F477888
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 729 | 371 | 675 | 61 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0141497|Ga0501033_0141497_267_470 |
| Length | 67 |
| Sequence | MAVQDSKKSRAKRGHRHAHWKNKATAPALSTDPTSGETHRRHHVTADGFYRGKKVIDTSPAAADAGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 2 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 3 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 4 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 5 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 6 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 7 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 8 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 9 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 10 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 11 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 12 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 13 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 14 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 15 | 2648501241 | Vibrio splendidus UCD-SED7 | Isolate | Rhizosphere |
| 16 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 17 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 18 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 19 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 20 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 21 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 22 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 23 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 24 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 25 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 26 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 27 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 28 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 29 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 30 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 31 | 2881714928 | Pseudidiomarina mangrovi ZQ330 | Isolate | Rhizosphere |
| 32 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 33 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 34 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 35 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 36 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 37 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 38 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 39 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 40 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 41 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 42 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 43 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 44 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 45 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 46 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 47 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 48 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 49 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 50 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 51 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 52 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 53 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 54 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 55 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 59 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 61 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 62 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 63 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 64 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 71 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 75 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 86 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 99 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 102 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 105 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 107 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 113 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 114 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 115 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 116 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 118 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 119 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 120 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 121 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 122 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 123 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 124 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 125 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 126 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 127 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 128 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 131 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 132 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 133 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 134 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 136 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 137 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 149 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 150 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 151 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 152 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 153 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 154 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 155 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 156 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 169 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 170 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 171 | 3300023438 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc | Metatranscriptome | Rhizosphere |
| 172 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 177 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 180 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 238 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 240 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 241 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 242 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 243 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 244 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 245 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 246 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 247 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 248 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 249 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 250 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 251 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 252 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 253 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 259 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 260 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 262 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 264 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 265 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 269 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 270 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 271 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 272 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 273 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 274 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 275 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 276 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 277 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 278 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 279 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 280 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 281 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 282 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 283 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 284 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 286 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 287 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 288 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 289 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 290 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 291 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 292 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 293 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 294 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 295 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 296 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 297 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 298 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 299 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 300 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 301 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 302 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 303 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 304 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 312 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 313 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 314 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 315 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 316 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 317 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 318 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 327 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 328 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 329 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 330 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 331 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 332 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 333 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 365 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 366 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 367 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 368 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 369 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 370 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 371 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.09 |
| Metatranscriptomes | 8.5 |
| Isolates | 7.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.39 |
| Nodule | 0.41 |
| Rhizoplane | 0.82 |
| Rhizosphere | 82.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1002391 | 3300002705 | Bacteria | 6781 |
| 2 | JGI25156J39149_1004783 | 3300002705 | Bacteria | 4047 |
| 3 | JGI25157J39369_1002228 | 3300002741 | Bacteria | 5270 |
| 4 | JGI25151J46595_10036365 | 3300003187 | Bacteria | 1858 |
| 5 | rootH2_10058115 | 3300003320 | Bacteria | 11775 |
| 6 | Ga0055539_1000930 | 3300003752 | Bacteria | 6538 |
| 7 | Ga0055533_1000474 | 3300003756 | Bacteria | 15083 |
| 8 | Ga0055525_1000097 | 3300003759 | Bacteria | 137371 |
| 9 | Ga0055527_1000198 | 3300003760 | Bacteria | 39703 |
| 10 | Ga0055527_1000344 | 3300003760 | Bacteria | 23312 |
| 11 | Ga0055527_1000513 | 3300003760 | Bacteria | 13411 |
| 12 | Ga0055535_1000795 | 3300003761 | Bacteria | 22979 |
| 13 | Ga0055535_1003536 | 3300003761 | Bacteria | 4348 |
| 14 | Ga0055542_1000441 | 3300003762 | Bacteria | 39703 |
| 15 | Ga0055542_1003400 | 3300003762 | Bacteria | 4332 |
| 16 | Ga0055529_1000591 | 3300003763 | Bacteria | 28451 |
| 17 | Ga0055529_1001024 | 3300003763 | Bacteria | 13373 |
| 18 | Ga0055531_10003401 | 3300003794 | Bacteria | 10167 |
| 19 | Ga0058692_1000017 | 3300003856 | Bacteria | 274459 |
| 20 | Ga0058859_11722583 | 3300004798 | Bacteria | 753 |
| 21 | Ga0058859_11813743 | 3300004798 | Bacteria | 781 |
| 22 | Ga0065703_1024523 | 3300005272 | Bacteria | 594 |
| 23 | Ga0065704_10072102 | 3300005289 | Bacteria | 9161 |
| 24 | Ga0065704_10082305 | 3300005289 | Bacteria | 3622 |
| 25 | Ga0065715_10078237 | 3300005293 | Bacteria | 596 |
| 26 | Ga0065715_11011924 | 3300005293 | Bacteria | 542 |
| 27 | Ga0070676_10025259 | 3300005328 | Bacteria | 3355 |
| 28 | Ga0070676_10474453 | 3300005328 | Bacteria | 884 |
| 29 | Ga0070683_100554473 | 3300005329 | Bacteria | 1099 |
| 30 | Ga0070683_101826633 | 3300005329 | Bacteria | 584 |
| 31 | Ga0070690_100000845 | 3300005330 | Bacteria | 15537 |
| 32 | Ga0070670_100000001 | 3300005331 | Bacteria | 728788 |
| 33 | Ga0070670_100161863 | 3300005331 | Bacteria | 1939 |
| 34 | Ga0070670_100598518 | 3300005331 | Bacteria | 986 |
| 35 | Ga0070670_101439520 | 3300005331 | Bacteria | 632 |
| 36 | Ga0070670_101644392 | 3300005331 | Bacteria | 591 |
| 37 | Ga0070677_10763524 | 3300005333 | Bacteria | 549 |
| 38 | Ga0068869_100002558 | 3300005334 | Bacteria | 10978 |
| 39 | Ga0068869_100004697 | 3300005334 | Bacteria | 8524 |
| 40 | Ga0068869_100017947 | 3300005334 | Bacteria | 4809 |
| 41 | Ga0068869_100384401 | 3300005334 | Bacteria | 1151 |
| 42 | Ga0068869_100727978 | 3300005334 | Bacteria | 848 |
| 43 | Ga0068869_101240323 | 3300005334 | Bacteria | 656 |
| 44 | Ga0070666_10015694 | 3300005335 | Bacteria | 4834 |
| 45 | Ga0070666_10212849 | 3300005335 | Bacteria | 1362 |
| 46 | Ga0070666_10538517 | 3300005335 | Bacteria | 849 |
| 47 | Ga0070680_100300083 | 3300005336 | Bacteria | 1362 |
| 48 | Ga0070680_100359947 | 3300005336 | Bacteria | 1237 |
| 49 | Ga0070682_101194433 | 3300005337 | Bacteria | 642 |
| 50 | Ga0070682_101753694 | 3300005337 | Bacteria | 540 |
| 51 | Ga0068868_100015146 | 3300005338 | Bacteria | 5697 |
| 52 | Ga0068868_100373544 | 3300005338 | Bacteria | 1225 |
| 53 | Ga0070689_100004467 | 3300005340 | Bacteria | 9455 |
| 54 | Ga0070689_100287396 | 3300005340 | Bacteria | 1366 |
| 55 | Ga0070689_101148206 | 3300005340 | Bacteria | 696 |
| 56 | Ga0070691_10143528 | 3300005341 | Bacteria | 1219 |
| 57 | Ga0070687_100322499 | 3300005343 | Bacteria | 987 |
| 58 | Ga0070687_100455327 | 3300005343 | Bacteria | 852 |
| 59 | Ga0070687_101047543 | 3300005343 | Unclassified | 594 |
| 60 | Ga0070692_10006900 | 3300005345 | Bacteria | 4963 |
| 61 | Ga0070668_100044400 | 3300005347 | Bacteria | 3410 |
| 62 | Ga0070668_100702951 | 3300005347 | Bacteria | 892 |
| 63 | Ga0070668_100907594 | 3300005347 | Bacteria | 788 |
| 64 | Ga0070668_101473393 | 3300005347 | Bacteria | 622 |
| 65 | Ga0070668_101765648 | 3300005347 | Bacteria | 569 |
| 66 | Ga0070669_100002161 | 3300005353 | Bacteria | 14223 |
| 67 | Ga0070669_100054718 | 3300005353 | Bacteria | 2923 |
| 68 | Ga0070669_100562965 | 3300005353 | Bacteria | 951 |
| 69 | Ga0070675_100076871 | 3300005354 | Bacteria | 2778 |
| 70 | Ga0070675_100276957 | 3300005354 | Bacteria | 1473 |
| 71 | Ga0070675_100540719 | 3300005354 | Bacteria | 1053 |
| 72 | Ga0070671_100000018 | 3300005355 | Bacteria | 147427 |
| 73 | Ga0070671_100122199 | 3300005355 | Bacteria | 2191 |
| 74 | Ga0070671_100739016 | 3300005355 | Bacteria | 855 |
| 75 | Ga0070674_100107450 | 3300005356 | Bacteria | 2043 |
| 76 | Ga0070674_100285205 | 3300005356 | Bacteria | 1310 |
| 77 | Ga0070674_100450220 | 3300005356 | Bacteria | 1062 |
| 78 | Ga0070674_100689548 | 3300005356 | Bacteria | 872 |
| 79 | Ga0070673_100031734 | 3300005364 | Bacteria | 3968 |
| 80 | Ga0070673_100459992 | 3300005364 | Bacteria | 1146 |
| 81 | Ga0070673_102142887 | 3300005364 | Bacteria | 531 |
| 82 | Ga0070688_100004521 | 3300005365 | Bacteria | 7253 |
| 83 | Ga0070688_100034596 | 3300005365 | Bacteria | 3062 |
| 84 | Ga0070667_100000026 | 3300005367 | Bacteria | 183244 |
| 85 | Ga0070667_100166193 | 3300005367 | Bacteria | 1946 |
| 86 | Ga0070667_100269306 | 3300005367 | Bacteria | 1527 |
| 87 | Ga0070667_100506787 | 3300005367 | Bacteria | 1107 |
| 88 | Ga0070667_100630074 | 3300005367 | Unclassified | 989 |
| 89 | Ga0070667_100683693 | 3300005367 | Bacteria | 949 |
| 90 | Ga0070709_11337362 | 3300005434 | Bacteria | 579 |
| 91 | Ga0070714_100003562 | 3300005435 | Bacteria | 11639 |
| 92 | Ga0070714_100868554 | 3300005435 | Bacteria | 875 |
| 93 | Ga0070701_10002994 | 3300005438 | Bacteria | 6610 |
| 94 | Ga0070701_10194129 | 3300005438 | Bacteria | 1196 |
| 95 | Ga0070701_11400941 | 3300005438 | Bacteria | 503 |
| 96 | Ga0070711_100121481 | 3300005439 | Bacteria | 1932 |
| 97 | Ga0070705_100040767 | 3300005440 | Bacteria | 2643 |
| 98 | Ga0070705_100489570 | 3300005440 | Unclassified | 931 |
| 99 | Ga0070700_100003802 | 3300005441 | Bacteria | 7820 |
| 100 | Ga0070694_100007985 | 3300005444 | Bacteria | 6468 |
| 101 | Ga0070694_100621039 | 3300005444 | Bacteria | 872 |
| 102 | Ga0070663_101850146 | 3300005455 | Bacteria | 542 |
| 103 | Ga0070678_100016566 | 3300005456 | Bacteria | 4720 |
| 104 | Ga0070678_100039342 | 3300005456 | Bacteria | 3335 |
| 105 | Ga0070678_100317971 | 3300005456 | Bacteria | 1328 |
| 106 | Ga0070678_100359450 | 3300005456 | Bacteria | 1254 |
| 107 | Ga0070678_100894115 | 3300005456 | Bacteria | 811 |
| 108 | Ga0070678_102242385 | 3300005456 | Bacteria | 518 |
| 109 | Ga0070662_100316250 | 3300005457 | Bacteria | 1272 |
| 110 | Ga0070662_101583941 | 3300005457 | Bacteria | 565 |
| 111 | Ga0070681_10608043 | 3300005458 | Bacteria | 1008 |
| 112 | Ga0068867_100012057 | 3300005459 | Bacteria | 6106 |
| 113 | Ga0068867_100025912 | 3300005459 | Bacteria | 4206 |
| 114 | Ga0068867_100146165 | 3300005459 | Bacteria | 1853 |
| 115 | Ga0068867_100299989 | 3300005459 | Bacteria | 1324 |
| 116 | Ga0068867_100896092 | 3300005459 | Bacteria | 798 |
| 117 | Ga0070685_10000007 | 3300005466 | Bacteria | 180539 |
| 118 | Ga0070685_10038655 | 3300005466 | Bacteria | 2707 |
| 119 | Ga0070699_100058688 | 3300005518 | Bacteria | 3334 |
| 120 | Ga0070699_100139643 | 3300005518 | Bacteria | 2139 |
| 121 | Ga0070679_101574454 | 3300005530 | Bacteria | 605 |
| 122 | Ga0070684_100963664 | 3300005535 | Bacteria | 800 |
| 123 | Ga0070697_100003415 | 3300005536 | Bacteria | 12210 |
| 124 | Ga0070697_102033512 | 3300005536 | Bacteria | 514 |
| 125 | Ga0068853_100107025 | 3300005539 | Bacteria | 2479 |
| 126 | Ga0068853_100401752 | 3300005539 | Bacteria | 1282 |
| 127 | Ga0068853_100490573 | 3300005539 | Bacteria | 1159 |
| 128 | Ga0070672_100036695 | 3300005543 | Bacteria | 3735 |
| 129 | Ga0070672_100305242 | 3300005543 | Bacteria | 1350 |
| 130 | Ga0070686_100001455 | 3300005544 | Bacteria | 13358 |
| 131 | Ga0070686_100162223 | 3300005544 | Bacteria | 1575 |
| 132 | Ga0070686_101292276 | 3300005544 | Bacteria | 609 |
| 133 | Ga0070695_100105939 | 3300005545 | Bacteria | 1901 |
| 134 | Ga0070696_100013458 | 3300005546 | Bacteria | 5489 |
| 135 | Ga0070693_100018924 | 3300005547 | Bacteria | 3603 |
| 136 | Ga0070693_100022625 | 3300005547 | Bacteria | 3345 |
| 137 | Ga0070693_100130569 | 3300005547 | Bacteria | 1570 |
| 138 | Ga0070665_100013638 | 3300005548 | Bacteria | 8175 |
| 139 | Ga0070665_100057794 | 3300005548 | Bacteria | 3889 |
| 140 | Ga0070665_100112949 | 3300005548 | Bacteria | 2719 |
| 141 | Ga0070665_100230673 | 3300005548 | Bacteria | 1851 |
| 142 | Ga0070665_100319643 | 3300005548 | Bacteria | 1556 |
| 143 | Ga0070665_101040540 | 3300005548 | Bacteria | 831 |
| 144 | Ga0070665_101734318 | 3300005548 | Bacteria | 631 |
| 145 | Ga0070704_100032448 | 3300005549 | Bacteria | 3523 |
| 146 | Ga0070704_101600249 | 3300005549 | Unclassified | 601 |
| 147 | Ga0070704_101994868 | 3300005549 | Bacteria | 538 |
| 148 | Ga0068855_102330383 | 3300005563 | Bacteria | 535 |
| 149 | Ga0068857_100469001 | 3300005577 | Bacteria | 1179 |
| 150 | Ga0068857_101505174 | 3300005577 | Bacteria | 656 |
| 151 | Ga0068857_101882781 | 3300005577 | Bacteria | 586 |
| 152 | Ga0068857_102202928 | 3300005577 | Unclassified | 541 |
| 153 | Ga0068854_101133922 | 3300005578 | Bacteria | 698 |
| 154 | Ga0068854_101304923 | 3300005578 | Unclassified | 653 |
| 155 | Ga0068856_100012880 | 3300005614 | Bacteria | 8095 |
| 156 | Ga0068856_100013948 | 3300005614 | Bacteria | 7770 |
| 157 | Ga0068856_100017128 | 3300005614 | Bacteria | 7024 |
| 158 | Ga0070702_100001220 | 3300005615 | Bacteria | 10400 |
| 159 | Ga0070702_100133509 | 3300005615 | Bacteria | 1571 |
| 160 | Ga0070702_100639653 | 3300005615 | Bacteria | 803 |
| 161 | Ga0070702_101811126 | 3300005615 | Bacteria | 510 |
| 162 | Ga0068852_100404198 | 3300005616 | Bacteria | 1344 |
| 163 | Ga0068852_102523817 | 3300005616 | Bacteria | 534 |
| 164 | Ga0068859_100007685 | 3300005617 | Bacteria | 10950 |
| 165 | Ga0068859_100017029 | 3300005617 | Bacteria | 7296 |
| 166 | Ga0068859_100061758 | 3300005617 | Bacteria | 3776 |
| 167 | Ga0068859_100083014 | 3300005617 | Bacteria | 3246 |
| 168 | Ga0068859_100163932 | 3300005617 | Bacteria | 2302 |
| 169 | Ga0068864_100000012 | 3300005618 | Bacteria | 335070 |
| 170 | Ga0068864_100126667 | 3300005618 | Unclassified | 2289 |
| 171 | Ga0068864_100145020 | 3300005618 | Bacteria | 2145 |
| 172 | Ga0068866_10000235 | 3300005718 | Bacteria | 26083 |
| 173 | Ga0068866_10078039 | 3300005718 | Bacteria | 1771 |
| 174 | Ga0068866_10151511 | 3300005718 | Bacteria | 1343 |
| 175 | Ga0068866_10336904 | 3300005718 | Bacteria | 954 |
| 176 | Ga0068861_100006760 | 3300005719 | Bacteria | 7837 |
| 177 | Ga0068861_100199308 | 3300005719 | Bacteria | 1679 |
| 178 | Ga0068861_100511226 | 3300005719 | Bacteria | 1088 |
| 179 | Ga0068861_101732754 | 3300005719 | Bacteria | 618 |
| 180 | Ga0068851_10436210 | 3300005834 | Bacteria | 776 |
| 181 | Ga0068851_10453043 | 3300005834 | Bacteria | 763 |
| 182 | Ga0068851_10553829 | 3300005834 | Bacteria | 695 |
| 183 | Ga0068870_10165818 | 3300005840 | Bacteria | 1314 |
| 184 | Ga0068870_10271776 | 3300005840 | Bacteria | 1059 |
| 185 | Ga0068870_10778535 | 3300005840 | Bacteria | 667 |
| 186 | Ga0068863_100256127 | 3300005841 | Bacteria | 1691 |
| 187 | Ga0068863_100292140 | 3300005841 | Bacteria | 1580 |
| 188 | Ga0068863_100484640 | 3300005841 | Bacteria | 1216 |
| 189 | Ga0068858_100002549 | 3300005842 | Bacteria | 18376 |
| 190 | Ga0068858_100016226 | 3300005842 | Bacteria | 6997 |
| 191 | Ga0068858_100204401 | 3300005842 | Bacteria | 1868 |
| 192 | Ga0068860_100007326 | 3300005843 | Bacteria | 11028 |
| 193 | Ga0068860_100007832 | 3300005843 | Bacteria | 10665 |
| 194 | Ga0068860_100009873 | 3300005843 | Bacteria | 9463 |
| 195 | Ga0068860_100436870 | 3300005843 | Bacteria | 1300 |
| 196 | Ga0068860_101628041 | 3300005843 | Bacteria | 667 |
| 197 | Ga0068862_100001146 | 3300005844 | Bacteria | 25101 |
| 198 | Ga0068862_100005397 | 3300005844 | Bacteria | 10689 |
| 199 | Ga0068862_100201685 | 3300005844 | Bacteria | 1794 |
| 200 | Ga0068862_100529938 | 3300005844 | Bacteria | 1122 |
| 201 | Ga0070715_10512399 | 3300006163 | Bacteria | 689 |
| 202 | Ga0097621_100002412 | 3300006237 | Bacteria | 12795 |
| 203 | Ga0097621_100004460 | 3300006237 | Bacteria | 9751 |
| 204 | Ga0097621_100021221 | 3300006237 | Bacteria | 5019 |
| 205 | Ga0097621_100079713 | 3300006237 | Bacteria | 2722 |
| 206 | Ga0097621_101609756 | 3300006237 | Bacteria | 617 |
| 207 | Ga0068871_100001034 | 3300006358 | Bacteria | 18634 |
| 208 | Ga0068871_100004954 | 3300006358 | Bacteria | 9303 |
| 209 | Ga0068871_100055319 | 3300006358 | Bacteria | 3221 |
| 210 | Ga0068871_100060853 | 3300006358 | Bacteria | 3081 |
| 211 | Ga0068871_100675654 | 3300006358 | Bacteria | 944 |
| 212 | Ga0075428_102214397 | 3300006844 | Bacteria | 567 |
| 213 | Ga0075434_100468902 | 3300006871 | Bacteria | 1280 |
| 214 | Ga0068865_100000229 | 3300006881 | Bacteria | 31243 |
| 215 | Ga0068865_100002785 | 3300006881 | Bacteria | 10385 |
| 216 | Ga0068865_100015225 | 3300006881 | Bacteria | 4902 |
| 217 | Ga0068865_100081427 | 3300006881 | Bacteria | 2325 |
| 218 | Ga0068865_100135329 | 3300006881 | Bacteria | 1851 |
| 219 | Ga0068865_100283874 | 3300006881 | Bacteria | 1319 |
| 220 | Ga0068865_100494921 | 3300006881 | Bacteria | 1018 |
| 221 | Ga0097620_100007685 | 3300006931 | Bacteria | 10950 |
| 222 | Ga0097620_100017029 | 3300006931 | Bacteria | 7296 |
| 223 | Ga0097620_100061758 | 3300006931 | Bacteria | 3776 |
| 224 | Ga0097620_100083015 | 3300006931 | Bacteria | 3246 |
| 225 | Ga0097620_100163932 | 3300006931 | Bacteria | 2302 |
| 226 | Ga0079104_1027215 | 3300006946 | Bacteria | 1468 |
| 227 | Ga0099794_10046640 | 3300007265 | Bacteria | 2076 |
| 228 | Ga0105240_10029653 | 3300009093 | Bacteria | 7122 |
| 229 | Ga0105240_11905248 | 3300009093 | Bacteria | 618 |
| 230 | Ga0105245_10000613 | 3300009098 | Bacteria | 32290 |
| 231 | Ga0105245_10050419 | 3300009098 | Bacteria | 3731 |
| 232 | Ga0105245_10449010 | 3300009098 | Bacteria | 1297 |
| 233 | Ga0105247_10047349 | 3300009101 | Bacteria | 2640 |
| 234 | Ga0105247_10527103 | 3300009101 | Bacteria | 865 |
| 235 | Ga0105243_10004808 | 3300009148 | Bacteria | 10615 |
| 236 | Ga0105243_10235256 | 3300009148 | Bacteria | 1627 |
| 237 | Ga0105242_10000678 | 3300009176 | Bacteria | 26735 |
| 238 | Ga0105242_10151229 | 3300009176 | Bacteria | 2024 |
| 239 | Ga0105242_11900004 | 3300009176 | Bacteria | 636 |
| 240 | Ga0105248_10007225 | 3300009177 | Bacteria | 12184 |
| 241 | Ga0105248_10075331 | 3300009177 | Bacteria | 3793 |
| 242 | Ga0105248_10189091 | 3300009177 | Bacteria | 2320 |
| 243 | Ga0105237_10533031 | 3300009545 | Bacteria | 1181 |
| 244 | Ga0105237_10770502 | 3300009545 | Bacteria | 969 |
| 245 | Ga0105237_10902234 | 3300009545 | Unclassified | 891 |
| 246 | Ga0105238_11528537 | 3300009551 | Bacteria | 697 |
| 247 | Ga0105249_10089678 | 3300009553 | Bacteria | 2874 |
| 248 | Ga0105249_12371493 | 3300009553 | Bacteria | 603 |
| 249 | Ga0105239_10012321 | 3300010375 | Bacteria | 9522 |
| 250 | Ga0105239_10117512 | 3300010375 | Bacteria | 2951 |
| 251 | Ga0105246_10301499 | 3300011119 | Bacteria | 1294 |
| 252 | Ga0105246_10441943 | 3300011119 | Bacteria | 1091 |
| 253 | Ga0157328_1003518 | 3300012478 | Bacteria | 822 |
| 254 | Ga0157325_1008442 | 3300012485 | Bacteria | 715 |
| 255 | Ga0157343_1006429 | 3300012488 | Bacteria | 792 |
| 256 | Ga0157319_1023389 | 3300012497 | Bacteria | 618 |
| 257 | Ga0157345_1006098 | 3300012498 | Bacteria | 951 |
| 258 | Ga0157314_1009914 | 3300012500 | Bacteria | 814 |
| 259 | Ga0157316_1025939 | 3300012510 | Bacteria | 677 |
| 260 | Ga0157316_1062919 | 3300012510 | Bacteria | 542 |
| 261 | Ga0157327_1006828 | 3300012512 | Bacteria | 975 |
| 262 | Ga0157373_10825838 | 3300013100 | Bacteria | 684 |
| 263 | Ga0157370_11208342 | 3300013104 | Bacteria | 682 |
| 264 | Ga0157369_11680401 | 3300013105 | Bacteria | 645 |
| 265 | Ga0157374_10174704 | 3300013296 | Bacteria | 2097 |
| 266 | Ga0157374_10193075 | 3300013296 | Unclassified | 1992 |
| 267 | Ga0157378_10001171 | 3300013297 | Bacteria | 23874 |
| 268 | Ga0157378_10086750 | 3300013297 | Bacteria | 2838 |
| 269 | Ga0157378_10089286 | 3300013297 | Bacteria | 2799 |
| 270 | Ga0157378_10267675 | 3300013297 | Bacteria | 1642 |
| 271 | Ga0163162_10223404 | 3300013306 | Bacteria | 2013 |
| 272 | Ga0163162_10363914 | 3300013306 | Bacteria | 1579 |
| 273 | Ga0163162_10471192 | 3300013306 | Bacteria | 1387 |
| 274 | Ga0157375_10010588 | 3300013308 | Bacteria | 8119 |
| 275 | Ga0157375_10180149 | 3300013308 | Bacteria | 2264 |
| 276 | Ga0157375_10255335 | 3300013308 | Bacteria | 1914 |
| 277 | Ga0163163_10000051 | 3300014325 | Bacteria | 128275 |
| 278 | Ga0163163_10060169 | 3300014325 | Bacteria | 3760 |
| 279 | Ga0157380_10001394 | 3300014326 | Bacteria | 15775 |
| 280 | Ga0157380_13493985 | 3300014326 | Bacteria | 503 |
| 281 | Ga0157379_10129320 | 3300014968 | Bacteria | 2272 |
| 282 | Ga0157379_10180018 | 3300014968 | Bacteria | 1910 |
| 283 | Ga0157376_10006054 | 3300014969 | Bacteria | 8505 |
| 284 | Ga0157376_10043903 | 3300014969 | Bacteria | 3671 |
| 285 | Ga0157376_10514750 | 3300014969 | Bacteria | 1178 |
| 286 | Ga0157376_12101220 | 3300014969 | Bacteria | 603 |
| 287 | Ga0157376_13005034 | 3300014969 | Bacteria | 511 |
| 288 | Ga0163161_10784124 | 3300017792 | Bacteria | 800 |
| 289 | Ga0163161_11173943 | 3300017792 | Bacteria | 663 |
| 290 | Ga0213872_10405218 | 3300021361 | Bacteria | 552 |
| 291 | Ga0213876_10681524 | 3300021384 | Bacteria | 547 |
| 292 | Ga0213875_10245939 | 3300021388 | Bacteria | 843 |
| 293 | Ga0256720_155306 | 3300023438 | Bacteria | 833 |
| 294 | Ga0209674_100506 | 3300025226 | Bacteria | 16062 |
| 295 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 296 | Ga0209672_100078 | 3300025228 | Bacteria | 156926 |
| 297 | Ga0209563_100079 | 3300025230 | Bacteria | 203017 |
| 298 | Ga0209258_100012 | 3300025242 | Bacteria | 825544 |
| 299 | Ga0209258_100046 | 3300025242 | Bacteria | 369794 |
| 300 | Ga0209026_1000285 | 3300025250 | Bacteria | 58221 |
| 301 | Ga0209677_101982 | 3300025253 | Bacteria | 8133 |
| 302 | Ga0209148_1000014 | 3300025254 | Bacteria | 925277 |
| 303 | Ga0209148_1000098 | 3300025254 | Bacteria | 233172 |
| 304 | Ga0209759_1000460 | 3300025256 | Bacteria | 46256 |
| 305 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 306 | Ga0209455_1000126 | 3300025272 | Bacteria | 165771 |
| 307 | Ga0207697_10424226 | 3300025315 | Unclassified | 590 |
| 308 | Ga0207656_10334120 | 3300025321 | Bacteria | 754 |
| 309 | Ga0207656_10676664 | 3300025321 | Bacteria | 528 |
| 310 | Ga0207653_10331922 | 3300025885 | Bacteria | 592 |
| 311 | Ga0207682_10342778 | 3300025893 | Bacteria | 703 |
| 312 | Ga0207642_10001272 | 3300025899 | Bacteria | 7804 |
| 313 | Ga0207642_10172119 | 3300025899 | Bacteria | 1173 |
| 314 | Ga0207642_10489262 | 3300025899 | Bacteria | 751 |
| 315 | Ga0207642_10528222 | 3300025899 | Bacteria | 726 |
| 316 | Ga0207710_10031118 | 3300025900 | Bacteria | 2332 |
| 317 | Ga0207680_10004217 | 3300025903 | Bacteria | 6806 |
| 318 | Ga0207680_10071444 | 3300025903 | Bacteria | 2152 |
| 319 | Ga0207680_10195442 | 3300025903 | Bacteria | 1376 |
| 320 | Ga0207680_10399268 | 3300025903 | Bacteria | 971 |
| 321 | Ga0207699_10609128 | 3300025906 | Bacteria | 796 |
| 322 | Ga0207645_10008655 | 3300025907 | Bacteria | 7089 |
| 323 | Ga0207645_10175099 | 3300025907 | Bacteria | 1407 |
| 324 | Ga0207645_10250990 | 3300025907 | Bacteria | 1170 |
| 325 | Ga0207645_10375117 | 3300025907 | Bacteria | 954 |
| 326 | Ga0207643_10006831 | 3300025908 | Bacteria | 6125 |
| 327 | Ga0207643_10039399 | 3300025908 | Bacteria | 2658 |
| 328 | Ga0207643_10336579 | 3300025908 | Bacteria | 945 |
| 329 | Ga0207705_10689888 | 3300025909 | Unclassified | 794 |
| 330 | Ga0207654_10064120 | 3300025911 | Bacteria | 2159 |
| 331 | Ga0207654_10708572 | 3300025911 | Bacteria | 723 |
| 332 | Ga0207707_10351118 | 3300025912 | Bacteria | 1271 |
| 333 | Ga0207707_11232643 | 3300025912 | Bacteria | 604 |
| 334 | Ga0207695_10001746 | 3300025913 | Bacteria | 34535 |
| 335 | Ga0207695_10382796 | 3300025913 | Bacteria | 1292 |
| 336 | Ga0207671_10001938 | 3300025914 | Bacteria | 22902 |
| 337 | Ga0207671_10264747 | 3300025914 | Bacteria | 1353 |
| 338 | Ga0207671_10344282 | 3300025914 | Bacteria | 1181 |
| 339 | Ga0207671_10401038 | 3300025914 | Bacteria | 1091 |
| 340 | Ga0207660_10038780 | 3300025917 | Bacteria | 3327 |
| 341 | Ga0207660_10222935 | 3300025917 | Bacteria | 1480 |
| 342 | Ga0207662_10183621 | 3300025918 | Bacteria | 1347 |
| 343 | Ga0207662_10329071 | 3300025918 | Bacteria | 1022 |
| 344 | Ga0207662_10335686 | 3300025918 | Bacteria | 1012 |
| 345 | Ga0207681_10001878 | 3300025923 | Bacteria | 13447 |
| 346 | Ga0207681_10129882 | 3300025923 | Bacteria | 1861 |
| 347 | Ga0207681_10823772 | 3300025923 | Bacteria | 776 |
| 348 | Ga0207694_10000627 | 3300025924 | Bacteria | 32068 |
| 349 | Ga0207694_10016648 | 3300025924 | Bacteria | 5555 |
| 350 | Ga0207694_11168254 | 3300025924 | Bacteria | 651 |
| 351 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 352 | Ga0207650_10049228 | 3300025925 | Bacteria | 3111 |
| 353 | Ga0207659_10330157 | 3300025926 | Bacteria | 1260 |
| 354 | Ga0207687_10003513 | 3300025927 | Bacteria | 10547 |
| 355 | Ga0207687_10042035 | 3300025927 | Bacteria | 3141 |
| 356 | Ga0207687_10795396 | 3300025927 | Bacteria | 806 |
| 357 | Ga0207687_11449792 | 3300025927 | Bacteria | 590 |
| 358 | Ga0207664_10748583 | 3300025929 | Bacteria | 879 |
| 359 | Ga0207644_10000026 | 3300025931 | Bacteria | 147255 |
| 360 | Ga0207644_10165775 | 3300025931 | Bacteria | 1721 |
| 361 | Ga0207644_10671696 | 3300025931 | Bacteria | 863 |
| 362 | Ga0207706_10334312 | 3300025933 | Bacteria | 1318 |
| 363 | Ga0207706_10423252 | 3300025933 | Bacteria | 1154 |
| 364 | Ga0207686_10000895 | 3300025934 | Bacteria | 17985 |
| 365 | Ga0207686_10007132 | 3300025934 | Bacteria | 6013 |
| 366 | Ga0207686_10232270 | 3300025934 | Bacteria | 1338 |
| 367 | Ga0207686_10390735 | 3300025934 | Bacteria | 1057 |
| 368 | Ga0207686_10829667 | 3300025934 | Bacteria | 743 |
| 369 | Ga0207709_10027431 | 3300025935 | Bacteria | 3281 |
| 370 | Ga0207709_10395512 | 3300025935 | Bacteria | 1055 |
| 371 | Ga0207670_10004995 | 3300025936 | Bacteria | 7226 |
| 372 | Ga0207670_10254969 | 3300025936 | Bacteria | 1357 |
| 373 | Ga0207669_10337081 | 3300025937 | Bacteria | 1160 |
| 374 | Ga0207669_10353411 | 3300025937 | Bacteria | 1136 |
| 375 | Ga0207669_10547520 | 3300025937 | Bacteria | 933 |
| 376 | Ga0207704_10000551 | 3300025938 | Bacteria | 16714 |
| 377 | Ga0207704_10053746 | 3300025938 | Bacteria | 2451 |
| 378 | Ga0207704_10158932 | 3300025938 | Bacteria | 1605 |
| 379 | Ga0207704_10487180 | 3300025938 | Bacteria | 991 |
| 380 | Ga0207704_10514258 | 3300025938 | Bacteria | 967 |
| 381 | Ga0207704_11451412 | 3300025938 | Bacteria | 588 |
| 382 | Ga0207665_11027731 | 3300025939 | Bacteria | 656 |
| 383 | Ga0207691_10018155 | 3300025940 | Bacteria | 6664 |
| 384 | Ga0207691_10019550 | 3300025940 | Bacteria | 6408 |
| 385 | Ga0207691_10355343 | 3300025940 | Bacteria | 1253 |
| 386 | Ga0207711_10000279 | 3300025941 | Bacteria | 55112 |
| 387 | Ga0207711_10021208 | 3300025941 | Bacteria | 5426 |
| 388 | Ga0207711_10042177 | 3300025941 | Bacteria | 3888 |
| 389 | Ga0207711_10080793 | 3300025941 | Bacteria | 2840 |
| 390 | Ga0207689_10000136 | 3300025942 | Bacteria | 62820 |
| 391 | Ga0207689_10002117 | 3300025942 | Bacteria | 18668 |
| 392 | Ga0207689_10172903 | 3300025942 | Bacteria | 1781 |
| 393 | Ga0207689_10194656 | 3300025942 | Bacteria | 1673 |
| 394 | Ga0207667_10222068 | 3300025949 | Bacteria | 1936 |
| 395 | Ga0207651_10350869 | 3300025960 | Bacteria | 1242 |
| 396 | Ga0207651_10455422 | 3300025960 | Bacteria | 1098 |
| 397 | Ga0207651_10934605 | 3300025960 | Unclassified | 773 |
| 398 | Ga0207712_10187403 | 3300025961 | Bacteria | 1630 |
| 399 | Ga0207712_10299585 | 3300025961 | Bacteria | 1319 |
| 400 | Ga0207712_10523795 | 3300025961 | Bacteria | 1016 |
| 401 | Ga0207668_10050976 | 3300025972 | Bacteria | 2856 |
| 402 | Ga0207668_10566720 | 3300025972 | Bacteria | 986 |
| 403 | Ga0207640_10372839 | 3300025981 | Bacteria | 1154 |
| 404 | Ga0207640_10448249 | 3300025981 | Bacteria | 1063 |
| 405 | Ga0207640_11140991 | 3300025981 | Bacteria | 691 |
| 406 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 407 | Ga0207658_10043506 | 3300025986 | Bacteria | 3265 |
| 408 | Ga0207658_10155909 | 3300025986 | Bacteria | 1866 |
| 409 | Ga0207658_10186518 | 3300025986 | Bacteria | 1721 |
| 410 | Ga0207658_10999171 | 3300025986 | Bacteria | 763 |
| 411 | Ga0207658_11009648 | 3300025986 | Bacteria | 759 |
| 412 | Ga0207677_10052958 | 3300026023 | Bacteria | 2760 |
| 413 | Ga0207677_10473799 | 3300026023 | Bacteria | 1077 |
| 414 | Ga0207677_10735967 | 3300026023 | Bacteria | 878 |
| 415 | Ga0207703_10006745 | 3300026035 | Bacteria | 9158 |
| 416 | Ga0207703_10026533 | 3300026035 | Bacteria | 4560 |
| 417 | Ga0207703_10194547 | 3300026035 | Unclassified | 1798 |
| 418 | Ga0207703_12312324 | 3300026035 | Bacteria | 513 |
| 419 | Ga0207639_10130378 | 3300026041 | Bacteria | 2080 |
| 420 | Ga0207639_10297488 | 3300026041 | Bacteria | 1425 |
| 421 | Ga0207639_10735962 | 3300026041 | Unclassified | 916 |
| 422 | Ga0207639_11372766 | 3300026041 | Unclassified | 663 |
| 423 | Ga0207639_11430050 | 3300026041 | Bacteria | 649 |
| 424 | Ga0207639_11572289 | 3300026041 | Bacteria | 617 |
| 425 | Ga0207708_10001168 | 3300026075 | Bacteria | 19751 |
| 426 | Ga0207702_10009097 | 3300026078 | Bacteria | 8361 |
| 427 | Ga0207702_10031237 | 3300026078 | Bacteria | 4438 |
| 428 | Ga0207702_10178517 | 3300026078 | Bacteria | 1953 |
| 429 | Ga0207641_10226320 | 3300026088 | Bacteria | 1736 |
| 430 | Ga0207641_10264976 | 3300026088 | Bacteria | 1610 |
| 431 | Ga0207641_10337426 | 3300026088 | Bacteria | 1433 |
| 432 | Ga0207641_10390777 | 3300026088 | Bacteria | 1334 |
| 433 | Ga0207648_10000485 | 3300026089 | Bacteria | 44215 |
| 434 | Ga0207648_10050348 | 3300026089 | Bacteria | 3642 |
| 435 | Ga0207648_10084228 | 3300026089 | Bacteria | 2773 |
| 436 | Ga0207648_10372947 | 3300026089 | Bacteria | 1289 |
| 437 | Ga0207648_10525858 | 3300026089 | Bacteria | 1084 |
| 438 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 439 | Ga0207676_10107818 | 3300026095 | Bacteria | 2324 |
| 440 | Ga0207676_10399217 | 3300026095 | Bacteria | 1284 |
| 441 | Ga0207674_10711716 | 3300026116 | Bacteria | 969 |
| 442 | Ga0207674_11165729 | 3300026116 | Bacteria | 740 |
| 443 | Ga0207675_100000213 | 3300026118 | Bacteria | 54289 |
| 444 | Ga0207675_100026284 | 3300026118 | Bacteria | 5418 |
| 445 | Ga0207675_100277204 | 3300026118 | Bacteria | 1628 |
| 446 | Ga0207683_10007796 | 3300026121 | Bacteria | 9160 |
| 447 | Ga0207683_10012473 | 3300026121 | Bacteria | 7251 |
| 448 | Ga0207683_10028497 | 3300026121 | Bacteria | 4829 |
| 449 | Ga0207683_10080612 | 3300026121 | Bacteria | 2888 |
| 450 | Ga0207683_10129572 | 3300026121 | Bacteria | 2268 |
| 451 | Ga0207683_10974922 | 3300026121 | Bacteria | 787 |
| 452 | Ga0207698_10195509 | 3300026142 | Bacteria | 1806 |
| 453 | Ga0207698_11395982 | 3300026142 | Bacteria | 715 |
| 454 | Ga0209281_1017235 | 3300027111 | Bacteria | 1469 |
| 455 | Ga0268266_10004153 | 3300028379 | Bacteria | 13973 |
| 456 | Ga0268266_10034465 | 3300028379 | Bacteria | 4306 |
| 457 | Ga0268266_10100747 | 3300028379 | Bacteria | 2545 |
| 458 | Ga0268266_10119001 | 3300028379 | Bacteria | 2349 |
| 459 | Ga0268266_10297762 | 3300028379 | Bacteria | 1504 |
| 460 | Ga0268266_10409104 | 3300028379 | Bacteria | 1284 |
| 461 | Ga0268265_10001823 | 3300028380 | Bacteria | 17029 |
| 462 | Ga0268265_10105660 | 3300028380 | Bacteria | 2285 |
| 463 | Ga0268265_10192601 | 3300028380 | Bacteria | 1762 |
| 464 | Ga0268265_10521751 | 3300028380 | Bacteria | 1123 |
| 465 | Ga0268265_11514842 | 3300028380 | Bacteria | 674 |
| 466 | Ga0268264_10000061 | 3300028381 | Bacteria | 303123 |
| 467 | Ga0268264_10003726 | 3300028381 | Bacteria | 13096 |
| 468 | Ga0268264_10739785 | 3300028381 | Bacteria | 979 |
| 469 | Ga0268264_10996088 | 3300028381 | Bacteria | 844 |
| 470 | Ga0268264_11212373 | 3300028381 | Bacteria | 764 |
| 471 | Ga0265326_10069355 | 3300028558 | Unclassified | 997 |
| 472 | Ga0265338_10002059 | 3300028800 | Bacteria | 31074 |
| 473 | Ga0265338_10896290 | 3300028800 | Unclassified | 604 |
| 474 | Ga0265327_10000014 | 3300031251 | Bacteria | 506288 |
| 475 | Ga0265327_10000112 | 3300031251 | Bacteria | 175878 |
| 476 | Ga0316575_10004381 | 3300031665 | Bacteria | 4965 |
| 477 | Ga0316575_10005135 | 3300031665 | Bacteria | 4650 |
| 478 | Ga0316579_10059399 | 3300031691 | Bacteria | 1797 |
| 479 | Ga0316579_10160210 | 3300031691 | Bacteria | 1087 |
| 480 | Ga0316579_10214753 | 3300031691 | Bacteria | 930 |
| 481 | Ga0316579_10295928 | 3300031691 | Bacteria | 782 |
| 482 | Ga0316576_10017223 | 3300031727 | Bacteria | 4904 |
| 483 | Ga0316576_10068103 | 3300031727 | Bacteria | 2622 |
| 484 | Ga0316576_11075512 | 3300031727 | Bacteria | 571 |
| 485 | Ga0316578_10027557 | 3300031728 | Bacteria | 3212 |
| 486 | Ga0307516_10103849 | 3300031730 | Bacteria | 2655 |
| 487 | Ga0307516_10176813 | 3300031730 | Bacteria | 1870 |
| 488 | Ga0307516_10236670 | 3300031730 | Bacteria | 1527 |
| 489 | Ga0316577_10005478 | 3300031733 | Bacteria | 6655 |
| 490 | Ga0316577_10005970 | 3300031733 | Bacteria | 6416 |
| 491 | Ga0316577_10144901 | 3300031733 | Bacteria | 1338 |
| 492 | Ga0307413_10464157 | 3300031824 | Bacteria | 1008 |
| 493 | Ga0307406_11938690 | 3300031901 | Unclassified | 526 |
| 494 | Ga0307409_101310740 | 3300031995 | Bacteria | 749 |
| 495 | Ga0307411_10983644 | 3300032005 | Bacteria | 754 |
| 496 | Ga0316583_10062951 | 3300032133 | Bacteria | 1300 |
| 497 | Ga0316583_10157765 | 3300032133 | Bacteria | 790 |
| 498 | Ga0316585_10040995 | 3300032137 | Bacteria | 1475 |
| 499 | Ga0316585_10090875 | 3300032137 | Unclassified | 998 |
| 500 | Ga0316585_10181481 | 3300032137 | Bacteria | 695 |
| 501 | Ga0316580_10006198 | 3300032139 | Bacteria | 3525 |
| 502 | Ga0316580_10067414 | 3300032139 | Bacteria | 1097 |
| 503 | Ga0316593_10000661 | 3300032168 | Bacteria | 6646 |
| 504 | Ga0316593_10000778 | 3300032168 | Bacteria | 6331 |
| 505 | Ga0316593_10005665 | 3300032168 | Bacteria | 3315 |
| 506 | Ga0316593_10006604 | 3300032168 | Bacteria | 3141 |
| 507 | Ga0316593_10052998 | 3300032168 | Bacteria | 1374 |
| 508 | Ga0316593_10055697 | 3300032168 | Unclassified | 1344 |
| 509 | Ga0316593_10065497 | 3300032168 | Bacteria | 1249 |
| 510 | Ga0316593_10081373 | 3300032168 | Bacteria | 1131 |
| 511 | Ga0316593_10082476 | 3300032168 | Bacteria | 1124 |
| 512 | Ga0316593_10195575 | 3300032168 | Bacteria | 746 |
| 513 | Ga0316592_1032534 | 3300033524 | Bacteria | 1138 |
| 514 | Ga0316592_1085366 | 3300033524 | Bacteria | 720 |
| 515 | Ga0316588_1027082 | 3300033528 | Unclassified | 1330 |
| 516 | Ga0316588_1030060 | 3300033528 | Bacteria | 1272 |
| 517 | Ga0316587_1043055 | 3300033529 | Bacteria | 818 |
| 518 | Ga0316587_1043065 | 3300033529 | Bacteria | 818 |
| 519 | Ga0316587_1048715 | 3300033529 | Bacteria | 774 |
| 520 | Ga0316587_1058203 | 3300033529 | Unclassified | 714 |
| 521 | Ga0316587_1060947 | 3300033529 | Unclassified | 699 |
| 522 | Ga0316587_1074827 | 3300033529 | Bacteria | 636 |
| 523 | Ga0316596_1001400 | 3300033541 | Bacteria | 4848 |
| 524 | Ga0316596_1027166 | 3300033541 | Bacteria | 1477 |
| 525 | Ga0316596_1029341 | 3300033541 | Bacteria | 1424 |
| 526 | Ga0316596_1039533 | 3300033541 | Bacteria | 1237 |
| 527 | Ga0316596_1079008 | 3300033541 | Bacteria | 884 |
| 528 | Ga0316596_1210040 | 3300033541 | Bacteria | 543 |
| 529 | Ga0373929_0250667 | 3300035085 | Bacteria | 513 |
| 530 | Ga0373952_0195494 | 3300035092 | Unclassified | 590 |
| 531 | Ga0373942_0198013 | 3300035207 | Unclassified | 665 |
| 532 | Ga0316574_0068386 | 3300035398 | Bacteria | 2240 |
| 533 | Ga0316574_0199288 | 3300035398 | Bacteria | 1286 |
| 534 | Ga0316574_0408235 | 3300035398 | Bacteria | 855 |
| 535 | Ga0316574_0835399 | 3300035398 | Unclassified | 559 |
| 536 | Ga0316574_0942254 | 3300035398 | Unclassified | 521 |
| 537 | Ga0373931_0339273 | 3300035691 | Bacteria | 938 |
| 538 | Ga0316582_0004572 | 3300036647 | Bacteria | 7010 |
| 539 | Ga0316582_0027446 | 3300036647 | Bacteria | 3439 |
| 540 | Ga0316582_0211511 | 3300036647 | Bacteria | 1325 |
| 541 | Ga0316584_0005066 | 3300036712 | Bacteria | 8784 |
| 542 | Ga0316584_0008148 | 3300036712 | Bacteria | 7203 |
| 543 | Ga0316584_0027572 | 3300036712 | Bacteria | 4182 |
| 544 | Ga0316584_0101289 | 3300036712 | Bacteria | 2157 |
| 545 | Ga0316584_0878276 | 3300036712 | Bacteria | 605 |
| 546 | Ga0395899_0000319 | 3300037312 | Bacteria | 61296 |
| 547 | Ga0395900_0000061 | 3300037418 | Bacteria | 202483 |
| 548 | Ga0395900_0000894 | 3300037418 | Bacteria | 39143 |
| 549 | Ga0395898_0000034 | 3300037466 | Bacteria | 356745 |
| 550 | Ga0436364_1060220 | 3300037853 | Unclassified | 1194 |
| 551 | Ga0395901_0077195 | 3300038443 | Bacteria | 3476 |
| 552 | Ga0400484_32124 | 3300038725 | Bacteria | 5681 |
| 553 | Ga0400490_20117 | 3300038726 | Bacteria | 25705 |
| 554 | Ga0400490_31688 | 3300038726 | Bacteria | 17721 |
| 555 | Ga0400491_20800 | 3300038727 | Bacteria | 10066 |
| 556 | Ga0400491_21758 | 3300038727 | Unclassified | 1050 |
| 557 | Ga0400485_12746 | 3300038735 | Bacteria | 3954 |
| 558 | Ga0400488_18372 | 3300038741 | Bacteria | 11596 |
| 559 | Ga0400488_38656 | 3300038741 | Bacteria | 1205 |
| 560 | Ga0400488_46405 | 3300038741 | Unclassified | 1373 |
| 561 | Ga0400488_50084 | 3300038741 | Bacteria | 1600 |
| 562 | Ga0400486_06219 | 3300038742 | Bacteria | 2854 |
| 563 | Ga0400483_006822 | 3300039062 | Bacteria | 2957 |
| 564 | Ga0400483_078683 | 3300039062 | Unclassified | 1133 |
| 565 | Ga0400483_085407 | 3300039062 | Bacteria | 1482 |
| 566 | Ga0400483_085605 | 3300039062 | Bacteria | 18729 |
| 567 | Ga0400483_129431 | 3300039062 | Bacteria | 1067 |
| 568 | Ga0400483_170867 | 3300039062 | Bacteria | 8559 |
| 569 | Ga0400483_248196 | 3300039062 | Bacteria | 7053 |
| 570 | Ga0400483_254656 | 3300039062 | Unclassified | 2017 |
| 571 | Ga0400489_11346 | 3300039093 | Bacteria | 1782 |
| 572 | Ga0400489_58554 | 3300039093 | Bacteria | 1025 |
| 573 | Ga0400487_07419 | 3300039110 | Bacteria | 1547 |
| 574 | Ga0400487_24791 | 3300039110 | Bacteria | 81428 |
| 575 | Ga0400487_41427 | 3300039110 | Bacteria | 4185 |
| 576 | Ga0400487_43791 | 3300039110 | Bacteria | 24362 |
| 577 | Ga0436365_0840042 | 3300039437 | Bacteria | 782 |
| 578 | Ga0436365_1664988 | 3300039437 | Bacteria | 1993 |
| 579 | Ga0436361_0665703 | 3300039447 | Bacteria | 552 |
| 580 | Ga0436361_0944033 | 3300039447 | Bacteria | 636 |
| 581 | Ga0436363_1117066 | 3300039450 | Bacteria | 1033 |
| 582 | Ga0436363_1191204 | 3300039450 | Unclassified | 561 |
| 583 | Ga0436362_0226625 | 3300039453 | Bacteria | 962 |
| 584 | Ga0439439_0007861 | 3300041406 | Bacteria | 2505 |
| 585 | Ga0451789_0793241 | 3300041443 | Bacteria | 760 |
| 586 | Ga0451790_31258 | 3300041444 | Bacteria | 1045 |
| 587 | Ga0451839_0741211 | 3300041496 | Bacteria | 765 |
| 588 | Ga0451847_0662423 | 3300041503 | Bacteria | 970 |
| 589 | Ga0451854_17261 | 3300041510 | Bacteria | 520 |
| 590 | Ga0451853_3376051 | 3300041512 | Bacteria | 1269 |
| 591 | Ga0439441_000553 | 3300042001 | Bacteria | 4140 |
| 592 | Ga0451577_0296099 | 3300042876 | Bacteria | 1466 |
| 593 | Ga0451577_0423063 | 3300042876 | Bacteria | 1210 |
| 594 | Ga0451577_0434525 | 3300042876 | Bacteria | 1192 |
| 595 | Ga0466969_0036984 | 3300044656 | Bacteria | 2463 |
| 596 | Ga0466966_0057286 | 3300044684 | Bacteria | 2463 |
| 597 | Ga0466961_0004766 | 3300044693 | Bacteria | 8537 |
| 598 | Ga0466961_0027892 | 3300044693 | Bacteria | 3630 |
| 599 | Ga0466964_0003032 | 3300044706 | Bacteria | 6092 |
| 600 | Ga0453684_1185901 | 3300044712 | Bacteria | 802 |
| 601 | Ga0453684_1361098 | 3300044712 | Bacteria | 738 |
| 602 | Ga0466971_0149901 | 3300044719 | Bacteria | 1088 |
| 603 | Ga0466968_0028966 | 3300044735 | Bacteria | 2287 |
| 604 | Ga0466970_0011634 | 3300044765 | Bacteria | 4488 |
| 605 | Ga0466957_0012640 | 3300044842 | Bacteria | 4889 |
| 606 | Ga0466959_0000258 | 3300045049 | Bacteria | 32514 |
| 607 | Ga0451576_0001131 | 3300045051 | Bacteria | 48320 |
| 608 | Ga0451576_2415862 | 3300045051 | Bacteria | 538 |
| 609 | Ga0466958_0383431 | 3300045836 | Bacteria | 906 |
| 610 | Ga0495592_0567489 | 3300046454 | Bacteria | 696 |
| 611 | Ga0495659_0090797 | 3300046664 | Bacteria | 1172 |
| 612 | Ga0495623_0421842 | 3300046679 | Bacteria | 715 |
| 613 | Ga0495604_0305648 | 3300047317 | Bacteria | 1067 |
| 614 | Ga0495674_0474784 | 3300047319 | Bacteria | 1003 |
| 615 | Ga0495677_0396098 | 3300047445 | Unclassified | 546 |
| 616 | Ga0496108_1287625 | 3300048911 | Bacteria | 615 |
| 617 | Ga0496114_0209806 | 3300048917 | Bacteria | 1708 |
| 618 | Ga0496114_0705029 | 3300048917 | Bacteria | 885 |
| 619 | Ga0496115_0000065 | 3300048918 | Bacteria | 98148 |
| 620 | Ga0496117_0516975 | 3300048920 | Bacteria | 575 |
| 621 | Ga0496118_0029968 | 3300048921 | Bacteria | 4553 |
| 622 | Ga0496124_0003292 | 3300048927 | Bacteria | 19912 |
| 623 | Ga0496124_0111130 | 3300048927 | Bacteria | 2205 |
| 624 | Ga0496125_0085562 | 3300048928 | Bacteria | 2388 |
| 625 | Ga0496126_0000185 | 3300048929 | Bacteria | 140051 |
| 626 | Ga0496126_1369376 | 3300048929 | Bacteria | 512 |
| 627 | Ga0501325_012123 | 3300049541 | Bacteria | 807 |
| 628 | Ga0501033_0141497 | 3300049570 | Bacteria | 1739 |
| 629 | Ga0501034_0239998 | 3300049571 | Bacteria | 1759 |
| 630 | Ga0501037_0102200 | 3300049573 | Bacteria | 2068 |
| 631 | Ga0501037_0465188 | 3300049573 | Bacteria | 861 |
| 632 | Ga0501039_1264232 | 3300049575 | Bacteria | 570 |
| 633 | Ga0501047_0117022 | 3300049581 | Bacteria | 2547 |
| 634 | Ga0501035_0007793 | 3300049822 | Bacteria | 10006 |
| 635 | Ga0501035_0568797 | 3300049822 | Bacteria | 927 |
| 636 | Ga0501045_0321852 | 3300049824 | Bacteria | 1151 |
| 637 | Ga0500650_0000034 | 3300053098 | Bacteria | 52582 |
| 638 | Ga0500554_257634 | 3300053102 | Unclassified | 573 |
| 639 | Ga0500595_025222 | 3300053119 | Bacteria | 2064 |
| 640 | Ga0500597_231227 | 3300053120 | Bacteria | 764 |
| 641 | Ga0500590_339989 | 3300053148 | Bacteria | 542 |
| 642 | Ga0500636_0070190 | 3300053177 | Bacteria | 2033 |
| 643 | Ga0500661_004201 | 3300055283 | Bacteria | 2695 |
| 644 | Ga0587084_052553 | 3300059477 | Bacteria | 726 |
| 645 | Ga0587093_075567 | 3300059478 | Bacteria | 573 |
| 646 | Ga0587070_054776 | 3300059491 | Bacteria | 807 |
| 647 | Ga0587077_087858 | 3300059493 | Unclassified | 725 |
| 648 | Ga0587080_114324 | 3300059503 | Unclassified | 592 |
| 649 | Ga0587083_0221326 | 3300059505 | Bacteria | 551 |
| 650 | Ga0587085_015437 | 3300059506 | Bacteria | 1091 |
| 651 | Ga0587086_049489 | 3300059507 | Unclassified | 674 |
| 652 | Ga0587088_047633 | 3300059508 | Unclassified | 829 |
| 653 | Ga0587090_026977 | 3300059510 | Unclassified | 937 |
| 654 | Ga0587091_051032 | 3300059511 | Unclassified | 849 |
| 655 | Ga0587094_073400 | 3300059513 | Unclassified | 620 |
| 656 | Ga0587095_023410 | 3300059514 | Unclassified | 606 |
| 657 | Ga0587125_011724 | 3300059607 | Unclassified | 924 |
| 658 | Ga0587129_028744 | 3300059608 | Unclassified | 526 |
| 659 | Ga0587101_091602 | 3300059623 | Bacteria | 592 |
| 660 | Ga0587109_056737 | 3300059624 | Unclassified | 815 |
| 661 | Ga0587117_014876 | 3300059627 | Unclassified | 1016 |
| 662 | Ga0587128_141479 | 3300059630 | Unclassified | 541 |
| 663 | Ga0587130_033675 | 3300059631 | Bacteria | 598 |
| 664 | Ga0587062_057243 | 3300059639 | Unclassified | 675 |
| 665 | Ga0587068_026769 | 3300059641 | Unclassified | 978 |
| 666 | Ga0587069_136651 | 3300059642 | Bacteria | 533 |
| 667 | Ga0587072_075379 | 3300059643 | Bacteria | 720 |
| 668 | Ga0587076_078552 | 3300059645 | Unclassified | 699 |
| 669 | Ga0587079_184519 | 3300059647 | Unclassified | 560 |
| 670 | Ga0587100_022084 | 3300059648 | Unclassified | 628 |
| 671 | Ga0587108_022809 | 3300059653 | Bacteria | 604 |
| 672 | Ga0587118_25044 | 3300059657 | Bacteria | 509 |
| 673 | Ga0587111_0029070 | 3300060346 | Unclassified | 1117 |
| 674 | Ga0501082_1408576 | 3300060353 | Bacteria | 609 |
| 675 | Ga0466962_0012161 | 3300061719 | Bacteria | 4138 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2690315857 | 2691330632 | 50 |
| 2 | iso_pu_bacteria | 2919534386 | 2919535655 | 50 |
| 3 | iso_pu_bacteria | 2506520007 | 2506577911 | 51 |
| 4 | iso_pu_bacteria | 2506520008 | 2506583049 | 51 |
| 5 | iso_pu_bacteria | 2654587920 | 2656275457 | 51 |
| 6 | iso_pu_bacteria | 2687453601 | 2689444436 | 51 |
| 7 | iso_pu_bacteria | 2869551831 | 2869553787 | 51 |
| 8 | iso_pu_bacteria | 2932406140 | 2932409707 | 51 |
| 9 | iso_pu_bacteria | 2939577877 | 2939578825 | 51 |
| 10 | iso_pu_bacteria | 2565956521 | 2566038296 | 52 |
| 11 | iso_pu_bacteria | 2648501241 | 2649120980 | 52 |
| 12 | iso_pu_bacteria | 2651869818 | 2652974926 | 52 |
| 13 | iso_pu_bacteria | 2881714928 | 2881715303 | 52 |
| 14 | iso_pu_bacteria | 8054357960 | 8054360172 | 52 |
| 15 | 3300005272 | Ga0065703_1024523 | Ga0065703_10245231 | 55 |
| 16 | 3300021388 | Ga0213875_10245939 | Ga0213875_102459392 | 55 |
| 17 | 3300025927 | Ga0207687_11449792 | Ga0207687_114497922 | 55 |
| 18 | 3300037853 | Ga0436364_1060220 | Ga0436364_1060220_577_780 | 55 |
| 19 | iso_pu_bacteria | 8002745576 | 8002749439 | 55 |
| 20 | 3300023438 | Ga0256720_155306 | Ga0256720_1553061 | 56 |
| 21 | 3300032168 | Ga0316593_10000661 | Ga0316593_100006613 | 56 |
| 22 | 3300032168 | Ga0316593_10000778 | Ga0316593_100007783 | 56 |
| 23 | 3300032168 | Ga0316593_10082476 | Ga0316593_100824762 | 56 |
| 24 | 3300033541 | Ga0316596_1210040 | Ga0316596_12100402 | 56 |
| 25 | 3300039062 | Ga0400483_085605 | Ga0400483_085605_6897_7067 | 56 |
| 26 | 3300041510 | Ga0451854_17261 | Ga0451854_17261_258_428 | 56 |
| 27 | 3300041512 | Ga0451853_3376051 | Ga0451853_3376051_262_432 | 56 |
| 28 | 3300005518 | Ga0070699_100058688 | Ga0070699_1000586884 | 58 |
| 29 | 3300005518 | Ga0070699_100139643 | Ga0070699_1001396432 | 58 |
| 30 | 3300013100 | Ga0157373_10825838 | Ga0157373_108258382 | 58 |
| 31 | 3300032133 | Ga0316583_10062951 | Ga0316583_100629512 | 58 |
| 32 | 3300032168 | Ga0316593_10005665 | Ga0316593_100056652 | 58 |
| 33 | 3300032168 | Ga0316593_10065497 | Ga0316593_100654972 | 58 |
| 34 | 3300033524 | Ga0316592_1085366 | Ga0316592_10853662 | 58 |
| 35 | 3300033528 | Ga0316588_1030060 | Ga0316588_10300602 | 58 |
| 36 | 3300036712 | Ga0316584_0878276 | Ga0316584_0878276_85_261 | 58 |
| 37 | 3300042001 | Ga0439441_000553 | Ga0439441_000553_2662_2838 | 58 |
| 38 | 3300045051 | Ga0451576_2415862 | Ga0451576_2415862_135_311 | 58 |
| 39 | 3300046454 | Ga0495592_0567489 | Ga0495592_0567489_229_405 | 58 |
| 40 | 3300047317 | Ga0495604_0305648 | Ga0495604_0305648_147_323 | 58 |
| 41 | 3300047319 | Ga0495674_0474784 | Ga0495674_0474784_194_370 | 58 |
| 42 | 3300004798 | Ga0058859_11813743 | Ga0058859_118137432 | 59 |
| 43 | 3300005328 | Ga0070676_10474453 | Ga0070676_104744532 | 59 |
| 44 | 3300005329 | Ga0070683_101826633 | Ga0070683_1018266332 | 59 |
| 45 | 3300005330 | Ga0070690_100000845 | Ga0070690_1000008459 | 59 |
| 46 | 3300005331 | Ga0070670_100000001 | Ga0070670_100000001543 | 59 |
| 47 | 3300005333 | Ga0070677_10763524 | Ga0070677_107635242 | 59 |
| 48 | 3300005334 | Ga0068869_100002558 | Ga0068869_1000025584 | 59 |
| 49 | 3300005334 | Ga0068869_100004697 | Ga0068869_1000046977 | 59 |
| 50 | 3300005335 | Ga0070666_10015694 | Ga0070666_100156944 | 59 |
| 51 | 3300005336 | Ga0070680_100300083 | Ga0070680_1003000832 | 59 |
| 52 | 3300005336 | Ga0070680_100359947 | Ga0070680_1003599473 | 59 |
| 53 | 3300005340 | Ga0070689_100004467 | Ga0070689_10000446710 | 59 |
| 54 | 3300005340 | Ga0070689_100287396 | Ga0070689_1002873962 | 59 |
| 55 | 3300005341 | Ga0070691_10143528 | Ga0070691_101435281 | 59 |
| 56 | 3300005343 | Ga0070687_100322499 | Ga0070687_1003224991 | 59 |
| 57 | 3300005343 | Ga0070687_101047543 | Ga0070687_1010475432 | 59 |
| 58 | 3300005345 | Ga0070692_10006900 | Ga0070692_100069003 | 59 |
| 59 | 3300005347 | Ga0070668_100907594 | Ga0070668_1009075942 | 59 |
| 60 | 3300005353 | Ga0070669_100002161 | Ga0070669_10000216116 | 59 |
| 61 | 3300005354 | Ga0070675_100540719 | Ga0070675_1005407192 | 59 |
| 62 | 3300005355 | Ga0070671_100000018 | Ga0070671_10000001892 | 59 |
| 63 | 3300005356 | Ga0070674_100107450 | Ga0070674_1001074504 | 59 |
| 64 | 3300005365 | Ga0070688_100004521 | Ga0070688_1000045217 | 59 |
| 65 | 3300005365 | Ga0070688_100034596 | Ga0070688_1000345963 | 59 |
| 66 | 3300005367 | Ga0070667_100000026 | Ga0070667_10000002671 | 59 |
| 67 | 3300005367 | Ga0070667_100269306 | Ga0070667_1002693062 | 59 |
| 68 | 3300005367 | Ga0070667_100630074 | Ga0070667_1006300742 | 59 |
| 69 | 3300005367 | Ga0070667_100683693 | Ga0070667_1006836932 | 59 |
| 70 | 3300005435 | Ga0070714_100003562 | Ga0070714_1000035625 | 59 |
| 71 | 3300005438 | Ga0070701_10002994 | Ga0070701_100029942 | 59 |
| 72 | 3300005438 | Ga0070701_10194129 | Ga0070701_101941292 | 59 |
| 73 | 3300005440 | Ga0070705_100040767 | Ga0070705_1000407673 | 59 |
| 74 | 3300005440 | Ga0070705_100489570 | Ga0070705_1004895702 | 59 |
| 75 | 3300005441 | Ga0070700_100003802 | Ga0070700_1000038022 | 59 |
| 76 | 3300005444 | Ga0070694_100007985 | Ga0070694_1000079854 | 59 |
| 77 | 3300005444 | Ga0070694_100621039 | Ga0070694_1006210392 | 59 |
| 78 | 3300005456 | Ga0070678_100016566 | Ga0070678_1000165665 | 59 |
| 79 | 3300005456 | Ga0070678_100359450 | Ga0070678_1003594502 | 59 |
| 80 | 3300005459 | Ga0068867_100012057 | Ga0068867_1000120575 | 59 |
| 81 | 3300005459 | Ga0068867_100896092 | Ga0068867_1008960922 | 59 |
| 82 | 3300005466 | Ga0070685_10000007 | Ga0070685_10000007155 | 59 |
| 83 | 3300005466 | Ga0070685_10038655 | Ga0070685_100386554 | 59 |
| 84 | 3300005535 | Ga0070684_100963664 | Ga0070684_1009636642 | 59 |
| 85 | 3300005536 | Ga0070697_100003415 | Ga0070697_1000034152 | 59 |
| 86 | 3300005536 | Ga0070697_102033512 | Ga0070697_1020335122 | 59 |
| 87 | 3300005539 | Ga0068853_100107025 | Ga0068853_1001070253 | 59 |
| 88 | 3300005543 | Ga0070672_100305242 | Ga0070672_1003052422 | 59 |
| 89 | 3300005544 | Ga0070686_100001455 | Ga0070686_10000145510 | 59 |
| 90 | 3300005544 | Ga0070686_100162223 | Ga0070686_1001622232 | 59 |
| 91 | 3300005545 | Ga0070695_100105939 | Ga0070695_1001059392 | 59 |
| 92 | 3300005546 | Ga0070696_100013458 | Ga0070696_1000134588 | 59 |
| 93 | 3300005547 | Ga0070693_100018924 | Ga0070693_1000189243 | 59 |
| 94 | 3300005548 | Ga0070665_100057794 | Ga0070665_1000577944 | 59 |
| 95 | 3300005548 | Ga0070665_100230673 | Ga0070665_1002306734 | 59 |
| 96 | 3300005549 | Ga0070704_100032448 | Ga0070704_1000324482 | 59 |
| 97 | 3300005549 | Ga0070704_101600249 | Ga0070704_1016002491 | 59 |
| 98 | 3300005549 | Ga0070704_101994868 | Ga0070704_1019948682 | 59 |
| 99 | 3300005563 | Ga0068855_102330383 | Ga0068855_1023303831 | 59 |
| 100 | 3300005578 | Ga0068854_101304923 | Ga0068854_1013049232 | 59 |
| 101 | 3300005615 | Ga0070702_100001220 | Ga0070702_1000012209 | 59 |
| 102 | 3300005615 | Ga0070702_100133509 | Ga0070702_1001335092 | 59 |
| 103 | 3300005615 | Ga0070702_101811126 | Ga0070702_1018111261 | 59 |
| 104 | 3300005617 | Ga0068859_100007685 | Ga0068859_10000768512 | 59 |
| 105 | 3300005617 | Ga0068859_100017029 | Ga0068859_1000170299 | 59 |
| 106 | 3300005618 | Ga0068864_100000012 | Ga0068864_100000012185 | 59 |
| 107 | 3300005618 | Ga0068864_100126667 | Ga0068864_1001266672 | 59 |
| 108 | 3300005718 | Ga0068866_10000235 | Ga0068866_1000023518 | 59 |
| 109 | 3300005719 | Ga0068861_100006760 | Ga0068861_1000067609 | 59 |
| 110 | 3300005719 | Ga0068861_100511226 | Ga0068861_1005112262 | 59 |
| 111 | 3300005719 | Ga0068861_101732754 | Ga0068861_1017327542 | 59 |
| 112 | 3300005840 | Ga0068870_10271776 | Ga0068870_102717762 | 59 |
| 113 | 3300005840 | Ga0068870_10778535 | Ga0068870_107785352 | 59 |
| 114 | 3300005841 | Ga0068863_100256127 | Ga0068863_1002561272 | 59 |
| 115 | 3300005842 | Ga0068858_100002549 | Ga0068858_1000025499 | 59 |
| 116 | 3300005842 | Ga0068858_100016226 | Ga0068858_1000162266 | 59 |
| 117 | 3300005842 | Ga0068858_100204401 | Ga0068858_1002044012 | 59 |
| 118 | 3300005843 | Ga0068860_100007832 | Ga0068860_1000078329 | 59 |
| 119 | 3300005843 | Ga0068860_100009873 | Ga0068860_1000098737 | 59 |
| 120 | 3300005844 | Ga0068862_100001146 | Ga0068862_10000114613 | 59 |
| 121 | 3300005844 | Ga0068862_100005397 | Ga0068862_1000053975 | 59 |
| 122 | 3300005844 | Ga0068862_100201685 | Ga0068862_1002016852 | 59 |
| 123 | 3300006237 | Ga0097621_100002412 | Ga0097621_1000024124 | 59 |
| 124 | 3300006237 | Ga0097621_100004460 | Ga0097621_1000044604 | 59 |
| 125 | 3300006358 | Ga0068871_100001034 | Ga0068871_10000103417 | 59 |
| 126 | 3300006358 | Ga0068871_100004954 | Ga0068871_1000049548 | 59 |
| 127 | 3300006881 | Ga0068865_100000229 | Ga0068865_10000022923 | 59 |
| 128 | 3300006881 | Ga0068865_100135329 | Ga0068865_1001353292 | 59 |
| 129 | 3300006931 | Ga0097620_100007685 | Ga0097620_10000768512 | 59 |
| 130 | 3300006931 | Ga0097620_100017029 | Ga0097620_1000170299 | 59 |
| 131 | 3300006946 | Ga0079104_1027215 | Ga0079104_10272152 | 59 |
| 132 | 3300007265 | Ga0099794_10046640 | Ga0099794_100466402 | 59 |
| 133 | 3300009093 | Ga0105240_10029653 | Ga0105240_100296533 | 59 |
| 134 | 3300009093 | Ga0105240_11905248 | Ga0105240_119052481 | 59 |
| 135 | 3300009098 | Ga0105245_10000613 | Ga0105245_1000061330 | 59 |
| 136 | 3300009098 | Ga0105245_10050419 | Ga0105245_100504193 | 59 |
| 137 | 3300009101 | Ga0105247_10047349 | Ga0105247_100473494 | 59 |
| 138 | 3300009101 | Ga0105247_10527103 | Ga0105247_105271031 | 59 |
| 139 | 3300009148 | Ga0105243_10004808 | Ga0105243_100048085 | 59 |
| 140 | 3300009148 | Ga0105243_10235256 | Ga0105243_102352563 | 59 |
| 141 | 3300009176 | Ga0105242_10000678 | Ga0105242_1000067810 | 59 |
| 142 | 3300009176 | Ga0105242_10151229 | Ga0105242_101512292 | 59 |
| 143 | 3300009177 | Ga0105248_10007225 | Ga0105248_100072257 | 59 |
| 144 | 3300009177 | Ga0105248_10075331 | Ga0105248_100753312 | 59 |
| 145 | 3300009177 | Ga0105248_10189091 | Ga0105248_101890913 | 59 |
| 146 | 3300009545 | Ga0105237_10533031 | Ga0105237_105330312 | 59 |
| 147 | 3300009545 | Ga0105237_10902234 | Ga0105237_109022342 | 59 |
| 148 | 3300009553 | Ga0105249_10089678 | Ga0105249_100896782 | 59 |
| 149 | 3300009553 | Ga0105249_12371493 | Ga0105249_123714931 | 59 |
| 150 | 3300010375 | Ga0105239_10117512 | Ga0105239_101175124 | 59 |
| 151 | 3300011119 | Ga0105246_10301499 | Ga0105246_103014991 | 59 |
| 152 | 3300011119 | Ga0105246_10441943 | Ga0105246_104419432 | 59 |
| 153 | 3300013296 | Ga0157374_10193075 | Ga0157374_101930752 | 59 |
| 154 | 3300013297 | Ga0157378_10001171 | Ga0157378_1000117116 | 59 |
| 155 | 3300013297 | Ga0157378_10086750 | Ga0157378_100867503 | 59 |
| 156 | 3300013297 | Ga0157378_10089286 | Ga0157378_100892863 | 59 |
| 157 | 3300013297 | Ga0157378_10267675 | Ga0157378_102676752 | 59 |
| 158 | 3300013306 | Ga0163162_10223404 | Ga0163162_102234042 | 59 |
| 159 | 3300013306 | Ga0163162_10363914 | Ga0163162_103639142 | 59 |
| 160 | 3300013306 | Ga0163162_10471192 | Ga0163162_104711922 | 59 |
| 161 | 3300013308 | Ga0157375_10010588 | Ga0157375_100105886 | 59 |
| 162 | 3300013308 | Ga0157375_10180149 | Ga0157375_101801494 | 59 |
| 163 | 3300014325 | Ga0163163_10000051 | Ga0163163_1000005154 | 59 |
| 164 | 3300014325 | Ga0163163_10060169 | Ga0163163_100601695 | 59 |
| 165 | 3300014326 | Ga0157380_10001394 | Ga0157380_1000139412 | 59 |
| 166 | 3300014968 | Ga0157379_10129320 | Ga0157379_101293202 | 59 |
| 167 | 3300014968 | Ga0157379_10180018 | Ga0157379_101800184 | 59 |
| 168 | 3300014969 | Ga0157376_10006054 | Ga0157376_100060549 | 59 |
| 169 | 3300014969 | Ga0157376_10514750 | Ga0157376_105147502 | 59 |
| 170 | 3300014969 | Ga0157376_12101220 | Ga0157376_121012202 | 59 |
| 171 | 3300017792 | Ga0163161_11173943 | Ga0163161_111739431 | 59 |
| 172 | 3300021361 | Ga0213872_10405218 | Ga0213872_104052181 | 59 |
| 173 | 3300025315 | Ga0207697_10424226 | Ga0207697_104242262 | 59 |
| 174 | 3300025885 | Ga0207653_10331922 | Ga0207653_103319221 | 59 |
| 175 | 3300025893 | Ga0207682_10342778 | Ga0207682_103427782 | 59 |
| 176 | 3300025899 | Ga0207642_10001272 | Ga0207642_100012723 | 59 |
| 177 | 3300025900 | Ga0207710_10031118 | Ga0207710_100311183 | 59 |
| 178 | 3300025903 | Ga0207680_10004217 | Ga0207680_100042178 | 59 |
| 179 | 3300025903 | Ga0207680_10195442 | Ga0207680_101954422 | 59 |
| 180 | 3300025907 | Ga0207645_10250990 | Ga0207645_102509902 | 59 |
| 181 | 3300025908 | Ga0207643_10006831 | Ga0207643_100068318 | 59 |
| 182 | 3300025908 | Ga0207643_10336579 | Ga0207643_103365791 | 59 |
| 183 | 3300025912 | Ga0207707_11232643 | Ga0207707_112326431 | 59 |
| 184 | 3300025913 | Ga0207695_10382796 | Ga0207695_103827962 | 59 |
| 185 | 3300025914 | Ga0207671_10264747 | Ga0207671_102647473 | 59 |
| 186 | 3300025914 | Ga0207671_10401038 | Ga0207671_104010382 | 59 |
| 187 | 3300025917 | Ga0207660_10038780 | Ga0207660_100387803 | 59 |
| 188 | 3300025917 | Ga0207660_10222935 | Ga0207660_102229352 | 59 |
| 189 | 3300025918 | Ga0207662_10183621 | Ga0207662_101836213 | 59 |
| 190 | 3300025918 | Ga0207662_10329071 | Ga0207662_103290711 | 59 |
| 191 | 3300025923 | Ga0207681_10001878 | Ga0207681_100018782 | 59 |
| 192 | 3300025925 | Ga0207650_10000002 | Ga0207650_100000021219 | 59 |
| 193 | 3300025927 | Ga0207687_10003513 | Ga0207687_100035139 | 59 |
| 194 | 3300025927 | Ga0207687_10042035 | Ga0207687_100420355 | 59 |
| 195 | 3300025931 | Ga0207644_10000026 | Ga0207644_1000002686 | 59 |
| 196 | 3300025934 | Ga0207686_10007132 | Ga0207686_100071329 | 59 |
| 197 | 3300025934 | Ga0207686_10232270 | Ga0207686_102322702 | 59 |
| 198 | 3300025935 | Ga0207709_10027431 | Ga0207709_100274315 | 59 |
| 199 | 3300025935 | Ga0207709_10395512 | Ga0207709_103955122 | 59 |
| 200 | 3300025936 | Ga0207670_10004995 | Ga0207670_100049954 | 59 |
| 201 | 3300025936 | Ga0207670_10254969 | Ga0207670_102549692 | 59 |
| 202 | 3300025937 | Ga0207669_10547520 | Ga0207669_105475202 | 59 |
| 203 | 3300025938 | Ga0207704_10000551 | Ga0207704_1000055117 | 59 |
| 204 | 3300025938 | Ga0207704_10487180 | Ga0207704_104871802 | 59 |
| 205 | 3300025939 | Ga0207665_11027731 | Ga0207665_110277311 | 59 |
| 206 | 3300025940 | Ga0207691_10355343 | Ga0207691_103553432 | 59 |
| 207 | 3300025941 | Ga0207711_10000279 | Ga0207711_1000027933 | 59 |
| 208 | 3300025941 | Ga0207711_10021208 | Ga0207711_100212084 | 59 |
| 209 | 3300025941 | Ga0207711_10080793 | Ga0207711_100807932 | 59 |
| 210 | 3300025942 | Ga0207689_10000136 | Ga0207689_1000013658 | 59 |
| 211 | 3300025942 | Ga0207689_10002117 | Ga0207689_1000211715 | 59 |
| 212 | 3300025960 | Ga0207651_10934605 | Ga0207651_109346052 | 59 |
| 213 | 3300025961 | Ga0207712_10523795 | Ga0207712_105237952 | 59 |
| 214 | 3300025972 | Ga0207668_10566720 | Ga0207668_105667201 | 59 |
| 215 | 3300025986 | Ga0207658_10000001 | Ga0207658_10000001136 | 59 |
| 216 | 3300025986 | Ga0207658_10999171 | Ga0207658_109991712 | 59 |
| 217 | 3300025986 | Ga0207658_11009648 | Ga0207658_110096481 | 59 |
| 218 | 3300026035 | Ga0207703_10006745 | Ga0207703_100067453 | 59 |
| 219 | 3300026035 | Ga0207703_10026533 | Ga0207703_100265336 | 59 |
| 220 | 3300026035 | Ga0207703_10194547 | Ga0207703_101945471 | 59 |
| 221 | 3300026041 | Ga0207639_10297488 | Ga0207639_102974882 | 59 |
| 222 | 3300026041 | Ga0207639_10735962 | Ga0207639_107359622 | 59 |
| 223 | 3300026075 | Ga0207708_10001168 | Ga0207708_100011689 | 59 |
| 224 | 3300026088 | Ga0207641_10226320 | Ga0207641_102263202 | 59 |
| 225 | 3300026088 | Ga0207641_10264976 | Ga0207641_102649761 | 59 |
| 226 | 3300026089 | Ga0207648_10000485 | Ga0207648_1000048517 | 59 |
| 227 | 3300026089 | Ga0207648_10050348 | Ga0207648_100503484 | 59 |
| 228 | 3300026089 | Ga0207648_10525858 | Ga0207648_105258581 | 59 |
| 229 | 3300026095 | Ga0207676_10000001 | Ga0207676_100000011219 | 59 |
| 230 | 3300026095 | Ga0207676_10107818 | Ga0207676_101078182 | 59 |
| 231 | 3300026118 | Ga0207675_100000213 | Ga0207675_1000002135 | 59 |
| 232 | 3300026118 | Ga0207675_100026284 | Ga0207675_1000262848 | 59 |
| 233 | 3300026121 | Ga0207683_10012473 | Ga0207683_100124734 | 59 |
| 234 | 3300026121 | Ga0207683_10028497 | Ga0207683_100284975 | 59 |
| 235 | 3300027111 | Ga0209281_1017235 | Ga0209281_10172352 | 59 |
| 236 | 3300028379 | Ga0268266_10004153 | Ga0268266_1000415311 | 59 |
| 237 | 3300028379 | Ga0268266_10100747 | Ga0268266_101007472 | 59 |
| 238 | 3300028379 | Ga0268266_10297762 | Ga0268266_102977623 | 59 |
| 239 | 3300028380 | Ga0268265_10001823 | Ga0268265_100018238 | 59 |
| 240 | 3300028380 | Ga0268265_10105660 | Ga0268265_101056604 | 59 |
| 241 | 3300028380 | Ga0268265_10192601 | Ga0268265_101926012 | 59 |
| 242 | 3300028381 | Ga0268264_10000061 | Ga0268264_10000061133 | 59 |
| 243 | 3300028381 | Ga0268264_11212373 | Ga0268264_112123731 | 59 |
| 244 | 3300028558 | Ga0265326_10069355 | Ga0265326_100693551 | 59 |
| 245 | 3300028800 | Ga0265338_10002059 | Ga0265338_1000205922 | 59 |
| 246 | 3300031251 | Ga0265327_10000014 | Ga0265327_1000001486 | 59 |
| 247 | 3300031251 | Ga0265327_10000112 | Ga0265327_10000112121 | 59 |
| 248 | 3300031665 | Ga0316575_10004381 | Ga0316575_100043814 | 59 |
| 249 | 3300031665 | Ga0316575_10005135 | Ga0316575_100051354 | 59 |
| 250 | 3300031691 | Ga0316579_10160210 | Ga0316579_101602103 | 59 |
| 251 | 3300031691 | Ga0316579_10214753 | Ga0316579_102147532 | 59 |
| 252 | 3300031691 | Ga0316579_10295928 | Ga0316579_102959282 | 59 |
| 253 | 3300031727 | Ga0316576_10017223 | Ga0316576_100172232 | 59 |
| 254 | 3300031727 | Ga0316576_11075512 | Ga0316576_110755122 | 59 |
| 255 | 3300031728 | Ga0316578_10027557 | Ga0316578_100275572 | 59 |
| 256 | 3300031733 | Ga0316577_10005478 | Ga0316577_100054784 | 59 |
| 257 | 3300031733 | Ga0316577_10005970 | Ga0316577_100059704 | 59 |
| 258 | 3300031733 | Ga0316577_10144901 | Ga0316577_101449012 | 59 |
| 259 | 3300031901 | Ga0307406_11938690 | Ga0307406_119386902 | 59 |
| 260 | 3300032133 | Ga0316583_10157765 | Ga0316583_101577652 | 59 |
| 261 | 3300032137 | Ga0316585_10040995 | Ga0316585_100409952 | 59 |
| 262 | 3300032137 | Ga0316585_10090875 | Ga0316585_100908752 | 59 |
| 263 | 3300032137 | Ga0316585_10181481 | Ga0316585_101814812 | 59 |
| 264 | 3300032139 | Ga0316580_10006198 | Ga0316580_100061983 | 59 |
| 265 | 3300032139 | Ga0316580_10067414 | Ga0316580_100674142 | 59 |
| 266 | 3300032168 | Ga0316593_10006604 | Ga0316593_100066042 | 59 |
| 267 | 3300032168 | Ga0316593_10052998 | Ga0316593_100529982 | 59 |
| 268 | 3300032168 | Ga0316593_10081373 | Ga0316593_100813732 | 59 |
| 269 | 3300033529 | Ga0316587_1043055 | Ga0316587_10430552 | 59 |
| 270 | 3300033529 | Ga0316587_1048715 | Ga0316587_10487152 | 59 |
| 271 | 3300033529 | Ga0316587_1058203 | Ga0316587_10582032 | 59 |
| 272 | 3300033529 | Ga0316587_1060947 | Ga0316587_10609472 | 59 |
| 273 | 3300033529 | Ga0316587_1074827 | Ga0316587_10748273 | 59 |
| 274 | 3300033541 | Ga0316596_1027166 | Ga0316596_10271662 | 59 |
| 275 | 3300033541 | Ga0316596_1029341 | Ga0316596_10293412 | 59 |
| 276 | 3300033541 | Ga0316596_1039533 | Ga0316596_10395332 | 59 |
| 277 | 3300033541 | Ga0316596_1079008 | Ga0316596_10790082 | 59 |
| 278 | 3300035085 | Ga0373929_0250667 | Ga0373929_0250667_209_388 | 59 |
| 279 | 3300035092 | Ga0373952_0195494 | Ga0373952_0195494_119_298 | 59 |
| 280 | 3300035207 | Ga0373942_0198013 | Ga0373942_0198013_461_640 | 59 |
| 281 | 3300035398 | Ga0316574_0835399 | Ga0316574_0835399_141_320 | 59 |
| 282 | 3300035691 | Ga0373931_0339273 | Ga0373931_0339273_227_406 | 59 |
| 283 | 3300036647 | Ga0316582_0004572 | Ga0316582_0004572_3562_3741 | 59 |
| 284 | 3300036647 | Ga0316582_0027446 | Ga0316582_0027446_688_867 | 59 |
| 285 | 3300036712 | Ga0316584_0005066 | Ga0316584_0005066_4499_4678 | 59 |
| 286 | 3300036712 | Ga0316584_0008148 | Ga0316584_0008148_4715_4894 | 59 |
| 287 | 3300038725 | Ga0400484_32124 | Ga0400484_32124_4805_4984 | 59 |
| 288 | 3300038726 | Ga0400490_20117 | Ga0400490_20117_22186_22365 | 59 |
| 289 | 3300038726 | Ga0400490_31688 | Ga0400490_31688_10949_11128 | 59 |
| 290 | 3300038727 | Ga0400491_20800 | Ga0400491_20800_3931_4110 | 59 |
| 291 | 3300038727 | Ga0400491_21758 | Ga0400491_21758_608_787 | 59 |
| 292 | 3300038735 | Ga0400485_12746 | Ga0400485_12746_1488_1667 | 59 |
| 293 | 3300038741 | Ga0400488_18372 | Ga0400488_18372_4047_4226 | 59 |
| 294 | 3300038741 | Ga0400488_38656 | Ga0400488_38656_68_247 | 59 |
| 295 | 3300038741 | Ga0400488_46405 | Ga0400488_46405_1124_1303 | 59 |
| 296 | 3300038741 | Ga0400488_50084 | Ga0400488_50084_1284_1463 | 59 |
| 297 | 3300038742 | Ga0400486_06219 | Ga0400486_06219_965_1144 | 59 |
| 298 | 3300039062 | Ga0400483_006822 | Ga0400483_006822_615_794 | 59 |
| 299 | 3300039062 | Ga0400483_078683 | Ga0400483_078683_559_738 | 59 |
| 300 | 3300039062 | Ga0400483_085407 | Ga0400483_085407_543_722 | 59 |
| 301 | 3300039062 | Ga0400483_129431 | Ga0400483_129431_389_568 | 59 |
| 302 | 3300039062 | Ga0400483_170867 | Ga0400483_170867_3088_3267 | 59 |
| 303 | 3300039062 | Ga0400483_248196 | Ga0400483_248196_3717_3896 | 59 |
| 304 | 3300039062 | Ga0400483_254656 | Ga0400483_254656_1412_1591 | 59 |
| 305 | 3300039093 | Ga0400489_11346 | Ga0400489_11346_510_689 | 59 |
| 306 | 3300039093 | Ga0400489_58554 | Ga0400489_58554_546_725 | 59 |
| 307 | 3300039110 | Ga0400487_07419 | Ga0400487_07419_897_1076 | 59 |
| 308 | 3300039110 | Ga0400487_24791 | Ga0400487_24791_20992_21171 | 59 |
| 309 | 3300039110 | Ga0400487_41427 | Ga0400487_41427_3208_3387 | 59 |
| 310 | 3300039110 | Ga0400487_43791 | Ga0400487_43791_16183_16362 | 59 |
| 311 | 3300039447 | Ga0436361_0665703 | Ga0436361_0665703_337_519 | 59 |
| 312 | 3300039447 | Ga0436361_0944033 | Ga0436361_0944033_372_554 | 59 |
| 313 | 3300041496 | Ga0451839_0741211 | Ga0451839_0741211_561_740 | 59 |
| 314 | 3300042876 | Ga0451577_0296099 | Ga0451577_0296099_621_803 | 59 |
| 315 | 3300042876 | Ga0451577_0434525 | Ga0451577_0434525_76_258 | 59 |
| 316 | 3300044712 | Ga0453684_1185901 | Ga0453684_1185901_204_386 | 59 |
| 317 | 3300045051 | Ga0451576_0001131 | Ga0451576_0001131_15653_15835 | 59 |
| 318 | 3300047445 | Ga0495677_0396098 | Ga0495677_0396098_323_505 | 59 |
| 319 | 3300048911 | Ga0496108_1287625 | Ga0496108_1287625_347_529 | 59 |
| 320 | 3300048917 | Ga0496114_0705029 | Ga0496114_0705029_617_796 | 59 |
| 321 | 3300048927 | Ga0496124_0003292 | Ga0496124_0003292_7104_7286 | 59 |
| 322 | 3300048927 | Ga0496124_0111130 | Ga0496124_0111130_340_522 | 59 |
| 323 | 3300048928 | Ga0496125_0085562 | Ga0496125_0085562_1526_1708 | 59 |
| 324 | 3300048929 | Ga0496126_1369376 | Ga0496126_1369376_228_410 | 59 |
| 325 | 3300049541 | Ga0501325_012123 | Ga0501325_012123_407_589 | 59 |
| 326 | 3300049575 | Ga0501039_1264232 | Ga0501039_1264232_165_347 | 59 |
| 327 | 3300049822 | Ga0501035_0568797 | Ga0501035_0568797_340_522 | 59 |
| 328 | 3300053098 | Ga0500650_0000034 | Ga0500650_0000034_21348_21530 | 59 |
| 329 | 3300053102 | Ga0500554_257634 | Ga0500554_257634_300_482 | 59 |
| 330 | 3300053119 | Ga0500595_025222 | Ga0500595_025222_1588_1770 | 59 |
| 331 | 3300053148 | Ga0500590_339989 | Ga0500590_339989_127_309 | 59 |
| 332 | 3300053177 | Ga0500636_0070190 | Ga0500636_0070190_1580_1762 | 59 |
| 333 | 3300055283 | Ga0500661_004201 | Ga0500661_004201_1627_1809 | 59 |
| 334 | 3300059477 | Ga0587084_052553 | Ga0587084_052553_144_326 | 59 |
| 335 | 3300059478 | Ga0587093_075567 | Ga0587093_075567_370_552 | 59 |
| 336 | 3300059491 | Ga0587070_054776 | Ga0587070_054776_171_353 | 59 |
| 337 | 3300059493 | Ga0587077_087858 | Ga0587077_087858_248_430 | 59 |
| 338 | 3300059503 | Ga0587080_114324 | Ga0587080_114324_175_357 | 59 |
| 339 | 3300059506 | Ga0587085_015437 | Ga0587085_015437_748_930 | 59 |
| 340 | 3300059507 | Ga0587086_049489 | Ga0587086_049489_38_220 | 59 |
| 341 | 3300059508 | Ga0587088_047633 | Ga0587088_047633_118_300 | 59 |
| 342 | 3300059510 | Ga0587090_026977 | Ga0587090_026977_211_393 | 59 |
| 343 | 3300059511 | Ga0587091_051032 | Ga0587091_051032_424_606 | 59 |
| 344 | 3300059513 | Ga0587094_073400 | Ga0587094_073400_195_377 | 59 |
| 345 | 3300059514 | Ga0587095_023410 | Ga0587095_023410_118_300 | 59 |
| 346 | 3300059607 | Ga0587125_011724 | Ga0587125_011724_523_705 | 59 |
| 347 | 3300059608 | Ga0587129_028744 | Ga0587129_028744_112_294 | 59 |
| 348 | 3300059623 | Ga0587101_091602 | Ga0587101_091602_374_556 | 59 |
| 349 | 3300059624 | Ga0587109_056737 | Ga0587109_056737_102_284 | 59 |
| 350 | 3300059627 | Ga0587117_014876 | Ga0587117_014876_218_400 | 59 |
| 351 | 3300059630 | Ga0587128_141479 | Ga0587128_141479_314_496 | 59 |
| 352 | 3300059631 | Ga0587130_033675 | Ga0587130_033675_24_206 | 59 |
| 353 | 3300059639 | Ga0587062_057243 | Ga0587062_057243_101_283 | 59 |
| 354 | 3300059641 | Ga0587068_026769 | Ga0587068_026769_545_727 | 59 |
| 355 | 3300059642 | Ga0587069_136651 | Ga0587069_136651_255_437 | 59 |
| 356 | 3300059645 | Ga0587076_078552 | Ga0587076_078552_401_583 | 59 |
| 357 | 3300059647 | Ga0587079_184519 | Ga0587079_184519_351_533 | 59 |
| 358 | 3300059648 | Ga0587100_022084 | Ga0587100_022084_195_377 | 59 |
| 359 | 3300059653 | Ga0587108_022809 | Ga0587108_022809_336_518 | 59 |
| 360 | 3300059657 | Ga0587118_25044 | Ga0587118_25044_227_409 | 59 |
| 361 | 3300060346 | Ga0587111_0029070 | Ga0587111_0029070_671_853 | 59 |
| 362 | 3300060353 | Ga0501082_1408576 | Ga0501082_1408576_391_573 | 59 |
| 363 | 3300009176 | Ga0105242_11900004 | Ga0105242_119000042 | 60 |
| 364 | 3300032168 | Ga0316593_10055697 | Ga0316593_100556972 | 60 |
| 365 | 3300033524 | Ga0316592_1032534 | Ga0316592_10325342 | 60 |
| 366 | 3300033528 | Ga0316588_1027082 | Ga0316588_10270822 | 60 |
| 367 | 3300033529 | Ga0316587_1043065 | Ga0316587_10430652 | 60 |
| 368 | 3300033541 | Ga0316596_1001400 | Ga0316596_10014005 | 60 |
| 369 | 3300036647 | Ga0316582_0211511 | Ga0316582_0211511_312_497 | 60 |
| 370 | 3300036712 | Ga0316584_0027572 | Ga0316584_0027572_184_369 | 60 |
| 371 | iso_pu_bacteria | 2547132130 | 2547503452 | 60 |
| 372 | iso_pu_bacteria | 2571042365 | 2572255282 | 60 |
| 373 | iso_pu_bacteria | 2643221559 | 2643818717 | 60 |
| 374 | iso_pu_bacteria | 2643221573 | 2643878372 | 60 |
| 375 | iso_pu_bacteria | 2643221579 | 2643908166 | 60 |
| 376 | iso_pu_bacteria | 2643221586 | 2643940968 | 60 |
| 377 | iso_pu_bacteria | 2643221612 | 2644079990 | 60 |
| 378 | iso_pu_bacteria | 2643221695 | 2644529935 | 60 |
| 379 | iso_pu_bacteria | 2643221720 | 2644659676 | 60 |
| 380 | iso_pu_bacteria | 2643221727 | 2644695585 | 60 |
| 381 | iso_pu_bacteria | 2643221728 | 2644700579 | 60 |
| 382 | iso_pu_bacteria | 2687453130 | 2687582671 | 60 |
| 383 | iso_pu_bacteria | 2747842428 | 2747947843 | 60 |
| 384 | iso_pu_bacteria | 2765235840 | 2765577915 | 60 |
| 385 | iso_pu_bacteria | 2816332141 | 2816515985 | 60 |
| 386 | iso_pu_bacteria | 2818991457 | 2819660509 | 60 |
| 387 | iso_pu_bacteria | 2842391507 | 2842394295 | 60 |
| 388 | iso_pu_bacteria | 2842757796 | 2842759880 | 60 |
| 389 | iso_pu_bacteria | 2842780639 | 2842781418 | 60 |
| 390 | iso_pu_bacteria | 2852684882 | 2852688958 | 60 |
| 391 | iso_pu_bacteria | 2874220319 | 2874220537 | 60 |
| 392 | iso_pu_bacteria | 2919089067 | 2919093259 | 60 |
| 393 | iso_pu_bacteria | 2919130084 | 2919130217 | 60 |
| 394 | iso_pu_bacteria | 2919134579 | 2919134807 | 60 |
| 395 | iso_pu_bacteria | 2923516293 | 2923518839 | 60 |
| 396 | iso_pu_bacteria | 2928496128 | 2928498603 | 60 |
| 397 | iso_pu_bacteria | 2929195423 | 2929198783 | 60 |
| 398 | iso_pu_bacteria | 2931380184 | 2931381830 | 60 |
| 399 | iso_pu_bacteria | 2937610967 | 2937611403 | 60 |
| 400 | iso_pu_bacteria | 2939626828 | 2939629840 | 60 |
| 401 | iso_pu_bacteria | 2941489479 | 2941493421 | 60 |
| 402 | iso_pu_bacteria | 2961047084 | 2961047302 | 60 |
| 403 | iso_pu_bacteria | 2961064222 | 2961068653 | 60 |
| 404 | iso_pu_bacteria | 2995948881 | 2995952484 | 60 |
| 405 | iso_pu_bacteria | 8002869464 | 8002872436 | 60 |
| 406 | iso_pu_bacteria | 8003014200 | 8003016329 | 60 |
| 407 | iso_pu_bacteria | 8021622325 | 8021622377 | 60 |
| 408 | iso_pu_bacteria | 8021626552 | 8021626898 | 60 |
| 409 | iso_pu_bacteria | 8021648035 | 8021648163 | 60 |
| 410 | 3300013105 | Ga0157369_11680401 | Ga0157369_116804012 | 61 |
| 411 | 3300031727 | Ga0316576_10068103 | Ga0316576_100681032 | 61 |
| 412 | 3300035398 | Ga0316574_0068386 | Ga0316574_0068386_1519_1707 | 61 |
| 413 | 3300036712 | Ga0316584_0101289 | Ga0316584_0101289_1632_1820 | 61 |
| 414 | 3300037418 | Ga0395900_0000894 | Ga0395900_0000894_33892_34092 | 61 |
| 415 | 3300004798 | Ga0058859_11722583 | Ga0058859_117225831 | 62 |
| 416 | 3300035398 | Ga0316574_0408235 | Ga0316574_0408235_310_501 | 62 |
| 417 | 3300035398 | Ga0316574_0942254 | Ga0316574_0942254_98_289 | 62 |
| 418 | 3300059643 | Ga0587072_075379 | Ga0587072_075379_263_463 | 62 |
| 419 | 3300005289 | Ga0065704_10072102 | Ga0065704_100721022 | 63 |
| 420 | 3300005293 | Ga0065715_10078237 | Ga0065715_100782371 | 63 |
| 421 | 3300005293 | Ga0065715_11011924 | Ga0065715_110119242 | 63 |
| 422 | 3300005347 | Ga0070668_101473393 | Ga0070668_1014733931 | 63 |
| 423 | 3300005355 | Ga0070671_100739016 | Ga0070671_1007390162 | 63 |
| 424 | 3300005438 | Ga0070701_11400941 | Ga0070701_114009411 | 63 |
| 425 | 3300005456 | Ga0070678_102242385 | Ga0070678_1022423851 | 63 |
| 426 | 3300005834 | Ga0068851_10453043 | Ga0068851_104530432 | 63 |
| 427 | 3300006881 | Ga0068865_100283874 | Ga0068865_1002838742 | 63 |
| 428 | 3300009551 | Ga0105238_11528537 | Ga0105238_115285372 | 63 |
| 429 | 3300012478 | Ga0157328_1003518 | Ga0157328_10035182 | 63 |
| 430 | 3300012485 | Ga0157325_1008442 | Ga0157325_10084421 | 63 |
| 431 | 3300012488 | Ga0157343_1006429 | Ga0157343_10064292 | 63 |
| 432 | 3300012497 | Ga0157319_1023389 | Ga0157319_10233892 | 63 |
| 433 | 3300012498 | Ga0157345_1006098 | Ga0157345_10060982 | 63 |
| 434 | 3300012500 | Ga0157314_1009914 | Ga0157314_10099142 | 63 |
| 435 | 3300012510 | Ga0157316_1025939 | Ga0157316_10259392 | 63 |
| 436 | 3300012510 | Ga0157316_1062919 | Ga0157316_10629192 | 63 |
| 437 | 3300012512 | Ga0157327_1006828 | Ga0157327_10068282 | 63 |
| 438 | 3300013104 | Ga0157370_11208342 | Ga0157370_112083422 | 63 |
| 439 | 3300014326 | Ga0157380_13493985 | Ga0157380_134939852 | 63 |
| 440 | 3300017792 | Ga0163161_10784124 | Ga0163161_107841242 | 63 |
| 441 | 3300025321 | Ga0207656_10334120 | Ga0207656_103341202 | 63 |
| 442 | 3300025924 | Ga0207694_11168254 | Ga0207694_111682542 | 63 |
| 443 | 3300025931 | Ga0207644_10671696 | Ga0207644_106716962 | 63 |
| 444 | 3300025981 | Ga0207640_10372839 | Ga0207640_103728391 | 63 |
| 445 | 3300026121 | Ga0207683_10974922 | Ga0207683_109749222 | 63 |
| 446 | 3300031691 | Ga0316579_10059399 | Ga0316579_100593994 | 63 |
| 447 | 3300031824 | Ga0307413_10464157 | Ga0307413_104641572 | 63 |
| 448 | 3300031995 | Ga0307409_101310740 | Ga0307409_1013107402 | 63 |
| 449 | 3300032005 | Ga0307411_10983644 | Ga0307411_109836442 | 63 |
| 450 | 3300032168 | Ga0316593_10195575 | Ga0316593_101955751 | 63 |
| 451 | 3300035398 | Ga0316574_0199288 | Ga0316574_0199288_117_311 | 63 |
| 452 | 3300039453 | Ga0436362_0226625 | Ga0436362_0226625_593_787 | 63 |
| 453 | 3300041443 | Ga0451789_0793241 | Ga0451789_0793241_305_499 | 63 |
| 454 | 3300041503 | Ga0451847_0662423 | Ga0451847_0662423_748_942 | 63 |
| 455 | 3300042876 | Ga0451577_0423063 | Ga0451577_0423063_740_934 | 63 |
| 456 | 3300044712 | Ga0453684_1361098 | Ga0453684_1361098_368_562 | 63 |
| 457 | 3300046664 | Ga0495659_0090797 | Ga0495659_0090797_628_834 | 63 |
| 458 | 3300049570 | Ga0501033_0141497 | Ga0501033_0141497_267_470 | 63 |
| 459 | 3300049571 | Ga0501034_0239998 | Ga0501034_0239998_1334_1537 | 63 |
| 460 | 3300049573 | Ga0501037_0102200 | Ga0501037_0102200_993_1196 | 63 |
| 461 | 3300049573 | Ga0501037_0465188 | Ga0501037_0465188_628_831 | 63 |
| 462 | 3300049581 | Ga0501047_0117022 | Ga0501047_0117022_680_883 | 63 |
| 463 | 3300049822 | Ga0501035_0007793 | Ga0501035_0007793_5142_5345 | 63 |
| 464 | 3300053120 | Ga0500597_231227 | Ga0500597_231227_426_620 | 63 |
| 465 | 3300059505 | Ga0587083_0221326 | Ga0587083_0221326_138_332 | 63 |
| 466 | 3300002705 | JGI25156J39149_1002391 | JGI25156J39149_10023915 | 64 |
| 467 | 3300002705 | JGI25156J39149_1004783 | JGI25156J39149_10047834 | 64 |
| 468 | 3300002741 | JGI25157J39369_1002228 | JGI25157J39369_10022285 | 64 |
| 469 | 3300003187 | JGI25151J46595_10036365 | JGI25151J46595_100363652 | 64 |
| 470 | 3300003320 | rootH2_10058115 | rootH2_100581152 | 64 |
| 471 | 3300003752 | Ga0055539_1000930 | Ga0055539_10009305 | 64 |
| 472 | 3300003756 | Ga0055533_1000474 | Ga0055533_10004745 | 64 |
| 473 | 3300003759 | Ga0055525_1000097 | Ga0055525_100009746 | 64 |
| 474 | 3300003760 | Ga0055527_1000198 | Ga0055527_100019827 | 64 |
| 475 | 3300003760 | Ga0055527_1000344 | Ga0055527_100034417 | 64 |
| 476 | 3300003760 | Ga0055527_1000513 | Ga0055527_100051312 | 64 |
| 477 | 3300003761 | Ga0055535_1000795 | Ga0055535_10007959 | 64 |
| 478 | 3300003761 | Ga0055535_1003536 | Ga0055535_10035362 | 64 |
| 479 | 3300003762 | Ga0055542_1000441 | Ga0055542_100044127 | 64 |
| 480 | 3300003762 | Ga0055542_1003400 | Ga0055542_10034005 | 64 |
| 481 | 3300003763 | Ga0055529_1000591 | Ga0055529_100059118 | 64 |
| 482 | 3300003763 | Ga0055529_1001024 | Ga0055529_10010245 | 64 |
| 483 | 3300003794 | Ga0055531_10003401 | Ga0055531_100034017 | 64 |
| 484 | 3300003856 | Ga0058692_1000017 | Ga0058692_100001715 | 64 |
| 485 | 3300005289 | Ga0065704_10082305 | Ga0065704_100823052 | 64 |
| 486 | 3300005328 | Ga0070676_10025259 | Ga0070676_100252594 | 64 |
| 487 | 3300005329 | Ga0070683_100554473 | Ga0070683_1005544732 | 64 |
| 488 | 3300005331 | Ga0070670_100161863 | Ga0070670_1001618632 | 64 |
| 489 | 3300005331 | Ga0070670_100598518 | Ga0070670_1005985181 | 64 |
| 490 | 3300005331 | Ga0070670_101439520 | Ga0070670_1014395202 | 64 |
| 491 | 3300005331 | Ga0070670_101644392 | Ga0070670_1016443922 | 64 |
| 492 | 3300005334 | Ga0068869_100017947 | Ga0068869_1000179474 | 64 |
| 493 | 3300005334 | Ga0068869_100384401 | Ga0068869_1003844012 | 64 |
| 494 | 3300005334 | Ga0068869_100727978 | Ga0068869_1007279782 | 64 |
| 495 | 3300005334 | Ga0068869_101240323 | Ga0068869_1012403231 | 64 |
| 496 | 3300005335 | Ga0070666_10212849 | Ga0070666_102128492 | 64 |
| 497 | 3300005335 | Ga0070666_10538517 | Ga0070666_105385171 | 64 |
| 498 | 3300005337 | Ga0070682_101194433 | Ga0070682_1011944332 | 64 |
| 499 | 3300005337 | Ga0070682_101753694 | Ga0070682_1017536941 | 64 |
| 500 | 3300005338 | Ga0068868_100015146 | Ga0068868_1000151464 | 64 |
| 501 | 3300005338 | Ga0068868_100373544 | Ga0068868_1003735442 | 64 |
| 502 | 3300005340 | Ga0070689_101148206 | Ga0070689_1011482062 | 64 |
| 503 | 3300005343 | Ga0070687_100455327 | Ga0070687_1004553271 | 64 |
| 504 | 3300005347 | Ga0070668_100044400 | Ga0070668_1000444005 | 64 |
| 505 | 3300005347 | Ga0070668_100702951 | Ga0070668_1007029512 | 64 |
| 506 | 3300005347 | Ga0070668_101765648 | Ga0070668_1017656481 | 64 |
| 507 | 3300005353 | Ga0070669_100054718 | Ga0070669_1000547183 | 64 |
| 508 | 3300005353 | Ga0070669_100562965 | Ga0070669_1005629651 | 64 |
| 509 | 3300005354 | Ga0070675_100076871 | Ga0070675_1000768712 | 64 |
| 510 | 3300005354 | Ga0070675_100276957 | Ga0070675_1002769572 | 64 |
| 511 | 3300005355 | Ga0070671_100122199 | Ga0070671_1001221993 | 64 |
| 512 | 3300005356 | Ga0070674_100285205 | Ga0070674_1002852052 | 64 |
| 513 | 3300005356 | Ga0070674_100450220 | Ga0070674_1004502202 | 64 |
| 514 | 3300005356 | Ga0070674_100689548 | Ga0070674_1006895481 | 64 |
| 515 | 3300005364 | Ga0070673_100031734 | Ga0070673_1000317343 | 64 |
| 516 | 3300005364 | Ga0070673_100459992 | Ga0070673_1004599922 | 64 |
| 517 | 3300005364 | Ga0070673_102142887 | Ga0070673_1021428872 | 64 |
| 518 | 3300005367 | Ga0070667_100166193 | Ga0070667_1001661933 | 64 |
| 519 | 3300005367 | Ga0070667_100506787 | Ga0070667_1005067871 | 64 |
| 520 | 3300005434 | Ga0070709_11337362 | Ga0070709_113373621 | 64 |
| 521 | 3300005435 | Ga0070714_100868554 | Ga0070714_1008685542 | 64 |
| 522 | 3300005439 | Ga0070711_100121481 | Ga0070711_1001214812 | 64 |
| 523 | 3300005455 | Ga0070663_101850146 | Ga0070663_1018501462 | 64 |
| 524 | 3300005456 | Ga0070678_100039342 | Ga0070678_1000393423 | 64 |
| 525 | 3300005456 | Ga0070678_100317971 | Ga0070678_1003179712 | 64 |
| 526 | 3300005456 | Ga0070678_100894115 | Ga0070678_1008941152 | 64 |
| 527 | 3300005457 | Ga0070662_100316250 | Ga0070662_1003162502 | 64 |
| 528 | 3300005457 | Ga0070662_101583941 | Ga0070662_1015839411 | 64 |
| 529 | 3300005458 | Ga0070681_10608043 | Ga0070681_106080431 | 64 |
| 530 | 3300005459 | Ga0068867_100025912 | Ga0068867_1000259122 | 64 |
| 531 | 3300005459 | Ga0068867_100146165 | Ga0068867_1001461652 | 64 |
| 532 | 3300005459 | Ga0068867_100299989 | Ga0068867_1002999892 | 64 |
| 533 | 3300005530 | Ga0070679_101574454 | Ga0070679_1015744542 | 64 |
| 534 | 3300005539 | Ga0068853_100401752 | Ga0068853_1004017522 | 64 |
| 535 | 3300005539 | Ga0068853_100490573 | Ga0068853_1004905732 | 64 |
| 536 | 3300005543 | Ga0070672_100036695 | Ga0070672_1000366953 | 64 |
| 537 | 3300005544 | Ga0070686_101292276 | Ga0070686_1012922762 | 64 |
| 538 | 3300005547 | Ga0070693_100022625 | Ga0070693_1000226252 | 64 |
| 539 | 3300005547 | Ga0070693_100130569 | Ga0070693_1001305692 | 64 |
| 540 | 3300005548 | Ga0070665_100013638 | Ga0070665_1000136385 | 64 |
| 541 | 3300005548 | Ga0070665_100112949 | Ga0070665_1001129494 | 64 |
| 542 | 3300005548 | Ga0070665_100319643 | Ga0070665_1003196432 | 64 |
| 543 | 3300005548 | Ga0070665_101040540 | Ga0070665_1010405402 | 64 |
| 544 | 3300005548 | Ga0070665_101734318 | Ga0070665_1017343182 | 64 |
| 545 | 3300005577 | Ga0068857_100469001 | Ga0068857_1004690012 | 64 |
| 546 | 3300005577 | Ga0068857_101505174 | Ga0068857_1015051742 | 64 |
| 547 | 3300005577 | Ga0068857_101882781 | Ga0068857_1018827812 | 64 |
| 548 | 3300005577 | Ga0068857_102202928 | Ga0068857_1022029282 | 64 |
| 549 | 3300005578 | Ga0068854_101133922 | Ga0068854_1011339222 | 64 |
| 550 | 3300005614 | Ga0068856_100012880 | Ga0068856_1000128809 | 64 |
| 551 | 3300005614 | Ga0068856_100013948 | Ga0068856_1000139484 | 64 |
| 552 | 3300005614 | Ga0068856_100017128 | Ga0068856_1000171285 | 64 |
| 553 | 3300005615 | Ga0070702_100639653 | Ga0070702_1006396531 | 64 |
| 554 | 3300005616 | Ga0068852_100404198 | Ga0068852_1004041982 | 64 |
| 555 | 3300005616 | Ga0068852_102523817 | Ga0068852_1025238172 | 64 |
| 556 | 3300005617 | Ga0068859_100061758 | Ga0068859_1000617582 | 64 |
| 557 | 3300005617 | Ga0068859_100083014 | Ga0068859_1000830144 | 64 |
| 558 | 3300005617 | Ga0068859_100163932 | Ga0068859_1001639324 | 64 |
| 559 | 3300005618 | Ga0068864_100145020 | Ga0068864_1001450202 | 64 |
| 560 | 3300005718 | Ga0068866_10078039 | Ga0068866_100780392 | 64 |
| 561 | 3300005718 | Ga0068866_10151511 | Ga0068866_101515112 | 64 |
| 562 | 3300005718 | Ga0068866_10336904 | Ga0068866_103369042 | 64 |
| 563 | 3300005719 | Ga0068861_100199308 | Ga0068861_1001993082 | 64 |
| 564 | 3300005834 | Ga0068851_10436210 | Ga0068851_104362102 | 64 |
| 565 | 3300005834 | Ga0068851_10553829 | Ga0068851_105538292 | 64 |
| 566 | 3300005840 | Ga0068870_10165818 | Ga0068870_101658182 | 64 |
| 567 | 3300005841 | Ga0068863_100292140 | Ga0068863_1002921402 | 64 |
| 568 | 3300005841 | Ga0068863_100484640 | Ga0068863_1004846402 | 64 |
| 569 | 3300005843 | Ga0068860_100007326 | Ga0068860_1000073265 | 64 |
| 570 | 3300005843 | Ga0068860_100436870 | Ga0068860_1004368702 | 64 |
| 571 | 3300005843 | Ga0068860_101628041 | Ga0068860_1016280411 | 64 |
| 572 | 3300005844 | Ga0068862_100529938 | Ga0068862_1005299382 | 64 |
| 573 | 3300006163 | Ga0070715_10512399 | Ga0070715_105123992 | 64 |
| 574 | 3300006237 | Ga0097621_100021221 | Ga0097621_1000212216 | 64 |
| 575 | 3300006237 | Ga0097621_100079713 | Ga0097621_1000797133 | 64 |
| 576 | 3300006237 | Ga0097621_101609756 | Ga0097621_1016097561 | 64 |
| 577 | 3300006358 | Ga0068871_100055319 | Ga0068871_1000553194 | 64 |
| 578 | 3300006358 | Ga0068871_100060853 | Ga0068871_1000608534 | 64 |
| 579 | 3300006358 | Ga0068871_100675654 | Ga0068871_1006756542 | 64 |
| 580 | 3300006844 | Ga0075428_102214397 | Ga0075428_1022143972 | 64 |
| 581 | 3300006871 | Ga0075434_100468902 | Ga0075434_1004689022 | 64 |
| 582 | 3300006881 | Ga0068865_100002785 | Ga0068865_10000278512 | 64 |
| 583 | 3300006881 | Ga0068865_100015225 | Ga0068865_1000152255 | 64 |
| 584 | 3300006881 | Ga0068865_100081427 | Ga0068865_1000814274 | 64 |
| 585 | 3300006881 | Ga0068865_100494921 | Ga0068865_1004949212 | 64 |
| 586 | 3300006931 | Ga0097620_100061758 | Ga0097620_1000617585 | 64 |
| 587 | 3300006931 | Ga0097620_100083015 | Ga0097620_1000830154 | 64 |
| 588 | 3300006931 | Ga0097620_100163932 | Ga0097620_1001639324 | 64 |
| 589 | 3300009098 | Ga0105245_10449010 | Ga0105245_104490102 | 64 |
| 590 | 3300009545 | Ga0105237_10770502 | Ga0105237_107705021 | 64 |
| 591 | 3300010375 | Ga0105239_10012321 | Ga0105239_100123216 | 64 |
| 592 | 3300013296 | Ga0157374_10174704 | Ga0157374_101747042 | 64 |
| 593 | 3300013308 | Ga0157375_10255335 | Ga0157375_102553352 | 64 |
| 594 | 3300014969 | Ga0157376_10043903 | Ga0157376_100439033 | 64 |
| 595 | 3300014969 | Ga0157376_13005034 | Ga0157376_130050341 | 64 |
| 596 | 3300021384 | Ga0213876_10681524 | Ga0213876_106815242 | 64 |
| 597 | 3300025226 | Ga0209674_100506 | Ga0209674_1005067 | 64 |
| 598 | 3300025228 | Ga0209672_100007 | Ga0209672_100007180 | 64 |
| 599 | 3300025228 | Ga0209672_100078 | Ga0209672_10007874 | 64 |
| 600 | 3300025230 | Ga0209563_100079 | Ga0209563_10007945 | 64 |
| 601 | 3300025242 | Ga0209258_100012 | Ga0209258_100012628 | 64 |
| 602 | 3300025242 | Ga0209258_100046 | Ga0209258_100046157 | 64 |
| 603 | 3300025250 | Ga0209026_1000285 | Ga0209026_100028546 | 64 |
| 604 | 3300025253 | Ga0209677_101982 | Ga0209677_1019824 | 64 |
| 605 | 3300025254 | Ga0209148_1000014 | Ga0209148_100001428 | 64 |
| 606 | 3300025254 | Ga0209148_1000098 | Ga0209148_100009828 | 64 |
| 607 | 3300025256 | Ga0209759_1000460 | Ga0209759_100046035 | 64 |
| 608 | 3300025272 | Ga0209455_1000010 | Ga0209455_1000010180 | 64 |
| 609 | 3300025272 | Ga0209455_1000126 | Ga0209455_100012686 | 64 |
| 610 | 3300025321 | Ga0207656_10676664 | Ga0207656_106766642 | 64 |
| 611 | 3300025899 | Ga0207642_10172119 | Ga0207642_101721192 | 64 |
| 612 | 3300025899 | Ga0207642_10489262 | Ga0207642_104892622 | 64 |
| 613 | 3300025899 | Ga0207642_10528222 | Ga0207642_105282222 | 64 |
| 614 | 3300025903 | Ga0207680_10071444 | Ga0207680_100714445 | 64 |
| 615 | 3300025903 | Ga0207680_10399268 | Ga0207680_103992681 | 64 |
| 616 | 3300025906 | Ga0207699_10609128 | Ga0207699_106091282 | 64 |
| 617 | 3300025907 | Ga0207645_10008655 | Ga0207645_100086557 | 64 |
| 618 | 3300025907 | Ga0207645_10175099 | Ga0207645_101750992 | 64 |
| 619 | 3300025907 | Ga0207645_10375117 | Ga0207645_103751172 | 64 |
| 620 | 3300025908 | Ga0207643_10039399 | Ga0207643_100393993 | 64 |
| 621 | 3300025909 | Ga0207705_10689888 | Ga0207705_106898881 | 64 |
| 622 | 3300025911 | Ga0207654_10064120 | Ga0207654_100641204 | 64 |
| 623 | 3300025911 | Ga0207654_10708572 | Ga0207654_107085722 | 64 |
| 624 | 3300025912 | Ga0207707_10351118 | Ga0207707_103511182 | 64 |
| 625 | 3300025913 | Ga0207695_10001746 | Ga0207695_1000174620 | 64 |
| 626 | 3300025914 | Ga0207671_10001938 | Ga0207671_1000193814 | 64 |
| 627 | 3300025914 | Ga0207671_10344282 | Ga0207671_103442822 | 64 |
| 628 | 3300025918 | Ga0207662_10335686 | Ga0207662_103356862 | 64 |
| 629 | 3300025923 | Ga0207681_10129882 | Ga0207681_101298821 | 64 |
| 630 | 3300025923 | Ga0207681_10823772 | Ga0207681_108237722 | 64 |
| 631 | 3300025924 | Ga0207694_10000627 | Ga0207694_1000062727 | 64 |
| 632 | 3300025924 | Ga0207694_10016648 | Ga0207694_100166487 | 64 |
| 633 | 3300025925 | Ga0207650_10049228 | Ga0207650_100492284 | 64 |
| 634 | 3300025926 | Ga0207659_10330157 | Ga0207659_103301572 | 64 |
| 635 | 3300025927 | Ga0207687_10795396 | Ga0207687_107953961 | 64 |
| 636 | 3300025929 | Ga0207664_10748583 | Ga0207664_107485832 | 64 |
| 637 | 3300025931 | Ga0207644_10165775 | Ga0207644_101657753 | 64 |
| 638 | 3300025933 | Ga0207706_10334312 | Ga0207706_103343122 | 64 |
| 639 | 3300025933 | Ga0207706_10423252 | Ga0207706_104232522 | 64 |
| 640 | 3300025934 | Ga0207686_10000895 | Ga0207686_1000089513 | 64 |
| 641 | 3300025934 | Ga0207686_10390735 | Ga0207686_103907352 | 64 |
| 642 | 3300025934 | Ga0207686_10829667 | Ga0207686_108296671 | 64 |
| 643 | 3300025937 | Ga0207669_10337081 | Ga0207669_103370812 | 64 |
| 644 | 3300025937 | Ga0207669_10353411 | Ga0207669_103534112 | 64 |
| 645 | 3300025938 | Ga0207704_10053746 | Ga0207704_100537463 | 64 |
| 646 | 3300025938 | Ga0207704_10158932 | Ga0207704_101589322 | 64 |
| 647 | 3300025938 | Ga0207704_10514258 | Ga0207704_105142582 | 64 |
| 648 | 3300025938 | Ga0207704_11451412 | Ga0207704_114514122 | 64 |
| 649 | 3300025940 | Ga0207691_10018155 | Ga0207691_100181558 | 64 |
| 650 | 3300025940 | Ga0207691_10019550 | Ga0207691_100195507 | 64 |
| 651 | 3300025941 | Ga0207711_10042177 | Ga0207711_100421775 | 64 |
| 652 | 3300025942 | Ga0207689_10172903 | Ga0207689_101729033 | 64 |
| 653 | 3300025942 | Ga0207689_10194656 | Ga0207689_101946561 | 64 |
| 654 | 3300025949 | Ga0207667_10222068 | Ga0207667_102220682 | 64 |
| 655 | 3300025960 | Ga0207651_10350869 | Ga0207651_103508691 | 64 |
| 656 | 3300025960 | Ga0207651_10455422 | Ga0207651_104554222 | 64 |
| 657 | 3300025961 | Ga0207712_10187403 | Ga0207712_101874033 | 64 |
| 658 | 3300025961 | Ga0207712_10299585 | Ga0207712_102995851 | 64 |
| 659 | 3300025972 | Ga0207668_10050976 | Ga0207668_100509761 | 64 |
| 660 | 3300025981 | Ga0207640_10448249 | Ga0207640_104482492 | 64 |
| 661 | 3300025981 | Ga0207640_11140991 | Ga0207640_111409911 | 64 |
| 662 | 3300025986 | Ga0207658_10043506 | Ga0207658_100435065 | 64 |
| 663 | 3300025986 | Ga0207658_10155909 | Ga0207658_101559093 | 64 |
| 664 | 3300025986 | Ga0207658_10186518 | Ga0207658_101865182 | 64 |
| 665 | 3300026023 | Ga0207677_10052958 | Ga0207677_100529582 | 64 |
| 666 | 3300026023 | Ga0207677_10473799 | Ga0207677_104737991 | 64 |
| 667 | 3300026023 | Ga0207677_10735967 | Ga0207677_107359672 | 64 |
| 668 | 3300026035 | Ga0207703_12312324 | Ga0207703_123123241 | 64 |
| 669 | 3300026041 | Ga0207639_10130378 | Ga0207639_101303783 | 64 |
| 670 | 3300026041 | Ga0207639_11372766 | Ga0207639_113727661 | 64 |
| 671 | 3300026041 | Ga0207639_11430050 | Ga0207639_114300502 | 64 |
| 672 | 3300026041 | Ga0207639_11572289 | Ga0207639_115722891 | 64 |
| 673 | 3300026078 | Ga0207702_10009097 | Ga0207702_100090975 | 64 |
| 674 | 3300026078 | Ga0207702_10031237 | Ga0207702_100312372 | 64 |
| 675 | 3300026078 | Ga0207702_10178517 | Ga0207702_101785172 | 64 |
| 676 | 3300026088 | Ga0207641_10337426 | Ga0207641_103374262 | 64 |
| 677 | 3300026088 | Ga0207641_10390777 | Ga0207641_103907772 | 64 |
| 678 | 3300026089 | Ga0207648_10084228 | Ga0207648_100842284 | 64 |
| 679 | 3300026089 | Ga0207648_10372947 | Ga0207648_103729472 | 64 |
| 680 | 3300026095 | Ga0207676_10399217 | Ga0207676_103992172 | 64 |
| 681 | 3300026116 | Ga0207674_10711716 | Ga0207674_107117162 | 64 |
| 682 | 3300026116 | Ga0207674_11165729 | Ga0207674_111657292 | 64 |
| 683 | 3300026118 | Ga0207675_100277204 | Ga0207675_1002772042 | 64 |
| 684 | 3300026121 | Ga0207683_10007796 | Ga0207683_100077969 | 64 |
| 685 | 3300026121 | Ga0207683_10080612 | Ga0207683_100806122 | 64 |
| 686 | 3300026121 | Ga0207683_10129572 | Ga0207683_101295724 | 64 |
| 687 | 3300026142 | Ga0207698_10195509 | Ga0207698_101955092 | 64 |
| 688 | 3300026142 | Ga0207698_11395982 | Ga0207698_113959822 | 64 |
| 689 | 3300028379 | Ga0268266_10034465 | Ga0268266_100344654 | 64 |
| 690 | 3300028379 | Ga0268266_10119001 | Ga0268266_101190012 | 64 |
| 691 | 3300028379 | Ga0268266_10409104 | Ga0268266_104091042 | 64 |
| 692 | 3300028380 | Ga0268265_10521751 | Ga0268265_105217512 | 64 |
| 693 | 3300028380 | Ga0268265_11514842 | Ga0268265_115148422 | 64 |
| 694 | 3300028381 | Ga0268264_10003726 | Ga0268264_1000372613 | 64 |
| 695 | 3300028381 | Ga0268264_10739785 | Ga0268264_107397852 | 64 |
| 696 | 3300028381 | Ga0268264_10996088 | Ga0268264_109960881 | 64 |
| 697 | 3300028800 | Ga0265338_10896290 | Ga0265338_108962902 | 64 |
| 698 | 3300031730 | Ga0307516_10103849 | Ga0307516_101038495 | 64 |
| 699 | 3300031730 | Ga0307516_10176813 | Ga0307516_101768132 | 64 |
| 700 | 3300031730 | Ga0307516_10236670 | Ga0307516_102366702 | 64 |
| 701 | 3300037312 | Ga0395899_0000319 | Ga0395899_0000319_19168_19362 | 64 |
| 702 | 3300037418 | Ga0395900_0000061 | Ga0395900_0000061_200445_200639 | 64 |
| 703 | 3300037466 | Ga0395898_0000034 | Ga0395898_0000034_145879_146073 | 64 |
| 704 | 3300038443 | Ga0395901_0077195 | Ga0395901_0077195_2585_2779 | 64 |
| 705 | 3300039437 | Ga0436365_0840042 | Ga0436365_0840042_326_520 | 64 |
| 706 | 3300039437 | Ga0436365_1664988 | Ga0436365_1664988_1613_1807 | 64 |
| 707 | 3300039450 | Ga0436363_1117066 | Ga0436363_1117066_648_842 | 64 |
| 708 | 3300039450 | Ga0436363_1191204 | Ga0436363_1191204_286_480 | 64 |
| 709 | 3300041406 | Ga0439439_0007861 | Ga0439439_0007861_900_1094 | 64 |
| 710 | 3300041444 | Ga0451790_31258 | Ga0451790_31258_249_443 | 64 |
| 711 | 3300044656 | Ga0466969_0036984 | Ga0466969_0036984_826_1020 | 64 |
| 712 | 3300044684 | Ga0466966_0057286 | Ga0466966_0057286_826_1020 | 64 |
| 713 | 3300044693 | Ga0466961_0004766 | Ga0466961_0004766_5624_5818 | 64 |
| 714 | 3300044693 | Ga0466961_0027892 | Ga0466961_0027892_2611_2805 | 64 |
| 715 | 3300044706 | Ga0466964_0003032 | Ga0466964_0003032_3715_3909 | 64 |
| 716 | 3300044719 | Ga0466971_0149901 | Ga0466971_0149901_445_639 | 64 |
| 717 | 3300044735 | Ga0466968_0028966 | Ga0466968_0028966_862_1056 | 64 |
| 718 | 3300044765 | Ga0466970_0011634 | Ga0466970_0011634_4264_4458 | 64 |
| 719 | 3300044842 | Ga0466957_0012640 | Ga0466957_0012640_450_644 | 64 |
| 720 | 3300045049 | Ga0466959_0000258 | Ga0466959_0000258_10074_10268 | 64 |
| 721 | 3300045836 | Ga0466958_0383431 | Ga0466958_0383431_130_324 | 64 |
| 722 | 3300046679 | Ga0495623_0421842 | Ga0495623_0421842_64_258 | 64 |
| 723 | 3300048917 | Ga0496114_0209806 | Ga0496114_0209806_1122_1316 | 64 |
| 724 | 3300048918 | Ga0496115_0000065 | Ga0496115_0000065_36228_36422 | 64 |
| 725 | 3300048920 | Ga0496117_0516975 | Ga0496117_0516975_51_245 | 64 |
| 726 | 3300048921 | Ga0496118_0029968 | Ga0496118_0029968_1855_2049 | 64 |
| 727 | 3300048929 | Ga0496126_0000185 | Ga0496126_0000185_99921_100115 | 64 |
| 728 | 3300049824 | Ga0501045_0321852 | Ga0501045_0321852_490_684 | 64 |
| 729 | 3300061719 | Ga0466962_0012161 | Ga0466962_0012161_154_348 | 64 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar