F477888

General Info

Members Datasets Scaffolds Average Seq Length
729 371 675 61

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0141497|Ga0501033_0141497_267_470
Length 67
Sequence MAVQDSKKSRAKRGHRHAHWKNKATAPALSTDPTSGETHRRHHVTADGFYRGKKVIDTSPAAADAGE

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
4 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
5 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
6 2643221559 Lysobacter sp. Root559 Isolate Unclassified
7 2643221573 Lysobacter sp. Root604 Isolate Unclassified
8 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
9 2643221586 Lysobacter sp. Root667 Isolate Unclassified
10 2643221612 Lysobacter sp. Root76 Isolate Unclassified
11 2643221695 Lysobacter sp. Root494 Isolate Unclassified
12 2643221720 Lysobacter sp. Root916 Isolate Unclassified
13 2643221727 Lysobacter sp. Root96 Isolate Unclassified
14 2643221728 Lysobacter sp. Root983 Isolate Unclassified
15 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
16 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
17 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
18 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
19 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
20 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
21 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
22 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
23 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
24 2818991457 Xanthomonas translucens 569 Isolate Unclassified
25 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
26 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
27 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
28 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
29 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
30 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
31 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
32 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
33 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
34 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
35 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
36 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
37 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
38 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
39 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
40 2932406140 Serratia sp. 2723 Isolate Rhizosphere
41 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
42 2939577877 Serratia sp. 509 Isolate Rhizosphere
43 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
44 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
45 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
46 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
47 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
48 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
49 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
50 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
51 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
52 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
53 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
54 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
55 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
56 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
57 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
58 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
59 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
60 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
61 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
62 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
63 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
64 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
66 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
67 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
70 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
71 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
72 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
73 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
76 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
77 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
78 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
79 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
80 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
81 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
82 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
83 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
84 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
85 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
86 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
87 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
88 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
89 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
90 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
91 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
92 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
93 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
94 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
95 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
96 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
97 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
98 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
99 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
100 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
101 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
102 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
103 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
104 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
105 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
106 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
107 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
108 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
109 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
110 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
111 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
112 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
113 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
114 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
115 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
116 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
117 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
118 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
119 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
120 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
121 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
122 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
123 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
124 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
125 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
126 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
127 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
128 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
129 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
131 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
132 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
133 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
134 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
136 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
139 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
145 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
149 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
150 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
151 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
152 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
153 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
154 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
155 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
156 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
157 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
158 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
159 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
160 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
161 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
162 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
163 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
164 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
165 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
166 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
167 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
168 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
169 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
170 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
171 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
172 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
177 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
180 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
234 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
238 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
239 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
240 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
241 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
242 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
243 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
244 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
245 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
246 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
249 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
250 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
251 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
252 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
253 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
259 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
260 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
261 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
262 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
263 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
264 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
265 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
269 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
270 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
271 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
272 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
273 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
274 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
275 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
276 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
277 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
278 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
279 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
280 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
281 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
282 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
283 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
284 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
285 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
286 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
287 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
288 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
289 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
290 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
291 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
292 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
293 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
294 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
295 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
296 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
297 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
298 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
299 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
300 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
301 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
302 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
303 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
304 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
305 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
306 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
313 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
314 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
315 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
316 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
326 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
327 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
328 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
329 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
330 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
331 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
332 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
333 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
364 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
365 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
366 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
367 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
368 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
369 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
370 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
371 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.09
Metatranscriptomes 8.5
Isolates 7.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.39
Nodule 0.41
Rhizoplane 0.82
Rhizosphere 82.99
Stem 0
Stem Tuber 0
Unclassified 11.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1002391 3300002705 Bacteria 6781
2 JGI25156J39149_1004783 3300002705 Bacteria 4047
3 JGI25157J39369_1002228 3300002741 Bacteria 5270
4 JGI25151J46595_10036365 3300003187 Bacteria 1858
5 rootH2_10058115 3300003320 Bacteria 11775
6 Ga0055539_1000930 3300003752 Bacteria 6538
7 Ga0055533_1000474 3300003756 Bacteria 15083
8 Ga0055525_1000097 3300003759 Bacteria 137371
9 Ga0055527_1000198 3300003760 Bacteria 39703
10 Ga0055527_1000344 3300003760 Bacteria 23312
11 Ga0055527_1000513 3300003760 Bacteria 13411
12 Ga0055535_1000795 3300003761 Bacteria 22979
13 Ga0055535_1003536 3300003761 Bacteria 4348
14 Ga0055542_1000441 3300003762 Bacteria 39703
15 Ga0055542_1003400 3300003762 Bacteria 4332
16 Ga0055529_1000591 3300003763 Bacteria 28451
17 Ga0055529_1001024 3300003763 Bacteria 13373
18 Ga0055531_10003401 3300003794 Bacteria 10167
19 Ga0058692_1000017 3300003856 Bacteria 274459
20 Ga0058859_11722583 3300004798 Bacteria 753
21 Ga0058859_11813743 3300004798 Bacteria 781
22 Ga0065703_1024523 3300005272 Bacteria 594
23 Ga0065704_10072102 3300005289 Bacteria 9161
24 Ga0065704_10082305 3300005289 Bacteria 3622
25 Ga0065715_10078237 3300005293 Bacteria 596
26 Ga0065715_11011924 3300005293 Bacteria 542
27 Ga0070676_10025259 3300005328 Bacteria 3355
28 Ga0070676_10474453 3300005328 Bacteria 884
29 Ga0070683_100554473 3300005329 Bacteria 1099
30 Ga0070683_101826633 3300005329 Bacteria 584
31 Ga0070690_100000845 3300005330 Bacteria 15537
32 Ga0070670_100000001 3300005331 Bacteria 728788
33 Ga0070670_100161863 3300005331 Bacteria 1939
34 Ga0070670_100598518 3300005331 Bacteria 986
35 Ga0070670_101439520 3300005331 Bacteria 632
36 Ga0070670_101644392 3300005331 Bacteria 591
37 Ga0070677_10763524 3300005333 Bacteria 549
38 Ga0068869_100002558 3300005334 Bacteria 10978
39 Ga0068869_100004697 3300005334 Bacteria 8524
40 Ga0068869_100017947 3300005334 Bacteria 4809
41 Ga0068869_100384401 3300005334 Bacteria 1151
42 Ga0068869_100727978 3300005334 Bacteria 848
43 Ga0068869_101240323 3300005334 Bacteria 656
44 Ga0070666_10015694 3300005335 Bacteria 4834
45 Ga0070666_10212849 3300005335 Bacteria 1362
46 Ga0070666_10538517 3300005335 Bacteria 849
47 Ga0070680_100300083 3300005336 Bacteria 1362
48 Ga0070680_100359947 3300005336 Bacteria 1237
49 Ga0070682_101194433 3300005337 Bacteria 642
50 Ga0070682_101753694 3300005337 Bacteria 540
51 Ga0068868_100015146 3300005338 Bacteria 5697
52 Ga0068868_100373544 3300005338 Bacteria 1225
53 Ga0070689_100004467 3300005340 Bacteria 9455
54 Ga0070689_100287396 3300005340 Bacteria 1366
55 Ga0070689_101148206 3300005340 Bacteria 696
56 Ga0070691_10143528 3300005341 Bacteria 1219
57 Ga0070687_100322499 3300005343 Bacteria 987
58 Ga0070687_100455327 3300005343 Bacteria 852
59 Ga0070687_101047543 3300005343 Unclassified 594
60 Ga0070692_10006900 3300005345 Bacteria 4963
61 Ga0070668_100044400 3300005347 Bacteria 3410
62 Ga0070668_100702951 3300005347 Bacteria 892
63 Ga0070668_100907594 3300005347 Bacteria 788
64 Ga0070668_101473393 3300005347 Bacteria 622
65 Ga0070668_101765648 3300005347 Bacteria 569
66 Ga0070669_100002161 3300005353 Bacteria 14223
67 Ga0070669_100054718 3300005353 Bacteria 2923
68 Ga0070669_100562965 3300005353 Bacteria 951
69 Ga0070675_100076871 3300005354 Bacteria 2778
70 Ga0070675_100276957 3300005354 Bacteria 1473
71 Ga0070675_100540719 3300005354 Bacteria 1053
72 Ga0070671_100000018 3300005355 Bacteria 147427
73 Ga0070671_100122199 3300005355 Bacteria 2191
74 Ga0070671_100739016 3300005355 Bacteria 855
75 Ga0070674_100107450 3300005356 Bacteria 2043
76 Ga0070674_100285205 3300005356 Bacteria 1310
77 Ga0070674_100450220 3300005356 Bacteria 1062
78 Ga0070674_100689548 3300005356 Bacteria 872
79 Ga0070673_100031734 3300005364 Bacteria 3968
80 Ga0070673_100459992 3300005364 Bacteria 1146
81 Ga0070673_102142887 3300005364 Bacteria 531
82 Ga0070688_100004521 3300005365 Bacteria 7253
83 Ga0070688_100034596 3300005365 Bacteria 3062
84 Ga0070667_100000026 3300005367 Bacteria 183244
85 Ga0070667_100166193 3300005367 Bacteria 1946
86 Ga0070667_100269306 3300005367 Bacteria 1527
87 Ga0070667_100506787 3300005367 Bacteria 1107
88 Ga0070667_100630074 3300005367 Unclassified 989
89 Ga0070667_100683693 3300005367 Bacteria 949
90 Ga0070709_11337362 3300005434 Bacteria 579
91 Ga0070714_100003562 3300005435 Bacteria 11639
92 Ga0070714_100868554 3300005435 Bacteria 875
93 Ga0070701_10002994 3300005438 Bacteria 6610
94 Ga0070701_10194129 3300005438 Bacteria 1196
95 Ga0070701_11400941 3300005438 Bacteria 503
96 Ga0070711_100121481 3300005439 Bacteria 1932
97 Ga0070705_100040767 3300005440 Bacteria 2643
98 Ga0070705_100489570 3300005440 Unclassified 931
99 Ga0070700_100003802 3300005441 Bacteria 7820
100 Ga0070694_100007985 3300005444 Bacteria 6468
101 Ga0070694_100621039 3300005444 Bacteria 872
102 Ga0070663_101850146 3300005455 Bacteria 542
103 Ga0070678_100016566 3300005456 Bacteria 4720
104 Ga0070678_100039342 3300005456 Bacteria 3335
105 Ga0070678_100317971 3300005456 Bacteria 1328
106 Ga0070678_100359450 3300005456 Bacteria 1254
107 Ga0070678_100894115 3300005456 Bacteria 811
108 Ga0070678_102242385 3300005456 Bacteria 518
109 Ga0070662_100316250 3300005457 Bacteria 1272
110 Ga0070662_101583941 3300005457 Bacteria 565
111 Ga0070681_10608043 3300005458 Bacteria 1008
112 Ga0068867_100012057 3300005459 Bacteria 6106
113 Ga0068867_100025912 3300005459 Bacteria 4206
114 Ga0068867_100146165 3300005459 Bacteria 1853
115 Ga0068867_100299989 3300005459 Bacteria 1324
116 Ga0068867_100896092 3300005459 Bacteria 798
117 Ga0070685_10000007 3300005466 Bacteria 180539
118 Ga0070685_10038655 3300005466 Bacteria 2707
119 Ga0070699_100058688 3300005518 Bacteria 3334
120 Ga0070699_100139643 3300005518 Bacteria 2139
121 Ga0070679_101574454 3300005530 Bacteria 605
122 Ga0070684_100963664 3300005535 Bacteria 800
123 Ga0070697_100003415 3300005536 Bacteria 12210
124 Ga0070697_102033512 3300005536 Bacteria 514
125 Ga0068853_100107025 3300005539 Bacteria 2479
126 Ga0068853_100401752 3300005539 Bacteria 1282
127 Ga0068853_100490573 3300005539 Bacteria 1159
128 Ga0070672_100036695 3300005543 Bacteria 3735
129 Ga0070672_100305242 3300005543 Bacteria 1350
130 Ga0070686_100001455 3300005544 Bacteria 13358
131 Ga0070686_100162223 3300005544 Bacteria 1575
132 Ga0070686_101292276 3300005544 Bacteria 609
133 Ga0070695_100105939 3300005545 Bacteria 1901
134 Ga0070696_100013458 3300005546 Bacteria 5489
135 Ga0070693_100018924 3300005547 Bacteria 3603
136 Ga0070693_100022625 3300005547 Bacteria 3345
137 Ga0070693_100130569 3300005547 Bacteria 1570
138 Ga0070665_100013638 3300005548 Bacteria 8175
139 Ga0070665_100057794 3300005548 Bacteria 3889
140 Ga0070665_100112949 3300005548 Bacteria 2719
141 Ga0070665_100230673 3300005548 Bacteria 1851
142 Ga0070665_100319643 3300005548 Bacteria 1556
143 Ga0070665_101040540 3300005548 Bacteria 831
144 Ga0070665_101734318 3300005548 Bacteria 631
145 Ga0070704_100032448 3300005549 Bacteria 3523
146 Ga0070704_101600249 3300005549 Unclassified 601
147 Ga0070704_101994868 3300005549 Bacteria 538
148 Ga0068855_102330383 3300005563 Bacteria 535
149 Ga0068857_100469001 3300005577 Bacteria 1179
150 Ga0068857_101505174 3300005577 Bacteria 656
151 Ga0068857_101882781 3300005577 Bacteria 586
152 Ga0068857_102202928 3300005577 Unclassified 541
153 Ga0068854_101133922 3300005578 Bacteria 698
154 Ga0068854_101304923 3300005578 Unclassified 653
155 Ga0068856_100012880 3300005614 Bacteria 8095
156 Ga0068856_100013948 3300005614 Bacteria 7770
157 Ga0068856_100017128 3300005614 Bacteria 7024
158 Ga0070702_100001220 3300005615 Bacteria 10400
159 Ga0070702_100133509 3300005615 Bacteria 1571
160 Ga0070702_100639653 3300005615 Bacteria 803
161 Ga0070702_101811126 3300005615 Bacteria 510
162 Ga0068852_100404198 3300005616 Bacteria 1344
163 Ga0068852_102523817 3300005616 Bacteria 534
164 Ga0068859_100007685 3300005617 Bacteria 10950
165 Ga0068859_100017029 3300005617 Bacteria 7296
166 Ga0068859_100061758 3300005617 Bacteria 3776
167 Ga0068859_100083014 3300005617 Bacteria 3246
168 Ga0068859_100163932 3300005617 Bacteria 2302
169 Ga0068864_100000012 3300005618 Bacteria 335070
170 Ga0068864_100126667 3300005618 Unclassified 2289
171 Ga0068864_100145020 3300005618 Bacteria 2145
172 Ga0068866_10000235 3300005718 Bacteria 26083
173 Ga0068866_10078039 3300005718 Bacteria 1771
174 Ga0068866_10151511 3300005718 Bacteria 1343
175 Ga0068866_10336904 3300005718 Bacteria 954
176 Ga0068861_100006760 3300005719 Bacteria 7837
177 Ga0068861_100199308 3300005719 Bacteria 1679
178 Ga0068861_100511226 3300005719 Bacteria 1088
179 Ga0068861_101732754 3300005719 Bacteria 618
180 Ga0068851_10436210 3300005834 Bacteria 776
181 Ga0068851_10453043 3300005834 Bacteria 763
182 Ga0068851_10553829 3300005834 Bacteria 695
183 Ga0068870_10165818 3300005840 Bacteria 1314
184 Ga0068870_10271776 3300005840 Bacteria 1059
185 Ga0068870_10778535 3300005840 Bacteria 667
186 Ga0068863_100256127 3300005841 Bacteria 1691
187 Ga0068863_100292140 3300005841 Bacteria 1580
188 Ga0068863_100484640 3300005841 Bacteria 1216
189 Ga0068858_100002549 3300005842 Bacteria 18376
190 Ga0068858_100016226 3300005842 Bacteria 6997
191 Ga0068858_100204401 3300005842 Bacteria 1868
192 Ga0068860_100007326 3300005843 Bacteria 11028
193 Ga0068860_100007832 3300005843 Bacteria 10665
194 Ga0068860_100009873 3300005843 Bacteria 9463
195 Ga0068860_100436870 3300005843 Bacteria 1300
196 Ga0068860_101628041 3300005843 Bacteria 667
197 Ga0068862_100001146 3300005844 Bacteria 25101
198 Ga0068862_100005397 3300005844 Bacteria 10689
199 Ga0068862_100201685 3300005844 Bacteria 1794
200 Ga0068862_100529938 3300005844 Bacteria 1122
201 Ga0070715_10512399 3300006163 Bacteria 689
202 Ga0097621_100002412 3300006237 Bacteria 12795
203 Ga0097621_100004460 3300006237 Bacteria 9751
204 Ga0097621_100021221 3300006237 Bacteria 5019
205 Ga0097621_100079713 3300006237 Bacteria 2722
206 Ga0097621_101609756 3300006237 Bacteria 617
207 Ga0068871_100001034 3300006358 Bacteria 18634
208 Ga0068871_100004954 3300006358 Bacteria 9303
209 Ga0068871_100055319 3300006358 Bacteria 3221
210 Ga0068871_100060853 3300006358 Bacteria 3081
211 Ga0068871_100675654 3300006358 Bacteria 944
212 Ga0075428_102214397 3300006844 Bacteria 567
213 Ga0075434_100468902 3300006871 Bacteria 1280
214 Ga0068865_100000229 3300006881 Bacteria 31243
215 Ga0068865_100002785 3300006881 Bacteria 10385
216 Ga0068865_100015225 3300006881 Bacteria 4902
217 Ga0068865_100081427 3300006881 Bacteria 2325
218 Ga0068865_100135329 3300006881 Bacteria 1851
219 Ga0068865_100283874 3300006881 Bacteria 1319
220 Ga0068865_100494921 3300006881 Bacteria 1018
221 Ga0097620_100007685 3300006931 Bacteria 10950
222 Ga0097620_100017029 3300006931 Bacteria 7296
223 Ga0097620_100061758 3300006931 Bacteria 3776
224 Ga0097620_100083015 3300006931 Bacteria 3246
225 Ga0097620_100163932 3300006931 Bacteria 2302
226 Ga0079104_1027215 3300006946 Bacteria 1468
227 Ga0099794_10046640 3300007265 Bacteria 2076
228 Ga0105240_10029653 3300009093 Bacteria 7122
229 Ga0105240_11905248 3300009093 Bacteria 618
230 Ga0105245_10000613 3300009098 Bacteria 32290
231 Ga0105245_10050419 3300009098 Bacteria 3731
232 Ga0105245_10449010 3300009098 Bacteria 1297
233 Ga0105247_10047349 3300009101 Bacteria 2640
234 Ga0105247_10527103 3300009101 Bacteria 865
235 Ga0105243_10004808 3300009148 Bacteria 10615
236 Ga0105243_10235256 3300009148 Bacteria 1627
237 Ga0105242_10000678 3300009176 Bacteria 26735
238 Ga0105242_10151229 3300009176 Bacteria 2024
239 Ga0105242_11900004 3300009176 Bacteria 636
240 Ga0105248_10007225 3300009177 Bacteria 12184
241 Ga0105248_10075331 3300009177 Bacteria 3793
242 Ga0105248_10189091 3300009177 Bacteria 2320
243 Ga0105237_10533031 3300009545 Bacteria 1181
244 Ga0105237_10770502 3300009545 Bacteria 969
245 Ga0105237_10902234 3300009545 Unclassified 891
246 Ga0105238_11528537 3300009551 Bacteria 697
247 Ga0105249_10089678 3300009553 Bacteria 2874
248 Ga0105249_12371493 3300009553 Bacteria 603
249 Ga0105239_10012321 3300010375 Bacteria 9522
250 Ga0105239_10117512 3300010375 Bacteria 2951
251 Ga0105246_10301499 3300011119 Bacteria 1294
252 Ga0105246_10441943 3300011119 Bacteria 1091
253 Ga0157328_1003518 3300012478 Bacteria 822
254 Ga0157325_1008442 3300012485 Bacteria 715
255 Ga0157343_1006429 3300012488 Bacteria 792
256 Ga0157319_1023389 3300012497 Bacteria 618
257 Ga0157345_1006098 3300012498 Bacteria 951
258 Ga0157314_1009914 3300012500 Bacteria 814
259 Ga0157316_1025939 3300012510 Bacteria 677
260 Ga0157316_1062919 3300012510 Bacteria 542
261 Ga0157327_1006828 3300012512 Bacteria 975
262 Ga0157373_10825838 3300013100 Bacteria 684
263 Ga0157370_11208342 3300013104 Bacteria 682
264 Ga0157369_11680401 3300013105 Bacteria 645
265 Ga0157374_10174704 3300013296 Bacteria 2097
266 Ga0157374_10193075 3300013296 Unclassified 1992
267 Ga0157378_10001171 3300013297 Bacteria 23874
268 Ga0157378_10086750 3300013297 Bacteria 2838
269 Ga0157378_10089286 3300013297 Bacteria 2799
270 Ga0157378_10267675 3300013297 Bacteria 1642
271 Ga0163162_10223404 3300013306 Bacteria 2013
272 Ga0163162_10363914 3300013306 Bacteria 1579
273 Ga0163162_10471192 3300013306 Bacteria 1387
274 Ga0157375_10010588 3300013308 Bacteria 8119
275 Ga0157375_10180149 3300013308 Bacteria 2264
276 Ga0157375_10255335 3300013308 Bacteria 1914
277 Ga0163163_10000051 3300014325 Bacteria 128275
278 Ga0163163_10060169 3300014325 Bacteria 3760
279 Ga0157380_10001394 3300014326 Bacteria 15775
280 Ga0157380_13493985 3300014326 Bacteria 503
281 Ga0157379_10129320 3300014968 Bacteria 2272
282 Ga0157379_10180018 3300014968 Bacteria 1910
283 Ga0157376_10006054 3300014969 Bacteria 8505
284 Ga0157376_10043903 3300014969 Bacteria 3671
285 Ga0157376_10514750 3300014969 Bacteria 1178
286 Ga0157376_12101220 3300014969 Bacteria 603
287 Ga0157376_13005034 3300014969 Bacteria 511
288 Ga0163161_10784124 3300017792 Bacteria 800
289 Ga0163161_11173943 3300017792 Bacteria 663
290 Ga0213872_10405218 3300021361 Bacteria 552
291 Ga0213876_10681524 3300021384 Bacteria 547
292 Ga0213875_10245939 3300021388 Bacteria 843
293 Ga0256720_155306 3300023438 Bacteria 833
294 Ga0209674_100506 3300025226 Bacteria 16062
295 Ga0209672_100007 3300025228 Bacteria 959482
296 Ga0209672_100078 3300025228 Bacteria 156926
297 Ga0209563_100079 3300025230 Bacteria 203017
298 Ga0209258_100012 3300025242 Bacteria 825544
299 Ga0209258_100046 3300025242 Bacteria 369794
300 Ga0209026_1000285 3300025250 Bacteria 58221
301 Ga0209677_101982 3300025253 Bacteria 8133
302 Ga0209148_1000014 3300025254 Bacteria 925277
303 Ga0209148_1000098 3300025254 Bacteria 233172
304 Ga0209759_1000460 3300025256 Bacteria 46256
305 Ga0209455_1000010 3300025272 Bacteria 959482
306 Ga0209455_1000126 3300025272 Bacteria 165771
307 Ga0207697_10424226 3300025315 Unclassified 590
308 Ga0207656_10334120 3300025321 Bacteria 754
309 Ga0207656_10676664 3300025321 Bacteria 528
310 Ga0207653_10331922 3300025885 Bacteria 592
311 Ga0207682_10342778 3300025893 Bacteria 703
312 Ga0207642_10001272 3300025899 Bacteria 7804
313 Ga0207642_10172119 3300025899 Bacteria 1173
314 Ga0207642_10489262 3300025899 Bacteria 751
315 Ga0207642_10528222 3300025899 Bacteria 726
316 Ga0207710_10031118 3300025900 Bacteria 2332
317 Ga0207680_10004217 3300025903 Bacteria 6806
318 Ga0207680_10071444 3300025903 Bacteria 2152
319 Ga0207680_10195442 3300025903 Bacteria 1376
320 Ga0207680_10399268 3300025903 Bacteria 971
321 Ga0207699_10609128 3300025906 Bacteria 796
322 Ga0207645_10008655 3300025907 Bacteria 7089
323 Ga0207645_10175099 3300025907 Bacteria 1407
324 Ga0207645_10250990 3300025907 Bacteria 1170
325 Ga0207645_10375117 3300025907 Bacteria 954
326 Ga0207643_10006831 3300025908 Bacteria 6125
327 Ga0207643_10039399 3300025908 Bacteria 2658
328 Ga0207643_10336579 3300025908 Bacteria 945
329 Ga0207705_10689888 3300025909 Unclassified 794
330 Ga0207654_10064120 3300025911 Bacteria 2159
331 Ga0207654_10708572 3300025911 Bacteria 723
332 Ga0207707_10351118 3300025912 Bacteria 1271
333 Ga0207707_11232643 3300025912 Bacteria 604
334 Ga0207695_10001746 3300025913 Bacteria 34535
335 Ga0207695_10382796 3300025913 Bacteria 1292
336 Ga0207671_10001938 3300025914 Bacteria 22902
337 Ga0207671_10264747 3300025914 Bacteria 1353
338 Ga0207671_10344282 3300025914 Bacteria 1181
339 Ga0207671_10401038 3300025914 Bacteria 1091
340 Ga0207660_10038780 3300025917 Bacteria 3327
341 Ga0207660_10222935 3300025917 Bacteria 1480
342 Ga0207662_10183621 3300025918 Bacteria 1347
343 Ga0207662_10329071 3300025918 Bacteria 1022
344 Ga0207662_10335686 3300025918 Bacteria 1012
345 Ga0207681_10001878 3300025923 Bacteria 13447
346 Ga0207681_10129882 3300025923 Bacteria 1861
347 Ga0207681_10823772 3300025923 Bacteria 776
348 Ga0207694_10000627 3300025924 Bacteria 32068
349 Ga0207694_10016648 3300025924 Bacteria 5555
350 Ga0207694_11168254 3300025924 Bacteria 651
351 Ga0207650_10000002 3300025925 Bacteria 1439222
352 Ga0207650_10049228 3300025925 Bacteria 3111
353 Ga0207659_10330157 3300025926 Bacteria 1260
354 Ga0207687_10003513 3300025927 Bacteria 10547
355 Ga0207687_10042035 3300025927 Bacteria 3141
356 Ga0207687_10795396 3300025927 Bacteria 806
357 Ga0207687_11449792 3300025927 Bacteria 590
358 Ga0207664_10748583 3300025929 Bacteria 879
359 Ga0207644_10000026 3300025931 Bacteria 147255
360 Ga0207644_10165775 3300025931 Bacteria 1721
361 Ga0207644_10671696 3300025931 Bacteria 863
362 Ga0207706_10334312 3300025933 Bacteria 1318
363 Ga0207706_10423252 3300025933 Bacteria 1154
364 Ga0207686_10000895 3300025934 Bacteria 17985
365 Ga0207686_10007132 3300025934 Bacteria 6013
366 Ga0207686_10232270 3300025934 Bacteria 1338
367 Ga0207686_10390735 3300025934 Bacteria 1057
368 Ga0207686_10829667 3300025934 Bacteria 743
369 Ga0207709_10027431 3300025935 Bacteria 3281
370 Ga0207709_10395512 3300025935 Bacteria 1055
371 Ga0207670_10004995 3300025936 Bacteria 7226
372 Ga0207670_10254969 3300025936 Bacteria 1357
373 Ga0207669_10337081 3300025937 Bacteria 1160
374 Ga0207669_10353411 3300025937 Bacteria 1136
375 Ga0207669_10547520 3300025937 Bacteria 933
376 Ga0207704_10000551 3300025938 Bacteria 16714
377 Ga0207704_10053746 3300025938 Bacteria 2451
378 Ga0207704_10158932 3300025938 Bacteria 1605
379 Ga0207704_10487180 3300025938 Bacteria 991
380 Ga0207704_10514258 3300025938 Bacteria 967
381 Ga0207704_11451412 3300025938 Bacteria 588
382 Ga0207665_11027731 3300025939 Bacteria 656
383 Ga0207691_10018155 3300025940 Bacteria 6664
384 Ga0207691_10019550 3300025940 Bacteria 6408
385 Ga0207691_10355343 3300025940 Bacteria 1253
386 Ga0207711_10000279 3300025941 Bacteria 55112
387 Ga0207711_10021208 3300025941 Bacteria 5426
388 Ga0207711_10042177 3300025941 Bacteria 3888
389 Ga0207711_10080793 3300025941 Bacteria 2840
390 Ga0207689_10000136 3300025942 Bacteria 62820
391 Ga0207689_10002117 3300025942 Bacteria 18668
392 Ga0207689_10172903 3300025942 Bacteria 1781
393 Ga0207689_10194656 3300025942 Bacteria 1673
394 Ga0207667_10222068 3300025949 Bacteria 1936
395 Ga0207651_10350869 3300025960 Bacteria 1242
396 Ga0207651_10455422 3300025960 Bacteria 1098
397 Ga0207651_10934605 3300025960 Unclassified 773
398 Ga0207712_10187403 3300025961 Bacteria 1630
399 Ga0207712_10299585 3300025961 Bacteria 1319
400 Ga0207712_10523795 3300025961 Bacteria 1016
401 Ga0207668_10050976 3300025972 Bacteria 2856
402 Ga0207668_10566720 3300025972 Bacteria 986
403 Ga0207640_10372839 3300025981 Bacteria 1154
404 Ga0207640_10448249 3300025981 Bacteria 1063
405 Ga0207640_11140991 3300025981 Bacteria 691
406 Ga0207658_10000001 3300025986 Bacteria 1439333
407 Ga0207658_10043506 3300025986 Bacteria 3265
408 Ga0207658_10155909 3300025986 Bacteria 1866
409 Ga0207658_10186518 3300025986 Bacteria 1721
410 Ga0207658_10999171 3300025986 Bacteria 763
411 Ga0207658_11009648 3300025986 Bacteria 759
412 Ga0207677_10052958 3300026023 Bacteria 2760
413 Ga0207677_10473799 3300026023 Bacteria 1077
414 Ga0207677_10735967 3300026023 Bacteria 878
415 Ga0207703_10006745 3300026035 Bacteria 9158
416 Ga0207703_10026533 3300026035 Bacteria 4560
417 Ga0207703_10194547 3300026035 Unclassified 1798
418 Ga0207703_12312324 3300026035 Bacteria 513
419 Ga0207639_10130378 3300026041 Bacteria 2080
420 Ga0207639_10297488 3300026041 Bacteria 1425
421 Ga0207639_10735962 3300026041 Unclassified 916
422 Ga0207639_11372766 3300026041 Unclassified 663
423 Ga0207639_11430050 3300026041 Bacteria 649
424 Ga0207639_11572289 3300026041 Bacteria 617
425 Ga0207708_10001168 3300026075 Bacteria 19751
426 Ga0207702_10009097 3300026078 Bacteria 8361
427 Ga0207702_10031237 3300026078 Bacteria 4438
428 Ga0207702_10178517 3300026078 Bacteria 1953
429 Ga0207641_10226320 3300026088 Bacteria 1736
430 Ga0207641_10264976 3300026088 Bacteria 1610
431 Ga0207641_10337426 3300026088 Bacteria 1433
432 Ga0207641_10390777 3300026088 Bacteria 1334
433 Ga0207648_10000485 3300026089 Bacteria 44215
434 Ga0207648_10050348 3300026089 Bacteria 3642
435 Ga0207648_10084228 3300026089 Bacteria 2773
436 Ga0207648_10372947 3300026089 Bacteria 1289
437 Ga0207648_10525858 3300026089 Bacteria 1084
438 Ga0207676_10000001 3300026095 Bacteria 1439222
439 Ga0207676_10107818 3300026095 Bacteria 2324
440 Ga0207676_10399217 3300026095 Bacteria 1284
441 Ga0207674_10711716 3300026116 Bacteria 969
442 Ga0207674_11165729 3300026116 Bacteria 740
443 Ga0207675_100000213 3300026118 Bacteria 54289
444 Ga0207675_100026284 3300026118 Bacteria 5418
445 Ga0207675_100277204 3300026118 Bacteria 1628
446 Ga0207683_10007796 3300026121 Bacteria 9160
447 Ga0207683_10012473 3300026121 Bacteria 7251
448 Ga0207683_10028497 3300026121 Bacteria 4829
449 Ga0207683_10080612 3300026121 Bacteria 2888
450 Ga0207683_10129572 3300026121 Bacteria 2268
451 Ga0207683_10974922 3300026121 Bacteria 787
452 Ga0207698_10195509 3300026142 Bacteria 1806
453 Ga0207698_11395982 3300026142 Bacteria 715
454 Ga0209281_1017235 3300027111 Bacteria 1469
455 Ga0268266_10004153 3300028379 Bacteria 13973
456 Ga0268266_10034465 3300028379 Bacteria 4306
457 Ga0268266_10100747 3300028379 Bacteria 2545
458 Ga0268266_10119001 3300028379 Bacteria 2349
459 Ga0268266_10297762 3300028379 Bacteria 1504
460 Ga0268266_10409104 3300028379 Bacteria 1284
461 Ga0268265_10001823 3300028380 Bacteria 17029
462 Ga0268265_10105660 3300028380 Bacteria 2285
463 Ga0268265_10192601 3300028380 Bacteria 1762
464 Ga0268265_10521751 3300028380 Bacteria 1123
465 Ga0268265_11514842 3300028380 Bacteria 674
466 Ga0268264_10000061 3300028381 Bacteria 303123
467 Ga0268264_10003726 3300028381 Bacteria 13096
468 Ga0268264_10739785 3300028381 Bacteria 979
469 Ga0268264_10996088 3300028381 Bacteria 844
470 Ga0268264_11212373 3300028381 Bacteria 764
471 Ga0265326_10069355 3300028558 Unclassified 997
472 Ga0265338_10002059 3300028800 Bacteria 31074
473 Ga0265338_10896290 3300028800 Unclassified 604
474 Ga0265327_10000014 3300031251 Bacteria 506288
475 Ga0265327_10000112 3300031251 Bacteria 175878
476 Ga0316575_10004381 3300031665 Bacteria 4965
477 Ga0316575_10005135 3300031665 Bacteria 4650
478 Ga0316579_10059399 3300031691 Bacteria 1797
479 Ga0316579_10160210 3300031691 Bacteria 1087
480 Ga0316579_10214753 3300031691 Bacteria 930
481 Ga0316579_10295928 3300031691 Bacteria 782
482 Ga0316576_10017223 3300031727 Bacteria 4904
483 Ga0316576_10068103 3300031727 Bacteria 2622
484 Ga0316576_11075512 3300031727 Bacteria 571
485 Ga0316578_10027557 3300031728 Bacteria 3212
486 Ga0307516_10103849 3300031730 Bacteria 2655
487 Ga0307516_10176813 3300031730 Bacteria 1870
488 Ga0307516_10236670 3300031730 Bacteria 1527
489 Ga0316577_10005478 3300031733 Bacteria 6655
490 Ga0316577_10005970 3300031733 Bacteria 6416
491 Ga0316577_10144901 3300031733 Bacteria 1338
492 Ga0307413_10464157 3300031824 Bacteria 1008
493 Ga0307406_11938690 3300031901 Unclassified 526
494 Ga0307409_101310740 3300031995 Bacteria 749
495 Ga0307411_10983644 3300032005 Bacteria 754
496 Ga0316583_10062951 3300032133 Bacteria 1300
497 Ga0316583_10157765 3300032133 Bacteria 790
498 Ga0316585_10040995 3300032137 Bacteria 1475
499 Ga0316585_10090875 3300032137 Unclassified 998
500 Ga0316585_10181481 3300032137 Bacteria 695
501 Ga0316580_10006198 3300032139 Bacteria 3525
502 Ga0316580_10067414 3300032139 Bacteria 1097
503 Ga0316593_10000661 3300032168 Bacteria 6646
504 Ga0316593_10000778 3300032168 Bacteria 6331
505 Ga0316593_10005665 3300032168 Bacteria 3315
506 Ga0316593_10006604 3300032168 Bacteria 3141
507 Ga0316593_10052998 3300032168 Bacteria 1374
508 Ga0316593_10055697 3300032168 Unclassified 1344
509 Ga0316593_10065497 3300032168 Bacteria 1249
510 Ga0316593_10081373 3300032168 Bacteria 1131
511 Ga0316593_10082476 3300032168 Bacteria 1124
512 Ga0316593_10195575 3300032168 Bacteria 746
513 Ga0316592_1032534 3300033524 Bacteria 1138
514 Ga0316592_1085366 3300033524 Bacteria 720
515 Ga0316588_1027082 3300033528 Unclassified 1330
516 Ga0316588_1030060 3300033528 Bacteria 1272
517 Ga0316587_1043055 3300033529 Bacteria 818
518 Ga0316587_1043065 3300033529 Bacteria 818
519 Ga0316587_1048715 3300033529 Bacteria 774
520 Ga0316587_1058203 3300033529 Unclassified 714
521 Ga0316587_1060947 3300033529 Unclassified 699
522 Ga0316587_1074827 3300033529 Bacteria 636
523 Ga0316596_1001400 3300033541 Bacteria 4848
524 Ga0316596_1027166 3300033541 Bacteria 1477
525 Ga0316596_1029341 3300033541 Bacteria 1424
526 Ga0316596_1039533 3300033541 Bacteria 1237
527 Ga0316596_1079008 3300033541 Bacteria 884
528 Ga0316596_1210040 3300033541 Bacteria 543
529 Ga0373929_0250667 3300035085 Bacteria 513
530 Ga0373952_0195494 3300035092 Unclassified 590
531 Ga0373942_0198013 3300035207 Unclassified 665
532 Ga0316574_0068386 3300035398 Bacteria 2240
533 Ga0316574_0199288 3300035398 Bacteria 1286
534 Ga0316574_0408235 3300035398 Bacteria 855
535 Ga0316574_0835399 3300035398 Unclassified 559
536 Ga0316574_0942254 3300035398 Unclassified 521
537 Ga0373931_0339273 3300035691 Bacteria 938
538 Ga0316582_0004572 3300036647 Bacteria 7010
539 Ga0316582_0027446 3300036647 Bacteria 3439
540 Ga0316582_0211511 3300036647 Bacteria 1325
541 Ga0316584_0005066 3300036712 Bacteria 8784
542 Ga0316584_0008148 3300036712 Bacteria 7203
543 Ga0316584_0027572 3300036712 Bacteria 4182
544 Ga0316584_0101289 3300036712 Bacteria 2157
545 Ga0316584_0878276 3300036712 Bacteria 605
546 Ga0395899_0000319 3300037312 Bacteria 61296
547 Ga0395900_0000061 3300037418 Bacteria 202483
548 Ga0395900_0000894 3300037418 Bacteria 39143
549 Ga0395898_0000034 3300037466 Bacteria 356745
550 Ga0436364_1060220 3300037853 Unclassified 1194
551 Ga0395901_0077195 3300038443 Bacteria 3476
552 Ga0400484_32124 3300038725 Bacteria 5681
553 Ga0400490_20117 3300038726 Bacteria 25705
554 Ga0400490_31688 3300038726 Bacteria 17721
555 Ga0400491_20800 3300038727 Bacteria 10066
556 Ga0400491_21758 3300038727 Unclassified 1050
557 Ga0400485_12746 3300038735 Bacteria 3954
558 Ga0400488_18372 3300038741 Bacteria 11596
559 Ga0400488_38656 3300038741 Bacteria 1205
560 Ga0400488_46405 3300038741 Unclassified 1373
561 Ga0400488_50084 3300038741 Bacteria 1600
562 Ga0400486_06219 3300038742 Bacteria 2854
563 Ga0400483_006822 3300039062 Bacteria 2957
564 Ga0400483_078683 3300039062 Unclassified 1133
565 Ga0400483_085407 3300039062 Bacteria 1482
566 Ga0400483_085605 3300039062 Bacteria 18729
567 Ga0400483_129431 3300039062 Bacteria 1067
568 Ga0400483_170867 3300039062 Bacteria 8559
569 Ga0400483_248196 3300039062 Bacteria 7053
570 Ga0400483_254656 3300039062 Unclassified 2017
571 Ga0400489_11346 3300039093 Bacteria 1782
572 Ga0400489_58554 3300039093 Bacteria 1025
573 Ga0400487_07419 3300039110 Bacteria 1547
574 Ga0400487_24791 3300039110 Bacteria 81428
575 Ga0400487_41427 3300039110 Bacteria 4185
576 Ga0400487_43791 3300039110 Bacteria 24362
577 Ga0436365_0840042 3300039437 Bacteria 782
578 Ga0436365_1664988 3300039437 Bacteria 1993
579 Ga0436361_0665703 3300039447 Bacteria 552
580 Ga0436361_0944033 3300039447 Bacteria 636
581 Ga0436363_1117066 3300039450 Bacteria 1033
582 Ga0436363_1191204 3300039450 Unclassified 561
583 Ga0436362_0226625 3300039453 Bacteria 962
584 Ga0439439_0007861 3300041406 Bacteria 2505
585 Ga0451789_0793241 3300041443 Bacteria 760
586 Ga0451790_31258 3300041444 Bacteria 1045
587 Ga0451839_0741211 3300041496 Bacteria 765
588 Ga0451847_0662423 3300041503 Bacteria 970
589 Ga0451854_17261 3300041510 Bacteria 520
590 Ga0451853_3376051 3300041512 Bacteria 1269
591 Ga0439441_000553 3300042001 Bacteria 4140
592 Ga0451577_0296099 3300042876 Bacteria 1466
593 Ga0451577_0423063 3300042876 Bacteria 1210
594 Ga0451577_0434525 3300042876 Bacteria 1192
595 Ga0466969_0036984 3300044656 Bacteria 2463
596 Ga0466966_0057286 3300044684 Bacteria 2463
597 Ga0466961_0004766 3300044693 Bacteria 8537
598 Ga0466961_0027892 3300044693 Bacteria 3630
599 Ga0466964_0003032 3300044706 Bacteria 6092
600 Ga0453684_1185901 3300044712 Bacteria 802
601 Ga0453684_1361098 3300044712 Bacteria 738
602 Ga0466971_0149901 3300044719 Bacteria 1088
603 Ga0466968_0028966 3300044735 Bacteria 2287
604 Ga0466970_0011634 3300044765 Bacteria 4488
605 Ga0466957_0012640 3300044842 Bacteria 4889
606 Ga0466959_0000258 3300045049 Bacteria 32514
607 Ga0451576_0001131 3300045051 Bacteria 48320
608 Ga0451576_2415862 3300045051 Bacteria 538
609 Ga0466958_0383431 3300045836 Bacteria 906
610 Ga0495592_0567489 3300046454 Bacteria 696
611 Ga0495659_0090797 3300046664 Bacteria 1172
612 Ga0495623_0421842 3300046679 Bacteria 715
613 Ga0495604_0305648 3300047317 Bacteria 1067
614 Ga0495674_0474784 3300047319 Bacteria 1003
615 Ga0495677_0396098 3300047445 Unclassified 546
616 Ga0496108_1287625 3300048911 Bacteria 615
617 Ga0496114_0209806 3300048917 Bacteria 1708
618 Ga0496114_0705029 3300048917 Bacteria 885
619 Ga0496115_0000065 3300048918 Bacteria 98148
620 Ga0496117_0516975 3300048920 Bacteria 575
621 Ga0496118_0029968 3300048921 Bacteria 4553
622 Ga0496124_0003292 3300048927 Bacteria 19912
623 Ga0496124_0111130 3300048927 Bacteria 2205
624 Ga0496125_0085562 3300048928 Bacteria 2388
625 Ga0496126_0000185 3300048929 Bacteria 140051
626 Ga0496126_1369376 3300048929 Bacteria 512
627 Ga0501325_012123 3300049541 Bacteria 807
628 Ga0501033_0141497 3300049570 Bacteria 1739
629 Ga0501034_0239998 3300049571 Bacteria 1759
630 Ga0501037_0102200 3300049573 Bacteria 2068
631 Ga0501037_0465188 3300049573 Bacteria 861
632 Ga0501039_1264232 3300049575 Bacteria 570
633 Ga0501047_0117022 3300049581 Bacteria 2547
634 Ga0501035_0007793 3300049822 Bacteria 10006
635 Ga0501035_0568797 3300049822 Bacteria 927
636 Ga0501045_0321852 3300049824 Bacteria 1151
637 Ga0500650_0000034 3300053098 Bacteria 52582
638 Ga0500554_257634 3300053102 Unclassified 573
639 Ga0500595_025222 3300053119 Bacteria 2064
640 Ga0500597_231227 3300053120 Bacteria 764
641 Ga0500590_339989 3300053148 Bacteria 542
642 Ga0500636_0070190 3300053177 Bacteria 2033
643 Ga0500661_004201 3300055283 Bacteria 2695
644 Ga0587084_052553 3300059477 Bacteria 726
645 Ga0587093_075567 3300059478 Bacteria 573
646 Ga0587070_054776 3300059491 Bacteria 807
647 Ga0587077_087858 3300059493 Unclassified 725
648 Ga0587080_114324 3300059503 Unclassified 592
649 Ga0587083_0221326 3300059505 Bacteria 551
650 Ga0587085_015437 3300059506 Bacteria 1091
651 Ga0587086_049489 3300059507 Unclassified 674
652 Ga0587088_047633 3300059508 Unclassified 829
653 Ga0587090_026977 3300059510 Unclassified 937
654 Ga0587091_051032 3300059511 Unclassified 849
655 Ga0587094_073400 3300059513 Unclassified 620
656 Ga0587095_023410 3300059514 Unclassified 606
657 Ga0587125_011724 3300059607 Unclassified 924
658 Ga0587129_028744 3300059608 Unclassified 526
659 Ga0587101_091602 3300059623 Bacteria 592
660 Ga0587109_056737 3300059624 Unclassified 815
661 Ga0587117_014876 3300059627 Unclassified 1016
662 Ga0587128_141479 3300059630 Unclassified 541
663 Ga0587130_033675 3300059631 Bacteria 598
664 Ga0587062_057243 3300059639 Unclassified 675
665 Ga0587068_026769 3300059641 Unclassified 978
666 Ga0587069_136651 3300059642 Bacteria 533
667 Ga0587072_075379 3300059643 Bacteria 720
668 Ga0587076_078552 3300059645 Unclassified 699
669 Ga0587079_184519 3300059647 Unclassified 560
670 Ga0587100_022084 3300059648 Unclassified 628
671 Ga0587108_022809 3300059653 Bacteria 604
672 Ga0587118_25044 3300059657 Bacteria 509
673 Ga0587111_0029070 3300060346 Unclassified 1117
674 Ga0501082_1408576 3300060353 Bacteria 609
675 Ga0466962_0012161 3300061719 Bacteria 4138

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2690315857 2691330632 50
2 iso_pu_bacteria 2919534386 2919535655 50
3 iso_pu_bacteria 2506520007 2506577911 51
4 iso_pu_bacteria 2506520008 2506583049 51
5 iso_pu_bacteria 2654587920 2656275457 51
6 iso_pu_bacteria 2687453601 2689444436 51
7 iso_pu_bacteria 2869551831 2869553787 51
8 iso_pu_bacteria 2932406140 2932409707 51
9 iso_pu_bacteria 2939577877 2939578825 51
10 iso_pu_bacteria 2565956521 2566038296 52
11 iso_pu_bacteria 2648501241 2649120980 52
12 iso_pu_bacteria 2651869818 2652974926 52
13 iso_pu_bacteria 2881714928 2881715303 52
14 iso_pu_bacteria 8054357960 8054360172 52
15 3300005272 Ga0065703_1024523 Ga0065703_10245231 55
16 3300021388 Ga0213875_10245939 Ga0213875_102459392 55
17 3300025927 Ga0207687_11449792 Ga0207687_114497922 55
18 3300037853 Ga0436364_1060220 Ga0436364_1060220_577_780 55
19 iso_pu_bacteria 8002745576 8002749439 55
20 3300023438 Ga0256720_155306 Ga0256720_1553061 56
21 3300032168 Ga0316593_10000661 Ga0316593_100006613 56
22 3300032168 Ga0316593_10000778 Ga0316593_100007783 56
23 3300032168 Ga0316593_10082476 Ga0316593_100824762 56
24 3300033541 Ga0316596_1210040 Ga0316596_12100402 56
25 3300039062 Ga0400483_085605 Ga0400483_085605_6897_7067 56
26 3300041510 Ga0451854_17261 Ga0451854_17261_258_428 56
27 3300041512 Ga0451853_3376051 Ga0451853_3376051_262_432 56
28 3300005518 Ga0070699_100058688 Ga0070699_1000586884 58
29 3300005518 Ga0070699_100139643 Ga0070699_1001396432 58
30 3300013100 Ga0157373_10825838 Ga0157373_108258382 58
31 3300032133 Ga0316583_10062951 Ga0316583_100629512 58
32 3300032168 Ga0316593_10005665 Ga0316593_100056652 58
33 3300032168 Ga0316593_10065497 Ga0316593_100654972 58
34 3300033524 Ga0316592_1085366 Ga0316592_10853662 58
35 3300033528 Ga0316588_1030060 Ga0316588_10300602 58
36 3300036712 Ga0316584_0878276 Ga0316584_0878276_85_261 58
37 3300042001 Ga0439441_000553 Ga0439441_000553_2662_2838 58
38 3300045051 Ga0451576_2415862 Ga0451576_2415862_135_311 58
39 3300046454 Ga0495592_0567489 Ga0495592_0567489_229_405 58
40 3300047317 Ga0495604_0305648 Ga0495604_0305648_147_323 58
41 3300047319 Ga0495674_0474784 Ga0495674_0474784_194_370 58
42 3300004798 Ga0058859_11813743 Ga0058859_118137432 59
43 3300005328 Ga0070676_10474453 Ga0070676_104744532 59
44 3300005329 Ga0070683_101826633 Ga0070683_1018266332 59
45 3300005330 Ga0070690_100000845 Ga0070690_1000008459 59
46 3300005331 Ga0070670_100000001 Ga0070670_100000001543 59
47 3300005333 Ga0070677_10763524 Ga0070677_107635242 59
48 3300005334 Ga0068869_100002558 Ga0068869_1000025584 59
49 3300005334 Ga0068869_100004697 Ga0068869_1000046977 59
50 3300005335 Ga0070666_10015694 Ga0070666_100156944 59
51 3300005336 Ga0070680_100300083 Ga0070680_1003000832 59
52 3300005336 Ga0070680_100359947 Ga0070680_1003599473 59
53 3300005340 Ga0070689_100004467 Ga0070689_10000446710 59
54 3300005340 Ga0070689_100287396 Ga0070689_1002873962 59
55 3300005341 Ga0070691_10143528 Ga0070691_101435281 59
56 3300005343 Ga0070687_100322499 Ga0070687_1003224991 59
57 3300005343 Ga0070687_101047543 Ga0070687_1010475432 59
58 3300005345 Ga0070692_10006900 Ga0070692_100069003 59
59 3300005347 Ga0070668_100907594 Ga0070668_1009075942 59
60 3300005353 Ga0070669_100002161 Ga0070669_10000216116 59
61 3300005354 Ga0070675_100540719 Ga0070675_1005407192 59
62 3300005355 Ga0070671_100000018 Ga0070671_10000001892 59
63 3300005356 Ga0070674_100107450 Ga0070674_1001074504 59
64 3300005365 Ga0070688_100004521 Ga0070688_1000045217 59
65 3300005365 Ga0070688_100034596 Ga0070688_1000345963 59
66 3300005367 Ga0070667_100000026 Ga0070667_10000002671 59
67 3300005367 Ga0070667_100269306 Ga0070667_1002693062 59
68 3300005367 Ga0070667_100630074 Ga0070667_1006300742 59
69 3300005367 Ga0070667_100683693 Ga0070667_1006836932 59
70 3300005435 Ga0070714_100003562 Ga0070714_1000035625 59
71 3300005438 Ga0070701_10002994 Ga0070701_100029942 59
72 3300005438 Ga0070701_10194129 Ga0070701_101941292 59
73 3300005440 Ga0070705_100040767 Ga0070705_1000407673 59
74 3300005440 Ga0070705_100489570 Ga0070705_1004895702 59
75 3300005441 Ga0070700_100003802 Ga0070700_1000038022 59
76 3300005444 Ga0070694_100007985 Ga0070694_1000079854 59
77 3300005444 Ga0070694_100621039 Ga0070694_1006210392 59
78 3300005456 Ga0070678_100016566 Ga0070678_1000165665 59
79 3300005456 Ga0070678_100359450 Ga0070678_1003594502 59
80 3300005459 Ga0068867_100012057 Ga0068867_1000120575 59
81 3300005459 Ga0068867_100896092 Ga0068867_1008960922 59
82 3300005466 Ga0070685_10000007 Ga0070685_10000007155 59
83 3300005466 Ga0070685_10038655 Ga0070685_100386554 59
84 3300005535 Ga0070684_100963664 Ga0070684_1009636642 59
85 3300005536 Ga0070697_100003415 Ga0070697_1000034152 59
86 3300005536 Ga0070697_102033512 Ga0070697_1020335122 59
87 3300005539 Ga0068853_100107025 Ga0068853_1001070253 59
88 3300005543 Ga0070672_100305242 Ga0070672_1003052422 59
89 3300005544 Ga0070686_100001455 Ga0070686_10000145510 59
90 3300005544 Ga0070686_100162223 Ga0070686_1001622232 59
91 3300005545 Ga0070695_100105939 Ga0070695_1001059392 59
92 3300005546 Ga0070696_100013458 Ga0070696_1000134588 59
93 3300005547 Ga0070693_100018924 Ga0070693_1000189243 59
94 3300005548 Ga0070665_100057794 Ga0070665_1000577944 59
95 3300005548 Ga0070665_100230673 Ga0070665_1002306734 59
96 3300005549 Ga0070704_100032448 Ga0070704_1000324482 59
97 3300005549 Ga0070704_101600249 Ga0070704_1016002491 59
98 3300005549 Ga0070704_101994868 Ga0070704_1019948682 59
99 3300005563 Ga0068855_102330383 Ga0068855_1023303831 59
100 3300005578 Ga0068854_101304923 Ga0068854_1013049232 59
101 3300005615 Ga0070702_100001220 Ga0070702_1000012209 59
102 3300005615 Ga0070702_100133509 Ga0070702_1001335092 59
103 3300005615 Ga0070702_101811126 Ga0070702_1018111261 59
104 3300005617 Ga0068859_100007685 Ga0068859_10000768512 59
105 3300005617 Ga0068859_100017029 Ga0068859_1000170299 59
106 3300005618 Ga0068864_100000012 Ga0068864_100000012185 59
107 3300005618 Ga0068864_100126667 Ga0068864_1001266672 59
108 3300005718 Ga0068866_10000235 Ga0068866_1000023518 59
109 3300005719 Ga0068861_100006760 Ga0068861_1000067609 59
110 3300005719 Ga0068861_100511226 Ga0068861_1005112262 59
111 3300005719 Ga0068861_101732754 Ga0068861_1017327542 59
112 3300005840 Ga0068870_10271776 Ga0068870_102717762 59
113 3300005840 Ga0068870_10778535 Ga0068870_107785352 59
114 3300005841 Ga0068863_100256127 Ga0068863_1002561272 59
115 3300005842 Ga0068858_100002549 Ga0068858_1000025499 59
116 3300005842 Ga0068858_100016226 Ga0068858_1000162266 59
117 3300005842 Ga0068858_100204401 Ga0068858_1002044012 59
118 3300005843 Ga0068860_100007832 Ga0068860_1000078329 59
119 3300005843 Ga0068860_100009873 Ga0068860_1000098737 59
120 3300005844 Ga0068862_100001146 Ga0068862_10000114613 59
121 3300005844 Ga0068862_100005397 Ga0068862_1000053975 59
122 3300005844 Ga0068862_100201685 Ga0068862_1002016852 59
123 3300006237 Ga0097621_100002412 Ga0097621_1000024124 59
124 3300006237 Ga0097621_100004460 Ga0097621_1000044604 59
125 3300006358 Ga0068871_100001034 Ga0068871_10000103417 59
126 3300006358 Ga0068871_100004954 Ga0068871_1000049548 59
127 3300006881 Ga0068865_100000229 Ga0068865_10000022923 59
128 3300006881 Ga0068865_100135329 Ga0068865_1001353292 59
129 3300006931 Ga0097620_100007685 Ga0097620_10000768512 59
130 3300006931 Ga0097620_100017029 Ga0097620_1000170299 59
131 3300006946 Ga0079104_1027215 Ga0079104_10272152 59
132 3300007265 Ga0099794_10046640 Ga0099794_100466402 59
133 3300009093 Ga0105240_10029653 Ga0105240_100296533 59
134 3300009093 Ga0105240_11905248 Ga0105240_119052481 59
135 3300009098 Ga0105245_10000613 Ga0105245_1000061330 59
136 3300009098 Ga0105245_10050419 Ga0105245_100504193 59
137 3300009101 Ga0105247_10047349 Ga0105247_100473494 59
138 3300009101 Ga0105247_10527103 Ga0105247_105271031 59
139 3300009148 Ga0105243_10004808 Ga0105243_100048085 59
140 3300009148 Ga0105243_10235256 Ga0105243_102352563 59
141 3300009176 Ga0105242_10000678 Ga0105242_1000067810 59
142 3300009176 Ga0105242_10151229 Ga0105242_101512292 59
143 3300009177 Ga0105248_10007225 Ga0105248_100072257 59
144 3300009177 Ga0105248_10075331 Ga0105248_100753312 59
145 3300009177 Ga0105248_10189091 Ga0105248_101890913 59
146 3300009545 Ga0105237_10533031 Ga0105237_105330312 59
147 3300009545 Ga0105237_10902234 Ga0105237_109022342 59
148 3300009553 Ga0105249_10089678 Ga0105249_100896782 59
149 3300009553 Ga0105249_12371493 Ga0105249_123714931 59
150 3300010375 Ga0105239_10117512 Ga0105239_101175124 59
151 3300011119 Ga0105246_10301499 Ga0105246_103014991 59
152 3300011119 Ga0105246_10441943 Ga0105246_104419432 59
153 3300013296 Ga0157374_10193075 Ga0157374_101930752 59
154 3300013297 Ga0157378_10001171 Ga0157378_1000117116 59
155 3300013297 Ga0157378_10086750 Ga0157378_100867503 59
156 3300013297 Ga0157378_10089286 Ga0157378_100892863 59
157 3300013297 Ga0157378_10267675 Ga0157378_102676752 59
158 3300013306 Ga0163162_10223404 Ga0163162_102234042 59
159 3300013306 Ga0163162_10363914 Ga0163162_103639142 59
160 3300013306 Ga0163162_10471192 Ga0163162_104711922 59
161 3300013308 Ga0157375_10010588 Ga0157375_100105886 59
162 3300013308 Ga0157375_10180149 Ga0157375_101801494 59
163 3300014325 Ga0163163_10000051 Ga0163163_1000005154 59
164 3300014325 Ga0163163_10060169 Ga0163163_100601695 59
165 3300014326 Ga0157380_10001394 Ga0157380_1000139412 59
166 3300014968 Ga0157379_10129320 Ga0157379_101293202 59
167 3300014968 Ga0157379_10180018 Ga0157379_101800184 59
168 3300014969 Ga0157376_10006054 Ga0157376_100060549 59
169 3300014969 Ga0157376_10514750 Ga0157376_105147502 59
170 3300014969 Ga0157376_12101220 Ga0157376_121012202 59
171 3300017792 Ga0163161_11173943 Ga0163161_111739431 59
172 3300021361 Ga0213872_10405218 Ga0213872_104052181 59
173 3300025315 Ga0207697_10424226 Ga0207697_104242262 59
174 3300025885 Ga0207653_10331922 Ga0207653_103319221 59
175 3300025893 Ga0207682_10342778 Ga0207682_103427782 59
176 3300025899 Ga0207642_10001272 Ga0207642_100012723 59
177 3300025900 Ga0207710_10031118 Ga0207710_100311183 59
178 3300025903 Ga0207680_10004217 Ga0207680_100042178 59
179 3300025903 Ga0207680_10195442 Ga0207680_101954422 59
180 3300025907 Ga0207645_10250990 Ga0207645_102509902 59
181 3300025908 Ga0207643_10006831 Ga0207643_100068318 59
182 3300025908 Ga0207643_10336579 Ga0207643_103365791 59
183 3300025912 Ga0207707_11232643 Ga0207707_112326431 59
184 3300025913 Ga0207695_10382796 Ga0207695_103827962 59
185 3300025914 Ga0207671_10264747 Ga0207671_102647473 59
186 3300025914 Ga0207671_10401038 Ga0207671_104010382 59
187 3300025917 Ga0207660_10038780 Ga0207660_100387803 59
188 3300025917 Ga0207660_10222935 Ga0207660_102229352 59
189 3300025918 Ga0207662_10183621 Ga0207662_101836213 59
190 3300025918 Ga0207662_10329071 Ga0207662_103290711 59
191 3300025923 Ga0207681_10001878 Ga0207681_100018782 59
192 3300025925 Ga0207650_10000002 Ga0207650_100000021219 59
193 3300025927 Ga0207687_10003513 Ga0207687_100035139 59
194 3300025927 Ga0207687_10042035 Ga0207687_100420355 59
195 3300025931 Ga0207644_10000026 Ga0207644_1000002686 59
196 3300025934 Ga0207686_10007132 Ga0207686_100071329 59
197 3300025934 Ga0207686_10232270 Ga0207686_102322702 59
198 3300025935 Ga0207709_10027431 Ga0207709_100274315 59
199 3300025935 Ga0207709_10395512 Ga0207709_103955122 59
200 3300025936 Ga0207670_10004995 Ga0207670_100049954 59
201 3300025936 Ga0207670_10254969 Ga0207670_102549692 59
202 3300025937 Ga0207669_10547520 Ga0207669_105475202 59
203 3300025938 Ga0207704_10000551 Ga0207704_1000055117 59
204 3300025938 Ga0207704_10487180 Ga0207704_104871802 59
205 3300025939 Ga0207665_11027731 Ga0207665_110277311 59
206 3300025940 Ga0207691_10355343 Ga0207691_103553432 59
207 3300025941 Ga0207711_10000279 Ga0207711_1000027933 59
208 3300025941 Ga0207711_10021208 Ga0207711_100212084 59
209 3300025941 Ga0207711_10080793 Ga0207711_100807932 59
210 3300025942 Ga0207689_10000136 Ga0207689_1000013658 59
211 3300025942 Ga0207689_10002117 Ga0207689_1000211715 59
212 3300025960 Ga0207651_10934605 Ga0207651_109346052 59
213 3300025961 Ga0207712_10523795 Ga0207712_105237952 59
214 3300025972 Ga0207668_10566720 Ga0207668_105667201 59
215 3300025986 Ga0207658_10000001 Ga0207658_10000001136 59
216 3300025986 Ga0207658_10999171 Ga0207658_109991712 59
217 3300025986 Ga0207658_11009648 Ga0207658_110096481 59
218 3300026035 Ga0207703_10006745 Ga0207703_100067453 59
219 3300026035 Ga0207703_10026533 Ga0207703_100265336 59
220 3300026035 Ga0207703_10194547 Ga0207703_101945471 59
221 3300026041 Ga0207639_10297488 Ga0207639_102974882 59
222 3300026041 Ga0207639_10735962 Ga0207639_107359622 59
223 3300026075 Ga0207708_10001168 Ga0207708_100011689 59
224 3300026088 Ga0207641_10226320 Ga0207641_102263202 59
225 3300026088 Ga0207641_10264976 Ga0207641_102649761 59
226 3300026089 Ga0207648_10000485 Ga0207648_1000048517 59
227 3300026089 Ga0207648_10050348 Ga0207648_100503484 59
228 3300026089 Ga0207648_10525858 Ga0207648_105258581 59
229 3300026095 Ga0207676_10000001 Ga0207676_100000011219 59
230 3300026095 Ga0207676_10107818 Ga0207676_101078182 59
231 3300026118 Ga0207675_100000213 Ga0207675_1000002135 59
232 3300026118 Ga0207675_100026284 Ga0207675_1000262848 59
233 3300026121 Ga0207683_10012473 Ga0207683_100124734 59
234 3300026121 Ga0207683_10028497 Ga0207683_100284975 59
235 3300027111 Ga0209281_1017235 Ga0209281_10172352 59
236 3300028379 Ga0268266_10004153 Ga0268266_1000415311 59
237 3300028379 Ga0268266_10100747 Ga0268266_101007472 59
238 3300028379 Ga0268266_10297762 Ga0268266_102977623 59
239 3300028380 Ga0268265_10001823 Ga0268265_100018238 59
240 3300028380 Ga0268265_10105660 Ga0268265_101056604 59
241 3300028380 Ga0268265_10192601 Ga0268265_101926012 59
242 3300028381 Ga0268264_10000061 Ga0268264_10000061133 59
243 3300028381 Ga0268264_11212373 Ga0268264_112123731 59
244 3300028558 Ga0265326_10069355 Ga0265326_100693551 59
245 3300028800 Ga0265338_10002059 Ga0265338_1000205922 59
246 3300031251 Ga0265327_10000014 Ga0265327_1000001486 59
247 3300031251 Ga0265327_10000112 Ga0265327_10000112121 59
248 3300031665 Ga0316575_10004381 Ga0316575_100043814 59
249 3300031665 Ga0316575_10005135 Ga0316575_100051354 59
250 3300031691 Ga0316579_10160210 Ga0316579_101602103 59
251 3300031691 Ga0316579_10214753 Ga0316579_102147532 59
252 3300031691 Ga0316579_10295928 Ga0316579_102959282 59
253 3300031727 Ga0316576_10017223 Ga0316576_100172232 59
254 3300031727 Ga0316576_11075512 Ga0316576_110755122 59
255 3300031728 Ga0316578_10027557 Ga0316578_100275572 59
256 3300031733 Ga0316577_10005478 Ga0316577_100054784 59
257 3300031733 Ga0316577_10005970 Ga0316577_100059704 59
258 3300031733 Ga0316577_10144901 Ga0316577_101449012 59
259 3300031901 Ga0307406_11938690 Ga0307406_119386902 59
260 3300032133 Ga0316583_10157765 Ga0316583_101577652 59
261 3300032137 Ga0316585_10040995 Ga0316585_100409952 59
262 3300032137 Ga0316585_10090875 Ga0316585_100908752 59
263 3300032137 Ga0316585_10181481 Ga0316585_101814812 59
264 3300032139 Ga0316580_10006198 Ga0316580_100061983 59
265 3300032139 Ga0316580_10067414 Ga0316580_100674142 59
266 3300032168 Ga0316593_10006604 Ga0316593_100066042 59
267 3300032168 Ga0316593_10052998 Ga0316593_100529982 59
268 3300032168 Ga0316593_10081373 Ga0316593_100813732 59
269 3300033529 Ga0316587_1043055 Ga0316587_10430552 59
270 3300033529 Ga0316587_1048715 Ga0316587_10487152 59
271 3300033529 Ga0316587_1058203 Ga0316587_10582032 59
272 3300033529 Ga0316587_1060947 Ga0316587_10609472 59
273 3300033529 Ga0316587_1074827 Ga0316587_10748273 59
274 3300033541 Ga0316596_1027166 Ga0316596_10271662 59
275 3300033541 Ga0316596_1029341 Ga0316596_10293412 59
276 3300033541 Ga0316596_1039533 Ga0316596_10395332 59
277 3300033541 Ga0316596_1079008 Ga0316596_10790082 59
278 3300035085 Ga0373929_0250667 Ga0373929_0250667_209_388 59
279 3300035092 Ga0373952_0195494 Ga0373952_0195494_119_298 59
280 3300035207 Ga0373942_0198013 Ga0373942_0198013_461_640 59
281 3300035398 Ga0316574_0835399 Ga0316574_0835399_141_320 59
282 3300035691 Ga0373931_0339273 Ga0373931_0339273_227_406 59
283 3300036647 Ga0316582_0004572 Ga0316582_0004572_3562_3741 59
284 3300036647 Ga0316582_0027446 Ga0316582_0027446_688_867 59
285 3300036712 Ga0316584_0005066 Ga0316584_0005066_4499_4678 59
286 3300036712 Ga0316584_0008148 Ga0316584_0008148_4715_4894 59
287 3300038725 Ga0400484_32124 Ga0400484_32124_4805_4984 59
288 3300038726 Ga0400490_20117 Ga0400490_20117_22186_22365 59
289 3300038726 Ga0400490_31688 Ga0400490_31688_10949_11128 59
290 3300038727 Ga0400491_20800 Ga0400491_20800_3931_4110 59
291 3300038727 Ga0400491_21758 Ga0400491_21758_608_787 59
292 3300038735 Ga0400485_12746 Ga0400485_12746_1488_1667 59
293 3300038741 Ga0400488_18372 Ga0400488_18372_4047_4226 59
294 3300038741 Ga0400488_38656 Ga0400488_38656_68_247 59
295 3300038741 Ga0400488_46405 Ga0400488_46405_1124_1303 59
296 3300038741 Ga0400488_50084 Ga0400488_50084_1284_1463 59
297 3300038742 Ga0400486_06219 Ga0400486_06219_965_1144 59
298 3300039062 Ga0400483_006822 Ga0400483_006822_615_794 59
299 3300039062 Ga0400483_078683 Ga0400483_078683_559_738 59
300 3300039062 Ga0400483_085407 Ga0400483_085407_543_722 59
301 3300039062 Ga0400483_129431 Ga0400483_129431_389_568 59
302 3300039062 Ga0400483_170867 Ga0400483_170867_3088_3267 59
303 3300039062 Ga0400483_248196 Ga0400483_248196_3717_3896 59
304 3300039062 Ga0400483_254656 Ga0400483_254656_1412_1591 59
305 3300039093 Ga0400489_11346 Ga0400489_11346_510_689 59
306 3300039093 Ga0400489_58554 Ga0400489_58554_546_725 59
307 3300039110 Ga0400487_07419 Ga0400487_07419_897_1076 59
308 3300039110 Ga0400487_24791 Ga0400487_24791_20992_21171 59
309 3300039110 Ga0400487_41427 Ga0400487_41427_3208_3387 59
310 3300039110 Ga0400487_43791 Ga0400487_43791_16183_16362 59
311 3300039447 Ga0436361_0665703 Ga0436361_0665703_337_519 59
312 3300039447 Ga0436361_0944033 Ga0436361_0944033_372_554 59
313 3300041496 Ga0451839_0741211 Ga0451839_0741211_561_740 59
314 3300042876 Ga0451577_0296099 Ga0451577_0296099_621_803 59
315 3300042876 Ga0451577_0434525 Ga0451577_0434525_76_258 59
316 3300044712 Ga0453684_1185901 Ga0453684_1185901_204_386 59
317 3300045051 Ga0451576_0001131 Ga0451576_0001131_15653_15835 59
318 3300047445 Ga0495677_0396098 Ga0495677_0396098_323_505 59
319 3300048911 Ga0496108_1287625 Ga0496108_1287625_347_529 59
320 3300048917 Ga0496114_0705029 Ga0496114_0705029_617_796 59
321 3300048927 Ga0496124_0003292 Ga0496124_0003292_7104_7286 59
322 3300048927 Ga0496124_0111130 Ga0496124_0111130_340_522 59
323 3300048928 Ga0496125_0085562 Ga0496125_0085562_1526_1708 59
324 3300048929 Ga0496126_1369376 Ga0496126_1369376_228_410 59
325 3300049541 Ga0501325_012123 Ga0501325_012123_407_589 59
326 3300049575 Ga0501039_1264232 Ga0501039_1264232_165_347 59
327 3300049822 Ga0501035_0568797 Ga0501035_0568797_340_522 59
328 3300053098 Ga0500650_0000034 Ga0500650_0000034_21348_21530 59
329 3300053102 Ga0500554_257634 Ga0500554_257634_300_482 59
330 3300053119 Ga0500595_025222 Ga0500595_025222_1588_1770 59
331 3300053148 Ga0500590_339989 Ga0500590_339989_127_309 59
332 3300053177 Ga0500636_0070190 Ga0500636_0070190_1580_1762 59
333 3300055283 Ga0500661_004201 Ga0500661_004201_1627_1809 59
334 3300059477 Ga0587084_052553 Ga0587084_052553_144_326 59
335 3300059478 Ga0587093_075567 Ga0587093_075567_370_552 59
336 3300059491 Ga0587070_054776 Ga0587070_054776_171_353 59
337 3300059493 Ga0587077_087858 Ga0587077_087858_248_430 59
338 3300059503 Ga0587080_114324 Ga0587080_114324_175_357 59
339 3300059506 Ga0587085_015437 Ga0587085_015437_748_930 59
340 3300059507 Ga0587086_049489 Ga0587086_049489_38_220 59
341 3300059508 Ga0587088_047633 Ga0587088_047633_118_300 59
342 3300059510 Ga0587090_026977 Ga0587090_026977_211_393 59
343 3300059511 Ga0587091_051032 Ga0587091_051032_424_606 59
344 3300059513 Ga0587094_073400 Ga0587094_073400_195_377 59
345 3300059514 Ga0587095_023410 Ga0587095_023410_118_300 59
346 3300059607 Ga0587125_011724 Ga0587125_011724_523_705 59
347 3300059608 Ga0587129_028744 Ga0587129_028744_112_294 59
348 3300059623 Ga0587101_091602 Ga0587101_091602_374_556 59
349 3300059624 Ga0587109_056737 Ga0587109_056737_102_284 59
350 3300059627 Ga0587117_014876 Ga0587117_014876_218_400 59
351 3300059630 Ga0587128_141479 Ga0587128_141479_314_496 59
352 3300059631 Ga0587130_033675 Ga0587130_033675_24_206 59
353 3300059639 Ga0587062_057243 Ga0587062_057243_101_283 59
354 3300059641 Ga0587068_026769 Ga0587068_026769_545_727 59
355 3300059642 Ga0587069_136651 Ga0587069_136651_255_437 59
356 3300059645 Ga0587076_078552 Ga0587076_078552_401_583 59
357 3300059647 Ga0587079_184519 Ga0587079_184519_351_533 59
358 3300059648 Ga0587100_022084 Ga0587100_022084_195_377 59
359 3300059653 Ga0587108_022809 Ga0587108_022809_336_518 59
360 3300059657 Ga0587118_25044 Ga0587118_25044_227_409 59
361 3300060346 Ga0587111_0029070 Ga0587111_0029070_671_853 59
362 3300060353 Ga0501082_1408576 Ga0501082_1408576_391_573 59
363 3300009176 Ga0105242_11900004 Ga0105242_119000042 60
364 3300032168 Ga0316593_10055697 Ga0316593_100556972 60
365 3300033524 Ga0316592_1032534 Ga0316592_10325342 60
366 3300033528 Ga0316588_1027082 Ga0316588_10270822 60
367 3300033529 Ga0316587_1043065 Ga0316587_10430652 60
368 3300033541 Ga0316596_1001400 Ga0316596_10014005 60
369 3300036647 Ga0316582_0211511 Ga0316582_0211511_312_497 60
370 3300036712 Ga0316584_0027572 Ga0316584_0027572_184_369 60
371 iso_pu_bacteria 2547132130 2547503452 60
372 iso_pu_bacteria 2571042365 2572255282 60
373 iso_pu_bacteria 2643221559 2643818717 60
374 iso_pu_bacteria 2643221573 2643878372 60
375 iso_pu_bacteria 2643221579 2643908166 60
376 iso_pu_bacteria 2643221586 2643940968 60
377 iso_pu_bacteria 2643221612 2644079990 60
378 iso_pu_bacteria 2643221695 2644529935 60
379 iso_pu_bacteria 2643221720 2644659676 60
380 iso_pu_bacteria 2643221727 2644695585 60
381 iso_pu_bacteria 2643221728 2644700579 60
382 iso_pu_bacteria 2687453130 2687582671 60
383 iso_pu_bacteria 2747842428 2747947843 60
384 iso_pu_bacteria 2765235840 2765577915 60
385 iso_pu_bacteria 2816332141 2816515985 60
386 iso_pu_bacteria 2818991457 2819660509 60
387 iso_pu_bacteria 2842391507 2842394295 60
388 iso_pu_bacteria 2842757796 2842759880 60
389 iso_pu_bacteria 2842780639 2842781418 60
390 iso_pu_bacteria 2852684882 2852688958 60
391 iso_pu_bacteria 2874220319 2874220537 60
392 iso_pu_bacteria 2919089067 2919093259 60
393 iso_pu_bacteria 2919130084 2919130217 60
394 iso_pu_bacteria 2919134579 2919134807 60
395 iso_pu_bacteria 2923516293 2923518839 60
396 iso_pu_bacteria 2928496128 2928498603 60
397 iso_pu_bacteria 2929195423 2929198783 60
398 iso_pu_bacteria 2931380184 2931381830 60
399 iso_pu_bacteria 2937610967 2937611403 60
400 iso_pu_bacteria 2939626828 2939629840 60
401 iso_pu_bacteria 2941489479 2941493421 60
402 iso_pu_bacteria 2961047084 2961047302 60
403 iso_pu_bacteria 2961064222 2961068653 60
404 iso_pu_bacteria 2995948881 2995952484 60
405 iso_pu_bacteria 8002869464 8002872436 60
406 iso_pu_bacteria 8003014200 8003016329 60
407 iso_pu_bacteria 8021622325 8021622377 60
408 iso_pu_bacteria 8021626552 8021626898 60
409 iso_pu_bacteria 8021648035 8021648163 60
410 3300013105 Ga0157369_11680401 Ga0157369_116804012 61
411 3300031727 Ga0316576_10068103 Ga0316576_100681032 61
412 3300035398 Ga0316574_0068386 Ga0316574_0068386_1519_1707 61
413 3300036712 Ga0316584_0101289 Ga0316584_0101289_1632_1820 61
414 3300037418 Ga0395900_0000894 Ga0395900_0000894_33892_34092 61
415 3300004798 Ga0058859_11722583 Ga0058859_117225831 62
416 3300035398 Ga0316574_0408235 Ga0316574_0408235_310_501 62
417 3300035398 Ga0316574_0942254 Ga0316574_0942254_98_289 62
418 3300059643 Ga0587072_075379 Ga0587072_075379_263_463 62
419 3300005289 Ga0065704_10072102 Ga0065704_100721022 63
420 3300005293 Ga0065715_10078237 Ga0065715_100782371 63
421 3300005293 Ga0065715_11011924 Ga0065715_110119242 63
422 3300005347 Ga0070668_101473393 Ga0070668_1014733931 63
423 3300005355 Ga0070671_100739016 Ga0070671_1007390162 63
424 3300005438 Ga0070701_11400941 Ga0070701_114009411 63
425 3300005456 Ga0070678_102242385 Ga0070678_1022423851 63
426 3300005834 Ga0068851_10453043 Ga0068851_104530432 63
427 3300006881 Ga0068865_100283874 Ga0068865_1002838742 63
428 3300009551 Ga0105238_11528537 Ga0105238_115285372 63
429 3300012478 Ga0157328_1003518 Ga0157328_10035182 63
430 3300012485 Ga0157325_1008442 Ga0157325_10084421 63
431 3300012488 Ga0157343_1006429 Ga0157343_10064292 63
432 3300012497 Ga0157319_1023389 Ga0157319_10233892 63
433 3300012498 Ga0157345_1006098 Ga0157345_10060982 63
434 3300012500 Ga0157314_1009914 Ga0157314_10099142 63
435 3300012510 Ga0157316_1025939 Ga0157316_10259392 63
436 3300012510 Ga0157316_1062919 Ga0157316_10629192 63
437 3300012512 Ga0157327_1006828 Ga0157327_10068282 63
438 3300013104 Ga0157370_11208342 Ga0157370_112083422 63
439 3300014326 Ga0157380_13493985 Ga0157380_134939852 63
440 3300017792 Ga0163161_10784124 Ga0163161_107841242 63
441 3300025321 Ga0207656_10334120 Ga0207656_103341202 63
442 3300025924 Ga0207694_11168254 Ga0207694_111682542 63
443 3300025931 Ga0207644_10671696 Ga0207644_106716962 63
444 3300025981 Ga0207640_10372839 Ga0207640_103728391 63
445 3300026121 Ga0207683_10974922 Ga0207683_109749222 63
446 3300031691 Ga0316579_10059399 Ga0316579_100593994 63
447 3300031824 Ga0307413_10464157 Ga0307413_104641572 63
448 3300031995 Ga0307409_101310740 Ga0307409_1013107402 63
449 3300032005 Ga0307411_10983644 Ga0307411_109836442 63
450 3300032168 Ga0316593_10195575 Ga0316593_101955751 63
451 3300035398 Ga0316574_0199288 Ga0316574_0199288_117_311 63
452 3300039453 Ga0436362_0226625 Ga0436362_0226625_593_787 63
453 3300041443 Ga0451789_0793241 Ga0451789_0793241_305_499 63
454 3300041503 Ga0451847_0662423 Ga0451847_0662423_748_942 63
455 3300042876 Ga0451577_0423063 Ga0451577_0423063_740_934 63
456 3300044712 Ga0453684_1361098 Ga0453684_1361098_368_562 63
457 3300046664 Ga0495659_0090797 Ga0495659_0090797_628_834 63
458 3300049570 Ga0501033_0141497 Ga0501033_0141497_267_470 63
459 3300049571 Ga0501034_0239998 Ga0501034_0239998_1334_1537 63
460 3300049573 Ga0501037_0102200 Ga0501037_0102200_993_1196 63
461 3300049573 Ga0501037_0465188 Ga0501037_0465188_628_831 63
462 3300049581 Ga0501047_0117022 Ga0501047_0117022_680_883 63
463 3300049822 Ga0501035_0007793 Ga0501035_0007793_5142_5345 63
464 3300053120 Ga0500597_231227 Ga0500597_231227_426_620 63
465 3300059505 Ga0587083_0221326 Ga0587083_0221326_138_332 63
466 3300002705 JGI25156J39149_1002391 JGI25156J39149_10023915 64
467 3300002705 JGI25156J39149_1004783 JGI25156J39149_10047834 64
468 3300002741 JGI25157J39369_1002228 JGI25157J39369_10022285 64
469 3300003187 JGI25151J46595_10036365 JGI25151J46595_100363652 64
470 3300003320 rootH2_10058115 rootH2_100581152 64
471 3300003752 Ga0055539_1000930 Ga0055539_10009305 64
472 3300003756 Ga0055533_1000474 Ga0055533_10004745 64
473 3300003759 Ga0055525_1000097 Ga0055525_100009746 64
474 3300003760 Ga0055527_1000198 Ga0055527_100019827 64
475 3300003760 Ga0055527_1000344 Ga0055527_100034417 64
476 3300003760 Ga0055527_1000513 Ga0055527_100051312 64
477 3300003761 Ga0055535_1000795 Ga0055535_10007959 64
478 3300003761 Ga0055535_1003536 Ga0055535_10035362 64
479 3300003762 Ga0055542_1000441 Ga0055542_100044127 64
480 3300003762 Ga0055542_1003400 Ga0055542_10034005 64
481 3300003763 Ga0055529_1000591 Ga0055529_100059118 64
482 3300003763 Ga0055529_1001024 Ga0055529_10010245 64
483 3300003794 Ga0055531_10003401 Ga0055531_100034017 64
484 3300003856 Ga0058692_1000017 Ga0058692_100001715 64
485 3300005289 Ga0065704_10082305 Ga0065704_100823052 64
486 3300005328 Ga0070676_10025259 Ga0070676_100252594 64
487 3300005329 Ga0070683_100554473 Ga0070683_1005544732 64
488 3300005331 Ga0070670_100161863 Ga0070670_1001618632 64
489 3300005331 Ga0070670_100598518 Ga0070670_1005985181 64
490 3300005331 Ga0070670_101439520 Ga0070670_1014395202 64
491 3300005331 Ga0070670_101644392 Ga0070670_1016443922 64
492 3300005334 Ga0068869_100017947 Ga0068869_1000179474 64
493 3300005334 Ga0068869_100384401 Ga0068869_1003844012 64
494 3300005334 Ga0068869_100727978 Ga0068869_1007279782 64
495 3300005334 Ga0068869_101240323 Ga0068869_1012403231 64
496 3300005335 Ga0070666_10212849 Ga0070666_102128492 64
497 3300005335 Ga0070666_10538517 Ga0070666_105385171 64
498 3300005337 Ga0070682_101194433 Ga0070682_1011944332 64
499 3300005337 Ga0070682_101753694 Ga0070682_1017536941 64
500 3300005338 Ga0068868_100015146 Ga0068868_1000151464 64
501 3300005338 Ga0068868_100373544 Ga0068868_1003735442 64
502 3300005340 Ga0070689_101148206 Ga0070689_1011482062 64
503 3300005343 Ga0070687_100455327 Ga0070687_1004553271 64
504 3300005347 Ga0070668_100044400 Ga0070668_1000444005 64
505 3300005347 Ga0070668_100702951 Ga0070668_1007029512 64
506 3300005347 Ga0070668_101765648 Ga0070668_1017656481 64
507 3300005353 Ga0070669_100054718 Ga0070669_1000547183 64
508 3300005353 Ga0070669_100562965 Ga0070669_1005629651 64
509 3300005354 Ga0070675_100076871 Ga0070675_1000768712 64
510 3300005354 Ga0070675_100276957 Ga0070675_1002769572 64
511 3300005355 Ga0070671_100122199 Ga0070671_1001221993 64
512 3300005356 Ga0070674_100285205 Ga0070674_1002852052 64
513 3300005356 Ga0070674_100450220 Ga0070674_1004502202 64
514 3300005356 Ga0070674_100689548 Ga0070674_1006895481 64
515 3300005364 Ga0070673_100031734 Ga0070673_1000317343 64
516 3300005364 Ga0070673_100459992 Ga0070673_1004599922 64
517 3300005364 Ga0070673_102142887 Ga0070673_1021428872 64
518 3300005367 Ga0070667_100166193 Ga0070667_1001661933 64
519 3300005367 Ga0070667_100506787 Ga0070667_1005067871 64
520 3300005434 Ga0070709_11337362 Ga0070709_113373621 64
521 3300005435 Ga0070714_100868554 Ga0070714_1008685542 64
522 3300005439 Ga0070711_100121481 Ga0070711_1001214812 64
523 3300005455 Ga0070663_101850146 Ga0070663_1018501462 64
524 3300005456 Ga0070678_100039342 Ga0070678_1000393423 64
525 3300005456 Ga0070678_100317971 Ga0070678_1003179712 64
526 3300005456 Ga0070678_100894115 Ga0070678_1008941152 64
527 3300005457 Ga0070662_100316250 Ga0070662_1003162502 64
528 3300005457 Ga0070662_101583941 Ga0070662_1015839411 64
529 3300005458 Ga0070681_10608043 Ga0070681_106080431 64
530 3300005459 Ga0068867_100025912 Ga0068867_1000259122 64
531 3300005459 Ga0068867_100146165 Ga0068867_1001461652 64
532 3300005459 Ga0068867_100299989 Ga0068867_1002999892 64
533 3300005530 Ga0070679_101574454 Ga0070679_1015744542 64
534 3300005539 Ga0068853_100401752 Ga0068853_1004017522 64
535 3300005539 Ga0068853_100490573 Ga0068853_1004905732 64
536 3300005543 Ga0070672_100036695 Ga0070672_1000366953 64
537 3300005544 Ga0070686_101292276 Ga0070686_1012922762 64
538 3300005547 Ga0070693_100022625 Ga0070693_1000226252 64
539 3300005547 Ga0070693_100130569 Ga0070693_1001305692 64
540 3300005548 Ga0070665_100013638 Ga0070665_1000136385 64
541 3300005548 Ga0070665_100112949 Ga0070665_1001129494 64
542 3300005548 Ga0070665_100319643 Ga0070665_1003196432 64
543 3300005548 Ga0070665_101040540 Ga0070665_1010405402 64
544 3300005548 Ga0070665_101734318 Ga0070665_1017343182 64
545 3300005577 Ga0068857_100469001 Ga0068857_1004690012 64
546 3300005577 Ga0068857_101505174 Ga0068857_1015051742 64
547 3300005577 Ga0068857_101882781 Ga0068857_1018827812 64
548 3300005577 Ga0068857_102202928 Ga0068857_1022029282 64
549 3300005578 Ga0068854_101133922 Ga0068854_1011339222 64
550 3300005614 Ga0068856_100012880 Ga0068856_1000128809 64
551 3300005614 Ga0068856_100013948 Ga0068856_1000139484 64
552 3300005614 Ga0068856_100017128 Ga0068856_1000171285 64
553 3300005615 Ga0070702_100639653 Ga0070702_1006396531 64
554 3300005616 Ga0068852_100404198 Ga0068852_1004041982 64
555 3300005616 Ga0068852_102523817 Ga0068852_1025238172 64
556 3300005617 Ga0068859_100061758 Ga0068859_1000617582 64
557 3300005617 Ga0068859_100083014 Ga0068859_1000830144 64
558 3300005617 Ga0068859_100163932 Ga0068859_1001639324 64
559 3300005618 Ga0068864_100145020 Ga0068864_1001450202 64
560 3300005718 Ga0068866_10078039 Ga0068866_100780392 64
561 3300005718 Ga0068866_10151511 Ga0068866_101515112 64
562 3300005718 Ga0068866_10336904 Ga0068866_103369042 64
563 3300005719 Ga0068861_100199308 Ga0068861_1001993082 64
564 3300005834 Ga0068851_10436210 Ga0068851_104362102 64
565 3300005834 Ga0068851_10553829 Ga0068851_105538292 64
566 3300005840 Ga0068870_10165818 Ga0068870_101658182 64
567 3300005841 Ga0068863_100292140 Ga0068863_1002921402 64
568 3300005841 Ga0068863_100484640 Ga0068863_1004846402 64
569 3300005843 Ga0068860_100007326 Ga0068860_1000073265 64
570 3300005843 Ga0068860_100436870 Ga0068860_1004368702 64
571 3300005843 Ga0068860_101628041 Ga0068860_1016280411 64
572 3300005844 Ga0068862_100529938 Ga0068862_1005299382 64
573 3300006163 Ga0070715_10512399 Ga0070715_105123992 64
574 3300006237 Ga0097621_100021221 Ga0097621_1000212216 64
575 3300006237 Ga0097621_100079713 Ga0097621_1000797133 64
576 3300006237 Ga0097621_101609756 Ga0097621_1016097561 64
577 3300006358 Ga0068871_100055319 Ga0068871_1000553194 64
578 3300006358 Ga0068871_100060853 Ga0068871_1000608534 64
579 3300006358 Ga0068871_100675654 Ga0068871_1006756542 64
580 3300006844 Ga0075428_102214397 Ga0075428_1022143972 64
581 3300006871 Ga0075434_100468902 Ga0075434_1004689022 64
582 3300006881 Ga0068865_100002785 Ga0068865_10000278512 64
583 3300006881 Ga0068865_100015225 Ga0068865_1000152255 64
584 3300006881 Ga0068865_100081427 Ga0068865_1000814274 64
585 3300006881 Ga0068865_100494921 Ga0068865_1004949212 64
586 3300006931 Ga0097620_100061758 Ga0097620_1000617585 64
587 3300006931 Ga0097620_100083015 Ga0097620_1000830154 64
588 3300006931 Ga0097620_100163932 Ga0097620_1001639324 64
589 3300009098 Ga0105245_10449010 Ga0105245_104490102 64
590 3300009545 Ga0105237_10770502 Ga0105237_107705021 64
591 3300010375 Ga0105239_10012321 Ga0105239_100123216 64
592 3300013296 Ga0157374_10174704 Ga0157374_101747042 64
593 3300013308 Ga0157375_10255335 Ga0157375_102553352 64
594 3300014969 Ga0157376_10043903 Ga0157376_100439033 64
595 3300014969 Ga0157376_13005034 Ga0157376_130050341 64
596 3300021384 Ga0213876_10681524 Ga0213876_106815242 64
597 3300025226 Ga0209674_100506 Ga0209674_1005067 64
598 3300025228 Ga0209672_100007 Ga0209672_100007180 64
599 3300025228 Ga0209672_100078 Ga0209672_10007874 64
600 3300025230 Ga0209563_100079 Ga0209563_10007945 64
601 3300025242 Ga0209258_100012 Ga0209258_100012628 64
602 3300025242 Ga0209258_100046 Ga0209258_100046157 64
603 3300025250 Ga0209026_1000285 Ga0209026_100028546 64
604 3300025253 Ga0209677_101982 Ga0209677_1019824 64
605 3300025254 Ga0209148_1000014 Ga0209148_100001428 64
606 3300025254 Ga0209148_1000098 Ga0209148_100009828 64
607 3300025256 Ga0209759_1000460 Ga0209759_100046035 64
608 3300025272 Ga0209455_1000010 Ga0209455_1000010180 64
609 3300025272 Ga0209455_1000126 Ga0209455_100012686 64
610 3300025321 Ga0207656_10676664 Ga0207656_106766642 64
611 3300025899 Ga0207642_10172119 Ga0207642_101721192 64
612 3300025899 Ga0207642_10489262 Ga0207642_104892622 64
613 3300025899 Ga0207642_10528222 Ga0207642_105282222 64
614 3300025903 Ga0207680_10071444 Ga0207680_100714445 64
615 3300025903 Ga0207680_10399268 Ga0207680_103992681 64
616 3300025906 Ga0207699_10609128 Ga0207699_106091282 64
617 3300025907 Ga0207645_10008655 Ga0207645_100086557 64
618 3300025907 Ga0207645_10175099 Ga0207645_101750992 64
619 3300025907 Ga0207645_10375117 Ga0207645_103751172 64
620 3300025908 Ga0207643_10039399 Ga0207643_100393993 64
621 3300025909 Ga0207705_10689888 Ga0207705_106898881 64
622 3300025911 Ga0207654_10064120 Ga0207654_100641204 64
623 3300025911 Ga0207654_10708572 Ga0207654_107085722 64
624 3300025912 Ga0207707_10351118 Ga0207707_103511182 64
625 3300025913 Ga0207695_10001746 Ga0207695_1000174620 64
626 3300025914 Ga0207671_10001938 Ga0207671_1000193814 64
627 3300025914 Ga0207671_10344282 Ga0207671_103442822 64
628 3300025918 Ga0207662_10335686 Ga0207662_103356862 64
629 3300025923 Ga0207681_10129882 Ga0207681_101298821 64
630 3300025923 Ga0207681_10823772 Ga0207681_108237722 64
631 3300025924 Ga0207694_10000627 Ga0207694_1000062727 64
632 3300025924 Ga0207694_10016648 Ga0207694_100166487 64
633 3300025925 Ga0207650_10049228 Ga0207650_100492284 64
634 3300025926 Ga0207659_10330157 Ga0207659_103301572 64
635 3300025927 Ga0207687_10795396 Ga0207687_107953961 64
636 3300025929 Ga0207664_10748583 Ga0207664_107485832 64
637 3300025931 Ga0207644_10165775 Ga0207644_101657753 64
638 3300025933 Ga0207706_10334312 Ga0207706_103343122 64
639 3300025933 Ga0207706_10423252 Ga0207706_104232522 64
640 3300025934 Ga0207686_10000895 Ga0207686_1000089513 64
641 3300025934 Ga0207686_10390735 Ga0207686_103907352 64
642 3300025934 Ga0207686_10829667 Ga0207686_108296671 64
643 3300025937 Ga0207669_10337081 Ga0207669_103370812 64
644 3300025937 Ga0207669_10353411 Ga0207669_103534112 64
645 3300025938 Ga0207704_10053746 Ga0207704_100537463 64
646 3300025938 Ga0207704_10158932 Ga0207704_101589322 64
647 3300025938 Ga0207704_10514258 Ga0207704_105142582 64
648 3300025938 Ga0207704_11451412 Ga0207704_114514122 64
649 3300025940 Ga0207691_10018155 Ga0207691_100181558 64
650 3300025940 Ga0207691_10019550 Ga0207691_100195507 64
651 3300025941 Ga0207711_10042177 Ga0207711_100421775 64
652 3300025942 Ga0207689_10172903 Ga0207689_101729033 64
653 3300025942 Ga0207689_10194656 Ga0207689_101946561 64
654 3300025949 Ga0207667_10222068 Ga0207667_102220682 64
655 3300025960 Ga0207651_10350869 Ga0207651_103508691 64
656 3300025960 Ga0207651_10455422 Ga0207651_104554222 64
657 3300025961 Ga0207712_10187403 Ga0207712_101874033 64
658 3300025961 Ga0207712_10299585 Ga0207712_102995851 64
659 3300025972 Ga0207668_10050976 Ga0207668_100509761 64
660 3300025981 Ga0207640_10448249 Ga0207640_104482492 64
661 3300025981 Ga0207640_11140991 Ga0207640_111409911 64
662 3300025986 Ga0207658_10043506 Ga0207658_100435065 64
663 3300025986 Ga0207658_10155909 Ga0207658_101559093 64
664 3300025986 Ga0207658_10186518 Ga0207658_101865182 64
665 3300026023 Ga0207677_10052958 Ga0207677_100529582 64
666 3300026023 Ga0207677_10473799 Ga0207677_104737991 64
667 3300026023 Ga0207677_10735967 Ga0207677_107359672 64
668 3300026035 Ga0207703_12312324 Ga0207703_123123241 64
669 3300026041 Ga0207639_10130378 Ga0207639_101303783 64
670 3300026041 Ga0207639_11372766 Ga0207639_113727661 64
671 3300026041 Ga0207639_11430050 Ga0207639_114300502 64
672 3300026041 Ga0207639_11572289 Ga0207639_115722891 64
673 3300026078 Ga0207702_10009097 Ga0207702_100090975 64
674 3300026078 Ga0207702_10031237 Ga0207702_100312372 64
675 3300026078 Ga0207702_10178517 Ga0207702_101785172 64
676 3300026088 Ga0207641_10337426 Ga0207641_103374262 64
677 3300026088 Ga0207641_10390777 Ga0207641_103907772 64
678 3300026089 Ga0207648_10084228 Ga0207648_100842284 64
679 3300026089 Ga0207648_10372947 Ga0207648_103729472 64
680 3300026095 Ga0207676_10399217 Ga0207676_103992172 64
681 3300026116 Ga0207674_10711716 Ga0207674_107117162 64
682 3300026116 Ga0207674_11165729 Ga0207674_111657292 64
683 3300026118 Ga0207675_100277204 Ga0207675_1002772042 64
684 3300026121 Ga0207683_10007796 Ga0207683_100077969 64
685 3300026121 Ga0207683_10080612 Ga0207683_100806122 64
686 3300026121 Ga0207683_10129572 Ga0207683_101295724 64
687 3300026142 Ga0207698_10195509 Ga0207698_101955092 64
688 3300026142 Ga0207698_11395982 Ga0207698_113959822 64
689 3300028379 Ga0268266_10034465 Ga0268266_100344654 64
690 3300028379 Ga0268266_10119001 Ga0268266_101190012 64
691 3300028379 Ga0268266_10409104 Ga0268266_104091042 64
692 3300028380 Ga0268265_10521751 Ga0268265_105217512 64
693 3300028380 Ga0268265_11514842 Ga0268265_115148422 64
694 3300028381 Ga0268264_10003726 Ga0268264_1000372613 64
695 3300028381 Ga0268264_10739785 Ga0268264_107397852 64
696 3300028381 Ga0268264_10996088 Ga0268264_109960881 64
697 3300028800 Ga0265338_10896290 Ga0265338_108962902 64
698 3300031730 Ga0307516_10103849 Ga0307516_101038495 64
699 3300031730 Ga0307516_10176813 Ga0307516_101768132 64
700 3300031730 Ga0307516_10236670 Ga0307516_102366702 64
701 3300037312 Ga0395899_0000319 Ga0395899_0000319_19168_19362 64
702 3300037418 Ga0395900_0000061 Ga0395900_0000061_200445_200639 64
703 3300037466 Ga0395898_0000034 Ga0395898_0000034_145879_146073 64
704 3300038443 Ga0395901_0077195 Ga0395901_0077195_2585_2779 64
705 3300039437 Ga0436365_0840042 Ga0436365_0840042_326_520 64
706 3300039437 Ga0436365_1664988 Ga0436365_1664988_1613_1807 64
707 3300039450 Ga0436363_1117066 Ga0436363_1117066_648_842 64
708 3300039450 Ga0436363_1191204 Ga0436363_1191204_286_480 64
709 3300041406 Ga0439439_0007861 Ga0439439_0007861_900_1094 64
710 3300041444 Ga0451790_31258 Ga0451790_31258_249_443 64
711 3300044656 Ga0466969_0036984 Ga0466969_0036984_826_1020 64
712 3300044684 Ga0466966_0057286 Ga0466966_0057286_826_1020 64
713 3300044693 Ga0466961_0004766 Ga0466961_0004766_5624_5818 64
714 3300044693 Ga0466961_0027892 Ga0466961_0027892_2611_2805 64
715 3300044706 Ga0466964_0003032 Ga0466964_0003032_3715_3909 64
716 3300044719 Ga0466971_0149901 Ga0466971_0149901_445_639 64
717 3300044735 Ga0466968_0028966 Ga0466968_0028966_862_1056 64
718 3300044765 Ga0466970_0011634 Ga0466970_0011634_4264_4458 64
719 3300044842 Ga0466957_0012640 Ga0466957_0012640_450_644 64
720 3300045049 Ga0466959_0000258 Ga0466959_0000258_10074_10268 64
721 3300045836 Ga0466958_0383431 Ga0466958_0383431_130_324 64
722 3300046679 Ga0495623_0421842 Ga0495623_0421842_64_258 64
723 3300048917 Ga0496114_0209806 Ga0496114_0209806_1122_1316 64
724 3300048918 Ga0496115_0000065 Ga0496115_0000065_36228_36422 64
725 3300048920 Ga0496117_0516975 Ga0496117_0516975_51_245 64
726 3300048921 Ga0496118_0029968 Ga0496118_0029968_1855_2049 64
727 3300048929 Ga0496126_0000185 Ga0496126_0000185_99921_100115 64
728 3300049824 Ga0501045_0321852 Ga0501045_0321852_490_684 64
729 3300061719 Ga0466962_0012161 Ga0466962_0012161_154_348 64

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01783

Ribosomal_L32p

Ribosomal L32p protein family

2

58

0.97

Feature Viewer

pLDDT pTM Quality
79.49 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map