |
| 119 | 3300005458 | Ga0070681_10062170 | Ga0070681_100621702 | 422 |
| 120 | 3300005530 | Ga0070679_100013044 | Ga0070679_1000130443 | 422 |
| 121 | 3300005543 | Ga0070672_100079594 | Ga0070672_1000795942 | 422 |
| 122 | 3300025909 | Ga0207705_10136076 | Ga0207705_101360762 | 422 |
| 123 | 3300025917 | Ga0207660_10001454 | Ga0207660_1000145412 | 422 |
| 124 | 3300025921 | Ga0207652_10051225 | Ga0207652_100512252 | 422 |
| 125 | 3300026121 | Ga0207683_10154519 | Ga0207683_101545192 | 422 |
| 126 | 3300042461 | Ga0439460_0009792 | Ga0439460_0009792_335_1723 | 422 |
| 127 | 3300003775 | Ga0055524_1000247 | Ga0055524_10002477 | 423 |
| 128 | 3300031507 | Ga0307509_10020572 | Ga0307509_100205726 | 423 |
| 129 | 3300031548 | Ga0307408_100032911 | Ga0307408_1000329113 | 423 |
| 130 | 3300005338 | Ga0068868_100111977 | Ga0068868_1001119773 | 424 |
| 131 | 3300005563 | Ga0068855_100072373 | Ga0068855_1000723733 | 424 |
| 132 | 3300005563 | Ga0068855_100268088 | Ga0068855_1002680881 | 424 |
| 133 | 3300005614 | Ga0068856_100023648 | Ga0068856_1000236487 | 424 |
| 134 | 3300006038 | Ga0075365_10011610 | Ga0075365_100116106 | 424 |
| 135 | 3300006177 | Ga0075362_10026936 | Ga0075362_100269362 | 424 |
| 136 | 3300006195 | Ga0075366_10036444 | Ga0075366_100364442 | 424 |
| 137 | 3300009098 | Ga0105245_10012950 | Ga0105245_100129504 | 424 |
| 138 | 3300025949 | Ga0207667_10131052 | Ga0207667_101310522 | 424 |
| 139 | 3300050489 | nmdc:mga03683_15504_c1 | nmdc:mga03683_15504_c1_742_2100 | 424 |
| 140 | 3300050492 | nmdc:mga0yw44_64343_c1 | nmdc:mga0yw44_64343_c1_765_2123 | 424 |
| 141 | 3300050493 | nmdc:mga0k408_47579_c1 | nmdc:mga0k408_47579_c1_337_1695 | 424 |
| 142 | 3300050496 | nmdc:mga07m45_74089_c1 | nmdc:mga07m45_74089_c1_548_1906 | 424 |
| 143 | 3300028794 | Ga0307515_10000011 | Ga0307515_100000116 | 425 |
| 144 | 3300028794 | Ga0307515_10000281 | Ga0307515_100002816 | 425 |
| 145 | 3300031730 | Ga0307516_10005578 | Ga0307516_1000557814 | 425 |
| 146 | 3300015683 | Ga0183362_10005 | Ga0183362_10005134 | 426 |
| 147 | 3300031456 | Ga0307513_10025768 | Ga0307513_100257683 | 426 |
| 148 | 3300042876 | Ga0451577_0014500 | Ga0451577_0014500_99_1469 | 426 |
| 149 | 3300049579 | Ga0501043_0030215 | Ga0501043_0030215_2241_3617 | 426 |
| 150 | iso_pu_bacteria | 2932422444 | 2932424491 | 426 |
| 151 | 3300005331 | Ga0070670_100044235 | Ga0070670_1000442353 | 427 |
| 152 | 3300005338 | Ga0068868_100022196 | Ga0068868_1000221962 | 427 |
| 153 | 3300005340 | Ga0070689_100012386 | Ga0070689_1000123864 | 427 |
| 154 | 3300005354 | Ga0070675_100012549 | Ga0070675_1000125496 | 427 |
| 155 | 3300005355 | Ga0070671_100004115 | Ga0070671_10000411510 | 427 |
| 156 | 3300005364 | Ga0070673_100009469 | Ga0070673_1000094695 | 427 |
| 157 | 3300005367 | Ga0070667_100008119 | Ga0070667_1000081198 | 427 |
| 158 | 3300005456 | Ga0070678_100051450 | Ga0070678_1000514501 | 427 |
| 159 | 3300005457 | Ga0070662_100075344 | Ga0070662_1000753442 | 427 |
| 160 | 3300005543 | Ga0070672_100123912 | Ga0070672_1001239122 | 427 |
| 161 | 3300005616 | Ga0068852_100140444 | Ga0068852_1001404442 | 427 |
| 162 | 3300005843 | Ga0068860_100084500 | Ga0068860_1000845002 | 427 |
| 163 | 3300013296 | Ga0157374_10048229 | Ga0157374_100482292 | 427 |
| 164 | 3300013306 | Ga0163162_10006139 | Ga0163162_100061395 | 427 |
| 165 | 3300013308 | Ga0157375_10016070 | Ga0157375_100160705 | 427 |
| 166 | 3300014325 | Ga0163163_10035773 | Ga0163163_100357732 | 427 |
| 167 | 3300014968 | Ga0157379_10022724 | Ga0157379_100227242 | 427 |
| 168 | 3300014969 | Ga0157376_10061714 | Ga0157376_100617142 | 427 |
| 169 | 3300025933 | Ga0207706_10061609 | Ga0207706_100616092 | 427 |
| 170 | 3300025960 | Ga0207651_10009387 | Ga0207651_100093875 | 427 |
| 171 | 3300026035 | Ga0207703_10011615 | Ga0207703_100116152 | 427 |
| 172 | 3300026142 | Ga0207698_10073054 | Ga0207698_100730542 | 427 |
| 173 | 3300027543 | Ga0209999_1007707 | Ga0209999_10077071 | 427 |
| 174 | 3300031995 | Ga0307409_100004999 | Ga0307409_1000049998 | 427 |
| 175 | 3300048911 | Ga0496108_0118815 | Ga0496108_0118815_241_1572 | 427 |
| 176 | 3300048912 | Ga0496109_0155807 | Ga0496109_0155807_421_1752 | 427 |
| 177 | iso_pu_bacteria | 2643221628 | 2644164023 | 427 |
| 178 | iso_pu_bacteria | 2842677519 | 2842678630 | 427 |
| 179 | iso_pu_bacteria | 2904449895 | 2904452766 | 427 |
| 180 | iso_pu_bacteria | 2904456579 | 2904460206 | 427 |
| 181 | iso_pu_bacteria | 2945945610 | 2945945702 | 427 |
| 182 | iso_pu_bacteria | 2945972063 | 2945975357 | 427 |
| 183 | 3300005331 | Ga0070670_100105924 | Ga0070670_1001059242 | 428 |
| 184 | 3300005355 | Ga0070671_100018389 | Ga0070671_1000183895 | 428 |
| 185 | 3300005618 | Ga0068864_100030433 | Ga0068864_1000304332 | 428 |
| 186 | 3300005841 | Ga0068863_100045751 | Ga0068863_1000457512 | 428 |
| 187 | 3300006358 | Ga0068871_100013329 | Ga0068871_1000133295 | 428 |
| 188 | 3300009093 | Ga0105240_10160491 | Ga0105240_101604912 | 428 |
| 189 | 3300009177 | Ga0105248_10024656 | Ga0105248_100246565 | 428 |
| 190 | 3300025931 | Ga0207644_10017333 | Ga0207644_100173335 | 428 |
| 191 | 3300025941 | Ga0207711_10019739 | Ga0207711_100197395 | 428 |
| 192 | 3300026088 | Ga0207641_10011103 | Ga0207641_100111037 | 428 |
| 193 | 3300048905 | Ga0496102_0009157 | Ga0496102_0009157_6389_7780 | 428 |
| 194 | 3300048912 | Ga0496109_0193157 | Ga0496109_0193157_88_1476 | 428 |
| 195 | 3300048916 | Ga0496113_0089270 | Ga0496113_0089270_998_2341 | 428 |
| 196 | 3300048928 | Ga0496125_0075095 | Ga0496125_0075095_410_1753 | 428 |
| 197 | iso_pu_bacteria | 2738543013 | 2739249703 | 428 |
| 198 | iso_pu_bacteria | 2842747753 | 2842752377 | 428 |
| 199 | iso_pu_bacteria | 2885192300 | 2885193210 | 428 |
| 200 | 3300025917 | Ga0207660_10117650 | Ga0207660_101176501 | 429 |
| 201 | 3300009176 | Ga0105242_10001200 | Ga0105242_1000120013 | 430 |
| 202 | 3300025934 | Ga0207686_10004163 | Ga0207686_100041638 | 430 |
| 203 | 3300003578 | Ga0006562J51391_1042152 | Ga0006562J51391_10421522 | 431 |
| 204 | 3300003792 | Ga0055540_1008623 | Ga0055540_10086232 | 431 |
| 205 | 3300005288 | Ga0065714_10010259 | Ga0065714_100102594 | 431 |
| 206 | 3300006051 | Ga0075364_10079311 | Ga0075364_100793111 | 431 |
| 207 | 3300006177 | Ga0075362_10002845 | Ga0075362_100028455 | 431 |
| 208 | 3300006177 | Ga0075362_10005426 | Ga0075362_100054263 | 431 |
| 209 | 3300006195 | Ga0075366_10013295 | Ga0075366_100132954 | 431 |
| 210 | 3300006195 | Ga0075366_10020444 | Ga0075366_100204442 | 431 |
| 211 | 3300006353 | Ga0075370_10008222 | Ga0075370_100082224 | 431 |
| 212 | 3300006946 | Ga0079104_1013480 | Ga0079104_10134802 | 431 |
| 213 | 3300013100 | Ga0157373_10012300 | Ga0157373_100123008 | 431 |
| 214 | 3300025273 | Ga0209673_1003690 | Ga0209673_10036909 | 431 |
| 215 | 3300025303 | Ga0209051_1008990 | Ga0209051_10089905 | 431 |
| 216 | 3300028794 | Ga0307515_10000419 | Ga0307515_100004196 | 431 |
| 217 | 3300030735 | Ga0316178_1131179 | Ga0316178_11311791 | 431 |
| 218 | 3300031251 | Ga0265327_10016534 | Ga0265327_100165344 | 431 |
| 219 | 3300031548 | Ga0307408_100056443 | Ga0307408_1000564432 | 431 |
| 220 | 3300031731 | Ga0307405_10034443 | Ga0307405_100344431 | 431 |
| 221 | 3300031901 | Ga0307406_10007227 | Ga0307406_100072275 | 431 |
| 222 | 3300041404 | Ga0439436_0016190 | Ga0439436_0016190_697_2037 | 431 |
| 223 | 3300041411 | Ga0439466_0006336 | Ga0439466_0006336_1436_2776 | 431 |
| 224 | 3300042002 | Ga0439442_004829 | Ga0439442_004829_1222_2562 | 431 |
| 225 | 3300042123 | Ga0450921_000014 | Ga0450921_000014_652_1992 | 431 |
| 226 | 3300042125 | Ga0450923_001529 | Ga0450923_001529_1343_2683 | 431 |
| 227 | 3300042156 | Ga0439446_0017256 | Ga0439446_0017256_508_1848 | 431 |
| 228 | 3300042184 | Ga0450908_000591 | Ga0450908_000591_4970_6310 | 431 |
| 229 | 3300042435 | Ga0439434_0011742 | Ga0439434_0011742_168_1508 | 431 |
| 230 | 3300042531 | Ga0450918_003796 | Ga0450918_003796_1197_2537 | 431 |
| 231 | 3300050489 | nmdc:mga03683_13349_c1 | nmdc:mga03683_13349_c1_1365_2705 | 431 |
| 232 | 3300050489 | nmdc:mga03683_6266_c1 | nmdc:mga03683_6266_c1_409_1749 | 431 |
| 233 | 3300050491 | nmdc:mga00v17_87387_c1 | nmdc:mga00v17_87387_c1_149_1489 | 431 |
| 234 | 3300050492 | nmdc:mga0yw44_8074_c1 | nmdc:mga0yw44_8074_c1_2424_3764 | 431 |
| 235 | 3300050493 | nmdc:mga0k408_12497_c1 | nmdc:mga0k408_12497_c1_739_2079 | 431 |
| 236 | iso_pu_bacteria | 2643221660 | 2644338646 | 431 |
| 237 | iso_pu_bacteria | 2881101125 | 2881103309 | 431 |
| 238 | iso_pu_bacteria | 2928115317 | 2928117980 | 431 |
| 239 | 3300003784 | Ga0055534_1002527 | Ga0055534_10025272 | 432 |
| 240 | 3300005353 | Ga0070669_100002701 | Ga0070669_1000027017 | 432 |
| 241 | 3300005456 | Ga0070678_100122314 | Ga0070678_1001223141 | 432 |
| 242 | 3300005543 | Ga0070672_100020259 | Ga0070672_1000202594 | 432 |
| 243 | 3300005548 | Ga0070665_100009614 | Ga0070665_1000096147 | 432 |
| 244 | 3300005577 | Ga0068857_100040785 | Ga0068857_1000407852 | 432 |
| 245 | 3300006038 | Ga0075365_10010955 | Ga0075365_100109557 | 432 |
| 246 | 3300006048 | Ga0075363_100009657 | Ga0075363_1000096572 | 432 |
| 247 | 3300006186 | Ga0075369_10055871 | Ga0075369_100558711 | 432 |
| 248 | 3300006195 | Ga0075366_10043068 | Ga0075366_100430682 | 432 |
| 249 | 3300006353 | Ga0075370_10001843 | Ga0075370_1000184311 | 432 |
| 250 | 3300006353 | Ga0075370_10012954 | Ga0075370_100129544 | 432 |
| 251 | 3300009177 | Ga0105248_10270413 | Ga0105248_102704131 | 432 |
| 252 | 3300013308 | Ga0157375_10098903 | Ga0157375_100989032 | 432 |
| 253 | 3300014497 | Ga0182008_10002992 | Ga0182008_100029928 | 432 |
| 254 | 3300014497 | Ga0182008_10006547 | Ga0182008_100065477 | 432 |
| 255 | 3300015262 | Ga0182007_10004423 | Ga0182007_100044232 | 432 |
| 256 | 3300015265 | Ga0182005_1007578 | Ga0182005_10075782 | 432 |
| 257 | 3300017792 | Ga0163161_10019147 | Ga0163161_100191473 | 432 |
| 258 | 3300017792 | Ga0163161_10039817 | Ga0163161_100398172 | 432 |
| 259 | 3300025291 | Ga0209675_1000911 | Ga0209675_10009112 | 432 |
| 260 | 3300025292 | Ga0209676_1011605 | Ga0209676_10116052 | 432 |
| 261 | 3300025303 | Ga0209051_1026222 | Ga0209051_10262222 | 432 |
| 262 | 3300025304 | Ga0209257_1006810 | Ga0209257_10068102 | 432 |
| 263 | 3300025923 | Ga0207681_10002578 | Ga0207681_1000257810 | 432 |
| 264 | 3300026121 | Ga0207683_10098453 | Ga0207683_100984532 | 432 |
| 265 | 3300027876 | Ga0209974_10017019 | Ga0209974_100170192 | 432 |
| 266 | 3300031235 | Ga0265330_10000052 | Ga0265330_1000005268 | 432 |
| 267 | 3300031238 | Ga0265332_10000001 | Ga0265332_10000001751 | 432 |
| 268 | 3300031241 | Ga0265325_10010139 | Ga0265325_100101395 | 432 |
| 269 | 3300031247 | Ga0265340_10059587 | Ga0265340_100595872 | 432 |
| 270 | 3300031711 | Ga0265314_10000013 | Ga0265314_1000001366 | 432 |
| 271 | 3300031731 | Ga0307405_10061018 | Ga0307405_100610182 | 432 |
| 272 | 3300031911 | Ga0307412_10015031 | Ga0307412_100150312 | 432 |
| 273 | 3300041404 | Ga0439436_0009572 | Ga0439436_0009572_537_1886 | 432 |
| 274 | 3300041406 | Ga0439439_0002335 | Ga0439439_0002335_2169_3518 | 432 |
| 275 | 3300041411 | Ga0439466_0013342 | Ga0439466_0013342_397_1746 | 432 |
| 276 | 3300041411 | Ga0439466_0019082 | Ga0439466_0019082_269_1618 | 432 |
| 277 | 3300041413 | Ga0439465_0006744 | Ga0439465_0006744_539_1888 | 432 |
| 278 | 3300041997 | Ga0439431_0001021 | Ga0439431_0001021_2884_4233 | 432 |
| 279 | 3300041999 | Ga0439433_0007805 | Ga0439433_0007805_25_1374 | 432 |
| 280 | 3300042002 | Ga0439442_003465 | Ga0439442_003465_1172_2521 | 432 |
| 281 | 3300042002 | Ga0439442_008074 | Ga0439442_008074_582_1931 | 432 |
| 282 | 3300042004 | Ga0439445_0000222 | Ga0439445_0000222_8583_9932 | 432 |
| 283 | 3300042004 | Ga0439445_0012752 | Ga0439445_0012752_472_1821 | 432 |
| 284 | 3300042006 | Ga0439432_005922 | Ga0439432_005922_2498_3847 | 432 |
| 285 | 3300042007 | Ga0439449_0005925 | Ga0439449_0005925_1924_3273 | 432 |
| 286 | 3300042007 | Ga0439449_0012922 | Ga0439449_0012922_653_2002 | 432 |
| 287 | 3300042010 | Ga0439452_012584 | Ga0439452_012584_693_2042 | 432 |
| 288 | 3300042014 | Ga0439457_009566 | Ga0439457_009566_674_2023 | 432 |
| 289 | 3300042014 | Ga0439457_009633 | Ga0439457_009633_546_1895 | 432 |
| 290 | 3300042015 | Ga0439462_0004249 | Ga0439462_0004249_463_1812 | 432 |
| 291 | 3300042015 | Ga0439462_0006720 | Ga0439462_0006720_561_1910 | 432 |
| 292 | 3300042131 | Ga0450894_002457 | Ga0450894_002457_511_1860 | 432 |
| 293 | 3300042145 | Ga0450906_004008 | Ga0450906_004008_743_2092 | 432 |
| 294 | 3300042156 | Ga0439446_0018498 | Ga0439446_0018498_67_1416 | 432 |
| 295 | 3300042184 | Ga0450908_009850 | Ga0450908_009850_260_1609 | 432 |
| 296 | 3300042185 | Ga0450909_003138 | Ga0450909_003138_960_2309 | 432 |
| 297 | 3300042435 | Ga0439434_0015589 | Ga0439434_0015589_518_1867 | 432 |
| 298 | 3300044683 | Ga0466965_0008433 | Ga0466965_0008433_526_1875 | 432 |
| 299 | 3300044901 | Ga0466960_0042774 | Ga0466960_0042774_422_1771 | 432 |
| 300 | 3300046459 | Ga0495629_0070447 | Ga0495629_0070447_582_1934 | 432 |
| 301 | 3300046471 | Ga0495650_0017128 | Ga0495650_0017128_207_1550 | 432 |
| 302 | 3300046475 | Ga0495639_0004264 | Ga0495639_0004264_870_2222 | 432 |
| 303 | 3300046522 | Ga0495643_0027317 | Ga0495643_0027317_611_1960 | 432 |
| 304 | 3300046528 | Ga0495642_0020287 | Ga0495642_0020287_228_1577 | 432 |
| 305 | 3300046615 | Ga0495656_0002495 | Ga0495656_0002495_822_2171 | 432 |
| 306 | 3300046674 | Ga0495588_0060622 | Ga0495588_0060622_105_1457 | 432 |
| 307 | 3300048904 | Ga0496101_0029043 | Ga0496101_0029043_508_1860 | 432 |
| 308 | 3300048905 | Ga0496102_0009561 | Ga0496102_0009561_4829_6181 | 432 |
| 309 | 3300048906 | Ga0496103_0033383 | Ga0496103_0033383_1438_2790 | 432 |
| 310 | 3300048908 | Ga0496105_0032115 | Ga0496105_0032115_2338_3690 | 432 |
| 311 | 3300048910 | Ga0496107_0109186 | Ga0496107_0109186_205_1557 | 432 |
| 312 | 3300048912 | Ga0496109_0047302 | Ga0496109_0047302_1872_3224 | 432 |
| 313 | 3300048913 | Ga0496110_0153617 | Ga0496110_0153617_207_1559 | 432 |
| 314 | 3300048914 | Ga0496111_0150933 | Ga0496111_0150933_211_1563 | 432 |
| 315 | 3300048925 | Ga0496122_0004537 | Ga0496122_0004537_11024_12379 | 432 |
| 316 | 3300048926 | Ga0496123_0000160 | Ga0496123_0000160_8563_9918 | 432 |
| 317 | 3300048929 | Ga0496126_0172256 | Ga0496126_0172256_68_1423 | 432 |
| 318 | 3300050490 | nmdc:mga03n38_16652_c1 | nmdc:mga03n38_16652_c1_1371_2720 | 432 |
| 319 | 3300050496 | nmdc:mga07m45_4843_c1 | nmdc:mga07m45_4843_c1_341_1690 | 432 |
| 320 | 3300050496 | nmdc:mga07m45_55744_c1 | nmdc:mga07m45_55744_c1_365_1711 | 432 |
| 321 | 3300053136 | Ga0500559_0005517 | Ga0500559_0005517_4062_5411 | 432 |
| 322 | 3300053136 | Ga0500559_0012959 | Ga0500559_0012959_1023_2372 | 432 |
| 323 | 3300003323 | rootH1_10069288 | rootH1_100692882 | 433 |
| 324 | 3300005345 | Ga0070692_10043595 | Ga0070692_100435952 | 433 |
| 325 | 3300005367 | Ga0070667_100036643 | Ga0070667_1000366432 | 433 |
| 326 | 3300005842 | Ga0068858_100004297 | Ga0068858_1000042972 | 433 |
| 327 | 3300046558 | Ga0495633_0007721 | Ga0495633_0007721_687_2051 | 433 |
| 328 | 3300049571 | Ga0501034_0124759 | Ga0501034_0124759_145_1503 | 433 |
| 329 | 3300049822 | Ga0501035_0111195 | Ga0501035_0111195_266_1624 | 433 |
| 330 | 3300049823 | Ga0501044_0308243 | Ga0501044_0308243_92_1447 | 433 |
| 331 | 3300053117 | Ga0500593_003896 | Ga0500593_003896_3548_4912 | 433 |
| 332 | 3300042006 | Ga0439432_021684 | Ga0439432_021684_386_1762 | 434 |
| 333 | 3300042007 | Ga0439449_0011708 | Ga0439449_0011708_1884_3260 | 434 |
| 334 | 3300042876 | Ga0451577_0009895 | Ga0451577_0009895_7078_8445 | 434 |
| 335 | 3300050493 | nmdc:mga0k408_35206_c1 | nmdc:mga0k408_35206_c1_227_1618 | 434 |
| 336 | 3300050496 | nmdc:mga07m45_5171_c1 | nmdc:mga07m45_5171_c1_754_2145 | 434 |
| 337 | 3300005355 | Ga0070671_100026675 | Ga0070671_1000266756 | 435 |
| 338 | 3300005618 | Ga0068864_100106106 | Ga0068864_1001061062 | 435 |
| 339 | 3300006353 | Ga0075370_10003491 | Ga0075370_100034912 | 435 |
| 340 | 3300009177 | Ga0105248_10036212 | Ga0105248_100362124 | 435 |
| 341 | 3300025941 | Ga0207711_10033268 | Ga0207711_100332684 | 435 |
| 342 | 3300026095 | Ga0207676_10095831 | Ga0207676_100958312 | 435 |
| 343 | 3300032005 | Ga0307411_10090769 | Ga0307411_100907692 | 435 |
| 344 | 3300048912 | Ga0496109_0077567 | Ga0496109_0077567_787_2157 | 435 |
| 345 | 3300050493 | nmdc:mga0k408_892_c1 | nmdc:mga0k408_892_c1_181_1539 | 435 |
| 346 | 3300050496 | nmdc:mga07m45_6993_c1 | nmdc:mga07m45_6993_c1_2935_4296 | 435 |
| 347 | 3300050496 | nmdc:mga07m45_7711_c1 | nmdc:mga07m45_7711_c1_370_1728 | 435 |
| 348 | iso_pu_bacteria | 2721755523 | 2722881536 | 435 |
| 349 | 3300005339 | Ga0070660_100026833 | Ga0070660_1000268334 | 436 |
| 350 | 3300005341 | Ga0070691_10053453 | Ga0070691_100534532 | 436 |
| 351 | 3300005458 | Ga0070681_10139067 | Ga0070681_101390672 | 436 |
| 352 | 3300005530 | Ga0070679_100062147 | Ga0070679_1000621472 | 436 |
| 353 | 3300005563 | Ga0068855_100007548 | Ga0068855_10000754814 | 436 |
| 354 | 3300006195 | Ga0075366_10000512 | Ga0075366_100005127 | 436 |
| 355 | 3300009093 | Ga0105240_10019194 | Ga0105240_100191942 | 436 |
| 356 | 3300025912 | Ga0207707_10120457 | Ga0207707_101204572 | 436 |
| 357 | 3300025919 | Ga0207657_10023991 | Ga0207657_100239917 | 436 |
| 358 | 3300027526 | Ga0209968_1000906 | Ga0209968_10009062 | 437 |
| 359 | 3300027695 | Ga0209966_1000017 | Ga0209966_100001720 | 437 |
| 360 | 3300031548 | Ga0307408_100064624 | Ga0307408_1000646242 | 437 |
| 361 | 3300031911 | Ga0307412_10026896 | Ga0307412_100268962 | 437 |
| 362 | 3300046543 | Ga0495645_0050111 | Ga0495645_0050111_1088_2467 | 437 |
| 363 | iso_pu_bacteria | 2643221644 | 2644244825 | 437 |
| 364 | iso_pu_bacteria | 2831864461 | 2831864583 | 438 |
| 365 | iso_pu_bacteria | 2886848708 | 2886851440 | 438 |
| 366 | 3300037471 | Ga0395905_0014064 | Ga0395905_0014064_2539_3909 | 439 |
| 367 | 3300037471 | Ga0395905_0109466 | Ga0395905_0109466_961_2328 | 439 |
| 368 | 3300048905 | Ga0496102_0011400 | Ga0496102_0011400_1262_2641 | 439 |
| 369 | 3300003316 | rootH1_10083585 | rootH1_100835853 | 440 |
| 370 | 3300003322 | rootL2_10106425 | rootL2_101064253 | 440 |
| 371 | 3300044684 | Ga0466966_0003197 | Ga0466966_0003197_6758_8125 | 440 |
| 372 | 3300044693 | Ga0466961_0007180 | Ga0466961_0007180_2610_3977 | 440 |
| 373 | 3300044706 | Ga0466964_0006544 | Ga0466964_0006544_963_2330 | 440 |
| 374 | 3300044719 | Ga0466971_0043912 | Ga0466971_0043912_175_1542 | 440 |
| 375 | 3300045049 | Ga0466959_0000174 | Ga0466959_0000174_36716_38083 | 440 |
| 376 | 3300048927 | Ga0496124_0000108 | Ga0496124_0000108_29813_31180 | 440 |
| 377 | 3300048928 | Ga0496125_0004332 | Ga0496125_0004332_14516_15883 | 440 |
| 378 | iso_pu_bacteria | 2585428057 | 2587725502 | 440 |
| 379 | iso_pu_bacteria | 2585428058 | 2587734972 | 440 |
| 380 | iso_pu_bacteria | 2588253510 | 2588290504 | 440 |
| 381 | 3300005262 | Ga0065165_1005747 | Ga0065165_10057472 | 441 |
| 382 | 3300006195 | Ga0075366_10002670 | Ga0075366_100026707 | 441 |
| 383 | 3300006195 | Ga0075366_10073830 | Ga0075366_100738302 | 441 |
| 384 | 3300006946 | Ga0079104_1000711 | Ga0079104_100071121 | 441 |
| 385 | 3300014745 | Ga0157377_10000044 | Ga0157377_1000004487 | 441 |
| 386 | 3300021361 | Ga0213872_10000067 | Ga0213872_100000677 | 441 |
| 387 | 3300021361 | Ga0213872_10000131 | Ga0213872_100001315 | 441 |
| 388 | 3300021361 | Ga0213872_10000233 | Ga0213872_1000023313 | 441 |
| 389 | 3300021361 | Ga0213872_10025078 | Ga0213872_100250782 | 441 |
| 390 | 3300025298 | Ga0209050_1004597 | Ga0209050_10045977 | 441 |
| 391 | 3300025298 | Ga0209050_1008492 | Ga0209050_10084925 | 441 |
| 392 | 3300025299 | Ga0209256_1000049 | Ga0209256_100004967 | 441 |
| 393 | 3300025303 | Ga0209051_1000247 | Ga0209051_100024747 | 441 |
| 394 | 3300025304 | Ga0209257_1000141 | Ga0209257_100014147 | 441 |
| 395 | 3300027111 | Ga0209281_1000395 | Ga0209281_100039548 | 441 |
| 396 | 3300028794 | Ga0307515_10031865 | Ga0307515_100318653 | 441 |
| 397 | 3300031250 | Ga0265331_10003008 | Ga0265331_100030083 | 441 |
| 398 | 3300031251 | Ga0265327_10000035 | Ga0265327_10000035152 | 441 |
| 399 | 3300031456 | Ga0307513_10034575 | Ga0307513_100345753 | 441 |
| 400 | 3300039447 | Ga0436361_0479314 | Ga0436361_0479314_2541_3923 | 441 |
| 401 | 3300039447 | Ga0436361_0816515 | Ga0436361_0816515_2126_3508 | 441 |
| 402 | 3300039447 | Ga0436361_1149866 | Ga0436361_1149866_3503_4885 | 441 |
| 403 | 3300042876 | Ga0451577_0125297 | Ga0451577_0125297_65_1438 | 441 |
| 404 | 3300048917 | Ga0496114_0006241 | Ga0496114_0006241_175_1557 | 441 |
| 405 | 3300049822 | Ga0501035_0083199 | Ga0501035_0083199_1059_2438 | 441 |
| 406 | 3300053086 | Ga0500578_0000025 | Ga0500578_0000025_13674_15053 | 441 |
| 407 | 3300053108 | Ga0500562_015236 | Ga0500562_015236_180_1559 | 441 |
| 408 | 3300053130 | Ga0500642_0032519 | Ga0500642_0032519_547_1926 | 441 |
| 409 | 3300053139 | Ga0500568_0011402 | Ga0500568_0011402_553_1932 | 441 |
| 410 | 3300053156 | Ga0500622_0000890 | Ga0500622_0000890_3893_5272 | 441 |
| 411 | 3300053156 | Ga0500622_0010205 | Ga0500622_0010205_3241_4620 | 441 |
| 412 | 3300003322 | rootL2_10003381 | rootL2_1000338116 | 442 |
| 413 | 3300003771 | Ga0055526_1001509 | Ga0055526_10015095 | 442 |
| 414 | 3300003775 | Ga0055524_1002449 | Ga0055524_10024494 | 442 |
| 415 | 3300003775 | Ga0055524_1003709 | Ga0055524_10037095 | 442 |
| 416 | 3300003794 | Ga0055531_10004940 | Ga0055531_100049405 | 442 |
| 417 | 3300003794 | Ga0055531_10008285 | Ga0055531_100082852 | 442 |
| 418 | 3300004625 | Ga0055543_1004417 | Ga0055543_10044175 | 442 |
| 419 | 3300005262 | Ga0065165_1000290 | Ga0065165_100029072 | 442 |
| 420 | 3300005262 | Ga0065165_1001688 | Ga0065165_10016884 | 442 |
| 421 | 3300005577 | Ga0068857_100005597 | Ga0068857_10000559711 | 442 |
| 422 | 3300006048 | Ga0075363_100005295 | Ga0075363_1000052954 | 442 |
| 423 | 3300006177 | Ga0075362_10001230 | Ga0075362_100012305 | 442 |
| 424 | 3300006186 | Ga0075369_10003566 | Ga0075369_100035666 | 442 |
| 425 | 3300006353 | Ga0075370_10002011 | Ga0075370_100020115 | 442 |
| 426 | 3300006944 | Ga0099823_1000065 | Ga0099823_10000655 | 442 |
| 427 | 3300009545 | Ga0105237_10000646 | Ga0105237_1000064610 | 442 |
| 428 | 3300012497 | Ga0157319_1000005 | Ga0157319_1000005268 | 442 |
| 429 | 3300013296 | Ga0157374_10071539 | Ga0157374_100715392 | 442 |
| 430 | 3300025242 | Ga0209258_103059 | Ga0209258_1030593 | 442 |
| 431 | 3300025273 | Ga0209673_1011942 | Ga0209673_10119421 | 442 |
| 432 | 3300025295 | Ga0209564_1000008 | Ga0209564_1000008217 | 442 |
| 433 | 3300025298 | Ga0209050_1010621 | Ga0209050_10106213 | 442 |
| 434 | 3300025299 | Ga0209256_1003918 | Ga0209256_10039185 | 442 |
| 435 | 3300025299 | Ga0209256_1004159 | Ga0209256_10041594 | 442 |
| 436 | 3300025303 | Ga0209051_1003902 | Ga0209051_10039023 | 442 |
| 437 | 3300025304 | Ga0209257_1001704 | Ga0209257_100170417 | 442 |
| 438 | 3300025304 | Ga0209257_1004727 | Ga0209257_10047275 | 442 |
| 439 | 3300025907 | Ga0207645_10054409 | Ga0207645_100544092 | 442 |
| 440 | 3300025914 | Ga0207671_10007157 | Ga0207671_100071573 | 442 |
| 441 | 3300027296 | Ga0209389_1010868 | Ga0209389_10108683 | 442 |
| 442 | 3300027866 | Ga0209813_10012578 | Ga0209813_100125782 | 442 |
| 443 | 3300042127 | Ga0450890_002246 | Ga0450890_002246_534_1919 | 442 |
| 444 | 3300044656 | Ga0466969_0000046 | Ga0466969_0000046_58804_60180 | 442 |
| 445 | 3300044684 | Ga0466966_0016292 | Ga0466966_0016292_297_1673 | 442 |
| 446 | 3300044694 | Ga0466963_0062885 | Ga0466963_0062885_795_2180 | 442 |
| 447 | 3300045049 | Ga0466959_0026183 | Ga0466959_0026183_62_1438 | 442 |
| 448 | 3300048912 | Ga0496109_0232931 | Ga0496109_0232931_279_1694 | 442 |
| 449 | 3300048913 | Ga0496110_0019147 | Ga0496110_0019147_3736_5151 | 442 |
| 450 | 3300048927 | Ga0496124_0075218 | Ga0496124_0075218_862_2247 | 442 |
| 451 | 3300050496 | nmdc:mga07m45_3610_c1 | nmdc:mga07m45_3610_c1_3535_4920 | 442 |
| 452 | 3300053156 | Ga0500622_0001306 | Ga0500622_0001306_16353_17780 | 442 |
| 453 | 3300005356 | Ga0070674_100004415 | Ga0070674_1000044156 | 443 |
| 454 | 3300025303 | Ga0209051_1007075 | Ga0209051_10070757 | 443 |
| 455 | 3300032002 | Ga0307416_100077835 | Ga0307416_1000778352 | 443 |
| 456 | 3300037418 | Ga0395900_0001686 | Ga0395900_0001686_4173_5549 | 443 |
| 457 | 3300037466 | Ga0395898_0002642 | Ga0395898_0002642_18107_19483 | 443 |
| 458 | 3300048907 | Ga0496104_0113229 | Ga0496104_0113229_666_2042 | 443 |
| 459 | 3300049686 | Ga0501257_015855 | Ga0501257_015855_69_1451 | 443 |
| 460 | 3300049762 | Ga0501265_002543 | Ga0501265_002543_149_1531 | 443 |
| 461 | 3300050496 | nmdc:mga07m45_11599_c1 | nmdc:mga07m45_11599_c1_1580_2971 | 443 |
| 462 | 3300003215 | JGI25153J46596_10002860 | JGI25153J46596_100028607 | 444 |
| 463 | 3300003323 | rootH1_10013830 | rootH1_100138302 | 444 |
| 464 | 3300003759 | Ga0055525_1000004 | Ga0055525_1000004130 | 444 |
| 465 | 3300003771 | Ga0055526_1002656 | Ga0055526_10026567 | 444 |
| 466 | 3300005331 | Ga0070670_100026772 | Ga0070670_1000267722 | 444 |
| 467 | 3300005343 | Ga0070687_100013556 | Ga0070687_1000135563 | 444 |
| 468 | 3300005356 | Ga0070674_100034797 | Ga0070674_1000347972 | 444 |
| 469 | 3300006177 | Ga0075362_10004591 | Ga0075362_100045915 | 444 |
| 470 | 3300006178 | Ga0075367_10025245 | Ga0075367_100252453 | 444 |
| 471 | 3300006186 | Ga0075369_10037162 | Ga0075369_100371622 | 444 |
| 472 | 3300006353 | Ga0075370_10001599 | Ga0075370_100015994 | 444 |
| 473 | 3300014968 | Ga0157379_10038113 | Ga0157379_100381133 | 444 |
| 474 | 3300025230 | Ga0209563_100013 | Ga0209563_100013130 | 444 |
| 475 | 3300025245 | Ga0207425_1000426 | Ga0207425_100042626 | 444 |
| 476 | 3300025258 | Ga0209129_1000269 | Ga0209129_100026926 | 444 |
| 477 | 3300025295 | Ga0209564_1000300 | Ga0209564_100030026 | 444 |
| 478 | 3300025297 | Ga0209758_1000605 | Ga0209758_10006057 | 444 |
| 479 | 3300025298 | Ga0209050_1000770 | Ga0209050_100077046 | 444 |
| 480 | 3300025303 | Ga0209051_1015628 | Ga0209051_10156283 | 444 |
| 481 | 3300026089 | Ga0207648_10061480 | Ga0207648_100614802 | 444 |
| 482 | 3300030522 | Ga0307512_10040205 | Ga0307512_100402054 | 444 |
| 483 | 3300031649 | Ga0307514_10006320 | Ga0307514_100063201 | 444 |
| 484 | 3300035691 | Ga0373931_0002648 | Ga0373931_0002648_3664_5064 | 444 |
| 485 | 3300036401 | Ga0373937_0016810 | Ga0373937_0016810_936_2318 | 444 |
| 486 | 3300039447 | Ga0436361_0099386 | Ga0436361_0099386_4039_5457 | 444 |
| 487 | 3300042121 | Ga0450919_000965 | Ga0450919_000965_730_2124 | 444 |
| 488 | 3300042531 | Ga0450918_000077 | Ga0450918_000077_1645_3039 | 444 |
| 489 | 3300044712 | Ga0453684_0082882 | Ga0453684_0082882_372_1811 | 444 |
| 490 | 3300044712 | Ga0453684_0198002 | Ga0453684_0198002_678_2087 | 444 |
| 491 | 3300046512 | Ga0495610_0007076 | Ga0495610_0007076_5303_6766 | 444 |
| 492 | 3300046522 | Ga0495643_0030737 | Ga0495643_0030737_388_1851 | 444 |
| 493 | 3300046537 | Ga0495598_0005445 | Ga0495598_0005445_828_2210 | 444 |
| 494 | 3300046660 | Ga0495625_0009857 | Ga0495625_0009857_3116_4579 | 444 |
| 495 | 3300049649 | Ga0501198_000007 | Ga0501198_000007_101761_103149 | 444 |
| 496 | 3300049662 | Ga0501222_000005 | Ga0501222_000005_26595_27983 | 444 |
| 497 | 3300050493 | nmdc:mga0k408_7424_c1 | nmdc:mga0k408_7424_c1_3618_5000 | 444 |
| 498 | iso_pu_bacteria | 2643221592 | 2643970018 | 444 |
| 499 | iso_pu_bacteria | 2643221625 | 2644143008 | 444 |
| 500 | iso_pu_bacteria | 2643221648 | 2644271932 | 444 |
| 501 | 3300005331 | Ga0070670_100010262 | Ga0070670_1000102622 | 445 |
| 502 | 3300005338 | Ga0068868_100079731 | Ga0068868_1000797311 | 445 |
| 503 | 3300005347 | Ga0070668_100111676 | Ga0070668_1001116762 | 445 |
| 504 | 3300005354 | Ga0070675_100000703 | Ga0070675_10000070317 | 445 |
| 505 | 3300005355 | Ga0070671_100002088 | Ga0070671_10000208816 | 445 |
| 506 | 3300005356 | Ga0070674_100004918 | Ga0070674_1000049181 | 445 |
| 507 | 3300005456 | Ga0070678_100009710 | Ga0070678_1000097101 | 445 |
| 508 | 3300005459 | Ga0068867_100002943 | Ga0068867_1000029436 | 445 |
| 509 | 3300005459 | Ga0068867_100054036 | Ga0068867_1000540362 | 445 |
| 510 | 3300005543 | Ga0070672_100000177 | Ga0070672_10000017720 | 445 |
| 511 | 3300005564 | Ga0070664_100043654 | Ga0070664_1000436542 | 445 |
| 512 | 3300005578 | Ga0068854_100016734 | Ga0068854_1000167342 | 445 |
| 513 | 3300006237 | Ga0097621_100013906 | Ga0097621_1000139062 | 445 |
| 514 | 3300006881 | Ga0068865_100051203 | Ga0068865_1000512032 | 445 |
| 515 | 3300009093 | Ga0105240_10030649 | Ga0105240_100306497 | 445 |
| 516 | 3300009545 | Ga0105237_10007873 | Ga0105237_100078732 | 445 |
| 517 | 3300009551 | Ga0105238_10013724 | Ga0105238_100137242 | 445 |
| 518 | 3300010375 | Ga0105239_10002203 | Ga0105239_1000220314 | 445 |
| 519 | 3300010375 | Ga0105239_10034573 | Ga0105239_100345732 | 445 |
| 520 | 3300013297 | Ga0157378_10122419 | Ga0157378_101224192 | 445 |
| 521 | 3300014969 | Ga0157376_10064408 | Ga0157376_100644082 | 445 |
| 522 | 3300017792 | Ga0163161_10006497 | Ga0163161_100064973 | 445 |
| 523 | 3300025304 | Ga0209257_1024286 | Ga0209257_10242861 | 445 |
| 524 | 3300025901 | Ga0207688_10022598 | Ga0207688_100225983 | 445 |
| 525 | 3300025907 | Ga0207645_10028492 | Ga0207645_100284922 | 445 |
| 526 | 3300025913 | Ga0207695_10028147 | Ga0207695_100281472 | 445 |
| 527 | 3300025914 | Ga0207671_10026506 | Ga0207671_100265064 | 445 |
| 528 | 3300025924 | Ga0207694_10016495 | Ga0207694_100164952 | 445 |
| 529 | 3300025925 | Ga0207650_10003269 | Ga0207650_100032692 | 445 |
| 530 | 3300025926 | Ga0207659_10000207 | Ga0207659_1000020726 | 445 |
| 531 | 3300025931 | Ga0207644_10005018 | Ga0207644_100050187 | 445 |
| 532 | 3300025931 | Ga0207644_10020439 | Ga0207644_100204392 | 445 |
| 533 | 3300025937 | Ga0207669_10002599 | Ga0207669_100025998 | 445 |
| 534 | 3300025938 | Ga0207704_10037050 | Ga0207704_100370502 | 445 |
| 535 | 3300025940 | Ga0207691_10002895 | Ga0207691_100028956 | 445 |
| 536 | 3300025945 | Ga0207679_10158714 | Ga0207679_101587142 | 445 |
| 537 | 3300025981 | Ga0207640_10024457 | Ga0207640_100244572 | 445 |
| 538 | 3300026089 | Ga0207648_10010854 | Ga0207648_100108543 | 445 |
| 539 | 3300026089 | Ga0207648_10011167 | Ga0207648_1001116710 | 445 |
| 540 | 3300026121 | Ga0207683_10012763 | Ga0207683_100127631 | 445 |
| 541 | 3300031649 | Ga0307514_10000355 | Ga0307514_1000035586 | 445 |
| 542 | 3300031731 | Ga0307405_10100625 | Ga0307405_101006252 | 445 |
| 543 | 3300031901 | Ga0307406_10056239 | Ga0307406_100562392 | 445 |
| 544 | 3300031903 | Ga0307407_10016230 | Ga0307407_100162302 | 445 |
| 545 | 3300031911 | Ga0307412_10138233 | Ga0307412_101382332 | 445 |
| 546 | 3300032004 | Ga0307414_10038560 | Ga0307414_100385601 | 445 |
| 547 | 3300032005 | Ga0307411_10003141 | Ga0307411_100031413 | 445 |
| 548 | 3300032126 | Ga0307415_100047717 | Ga0307415_1000477172 | 445 |
| 549 | 3300049569 | Ga0501032_0037757 | Ga0501032_0037757_1273_2658 | 445 |
| 550 | 3300049579 | Ga0501043_0000002 | Ga0501043_0000002_305058_306443 | 445 |
| 551 | 3300049580 | Ga0501046_0000008 | Ga0501046_0000008_305155_306540 | 445 |
| 552 | 3300049581 | Ga0501047_0000003 | Ga0501047_0000003_328323_329708 | 445 |
| 553 | 3300049582 | Ga0501048_0004029 | Ga0501048_0004029_2430_3815 | 445 |
| 554 | 3300050490 | nmdc:mga03n38_26117_c1 | nmdc:mga03n38_26117_c1_654_2042 | 445 |
| 555 | 3300050493 | nmdc:mga0k408_3759_c1 | nmdc:mga0k408_3759_c1_3065_4453 | 445 |
| 556 | 3300050494 | nmdc:mga06z11_16470_c1 | nmdc:mga06z11_16470_c1_897_2285 | 445 |
| 557 | 3300050494 | nmdc:mga06z11_63094_c1 | nmdc:mga06z11_63094_c1_409_1800 | 445 |
| 558 | 3300050496 | nmdc:mga07m45_10995_c1 | nmdc:mga07m45_10995_c1_1198_2589 | 445 |
| 559 | 3300050496 | nmdc:mga07m45_23016_c1 | nmdc:mga07m45_23016_c1_493_1881 | 445 |
| 560 | 3300050516 | nmdc:mga0sz30_14235_c1 | nmdc:mga0sz30_14235_c1_767_2155 | 445 |
| 561 | 3300005467 | Ga0070706_100063204 | Ga0070706_1000632042 | 446 |
| 562 | 3300006195 | Ga0075366_10000833 | Ga0075366_1000083313 | 446 |
| 563 | 3300006846 | Ga0075430_100014313 | Ga0075430_1000143132 | 446 |
| 564 | 3300006880 | Ga0075429_100045567 | Ga0075429_1000455672 | 446 |
| 565 | 3300009093 | Ga0105240_10110593 | Ga0105240_101105932 | 446 |
| 566 | 3300025231 | Ga0207427_101037 | Ga0207427_1010372 | 446 |
| 567 | 3300025910 | Ga0207684_10101912 | Ga0207684_101019122 | 446 |
| 568 | 3300026067 | Ga0207678_10007570 | Ga0207678_100075705 | 446 |
| 569 | 3300044712 | Ga0453684_0032339 | Ga0453684_0032339_490_1878 | 446 |
| 570 | 3300045051 | Ga0451576_0003229 | Ga0451576_0003229_13415_14803 | 446 |
| 571 | 3300050489 | nmdc:mga03683_7162_c1 | nmdc:mga03683_7162_c1_1110_2498 | 446 |
| 572 | 3300050493 | nmdc:mga0k408_396_c1 | nmdc:mga0k408_396_c1_20383_21771 | 446 |
| 573 | 3300050493 | nmdc:mga0k408_57467_c1 | nmdc:mga0k408_57467_c1_314_1702 | 446 |
| 574 | 3300050508 | nmdc:mga09592_2264_c1 | nmdc:mga09592_2264_c1_4345_5844 | 446 |
| 575 | 3300050509 | nmdc:mga0qj67_10871_c1 | nmdc:mga0qj67_10871_c1_112_1611 | 446 |
| 576 | 3300005330 | Ga0070690_100004054 | Ga0070690_10000405410 | 447 |
| 577 | 3300005330 | Ga0070690_100027300 | Ga0070690_1000273003 | 447 |
| 578 | 3300005334 | Ga0068869_100024040 | Ga0068869_1000240402 | 447 |
| 579 | 3300005335 | Ga0070666_10032453 | Ga0070666_100324532 | 447 |
| 580 | 3300005339 | Ga0070660_100023302 | Ga0070660_1000233025 | 447 |
| 581 | 3300005344 | Ga0070661_100025217 | Ga0070661_1000252175 | 447 |
| 582 | 3300005347 | Ga0070668_100003480 | Ga0070668_1000034809 | 447 |
| 583 | 3300005353 | Ga0070669_100013341 | Ga0070669_1000133415 | 447 |
| 584 | 3300005354 | Ga0070675_100034117 | Ga0070675_1000341174 | 447 |
| 585 | 3300005356 | Ga0070674_100001813 | Ga0070674_1000018135 | 447 |
| 586 | 3300005366 | Ga0070659_100188672 | Ga0070659_1001886721 | 447 |
| 587 | 3300005367 | Ga0070667_100006775 | Ga0070667_1000067758 | 447 |
| 588 | 3300005459 | Ga0068867_100007438 | Ga0068867_1000074385 | 447 |
| 589 | 3300005543 | Ga0070672_100005324 | Ga0070672_1000053246 | 447 |
| 590 | 3300005563 | Ga0068855_100275571 | Ga0068855_1002755711 | 447 |
| 591 | 3300005614 | Ga0068856_100020622 | Ga0068856_1000206223 | 447 |
| 592 | 3300005616 | Ga0068852_100005336 | Ga0068852_1000053367 | 447 |
| 593 | 3300005719 | Ga0068861_100040043 | Ga0068861_1000400432 | 447 |
| 594 | 3300005834 | Ga0068851_10011301 | Ga0068851_100113014 | 447 |
| 595 | 3300005842 | Ga0068858_100002003 | Ga0068858_10000200319 | 447 |
| 596 | 3300005843 | Ga0068860_100005401 | Ga0068860_1000054015 | 447 |
| 597 | 3300005844 | Ga0068862_100101762 | Ga0068862_1001017622 | 447 |
| 598 | 3300006881 | Ga0068865_100004212 | Ga0068865_1000042126 | 447 |
| 599 | 3300009098 | Ga0105245_10037642 | Ga0105245_100376422 | 447 |
| 600 | 3300009148 | Ga0105243_10006470 | Ga0105243_100064707 | 447 |
| 601 | 3300009176 | Ga0105242_10029895 | Ga0105242_100298953 | 447 |
| 602 | 3300009177 | Ga0105248_10103720 | Ga0105248_101037201 | 447 |
| 603 | 3300009553 | Ga0105249_10075709 | Ga0105249_100757092 | 447 |
| 604 | 3300011119 | Ga0105246_10139525 | Ga0105246_101395252 | 447 |
| 605 | 3300013100 | Ga0157373_10051815 | Ga0157373_100518152 | 447 |
| 606 | 3300013102 | Ga0157371_10139560 | Ga0157371_101395602 | 447 |
| 607 | 3300013306 | Ga0163162_10019585 | Ga0163162_100195855 | 447 |
| 608 | 3300013307 | Ga0157372_10011552 | Ga0157372_100115522 | 447 |
| 609 | 3300013308 | Ga0157375_10010413 | Ga0157375_100104135 | 447 |
| 610 | 3300013308 | Ga0157375_10035829 | Ga0157375_100358292 | 447 |
| 611 | 3300013308 | Ga0157375_10060447 | Ga0157375_100604474 | 447 |
| 612 | 3300014968 | Ga0157379_10008058 | Ga0157379_100080582 | 447 |
| 613 | 3300014968 | Ga0157379_10030665 | Ga0157379_100306655 | 447 |
| 614 | 3300014969 | Ga0157376_10177582 | Ga0157376_101775822 | 447 |
| 615 | 3300021361 | Ga0213872_10019666 | Ga0213872_100196662 | 447 |
| 616 | 3300025907 | Ga0207645_10004343 | Ga0207645_100043433 | 447 |
| 617 | 3300025909 | Ga0207705_10027738 | Ga0207705_100277383 | 447 |
| 618 | 3300025919 | Ga0207657_10029766 | Ga0207657_100297661 | 447 |
| 619 | 3300025920 | Ga0207649_10027585 | Ga0207649_100275852 | 447 |
| 620 | 3300025923 | Ga0207681_10001008 | Ga0207681_100010082 | 447 |
| 621 | 3300025924 | Ga0207694_10034410 | Ga0207694_100344103 | 447 |
| 622 | 3300025926 | Ga0207659_10040934 | Ga0207659_100409343 | 447 |
| 623 | 3300025934 | Ga0207686_10014698 | Ga0207686_100146982 | 447 |
| 624 | 3300025934 | Ga0207686_10103781 | Ga0207686_101037811 | 447 |
| 625 | 3300025935 | Ga0207709_10007539 | Ga0207709_100075394 | 447 |
| 626 | 3300025937 | Ga0207669_10005642 | Ga0207669_100056424 | 447 |
| 627 | 3300025938 | Ga0207704_10040842 | Ga0207704_100408422 | 447 |
| 628 | 3300025939 | Ga0207665_10069689 | Ga0207665_100696892 | 447 |
| 629 | 3300025940 | Ga0207691_10009917 | Ga0207691_100099177 | 447 |
| 630 | 3300025942 | Ga0207689_10003961 | Ga0207689_100039619 | 447 |
| 631 | 3300025942 | Ga0207689_10070714 | Ga0207689_100707142 | 447 |
| 632 | 3300025944 | Ga0207661_10012579 | Ga0207661_100125792 | 447 |
| 633 | 3300025945 | Ga0207679_10050636 | Ga0207679_100506362 | 447 |
| 634 | 3300025960 | Ga0207651_10040524 | Ga0207651_100405242 | 447 |
| 635 | 3300025961 | Ga0207712_10013724 | Ga0207712_100137243 | 447 |
| 636 | 3300025972 | Ga0207668_10013756 | Ga0207668_100137563 | 447 |
| 637 | 3300025986 | Ga0207658_10028406 | Ga0207658_100284064 | 447 |
| 638 | 3300026023 | Ga0207677_10055029 | Ga0207677_100550292 | 447 |
| 639 | 3300026035 | Ga0207703_10065459 | Ga0207703_100654592 | 447 |
| 640 | 3300026088 | Ga0207641_10032121 | Ga0207641_100321212 | 447 |
| 641 | 3300026089 | Ga0207648_10010452 | Ga0207648_100104524 | 447 |
| 642 | 3300026118 | Ga0207675_100042444 | Ga0207675_1000424441 | 447 |
| 643 | 3300026118 | Ga0207675_100058322 | Ga0207675_1000583222 | 447 |
| 644 | 3300028380 | Ga0268265_10158359 | Ga0268265_101583592 | 447 |
| 645 | 3300028381 | Ga0268264_10010530 | Ga0268264_100105306 | 447 |
| 646 | 3300031456 | Ga0307513_10075354 | Ga0307513_100753542 | 447 |
| 647 | 3300036401 | Ga0373937_0090530 | Ga0373937_0090530_697_2085 | 447 |
| 648 | 3300037068 | Ga0373925_0048624 | Ga0373925_0048624_935_2323 | 447 |
| 649 | 3300039447 | Ga0436361_0028732 | Ga0436361_0028732_1106_2578 | 447 |
| 650 | 3300042876 | Ga0451577_0024419 | Ga0451577_0024419_947_2356 | 447 |
| 651 | 3300045051 | Ga0451576_0024150 | Ga0451576_0024150_4854_6293 | 447 |
| 652 | 3300046472 | Ga0495580_0111528 | Ga0495580_0111528_383_1771 | 447 |
| 653 | 3300047319 | Ga0495674_0197156 | Ga0495674_0197156_243_1631 | 447 |
| 654 | 3300047471 | Ga0495684_0038701 | Ga0495684_0038701_1227_2615 | 447 |
| 655 | 3300048907 | Ga0496104_0106928 | Ga0496104_0106928_506_1897 | 447 |
| 656 | 3300048908 | Ga0496105_0039421 | Ga0496105_0039421_1400_2791 | 447 |
| 657 | 3300053077 | Ga0495601_0023250 | Ga0495601_0023250_1632_3020 | 447 |
| 658 | 3300053085 | Ga0495619_0022578 | Ga0495619_0022578_2547_3935 | 447 |
| 659 | 3300053138 | Ga0500564_025252 | Ga0500564_025252_456_1907 | 447 |
| 660 | 3300053148 | Ga0500590_035532 | Ga0500590_035532_495_1943 | 447 |
| 661 | 3300053177 | Ga0500636_0022800 | Ga0500636_0022800_68_1468 | 447 |
| 662 | 3300021361 | Ga0213872_10000007 | Ga0213872_100000074 | 448 |
| 663 | 3300039447 | Ga0436361_0504982 | Ga0436361_0504982_48265_49671 | 448 |
| 664 | 3300028794 | Ga0307515_10073207 | Ga0307515_100732072 | 449 |
| 665 | 3300049128 | Ga0501308_000901 | Ga0501308_000901_227_1633 | 449 |
| 666 | 3300049160 | Ga0501304_000399 | Ga0501304_000399_227_1633 | 449 |
| 667 | 3300009093 | Ga0105240_10199500 | Ga0105240_101995001 | 450 |
| 668 | 3300025242 | Ga0209258_103479 | Ga0209258_1034793 | 450 |
| 669 | 3300025913 | Ga0207695_10034025 | Ga0207695_100340256 | 450 |
| 670 | 3300031730 | Ga0307516_10000054 | Ga0307516_1000005424 | 450 |
| 671 | 3300002705 | JGI25156J39149_1002558 | JGI25156J39149_10025587 | 451 |
| 672 | 3300002738 | JGI25154J39366_1004695 | JGI25154J39366_10046952 | 451 |
| 673 | 3300002741 | JGI25157J39369_1000267 | JGI25157J39369_100026729 | 451 |
| 674 | 3300003323 | rootH1_10060360 | rootH1_100603602 | 451 |
| 675 | 3300003752 | Ga0055539_1000550 | Ga0055539_10005507 | 451 |
| 676 | 3300003752 | Ga0055539_1001108 | Ga0055539_10011084 | 451 |
| 677 | 3300003756 | Ga0055533_1000045 | Ga0055533_1000045100 | 451 |
| 678 | 3300003759 | Ga0055525_1000632 | Ga0055525_10006328 | 451 |
| 679 | 3300003761 | Ga0055535_1000047 | Ga0055535_100004721 | 451 |
| 680 | 3300003763 | Ga0055529_1000148 | Ga0055529_100014831 | 451 |
| 681 | 3300003792 | Ga0055540_1006264 | Ga0055540_10062644 | 451 |
| 682 | 3300005339 | Ga0070660_100015360 | Ga0070660_1000153606 | 451 |
| 683 | 3300005364 | Ga0070673_100015757 | Ga0070673_1000157576 | 451 |
| 684 | 3300005366 | Ga0070659_100164693 | Ga0070659_1001646931 | 451 |
| 685 | 3300005366 | Ga0070659_100195089 | Ga0070659_1001950891 | 451 |
| 686 | 3300005563 | Ga0068855_100069769 | Ga0068855_1000697693 | 451 |
| 687 | 3300005577 | Ga0068857_100056953 | Ga0068857_1000569533 | 451 |
| 688 | 3300005578 | Ga0068854_100006801 | Ga0068854_1000068018 | 451 |
| 689 | 3300005614 | Ga0068856_100001716 | Ga0068856_1000017167 | 451 |
| 690 | 3300006195 | Ga0075366_10009487 | Ga0075366_100094874 | 451 |
| 691 | 3300009148 | Ga0105243_10020659 | Ga0105243_100206592 | 451 |
| 692 | 3300009148 | Ga0105243_10298387 | Ga0105243_102983871 | 451 |
| 693 | 3300009545 | Ga0105237_10055655 | Ga0105237_100556552 | 451 |
| 694 | 3300013105 | Ga0157369_10051064 | Ga0157369_100510645 | 451 |
| 695 | 3300025226 | Ga0209674_100073 | Ga0209674_100073100 | 451 |
| 696 | 3300025230 | Ga0209563_100061 | Ga0209563_100061130 | 451 |
| 697 | 3300025242 | Ga0209258_100072 | Ga0209258_100072246 | 451 |
| 698 | 3300025246 | Ga0209646_1000076 | Ga0209646_1000076171 | 451 |
| 699 | 3300025250 | Ga0209026_1000011 | Ga0209026_1000011355 | 451 |
| 700 | 3300025253 | Ga0209677_100070 | Ga0209677_10007045 | 451 |
| 701 | 3300025253 | Ga0209677_100751 | Ga0209677_1007513 | 451 |
| 702 | 3300025253 | Ga0209677_105485 | Ga0209677_1054852 | 451 |
| 703 | 3300025254 | Ga0209148_1002371 | Ga0209148_10023718 | 451 |
| 704 | 3300025256 | Ga0209759_1000034 | Ga0209759_1000034121 | 451 |
| 705 | 3300025256 | Ga0209759_1001263 | Ga0209759_100126317 | 451 |
| 706 | 3300025256 | Ga0209759_1001427 | Ga0209759_100142715 | 451 |
| 707 | 3300025272 | Ga0209455_1000053 | Ga0209455_1000053326 | 451 |
| 708 | 3300025303 | Ga0209051_1004626 | Ga0209051_10046266 | 451 |
| 709 | 3300025909 | Ga0207705_10050908 | Ga0207705_100509082 | 451 |
| 710 | 3300025919 | Ga0207657_10018081 | Ga0207657_100180818 | 451 |
| 711 | 3300025935 | Ga0207709_10012409 | Ga0207709_100124093 | 451 |
| 712 | 3300025949 | Ga0207667_10051160 | Ga0207667_100511602 | 451 |
| 713 | 3300025960 | Ga0207651_10008453 | Ga0207651_100084532 | 451 |
| 714 | 3300025981 | Ga0207640_10012952 | Ga0207640_100129523 | 451 |
| 715 | 3300026078 | Ga0207702_10001565 | Ga0207702_1000156522 | 451 |
| 716 | 3300026142 | Ga0207698_10142335 | Ga0207698_101423352 | 451 |
| 717 | 3300028666 | Ga0265336_10000036 | Ga0265336_1000003634 | 451 |
| 718 | 3300029957 | Ga0265324_10000136 | Ga0265324_1000013647 | 451 |
| 719 | 3300031730 | Ga0307516_10001961 | Ga0307516_100019614 | 451 |
| 720 | 3300038443 | Ga0395901_0072660 | Ga0395901_0072660_2117_3517 | 451 |
| 721 | 3300044656 | Ga0466969_0067627 | Ga0466969_0067627_197_1606 | 451 |
| 722 | 3300044683 | Ga0466965_0035916 | Ga0466965_0035916_166_1575 | 451 |
| 723 | 3300044684 | Ga0466966_0011921 | Ga0466966_0011921_4249_5658 | 451 |
| 724 | 3300044693 | Ga0466961_0147994 | Ga0466961_0147994_23_1432 | 451 |
| 725 | 3300044694 | Ga0466963_0086305 | Ga0466963_0086305_510_1910 | 451 |
| 726 | 3300045836 | Ga0466958_0066533 | Ga0466958_0066533_493_1902 | 451 |
| 727 | 3300046492 | Ga0495585_0043320 | Ga0495585_0043320_534_1940 | 451 |
| 728 | 3300047472 | Ga0495686_0080121 | Ga0495686_0080121_552_1952 | 451 |
| 729 | 3300053080 | Ga0500635_0000030 | Ga0500635_0000030_15824_17224 | 451 |
| 730 | 3300053119 | Ga0500595_018156 | Ga0500595_018156_679_2079 | 451 |
| 731 | 3300055283 | Ga0500661_003126 | Ga0500661_003126_652_2124 | 451 |
| 732 | 3300061719 | Ga0466962_0002224 | Ga0466962_0002224_200_1609 | 451 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4bh5-assembly4.cif.gz_D | lytm domain of envc, an activator of cell wall amidases in escherichia coli | 0.9574 | 311 | 406 |
| 4zyb-assembly3.cif.gz_C | high resolution structure of m23 peptidase lytm with substrate analogue | 0.9339 | 312 | 412 |
| 4qpb-assembly1.cif.gz_A | catalytic domain of the antimicrobial peptidase lysostaphin from staphylococcus simulans crystallized in the absence of phosphate | 0.9123 | 312 | 412 |
| 6tpi-assembly1.cif.gz_A | envc bound to the ftsx periplasmic domain | 0.8863 | 301 | 410 |
| 8tzl-assembly1.cif.gz_E | cryo-em structure of vibrio cholerae ftse/ftsx/envc complex, full-length | 0.8627 | 277 | 406 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4bh5D00 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9574 | 311 | 406 | 2.70.70.10 |
| af_O33599_157_316_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9548 | 311 | 409 | 2.70.70.10 |
| 1qwyA02 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.953 | 311 | 409 | 2.70.70.10 |
| 4zybC00 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9339 | 312 | 412 | 2.70.70.10 |
| 3sluA02 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9247 | 172 | 280 | 3.10.450.350 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S6U331-F1-model_v4 | Peptidase M23 domain-containing protein | 0.984 | 311 | 406 |
GO:0004222
|
| AF-A0A1V2ZHL6-F1-model_v4 | Peptidase M23 domain-containing protein | 0.9788 | 313 | 405 |
GO:0004222
|
| AF-A0A357N2G3-F1-model_v4 | Peptidase M23 | 0.9773 | 331 | 406 |
GO:0004222
|
| AF-A0A0G1P2M8-F1-model_v4 | Peptidase M23 | 0.9752 | 332 | 406 |
GO:0004222
|
| AF-A0A521UA26-F1-model_v4 | M23 family metallopeptidase | 0.9744 | 312 | 409 |
GO:0004222
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar