F477748
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 727 | 377 | 727 | 272 |
Family's Representative Sequence
| Representative Sequence | 3300027360|Ga0209969_1004401|Ga0209969_10044012 |
| Length | 335 |
| Sequence | LAEIIVVTSGKGGVGKTTTSASLACGLARHGKKVAVIDFDVGLRNLDLIMGCERRVVYDFVNVIHGEASLKQSLIKDKRFDNLFVLAASQTRDKDALTTEGVQKVLDDLAADGFDYIVCDSPAGIEKGAFLAMYFADQAVVVVNPEVSSVRDSDRILGLLASKTRRAEAGERVKEHLLLTRYSPARVETGEMLSIGDVEEVLGLKTIGVIPESGDVLNASNKGEPVILDMESPAGQAYDDAVAPRYNQLGRDTWADSVTNDAQRLTVNEILTVNGRGLGAVPNTGVKRDVVSMTPAHRWVNRSPSSWGKISKKCRASRSCEGDCSRRGSILPGKW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 15 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 18 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 92 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 96 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 97 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 98 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 99 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 114 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 119 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 123 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 197 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 214 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 216 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 219 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 220 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 221 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 222 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 223 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 226 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 233 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 234 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 235 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 242 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 244 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 245 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 246 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 252 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 253 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 254 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 255 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 256 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 257 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 258 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 259 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 265 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 266 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 267 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 268 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 269 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 270 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 271 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 272 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 273 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 274 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 275 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 276 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 277 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 278 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 279 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 280 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 281 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 282 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 283 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 284 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 285 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 286 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 325 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 326 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 329 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 330 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 331 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 332 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 333 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 334 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 335 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 336 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 337 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 338 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 339 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 340 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 341 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 345 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 358 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 359 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 360 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 361 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 365 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 366 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 368 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 370 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 371 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 372 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 373 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 374 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 375 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 376 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.46 |
| Metatranscriptomes | 4.54 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.09 |
| Nodule | 0.28 |
| Rhizoplane | 2.75 |
| Rhizosphere | 72.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2648276 | 2162886007 | Bacteria | 3478 |
| 2 | SwRhRL2b_contig_613501 | 2162886007 | Bacteria | 1245 |
| 3 | JGI24740J21852_10022400 | 3300001979 | Bacteria | 2175 |
| 4 | JGI24739J22299_10000089 | 3300001989 | Bacteria | 26418 |
| 5 | JGI24737J22298_10030053 | 3300001990 | Bacteria | 1701 |
| 6 | JGI24735J21928_10000702 | 3300002067 | Bacteria | 11875 |
| 7 | JGI24735J21928_10002530 | 3300002067 | Bacteria | 6323 |
| 8 | JGI25162J39368_1000057 | 3300002737 | Bacteria | 145686 |
| 9 | JGI25162J39368_1007427 | 3300002737 | Bacteria | 1712 |
| 10 | JGI25157J39369_1000538 | 3300002741 | Bacteria | 22762 |
| 11 | JGI25157J39369_1001918 | 3300002741 | Bacteria | 6287 |
| 12 | JGI25163J39215_1001422 | 3300002771 | Bacteria | 3978 |
| 13 | JGI25164J39214_1000043 | 3300002772 | Bacteria | 126257 |
| 14 | JGI25164J39214_1001165 | 3300002772 | Bacteria | 7293 |
| 15 | JGI25150J39212_1000120 | 3300002774 | Bacteria | 44029 |
| 16 | JGI25151J46595_10000107 | 3300003187 | Bacteria | 113288 |
| 17 | JGI25151J46595_10000260 | 3300003187 | Bacteria | 61845 |
| 18 | JGI25165J46597_1000113 | 3300003214 | Bacteria | 145686 |
| 19 | JGI25165J46597_1003673 | 3300003214 | Bacteria | 3664 |
| 20 | JGI25153J46596_10000078 | 3300003215 | Bacteria | 113288 |
| 21 | JGI25153J46596_10040868 | 3300003215 | Bacteria | 1433 |
| 22 | JGI26145J50221_1003303 | 3300003371 | Bacteria | 1283 |
| 23 | Ga0006556J51387_1029963 | 3300003479 | Bacteria | 1270 |
| 24 | Ga0006554J51385_1026984 | 3300003567 | Bacteria | 1441 |
| 25 | Ga0006562J51391_1011820 | 3300003578 | Bacteria | 2148 |
| 26 | Ga0006562J51391_1022863 | 3300003578 | Bacteria | 3210 |
| 27 | Ga0055538_1001003 | 3300003751 | Bacteria | 6516 |
| 28 | Ga0055533_1000782 | 3300003756 | Bacteria | 9978 |
| 29 | Ga0055535_1000043 | 3300003761 | Bacteria | 145953 |
| 30 | Ga0055542_1000067 | 3300003762 | Bacteria | 154585 |
| 31 | Ga0055542_1000072 | 3300003762 | Bacteria | 145686 |
| 32 | Ga0055529_1000339 | 3300003763 | Bacteria | 52374 |
| 33 | Ga0055526_1000564 | 3300003771 | Bacteria | 29305 |
| 34 | Ga0055526_1002454 | 3300003771 | Bacteria | 12538 |
| 35 | Ga0055537_1000251 | 3300003773 | Bacteria | 39049 |
| 36 | Ga0055537_1000954 | 3300003773 | Bacteria | 13306 |
| 37 | Ga0055524_1001496 | 3300003775 | Bacteria | 13307 |
| 38 | Ga0055524_1006561 | 3300003775 | Bacteria | 5033 |
| 39 | Ga0055536_1004489 | 3300003781 | Bacteria | 7117 |
| 40 | Ga0055534_1000913 | 3300003784 | Bacteria | 13307 |
| 41 | Ga0055534_1001894 | 3300003784 | Bacteria | 7731 |
| 42 | Ga0055528_1000533 | 3300003790 | Bacteria | 29305 |
| 43 | Ga0055528_1002470 | 3300003790 | Bacteria | 9882 |
| 44 | Ga0055530_10001071 | 3300003791 | Bacteria | 21561 |
| 45 | Ga0055530_10008328 | 3300003791 | Bacteria | 4174 |
| 46 | Ga0055540_1026696 | 3300003792 | Bacteria | 1393 |
| 47 | Ga0055531_10003169 | 3300003794 | Bacteria | 10577 |
| 48 | Ga0055531_10037499 | 3300003794 | Bacteria | 1473 |
| 49 | Ga0058692_1000022 | 3300003856 | Bacteria | 237321 |
| 50 | Ga0065165_1000108 | 3300005262 | Bacteria | 139605 |
| 51 | Ga0065704_10088826 | 3300005289 | Bacteria | 2908 |
| 52 | Ga0070658_10154552 | 3300005327 | Bacteria | 1922 |
| 53 | Ga0070670_100008545 | 3300005331 | Bacteria | 8734 |
| 54 | Ga0070670_100011146 | 3300005331 | Bacteria | 7682 |
| 55 | Ga0070670_100029814 | 3300005331 | Bacteria | 4699 |
| 56 | Ga0070680_100000676 | 3300005336 | Bacteria | 23705 |
| 57 | Ga0070680_100064855 | 3300005336 | Bacteria | 2993 |
| 58 | Ga0070682_100151034 | 3300005337 | Bacteria | 1594 |
| 59 | Ga0070682_100275707 | 3300005337 | Bacteria | 1224 |
| 60 | Ga0070660_100189112 | 3300005339 | Bacteria | 1667 |
| 61 | Ga0070689_100001462 | 3300005340 | Bacteria | 15069 |
| 62 | Ga0070661_100007538 | 3300005344 | Bacteria | 7508 |
| 63 | Ga0070668_100609766 | 3300005347 | Bacteria | 956 |
| 64 | Ga0070669_100052790 | 3300005353 | Bacteria | 2975 |
| 65 | Ga0070675_100059966 | 3300005354 | Bacteria | 3141 |
| 66 | Ga0070675_100198261 | 3300005354 | Bacteria | 1742 |
| 67 | Ga0070671_100025253 | 3300005355 | Bacteria | 4874 |
| 68 | Ga0070671_100143038 | 3300005355 | Bacteria | 2019 |
| 69 | Ga0070671_100276600 | 3300005355 | Bacteria | 1427 |
| 70 | Ga0070674_100133400 | 3300005356 | Bacteria | 1855 |
| 71 | Ga0070659_100097915 | 3300005366 | Bacteria | 2358 |
| 72 | Ga0070659_100223793 | 3300005366 | Bacteria | 1554 |
| 73 | Ga0070667_100007996 | 3300005367 | Bacteria | 8772 |
| 74 | Ga0070667_100164927 | 3300005367 | Bacteria | 1953 |
| 75 | Ga0070667_100228753 | 3300005367 | Bacteria | 1657 |
| 76 | Ga0070714_100089629 | 3300005435 | Bacteria | 2693 |
| 77 | Ga0070713_100114561 | 3300005436 | Bacteria | 2356 |
| 78 | Ga0070663_100025773 | 3300005455 | Bacteria | 3974 |
| 79 | Ga0070663_100090499 | 3300005455 | Bacteria | 2266 |
| 80 | Ga0070663_100118768 | 3300005455 | Bacteria | 1995 |
| 81 | Ga0070663_100183284 | 3300005455 | Bacteria | 1625 |
| 82 | Ga0070662_100013229 | 3300005457 | Bacteria | 5487 |
| 83 | Ga0070681_10000099 | 3300005458 | Bacteria | 64409 |
| 84 | Ga0070681_10003096 | 3300005458 | Bacteria | 15444 |
| 85 | Ga0070681_10004417 | 3300005458 | Bacteria | 13396 |
| 86 | Ga0070681_10027458 | 3300005458 | Bacteria | 5723 |
| 87 | Ga0070681_10086744 | 3300005458 | Bacteria | 3083 |
| 88 | Ga0070685_10015608 | 3300005466 | Bacteria | 4037 |
| 89 | Ga0070679_100001851 | 3300005530 | Bacteria | 19019 |
| 90 | Ga0070679_100041191 | 3300005530 | Bacteria | 4597 |
| 91 | Ga0070679_100093771 | 3300005530 | Bacteria | 2989 |
| 92 | Ga0068853_100161816 | 3300005539 | Bacteria | 2020 |
| 93 | Ga0070672_100000943 | 3300005543 | Bacteria | 17491 |
| 94 | Ga0070672_100005546 | 3300005543 | Bacteria | 8381 |
| 95 | Ga0070672_100095766 | 3300005543 | Bacteria | 2401 |
| 96 | Ga0070665_100001585 | 3300005548 | Bacteria | 26221 |
| 97 | Ga0070665_100318368 | 3300005548 | Bacteria | 1560 |
| 98 | Ga0070665_100447780 | 3300005548 | Bacteria | 1301 |
| 99 | Ga0068855_100001765 | 3300005563 | Bacteria | 27005 |
| 100 | Ga0068855_100004088 | 3300005563 | Bacteria | 17795 |
| 101 | Ga0068855_100049342 | 3300005563 | Bacteria | 4964 |
| 102 | Ga0068855_100066454 | 3300005563 | Bacteria | 4204 |
| 103 | Ga0068855_100288107 | 3300005563 | Bacteria | 1821 |
| 104 | Ga0070664_100143974 | 3300005564 | Bacteria | 2101 |
| 105 | Ga0068857_100004412 | 3300005577 | Bacteria | 11893 |
| 106 | Ga0068854_100023085 | 3300005578 | Bacteria | 4246 |
| 107 | Ga0068856_100033193 | 3300005614 | Bacteria | 5054 |
| 108 | Ga0068856_100391281 | 3300005614 | Bacteria | 1410 |
| 109 | Ga0068852_100050040 | 3300005616 | Bacteria | 3578 |
| 110 | Ga0068859_100347938 | 3300005617 | Bacteria | 1577 |
| 111 | Ga0068864_100046699 | 3300005618 | Bacteria | 3716 |
| 112 | Ga0068851_10000643 | 3300005834 | Bacteria | 14875 |
| 113 | Ga0068851_10005136 | 3300005834 | Bacteria | 5936 |
| 114 | Ga0068851_10018299 | 3300005834 | Bacteria | 3374 |
| 115 | Ga0068851_10131723 | 3300005834 | Bacteria | 1353 |
| 116 | Ga0068858_100002671 | 3300005842 | Bacteria | 17949 |
| 117 | Ga0068858_100031901 | 3300005842 | Bacteria | 4895 |
| 118 | Ga0068862_100035072 | 3300005844 | Bacteria | 4247 |
| 119 | Ga0068862_100067754 | 3300005844 | Bacteria | 3078 |
| 120 | Ga0081539_10040705 | 3300005985 | Bacteria | 2725 |
| 121 | Ga0075365_10024305 | 3300006038 | Bacteria | 3820 |
| 122 | Ga0075364_10065436 | 3300006051 | Bacteria | 2386 |
| 123 | Ga0075364_10066556 | 3300006051 | Bacteria | 2367 |
| 124 | Ga0075364_10215446 | 3300006051 | Bacteria | 1302 |
| 125 | Ga0097621_100079375 | 3300006237 | Bacteria | 2728 |
| 126 | Ga0068871_100081249 | 3300006358 | Bacteria | 2685 |
| 127 | Ga0068871_100388063 | 3300006358 | Bacteria | 1241 |
| 128 | Ga0068865_100020792 | 3300006881 | Bacteria | 4261 |
| 129 | Ga0068865_100234792 | 3300006881 | Bacteria | 1440 |
| 130 | Ga0097620_100347947 | 3300006931 | Bacteria | 1577 |
| 131 | Ga0079104_1000008 | 3300006946 | Bacteria | 371223 |
| 132 | Ga0105251_10000259 | 3300009011 | Bacteria | 53031 |
| 133 | Ga0105251_10002216 | 3300009011 | Bacteria | 15497 |
| 134 | Ga0105244_10026087 | 3300009036 | Bacteria | 3166 |
| 135 | Ga0105250_10000043 | 3300009092 | Bacteria | 129336 |
| 136 | Ga0105240_10000617 | 3300009093 | Bacteria | 65935 |
| 137 | Ga0105240_10000755 | 3300009093 | Bacteria | 58976 |
| 138 | Ga0105240_10013159 | 3300009093 | Bacteria | 11383 |
| 139 | Ga0105240_10019235 | 3300009093 | Bacteria | 9128 |
| 140 | Ga0105240_10019299 | 3300009093 | Bacteria | 9111 |
| 141 | Ga0105240_10024140 | 3300009093 | Bacteria | 8025 |
| 142 | Ga0111539_10058864 | 3300009094 | Bacteria | 4557 |
| 143 | Ga0105245_10543391 | 3300009098 | Bacteria | 1183 |
| 144 | Ga0105247_10002256 | 3300009101 | Bacteria | 13254 |
| 145 | Ga0105243_10001498 | 3300009148 | Bacteria | 20434 |
| 146 | Ga0105243_10002163 | 3300009148 | Bacteria | 16598 |
| 147 | Ga0105243_10007322 | 3300009148 | Bacteria | 8487 |
| 148 | Ga0105241_10041687 | 3300009174 | Bacteria | 3470 |
| 149 | Ga0105248_10086868 | 3300009177 | Bacteria | 3519 |
| 150 | Ga0105248_10166065 | 3300009177 | Bacteria | 2488 |
| 151 | Ga0105237_10000063 | 3300009545 | Bacteria | 141759 |
| 152 | Ga0105237_10200765 | 3300009545 | Bacteria | 1994 |
| 153 | Ga0105237_10275591 | 3300009545 | Bacteria | 1685 |
| 154 | Ga0105237_10301734 | 3300009545 | Bacteria | 1605 |
| 155 | Ga0105237_10518034 | 3300009545 | Bacteria | 1199 |
| 156 | Ga0105238_10001654 | 3300009551 | Bacteria | 22378 |
| 157 | Ga0105238_10001944 | 3300009551 | Bacteria | 20782 |
| 158 | Ga0105238_10057666 | 3300009551 | Bacteria | 3893 |
| 159 | Ga0105238_10072874 | 3300009551 | Bacteria | 3429 |
| 160 | Ga0105238_10093232 | 3300009551 | Bacteria | 2999 |
| 161 | Ga0105249_10269449 | 3300009553 | Bacteria | 1696 |
| 162 | Ga0105148_101777 | 3300009978 | Bacteria | 1509 |
| 163 | Ga0105032_100374 | 3300009979 | Bacteria | 4513 |
| 164 | Ga0105239_10014375 | 3300010375 | Bacteria | 8783 |
| 165 | Ga0105239_10024562 | 3300010375 | Bacteria | 6639 |
| 166 | Ga0105239_10571243 | 3300010375 | Bacteria | 1289 |
| 167 | Ga0105239_11134771 | 3300010375 | Bacteria | 900 |
| 168 | Ga0105246_10260825 | 3300011119 | Bacteria | 1380 |
| 169 | Ga0157317_1001242 | 3300012475 | Bacteria | 1339 |
| 170 | Ga0157337_1000899 | 3300012483 | Bacteria | 1430 |
| 171 | Ga0157314_1000730 | 3300012500 | Bacteria | 2882 |
| 172 | Ga0157316_1000171 | 3300012510 | Bacteria | 3153 |
| 173 | Ga0157327_1001515 | 3300012512 | Bacteria | 1469 |
| 174 | Ga0157371_10000819 | 3300013102 | Bacteria | 35696 |
| 175 | Ga0157371_10075571 | 3300013102 | Bacteria | 2386 |
| 176 | Ga0157370_10000272 | 3300013104 | Bacteria | 65739 |
| 177 | Ga0157370_10017678 | 3300013104 | Bacteria | 7188 |
| 178 | Ga0157370_10073786 | 3300013104 | Bacteria | 3219 |
| 179 | Ga0157370_10078752 | 3300013104 | Bacteria | 3104 |
| 180 | Ga0157370_10171157 | 3300013104 | Bacteria | 2019 |
| 181 | Ga0157370_10177038 | 3300013104 | Bacteria | 1982 |
| 182 | Ga0157369_10004930 | 3300013105 | Bacteria | 15633 |
| 183 | Ga0157369_10024694 | 3300013105 | Bacteria | 6679 |
| 184 | Ga0157369_10039054 | 3300013105 | Bacteria | 5189 |
| 185 | Ga0157369_10062739 | 3300013105 | Bacteria | 4004 |
| 186 | Ga0157369_10063781 | 3300013105 | Bacteria | 3969 |
| 187 | Ga0157369_10109099 | 3300013105 | Bacteria | 2943 |
| 188 | Ga0157369_10148651 | 3300013105 | Bacteria | 2476 |
| 189 | Ga0163162_10000003 | 3300013306 | Bacteria | 698280 |
| 190 | Ga0163162_10000541 | 3300013306 | Bacteria | 34925 |
| 191 | Ga0163162_10043913 | 3300013306 | Bacteria | 4475 |
| 192 | Ga0163162_10205823 | 3300013306 | Bacteria | 2097 |
| 193 | Ga0163162_10986906 | 3300013306 | Bacteria | 952 |
| 194 | Ga0157372_10023028 | 3300013307 | Bacteria | 6749 |
| 195 | Ga0157372_10092934 | 3300013307 | Bacteria | 3432 |
| 196 | Ga0157372_10477217 | 3300013307 | Bacteria | 1454 |
| 197 | Ga0157375_10136397 | 3300013308 | Bacteria | 2578 |
| 198 | Ga0163163_10029266 | 3300014325 | Bacteria | 5298 |
| 199 | Ga0163163_10040831 | 3300014325 | Bacteria | 4533 |
| 200 | Ga0182008_10000880 | 3300014497 | Bacteria | 20870 |
| 201 | Ga0182008_10000889 | 3300014497 | Bacteria | 20766 |
| 202 | Ga0157379_10035900 | 3300014968 | Bacteria | 4420 |
| 203 | Ga0157379_10264993 | 3300014968 | Bacteria | 1562 |
| 204 | Ga0157376_10030620 | 3300014969 | Bacteria | 4299 |
| 205 | Ga0157376_10141880 | 3300014969 | Bacteria | 2156 |
| 206 | Ga0182006_1000034 | 3300015261 | Bacteria | 232484 |
| 207 | Ga0182006_1021593 | 3300015261 | Bacteria | 2683 |
| 208 | Ga0182006_1105263 | 3300015261 | Bacteria | 996 |
| 209 | Ga0182007_10000099 | 3300015262 | Bacteria | 60975 |
| 210 | Ga0182007_10003139 | 3300015262 | Bacteria | 7942 |
| 211 | Ga0182005_1000362 | 3300015265 | Bacteria | 25350 |
| 212 | Ga0182005_1000495 | 3300015265 | Bacteria | 20104 |
| 213 | Ga0182005_1000900 | 3300015265 | Bacteria | 13006 |
| 214 | Ga0182005_1005127 | 3300015265 | Bacteria | 4126 |
| 215 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 216 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 217 | Ga0163161_10014174 | 3300017792 | Bacteria | 5552 |
| 218 | Ga0163161_10096973 | 3300017792 | Bacteria | 2190 |
| 219 | Ga0163161_10115260 | 3300017792 | Bacteria | 2014 |
| 220 | Ga0163161_10121279 | 3300017792 | Bacteria | 1965 |
| 221 | Ga0197907_11509201 | 3300020069 | Bacteria | 2363 |
| 222 | Ga0206356_10569860 | 3300020070 | Bacteria | 3765 |
| 223 | Ga0206355_1088656 | 3300020076 | Bacteria | 1123 |
| 224 | Ga0206351_10886011 | 3300020077 | Bacteria | 1669 |
| 225 | Ga0206352_10703733 | 3300020078 | Bacteria | 1437 |
| 226 | Ga0206353_10004922 | 3300020082 | Bacteria | 4078 |
| 227 | Ga0213872_10041194 | 3300021361 | Bacteria | 2107 |
| 228 | Ga0209784_100073 | 3300025224 | Bacteria | 146019 |
| 229 | Ga0209566_101719 | 3300025225 | Bacteria | 5324 |
| 230 | Ga0209674_100043 | 3300025226 | Bacteria | 369728 |
| 231 | Ga0209674_100878 | 3300025226 | Bacteria | 9798 |
| 232 | Ga0209672_101032 | 3300025228 | Bacteria | 12045 |
| 233 | Ga0207427_100013 | 3300025231 | Bacteria | 581419 |
| 234 | Ga0207427_102570 | 3300025231 | Bacteria | 4702 |
| 235 | Ga0209437_100015 | 3300025233 | Bacteria | 713457 |
| 236 | Ga0209437_100126 | 3300025233 | Bacteria | 192521 |
| 237 | Ga0209437_101272 | 3300025233 | Bacteria | 6840 |
| 238 | Ga0209437_102587 | 3300025233 | Bacteria | 3475 |
| 239 | Ga0209258_100049 | 3300025242 | Bacteria | 358328 |
| 240 | Ga0209258_100551 | 3300025242 | Bacteria | 33759 |
| 241 | Ga0209258_104081 | 3300025242 | Bacteria | 2883 |
| 242 | Ga0207425_1000028 | 3300025245 | Bacteria | 286333 |
| 243 | Ga0207425_1028457 | 3300025245 | Bacteria | 1132 |
| 244 | Ga0209646_1000393 | 3300025246 | Bacteria | 26898 |
| 245 | Ga0209646_1006511 | 3300025246 | Bacteria | 1958 |
| 246 | Ga0209026_1000094 | 3300025250 | Bacteria | 169671 |
| 247 | Ga0209026_1000866 | 3300025250 | Bacteria | 15820 |
| 248 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 249 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 250 | Ga0209148_1005036 | 3300025254 | Bacteria | 3101 |
| 251 | Ga0209759_1000761 | 3300025256 | Bacteria | 27563 |
| 252 | Ga0209759_1003734 | 3300025256 | Bacteria | 5954 |
| 253 | Ga0209129_1000065 | 3300025258 | Bacteria | 232568 |
| 254 | Ga0209129_1010470 | 3300025258 | Bacteria | 2308 |
| 255 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 256 | Ga0209233_1001164 | 3300025261 | Bacteria | 10648 |
| 257 | Ga0209233_1017570 | 3300025261 | Bacteria | 1946 |
| 258 | Ga0209565_1000005 | 3300025263 | Bacteria | 947317 |
| 259 | Ga0209565_1000031 | 3300025263 | Bacteria | 320341 |
| 260 | Ga0209455_1000082 | 3300025272 | Bacteria | 257909 |
| 261 | Ga0209455_1000327 | 3300025272 | Bacteria | 46194 |
| 262 | Ga0209455_1016064 | 3300025272 | Bacteria | 1621 |
| 263 | Ga0209673_1000011 | 3300025273 | Bacteria | 586604 |
| 264 | Ga0209673_1000484 | 3300025273 | Bacteria | 66361 |
| 265 | Ga0209673_1018095 | 3300025273 | Bacteria | 2575 |
| 266 | Ga0209130_1006679 | 3300025284 | Bacteria | 3700 |
| 267 | Ga0209130_1021705 | 3300025284 | Bacteria | 1444 |
| 268 | Ga0209675_1000004 | 3300025291 | Bacteria | 947166 |
| 269 | Ga0209675_1000015 | 3300025291 | Bacteria | 403517 |
| 270 | Ga0209675_1006730 | 3300025291 | Bacteria | 4548 |
| 271 | Ga0209676_1000034 | 3300025292 | Bacteria | 460125 |
| 272 | Ga0209676_1000225 | 3300025292 | Bacteria | 124018 |
| 273 | Ga0209676_1000892 | 3300025292 | Bacteria | 38056 |
| 274 | Ga0209676_1001193 | 3300025292 | Bacteria | 27924 |
| 275 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 276 | Ga0209025_1000036 | 3300025294 | Bacteria | 404113 |
| 277 | Ga0209025_1008389 | 3300025294 | Bacteria | 7447 |
| 278 | Ga0209025_1025631 | 3300025294 | Bacteria | 2993 |
| 279 | Ga0209564_1000018 | 3300025295 | Bacteria | 586913 |
| 280 | Ga0209564_1000480 | 3300025295 | Bacteria | 66421 |
| 281 | Ga0209564_1004657 | 3300025295 | Bacteria | 8241 |
| 282 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 283 | Ga0209758_1024688 | 3300025297 | Bacteria | 2670 |
| 284 | Ga0209050_1000201 | 3300025298 | Bacteria | 134028 |
| 285 | Ga0209050_1000998 | 3300025298 | Bacteria | 35642 |
| 286 | Ga0209050_1005741 | 3300025298 | Bacteria | 7657 |
| 287 | Ga0209256_1000021 | 3300025299 | Bacteria | 537097 |
| 288 | Ga0209256_1005457 | 3300025299 | Bacteria | 7315 |
| 289 | Ga0209256_1010568 | 3300025299 | Bacteria | 3841 |
| 290 | Ga0207426_1009262 | 3300025302 | Bacteria | 3912 |
| 291 | Ga0209051_1001219 | 3300025303 | Bacteria | 23138 |
| 292 | Ga0209051_1003605 | 3300025303 | Bacteria | 10058 |
| 293 | Ga0209051_1007665 | 3300025303 | Bacteria | 5865 |
| 294 | Ga0209257_1000133 | 3300025304 | Bacteria | 208808 |
| 295 | Ga0209257_1000208 | 3300025304 | Bacteria | 141393 |
| 296 | Ga0209257_1000308 | 3300025304 | Bacteria | 105012 |
| 297 | Ga0209257_1000585 | 3300025304 | Bacteria | 61004 |
| 298 | Ga0209257_1002220 | 3300025304 | Bacteria | 19971 |
| 299 | Ga0209257_1004172 | 3300025304 | Bacteria | 11472 |
| 300 | Ga0207656_10002466 | 3300025321 | Bacteria | 6241 |
| 301 | Ga0207656_10040174 | 3300025321 | Bacteria | 1982 |
| 302 | Ga0207696_1000424 | 3300025711 | Bacteria | 38612 |
| 303 | Ga0207655_1093954 | 3300025728 | Bacteria | 1049 |
| 304 | Ga0207713_1000282 | 3300025735 | Bacteria | 59331 |
| 305 | Ga0207713_1005483 | 3300025735 | Bacteria | 7921 |
| 306 | Ga0207710_10009441 | 3300025900 | Bacteria | 4104 |
| 307 | Ga0207680_10000002 | 3300025903 | Bacteria | 1018646 |
| 308 | Ga0207680_10007823 | 3300025903 | Bacteria | 5225 |
| 309 | Ga0207647_10000124 | 3300025904 | Bacteria | 60056 |
| 310 | Ga0207647_10006001 | 3300025904 | Bacteria | 8850 |
| 311 | Ga0207647_10008548 | 3300025904 | Bacteria | 7330 |
| 312 | Ga0207647_10020227 | 3300025904 | Bacteria | 4465 |
| 313 | Ga0207645_10055926 | 3300025907 | Bacteria | 2519 |
| 314 | Ga0207654_10299644 | 3300025911 | Bacteria | 1093 |
| 315 | Ga0207707_10000052 | 3300025912 | Bacteria | 117200 |
| 316 | Ga0207707_10002396 | 3300025912 | Bacteria | 16876 |
| 317 | Ga0207707_10019691 | 3300025912 | Bacteria | 5891 |
| 318 | Ga0207707_10082068 | 3300025912 | Bacteria | 2814 |
| 319 | Ga0207707_10229832 | 3300025912 | Bacteria | 1614 |
| 320 | Ga0207707_10297703 | 3300025912 | Bacteria | 1395 |
| 321 | Ga0207695_10000032 | 3300025913 | Bacteria | 521283 |
| 322 | Ga0207695_10003509 | 3300025913 | Bacteria | 21983 |
| 323 | Ga0207695_10005651 | 3300025913 | Bacteria | 16501 |
| 324 | Ga0207695_10017386 | 3300025913 | Bacteria | 8367 |
| 325 | Ga0207695_10042408 | 3300025913 | Bacteria | 4860 |
| 326 | Ga0207695_10044959 | 3300025913 | Bacteria | 4692 |
| 327 | Ga0207695_10062813 | 3300025913 | Bacteria | 3832 |
| 328 | Ga0207695_10064043 | 3300025913 | Bacteria | 3788 |
| 329 | Ga0207695_10215903 | 3300025913 | Bacteria | 1827 |
| 330 | Ga0207671_10000021 | 3300025914 | Bacteria | 300409 |
| 331 | Ga0207671_10000074 | 3300025914 | Bacteria | 156482 |
| 332 | Ga0207671_10099946 | 3300025914 | Bacteria | 2196 |
| 333 | Ga0207671_10103706 | 3300025914 | Bacteria | 2157 |
| 334 | Ga0207671_10215037 | 3300025914 | Bacteria | 1505 |
| 335 | Ga0207660_10005646 | 3300025917 | Bacteria | 8118 |
| 336 | Ga0207660_10067465 | 3300025917 | Bacteria | 2591 |
| 337 | Ga0207660_10172177 | 3300025917 | Bacteria | 1676 |
| 338 | Ga0207660_10227604 | 3300025917 | Bacteria | 1465 |
| 339 | Ga0207657_10020970 | 3300025919 | Bacteria | 6163 |
| 340 | Ga0207649_10033212 | 3300025920 | Bacteria | 3081 |
| 341 | Ga0207649_10074121 | 3300025920 | Bacteria | 2183 |
| 342 | Ga0207652_10002038 | 3300025921 | Bacteria | 17384 |
| 343 | Ga0207652_10126616 | 3300025921 | Bacteria | 2276 |
| 344 | Ga0207652_10196091 | 3300025921 | Bacteria | 1817 |
| 345 | Ga0207652_10210441 | 3300025921 | Bacteria | 1751 |
| 346 | Ga0207652_10254728 | 3300025921 | Bacteria | 1583 |
| 347 | Ga0207681_10072389 | 3300025923 | Bacteria | 2407 |
| 348 | Ga0207681_10114324 | 3300025923 | Bacteria | 1969 |
| 349 | Ga0207694_10002009 | 3300025924 | Bacteria | 16833 |
| 350 | Ga0207694_10036893 | 3300025924 | Bacteria | 3751 |
| 351 | Ga0207694_10068552 | 3300025924 | Bacteria | 2770 |
| 352 | Ga0207694_10069526 | 3300025924 | Bacteria | 2751 |
| 353 | Ga0207694_10156600 | 3300025924 | Bacteria | 1838 |
| 354 | Ga0207694_10262912 | 3300025924 | Bacteria | 1414 |
| 355 | Ga0207694_10300622 | 3300025924 | Bacteria | 1321 |
| 356 | Ga0207650_10005386 | 3300025925 | Bacteria | 8727 |
| 357 | Ga0207650_10019958 | 3300025925 | Bacteria | 4719 |
| 358 | Ga0207659_10083890 | 3300025926 | Bacteria | 2363 |
| 359 | Ga0207659_10298780 | 3300025926 | Bacteria | 1322 |
| 360 | Ga0207687_10235868 | 3300025927 | Bacteria | 1447 |
| 361 | Ga0207644_10065136 | 3300025931 | Bacteria | 2649 |
| 362 | Ga0207690_10304855 | 3300025932 | Bacteria | 1247 |
| 363 | Ga0207706_10034947 | 3300025933 | Bacteria | 4471 |
| 364 | Ga0207709_10000070 | 3300025935 | Bacteria | 183020 |
| 365 | Ga0207709_10001467 | 3300025935 | Bacteria | 16381 |
| 366 | Ga0207709_10002281 | 3300025935 | Bacteria | 12175 |
| 367 | Ga0207670_10001715 | 3300025936 | Bacteria | 11438 |
| 368 | Ga0207704_10008276 | 3300025938 | Bacteria | 4960 |
| 369 | Ga0207691_10000184 | 3300025940 | Bacteria | 59044 |
| 370 | Ga0207691_10070446 | 3300025940 | Bacteria | 3157 |
| 371 | Ga0207711_10069448 | 3300025941 | Bacteria | 3054 |
| 372 | Ga0207689_10087947 | 3300025942 | Bacteria | 2552 |
| 373 | Ga0207667_10000141 | 3300025949 | Bacteria | 109666 |
| 374 | Ga0207667_10001686 | 3300025949 | Bacteria | 27833 |
| 375 | Ga0207667_10017203 | 3300025949 | Bacteria | 8148 |
| 376 | Ga0207667_10092175 | 3300025949 | Bacteria | 3130 |
| 377 | Ga0207667_10252878 | 3300025949 | Bacteria | 1803 |
| 378 | Ga0207651_10029033 | 3300025960 | Bacteria | 3499 |
| 379 | Ga0207712_10021091 | 3300025961 | Bacteria | 4274 |
| 380 | Ga0207668_10018364 | 3300025972 | Bacteria | 4399 |
| 381 | Ga0207668_10019560 | 3300025972 | Bacteria | 4284 |
| 382 | Ga0207668_10211352 | 3300025972 | Bacteria | 1552 |
| 383 | Ga0207640_10012031 | 3300025981 | Bacteria | 4918 |
| 384 | Ga0207640_10078236 | 3300025981 | Bacteria | 2250 |
| 385 | Ga0207658_10021705 | 3300025986 | Bacteria | 4461 |
| 386 | Ga0207658_10416735 | 3300025986 | Bacteria | 1183 |
| 387 | Ga0207658_10650709 | 3300025986 | Bacteria | 950 |
| 388 | Ga0207677_10191670 | 3300026023 | Bacteria | 1617 |
| 389 | Ga0207703_10001626 | 3300026035 | Bacteria | 20244 |
| 390 | Ga0207703_10019515 | 3300026035 | Bacteria | 5297 |
| 391 | Ga0207639_10000465 | 3300026041 | Bacteria | 27917 |
| 392 | Ga0207678_10001930 | 3300026067 | Bacteria | 18917 |
| 393 | Ga0207678_10078089 | 3300026067 | Bacteria | 2835 |
| 394 | Ga0207678_10122151 | 3300026067 | Bacteria | 2222 |
| 395 | Ga0207702_10051044 | 3300026078 | Bacteria | 3493 |
| 396 | Ga0207702_10171911 | 3300026078 | Bacteria | 1987 |
| 397 | Ga0207648_10028187 | 3300026089 | Bacteria | 4980 |
| 398 | Ga0207676_10270576 | 3300026095 | Bacteria | 1538 |
| 399 | Ga0207674_10000168 | 3300026116 | Bacteria | 78785 |
| 400 | Ga0207674_10442052 | 3300026116 | Bacteria | 1257 |
| 401 | Ga0207698_10002152 | 3300026142 | Bacteria | 11636 |
| 402 | Ga0207698_10125802 | 3300026142 | Bacteria | 2179 |
| 403 | Ga0207698_10127115 | 3300026142 | Bacteria | 2170 |
| 404 | Ga0209281_1000029 | 3300027111 | Bacteria | 431495 |
| 405 | Ga0209973_1009782 | 3300027252 | Bacteria | 1122 |
| 406 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 407 | Ga0209371_1000044 | 3300027312 | Bacteria | 327086 |
| 408 | Ga0209969_1004401 | 3300027360 | Bacteria | 1969 |
| 409 | Ga0209967_1009511 | 3300027364 | Bacteria | 1348 |
| 410 | Ga0209981_1007700 | 3300027378 | Bacteria | 1456 |
| 411 | Ga0209984_1004997 | 3300027424 | Bacteria | 1580 |
| 412 | Ga0209995_1005784 | 3300027471 | Bacteria | 1988 |
| 413 | Ga0209999_1000972 | 3300027543 | Bacteria | 4840 |
| 414 | Ga0209982_1000533 | 3300027552 | Bacteria | 4742 |
| 415 | Ga0209970_1000890 | 3300027614 | Bacteria | 5258 |
| 416 | Ga0209983_1000051 | 3300027665 | Bacteria | 17495 |
| 417 | Ga0209971_1001064 | 3300027682 | Bacteria | 6984 |
| 418 | Ga0209974_10028918 | 3300027876 | Bacteria | 1836 |
| 419 | Ga0268266_10000013 | 3300028379 | Bacteria | 649715 |
| 420 | Ga0268266_10000851 | 3300028379 | Bacteria | 39762 |
| 421 | Ga0268266_10162328 | 3300028379 | Bacteria | 2022 |
| 422 | Ga0268265_10174602 | 3300028380 | Bacteria | 1840 |
| 423 | Ga0268265_10243704 | 3300028380 | Bacteria | 1588 |
| 424 | Ga0268264_10092928 | 3300028381 | Bacteria | 2605 |
| 425 | Ga0268264_10430803 | 3300028381 | Bacteria | 1274 |
| 426 | Ga0307515_10047768 | 3300028794 | Bacteria | 6495 |
| 427 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 428 | Ga0268256_1000046 | 3300030500 | Bacteria | 327003 |
| 429 | Ga0314311_1201706 | 3300030733 | Bacteria | 1421 |
| 430 | Ga0316178_1134858 | 3300030735 | Bacteria | 1646 |
| 431 | Ga0307513_10066968 | 3300031456 | Bacteria | 3771 |
| 432 | Ga0307513_10100996 | 3300031456 | Bacteria | 2908 |
| 433 | Ga0307408_100170665 | 3300031548 | Bacteria | 1736 |
| 434 | Ga0316575_10128476 | 3300031665 | Bacteria | 1039 |
| 435 | Ga0316579_10003171 | 3300031691 | Bacteria | 6362 |
| 436 | Ga0316579_10013810 | 3300031691 | Bacteria | 3480 |
| 437 | Ga0316579_10022481 | 3300031691 | Bacteria | 2819 |
| 438 | Ga0316576_10008419 | 3300031727 | Bacteria | 6576 |
| 439 | Ga0316576_10011926 | 3300031727 | Bacteria | 5719 |
| 440 | Ga0316576_10014892 | 3300031727 | Bacteria | 5202 |
| 441 | Ga0316576_10020551 | 3300031727 | Bacteria | 4548 |
| 442 | Ga0316576_10382668 | 3300031727 | Bacteria | 1044 |
| 443 | Ga0316578_10008010 | 3300031728 | Bacteria | 5342 |
| 444 | Ga0316578_10017934 | 3300031728 | Bacteria | 3866 |
| 445 | Ga0316578_10119133 | 3300031728 | Bacteria | 1586 |
| 446 | Ga0316578_10130445 | 3300031728 | Bacteria | 1512 |
| 447 | Ga0316577_10003874 | 3300031733 | Bacteria | 7625 |
| 448 | Ga0307413_10020958 | 3300031824 | Bacteria | 3488 |
| 449 | Ga0307413_10089992 | 3300031824 | Bacteria | 1995 |
| 450 | Ga0307413_10202751 | 3300031824 | Bacteria | 1434 |
| 451 | Ga0307406_10036900 | 3300031901 | Bacteria | 3014 |
| 452 | Ga0307406_10350039 | 3300031901 | Bacteria | 1154 |
| 453 | Ga0307407_10112034 | 3300031903 | Bacteria | 1714 |
| 454 | Ga0307412_10000409 | 3300031911 | Bacteria | 26195 |
| 455 | Ga0307412_10069421 | 3300031911 | Bacteria | 2399 |
| 456 | Ga0307409_100152856 | 3300031995 | Bacteria | 2006 |
| 457 | Ga0307416_100593481 | 3300032002 | Bacteria | 1186 |
| 458 | Ga0307414_10000329 | 3300032004 | Bacteria | 27035 |
| 459 | Ga0307414_10018957 | 3300032004 | Bacteria | 4252 |
| 460 | Ga0307414_10041115 | 3300032004 | Bacteria | 3128 |
| 461 | Ga0307414_10041175 | 3300032004 | Bacteria | 3126 |
| 462 | Ga0307414_10117456 | 3300032004 | Bacteria | 2038 |
| 463 | Ga0307414_10123146 | 3300032004 | Bacteria | 1997 |
| 464 | Ga0307414_10182905 | 3300032004 | Bacteria | 1687 |
| 465 | Ga0307414_10301714 | 3300032004 | Bacteria | 1355 |
| 466 | Ga0307411_10170988 | 3300032005 | Bacteria | 1638 |
| 467 | Ga0316583_10001437 | 3300032133 | Bacteria | 7944 |
| 468 | Ga0316583_10022469 | 3300032133 | Bacteria | 2257 |
| 469 | Ga0316585_10000275 | 3300032137 | Bacteria | 11263 |
| 470 | Ga0316585_10012208 | 3300032137 | Bacteria | 2541 |
| 471 | Ga0316580_10001002 | 3300032139 | Bacteria | 7048 |
| 472 | Ga0316580_10023955 | 3300032139 | Bacteria | 1886 |
| 473 | Ga0316593_10000128 | 3300032168 | Bacteria | 10385 |
| 474 | Ga0316593_10004553 | 3300032168 | Bacteria | 3570 |
| 475 | Ga0316593_10005144 | 3300032168 | Bacteria | 3424 |
| 476 | Ga0316593_10030965 | 3300032168 | Bacteria | 1740 |
| 477 | Ga0316593_10062911 | 3300032168 | Bacteria | 1271 |
| 478 | Ga0316592_1002694 | 3300033524 | Bacteria | 3101 |
| 479 | Ga0316592_1003547 | 3300033524 | Bacteria | 2824 |
| 480 | Ga0316592_1011886 | 3300033524 | Bacteria | 1777 |
| 481 | Ga0316592_1012680 | 3300033524 | Bacteria | 1731 |
| 482 | Ga0316586_1010879 | 3300033527 | Bacteria | 1386 |
| 483 | Ga0316588_1000497 | 3300033528 | Bacteria | 5381 |
| 484 | Ga0316588_1001124 | 3300033528 | Bacteria | 4252 |
| 485 | Ga0316587_1000129 | 3300033529 | Bacteria | 5821 |
| 486 | Ga0316587_1005380 | 3300033529 | Bacteria | 1917 |
| 487 | Ga0316596_1004992 | 3300033541 | Bacteria | 3008 |
| 488 | Ga0316596_1005003 | 3300033541 | Bacteria | 3006 |
| 489 | Ga0316596_1006902 | 3300033541 | Bacteria | 2660 |
| 490 | Ga0316596_1007371 | 3300033541 | Bacteria | 2599 |
| 491 | Ga0316596_1018008 | 3300033541 | Bacteria | 1782 |
| 492 | Ga0316574_0006324 | 3300035398 | Bacteria | 6391 |
| 493 | Ga0316574_0011135 | 3300035398 | Bacteria | 5103 |
| 494 | Ga0316574_0154014 | 3300035398 | Bacteria | 1481 |
| 495 | Ga0373931_0295856 | 3300035691 | Bacteria | 998 |
| 496 | Ga0316582_0004634 | 3300036647 | Bacteria | 6980 |
| 497 | Ga0316582_0171387 | 3300036647 | Bacteria | 1473 |
| 498 | Ga0316584_0010088 | 3300036712 | Bacteria | 6585 |
| 499 | Ga0316584_0061697 | 3300036712 | Bacteria | 2807 |
| 500 | Ga0316584_0078523 | 3300036712 | Bacteria | 2472 |
| 501 | Ga0316584_0104108 | 3300036712 | Bacteria | 2124 |
| 502 | Ga0395899_0092009 | 3300037312 | Bacteria | 2196 |
| 503 | Ga0395899_0116524 | 3300037312 | Bacteria | 1917 |
| 504 | Ga0395900_0000092 | 3300037418 | Bacteria | 166966 |
| 505 | Ga0395900_0002408 | 3300037418 | Bacteria | 20638 |
| 506 | Ga0395900_0020686 | 3300037418 | Bacteria | 6724 |
| 507 | Ga0395900_0164418 | 3300037418 | Bacteria | 2262 |
| 508 | Ga0395898_0004660 | 3300037466 | Bacteria | 14947 |
| 509 | Ga0395898_0018342 | 3300037466 | Bacteria | 7136 |
| 510 | Ga0395898_0112378 | 3300037466 | Bacteria | 2611 |
| 511 | Ga0395898_0177780 | 3300037466 | Bacteria | 2034 |
| 512 | Ga0395905_0006744 | 3300037471 | Bacteria | 11500 |
| 513 | Ga0395905_0036234 | 3300037471 | Bacteria | 4633 |
| 514 | Ga0316581_0016438 | 3300037588 | Bacteria | 2124 |
| 515 | Ga0395901_0061309 | 3300038443 | Bacteria | 3913 |
| 516 | Ga0395901_0298803 | 3300038443 | Bacteria | 1669 |
| 517 | Ga0395901_0338873 | 3300038443 | Bacteria | 1554 |
| 518 | Ga0237819_00665 | 3300038705 | Bacteria | 11180 |
| 519 | Ga0400483_243809 | 3300039062 | Bacteria | 4359 |
| 520 | Ga0237816_00195 | 3300039145 | Bacteria | 4897 |
| 521 | Ga0436360_0102938 | 3300039438 | Bacteria | 926 |
| 522 | Ga0436361_1057408 | 3300039447 | Bacteria | 13864 |
| 523 | Ga0436361_1092360 | 3300039447 | Bacteria | 6889 |
| 524 | Ga0439436_0000157 | 3300041404 | Bacteria | 15861 |
| 525 | Ga0439447_000418 | 3300041407 | Bacteria | 15789 |
| 526 | Ga0439465_0000266 | 3300041413 | Bacteria | 14541 |
| 527 | Ga0439465_0003036 | 3300041413 | Bacteria | 5490 |
| 528 | Ga0451791_0175559 | 3300041451 | Bacteria | 2761 |
| 529 | Ga0451791_0536344 | 3300041451 | Bacteria | 4138 |
| 530 | Ga0451797_0545361 | 3300041453 | Bacteria | 1741 |
| 531 | Ga0451797_0951842 | 3300041453 | Bacteria | 1405 |
| 532 | Ga0451806_039266 | 3300041462 | Bacteria | 2363 |
| 533 | Ga0451804_0087857 | 3300041463 | Bacteria | 2251 |
| 534 | Ga0451804_0210285 | 3300041463 | Bacteria | 1001 |
| 535 | Ga0451807_0979098 | 3300041486 | Bacteria | 8310 |
| 536 | Ga0451841_0905478 | 3300041498 | Bacteria | 872 |
| 537 | Ga0451843_0039220 | 3300041509 | Bacteria | 2218 |
| 538 | Ga0451853_3664325 | 3300041512 | Bacteria | 1294 |
| 539 | Ga0439432_058689 | 3300042006 | Bacteria | 1189 |
| 540 | Ga0439449_0000143 | 3300042007 | Bacteria | 24455 |
| 541 | Ga0439449_0003099 | 3300042007 | Bacteria | 6478 |
| 542 | Ga0439449_0018158 | 3300042007 | Bacteria | 2639 |
| 543 | Ga0450905_000523 | 3300042142 | Bacteria | 4707 |
| 544 | Ga0450908_000031 | 3300042184 | Bacteria | 31856 |
| 545 | Ga0439434_0016505 | 3300042435 | Bacteria | 2207 |
| 546 | Ga0451577_0001339 | 3300042876 | Bacteria | 33424 |
| 547 | Ga0451577_0005403 | 3300042876 | Bacteria | 13110 |
| 548 | Ga0466969_0000600 | 3300044656 | Bacteria | 19514 |
| 549 | Ga0466982_0000004 | 3300044672 | Bacteria | 386724 |
| 550 | Ga0466982_0000036 | 3300044672 | Bacteria | 43109 |
| 551 | Ga0466965_0038379 | 3300044683 | Bacteria | 2352 |
| 552 | Ga0466966_0003574 | 3300044684 | Bacteria | 10260 |
| 553 | Ga0466966_0005847 | 3300044684 | Bacteria | 8109 |
| 554 | Ga0466966_0043432 | 3300044684 | Bacteria | 2881 |
| 555 | Ga0466961_0033609 | 3300044693 | Bacteria | 3294 |
| 556 | Ga0466961_0085395 | 3300044693 | Bacteria | 1996 |
| 557 | Ga0453684_0000298 | 3300044712 | Bacteria | 209777 |
| 558 | Ga0466971_0019109 | 3300044719 | Bacteria | 3041 |
| 559 | Ga0466968_0004202 | 3300044735 | Bacteria | 5368 |
| 560 | Ga0466968_0018973 | 3300044735 | Bacteria | 2763 |
| 561 | Ga0466968_0054690 | 3300044735 | Bacteria | 1711 |
| 562 | Ga0466970_0008080 | 3300044765 | Bacteria | 5282 |
| 563 | Ga0466957_0087490 | 3300044842 | Bacteria | 1948 |
| 564 | Ga0466960_0007681 | 3300044901 | Bacteria | 4391 |
| 565 | Ga0466959_0010364 | 3300045049 | Bacteria | 6659 |
| 566 | Ga0451576_0000033 | 3300045051 | Bacteria | 393131 |
| 567 | Ga0495617_000083 | 3300046452 | Bacteria | 69141 |
| 568 | Ga0495617_001456 | 3300046452 | Bacteria | 10381 |
| 569 | Ga0495590_0074818 | 3300046457 | Bacteria | 1191 |
| 570 | Ga0495638_0000007 | 3300046460 | Bacteria | 602783 |
| 571 | Ga0495638_0000340 | 3300046460 | Bacteria | 58967 |
| 572 | Ga0495638_0002252 | 3300046460 | Bacteria | 15992 |
| 573 | Ga0495638_0030059 | 3300046460 | Bacteria | 3500 |
| 574 | Ga0495638_0248113 | 3300046460 | Bacteria | 982 |
| 575 | Ga0495650_0000078 | 3300046471 | Bacteria | 245487 |
| 576 | Ga0495585_0000887 | 3300046492 | Bacteria | 25337 |
| 577 | Ga0495607_0000247 | 3300046501 | Bacteria | 57993 |
| 578 | Ga0495607_0006220 | 3300046501 | Bacteria | 8421 |
| 579 | Ga0495607_0028180 | 3300046501 | Bacteria | 3467 |
| 580 | Ga0495606_0000242 | 3300046507 | Bacteria | 96491 |
| 581 | Ga0495606_0002571 | 3300046507 | Bacteria | 20791 |
| 582 | Ga0495606_0015919 | 3300046507 | Bacteria | 5767 |
| 583 | Ga0495606_0032337 | 3300046507 | Bacteria | 3625 |
| 584 | Ga0495610_0002284 | 3300046512 | Bacteria | 16194 |
| 585 | Ga0495610_0011396 | 3300046512 | Bacteria | 5439 |
| 586 | Ga0495616_0029914 | 3300046513 | Bacteria | 2868 |
| 587 | Ga0495620_0000791 | 3300046515 | Bacteria | 19421 |
| 588 | Ga0495620_0006935 | 3300046515 | Bacteria | 6189 |
| 589 | Ga0495631_0000153 | 3300046518 | Bacteria | 47259 |
| 590 | Ga0495631_0000603 | 3300046518 | Bacteria | 23596 |
| 591 | Ga0495632_0000008 | 3300046519 | Bacteria | 294056 |
| 592 | Ga0495637_0011054 | 3300046520 | Bacteria | 4348 |
| 593 | Ga0495648_0006713 | 3300046524 | Bacteria | 9312 |
| 594 | Ga0495663_0000749 | 3300046525 | Bacteria | 11143 |
| 595 | Ga0495663_0012113 | 3300046525 | Bacteria | 2404 |
| 596 | Ga0495598_0001238 | 3300046537 | Bacteria | 4962 |
| 597 | Ga0495598_0039833 | 3300046537 | Bacteria | 1368 |
| 598 | Ga0495609_0004838 | 3300046538 | Bacteria | 7262 |
| 599 | Ga0495621_0000225 | 3300046539 | Bacteria | 13202 |
| 600 | Ga0495622_0006516 | 3300046557 | Bacteria | 5415 |
| 601 | Ga0495633_0051344 | 3300046558 | Bacteria | 1943 |
| 602 | Ga0495656_0002380 | 3300046615 | Bacteria | 6232 |
| 603 | Ga0495668_0003638 | 3300046616 | Bacteria | 11412 |
| 604 | Ga0495668_0018796 | 3300046616 | Bacteria | 3993 |
| 605 | Ga0495611_0000029 | 3300046648 | Bacteria | 115887 |
| 606 | Ga0495611_0000076 | 3300046648 | Bacteria | 69480 |
| 607 | Ga0495625_0000260 | 3300046660 | Bacteria | 82175 |
| 608 | Ga0495625_0343311 | 3300046660 | Bacteria | 945 |
| 609 | Ga0495661_0003624 | 3300046665 | Bacteria | 11375 |
| 610 | Ga0495670_0000523 | 3300046691 | Bacteria | 18177 |
| 611 | Ga0495670_0006569 | 3300046691 | Bacteria | 5717 |
| 612 | Ga0495670_0048214 | 3300046691 | Bacteria | 2131 |
| 613 | Ga0495671_0000545 | 3300046692 | Bacteria | 28273 |
| 614 | Ga0495649_0005342 | 3300046694 | Bacteria | 8196 |
| 615 | Ga0495589_0000173 | 3300046794 | Bacteria | 58030 |
| 616 | Ga0495660_0000235 | 3300046810 | Bacteria | 54297 |
| 617 | Ga0495660_0000918 | 3300046810 | Bacteria | 21697 |
| 618 | Ga0495636_0004741 | 3300047318 | Bacteria | 5334 |
| 619 | Ga0495636_0025936 | 3300047318 | Bacteria | 2382 |
| 620 | Ga0495672_0000230 | 3300047320 | Bacteria | 79829 |
| 621 | Ga0495687_047033 | 3300047443 | Bacteria | 1859 |
| 622 | Ga0495679_000091 | 3300047446 | Bacteria | 82366 |
| 623 | Ga0495673_0000175 | 3300047469 | Bacteria | 105273 |
| 624 | Ga0495673_0000392 | 3300047469 | Bacteria | 51434 |
| 625 | Ga0495673_0000548 | 3300047469 | Bacteria | 38312 |
| 626 | Ga0495686_0001098 | 3300047472 | Bacteria | 32179 |
| 627 | Ga0495686_0101511 | 3300047472 | Bacteria | 1734 |
| 628 | Ga0496100_0003750 | 3300048903 | Bacteria | 7957 |
| 629 | Ga0496100_0335523 | 3300048903 | Bacteria | 1139 |
| 630 | Ga0496101_0001114 | 3300048904 | Bacteria | 15992 |
| 631 | Ga0496102_0079547 | 3300048905 | Bacteria | 3019 |
| 632 | Ga0496102_0172043 | 3300048905 | Bacteria | 2039 |
| 633 | Ga0496103_0086893 | 3300048906 | Bacteria | 1971 |
| 634 | Ga0496108_0028586 | 3300048911 | Bacteria | 4613 |
| 635 | Ga0496111_0032428 | 3300048914 | Bacteria | 3724 |
| 636 | Ga0496113_0005362 | 3300048916 | Bacteria | 7993 |
| 637 | Ga0496114_0003374 | 3300048917 | Bacteria | 12258 |
| 638 | Ga0496114_0083210 | 3300048917 | Bacteria | 2707 |
| 639 | Ga0496115_0000158 | 3300048918 | Bacteria | 63464 |
| 640 | Ga0496116_0000107 | 3300048919 | Bacteria | 188067 |
| 641 | Ga0496116_0020070 | 3300048919 | Bacteria | 5089 |
| 642 | Ga0496116_0091412 | 3300048919 | Bacteria | 1849 |
| 643 | Ga0496117_0001949 | 3300048920 | Bacteria | 27525 |
| 644 | Ga0496117_0038210 | 3300048920 | Bacteria | 3564 |
| 645 | Ga0496118_0001826 | 3300048921 | Bacteria | 30584 |
| 646 | Ga0496118_0002205 | 3300048921 | Bacteria | 27034 |
| 647 | Ga0496118_0002535 | 3300048921 | Bacteria | 24467 |
| 648 | Ga0496118_0012510 | 3300048921 | Bacteria | 8136 |
| 649 | Ga0496119_0000979 | 3300048922 | Bacteria | 36683 |
| 650 | Ga0496121_0000260 | 3300048924 | Bacteria | 110424 |
| 651 | Ga0496121_0000290 | 3300048924 | Bacteria | 104280 |
| 652 | Ga0496121_0003326 | 3300048924 | Bacteria | 23084 |
| 653 | Ga0496121_0005560 | 3300048924 | Bacteria | 16099 |
| 654 | Ga0496121_0022928 | 3300048924 | Bacteria | 6033 |
| 655 | Ga0496121_0053328 | 3300048924 | Bacteria | 3389 |
| 656 | Ga0496121_0055485 | 3300048924 | Bacteria | 3300 |
| 657 | Ga0496121_0125081 | 3300048924 | Bacteria | 1934 |
| 658 | Ga0496121_0279446 | 3300048924 | Bacteria | 1143 |
| 659 | Ga0496122_0015375 | 3300048925 | Bacteria | 7321 |
| 660 | Ga0496122_0036592 | 3300048925 | Bacteria | 3965 |
| 661 | Ga0496123_0009952 | 3300048926 | Bacteria | 8478 |
| 662 | Ga0496123_0024992 | 3300048926 | Bacteria | 4518 |
| 663 | Ga0496123_0034574 | 3300048926 | Bacteria | 3617 |
| 664 | Ga0496123_0042350 | 3300048926 | Bacteria | 3143 |
| 665 | Ga0496123_0151785 | 3300048926 | Bacteria | 1248 |
| 666 | Ga0496124_0004391 | 3300048927 | Bacteria | 16476 |
| 667 | Ga0496124_0005917 | 3300048927 | Bacteria | 13535 |
| 668 | Ga0496124_0019963 | 3300048927 | Bacteria | 6213 |
| 669 | Ga0496124_0024627 | 3300048927 | Bacteria | 5467 |
| 670 | Ga0496124_0171644 | 3300048927 | Bacteria | 1678 |
| 671 | Ga0496124_0441285 | 3300048927 | Bacteria | 890 |
| 672 | Ga0496125_0000517 | 3300048928 | Bacteria | 67165 |
| 673 | Ga0496125_0015924 | 3300048928 | Bacteria | 7241 |
| 674 | Ga0496125_0032443 | 3300048928 | Bacteria | 4639 |
| 675 | Ga0496125_0117126 | 3300048928 | Bacteria | 1911 |
| 676 | Ga0496125_0119643 | 3300048928 | Bacteria | 1882 |
| 677 | Ga0496126_0086921 | 3300048929 | Bacteria | 2755 |
| 678 | Ga0496126_0121963 | 3300048929 | Bacteria | 2259 |
| 679 | Ga0496126_0195718 | 3300048929 | Bacteria | 1709 |
| 680 | Ga0496126_0457308 | 3300048929 | Bacteria | 1026 |
| 681 | Ga0501306_005006 | 3300049127 | Bacteria | 1503 |
| 682 | Ga0501308_004437 | 3300049128 | Bacteria | 1354 |
| 683 | Ga0495682_0021799 | 3300049460 | Bacteria | 2398 |
| 684 | Ga0495682_0024202 | 3300049460 | Bacteria | 2264 |
| 685 | Ga0501290_000996 | 3300049513 | Bacteria | 4077 |
| 686 | Ga0501323_015746 | 3300049539 | Bacteria | 957 |
| 687 | Ga0501032_0110794 | 3300049569 | Bacteria | 1816 |
| 688 | Ga0501033_0001185 | 3300049570 | Bacteria | 23529 |
| 689 | Ga0501034_0000420 | 3300049571 | Bacteria | 71131 |
| 690 | Ga0501034_0009706 | 3300049571 | Bacteria | 10064 |
| 691 | Ga0501034_0219092 | 3300049571 | Bacteria | 1856 |
| 692 | Ga0501036_0031485 | 3300049572 | Bacteria | 4482 |
| 693 | Ga0501036_0161633 | 3300049572 | Bacteria | 1888 |
| 694 | Ga0501037_0128953 | 3300049573 | Bacteria | 1814 |
| 695 | Ga0501038_0140096 | 3300049574 | Bacteria | 1979 |
| 696 | Ga0501042_0229098 | 3300049578 | Bacteria | 1340 |
| 697 | Ga0501043_0007657 | 3300049579 | Bacteria | 8558 |
| 698 | Ga0501047_0007374 | 3300049581 | Bacteria | 10343 |
| 699 | Ga0501047_0030758 | 3300049581 | Bacteria | 5174 |
| 700 | Ga0501048_0432001 | 3300049582 | Bacteria | 942 |
| 701 | Ga0501076_0427275 | 3300049592 | Bacteria | 1090 |
| 702 | Ga0501216_013397 | 3300049660 | Bacteria | 1359 |
| 703 | Ga0501240_003223 | 3300049673 | Bacteria | 1801 |
| 704 | Ga0501266_010067 | 3300049763 | Bacteria | 1200 |
| 705 | Ga0501268_010600 | 3300049765 | Bacteria | 1438 |
| 706 | Ga0501035_0081952 | 3300049822 | Bacteria | 2847 |
| 707 | Ga0501044_0015211 | 3300049823 | Bacteria | 8287 |
| 708 | Ga0501044_0164906 | 3300049823 | Bacteria | 2190 |
| 709 | Ga0501044_0448216 | 3300049823 | Bacteria | 1197 |
| 710 | Ga0501044_0448876 | 3300049823 | Bacteria | 1196 |
| 711 | Ga0501045_0137649 | 3300049824 | Bacteria | 1816 |
| 712 | Ga0501045_0146315 | 3300049824 | Bacteria | 1758 |
| 713 | nmdc:mga00v17_38711_c1 | 3300050491 | Bacteria | 2853 |
| 714 | nmdc:mga0yw44_8255_c1 | 3300050492 | Bacteria | 4837 |
| 715 | nmdc:mga08y16_244865_c1 | 3300050511 | Bacteria | 1853 |
| 716 | Ga0500643_000012 | 3300053087 | Bacteria | 369839 |
| 717 | Ga0500644_0046847 | 3300053088 | Bacteria | 1464 |
| 718 | Ga0500583_0023387 | 3300053092 | Bacteria | 2603 |
| 719 | Ga0500641_0049052 | 3300053096 | Bacteria | 1731 |
| 720 | Ga0500589_040476 | 3300053147 | Bacteria | 2176 |
| 721 | Ga0500616_0000062 | 3300053153 | Bacteria | 245744 |
| 722 | Ga0500622_0001420 | 3300053156 | Bacteria | 19283 |
| 723 | Ga0500622_0009404 | 3300053156 | Bacteria | 5409 |
| 724 | Ga0500637_0192675 | 3300053178 | Bacteria | 1164 |
| 725 | Ga0500645_000820 | 3300053730 | Bacteria | 18519 |
| 726 | Ga0587082_014096 | 3300059504 | Bacteria | 1215 |
| 727 | Ga0466962_0001511 | 3300061719 | Bacteria | 10859 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048924 | Ga0496121_0279446 | Ga0496121_0279446_87_908 | 266 |
| 2 | 3300006038 | Ga0075365_10024305 | Ga0075365_100243051 | 267 |
| 3 | 3300025921 | Ga0207652_10210441 | Ga0207652_102104412 | 267 |
| 4 | 3300048919 | Ga0496116_0000107 | Ga0496116_0000107_179862_180686 | 267 |
| 5 | 3300048924 | Ga0496121_0000260 | Ga0496121_0000260_102085_102909 | 267 |
| 6 | 3300050492 | nmdc:mga0yw44_8255_c1 | nmdc:mga0yw44_8255_c1_3208_4032 | 267 |
| 7 | 3300005367 | Ga0070667_100007996 | Ga0070667_1000079966 | 268 |
| 8 | 3300013306 | Ga0163162_10000541 | Ga0163162_1000054132 | 268 |
| 9 | 3300025903 | Ga0207680_10000002 | Ga0207680_10000002682 | 268 |
| 10 | 3300025972 | Ga0207668_10018364 | Ga0207668_100183644 | 268 |
| 11 | 3300025986 | Ga0207658_10021705 | Ga0207658_100217054 | 268 |
| 12 | 3300028381 | Ga0268264_10092928 | Ga0268264_100929285 | 268 |
| 13 | 3300031665 | Ga0316575_10128476 | Ga0316575_101284761 | 268 |
| 14 | 3300031691 | Ga0316579_10003171 | Ga0316579_100031715 | 268 |
| 15 | 3300031691 | Ga0316579_10013810 | Ga0316579_100138103 | 268 |
| 16 | 3300031691 | Ga0316579_10022481 | Ga0316579_100224813 | 268 |
| 17 | 3300031727 | Ga0316576_10008419 | Ga0316576_100084192 | 268 |
| 18 | 3300031727 | Ga0316576_10011926 | Ga0316576_100119266 | 268 |
| 19 | 3300031727 | Ga0316576_10014892 | Ga0316576_100148922 | 268 |
| 20 | 3300031727 | Ga0316576_10020551 | Ga0316576_100205514 | 268 |
| 21 | 3300031727 | Ga0316576_10382668 | Ga0316576_103826682 | 268 |
| 22 | 3300031728 | Ga0316578_10008010 | Ga0316578_100080106 | 268 |
| 23 | 3300031728 | Ga0316578_10017934 | Ga0316578_100179344 | 268 |
| 24 | 3300031728 | Ga0316578_10119133 | Ga0316578_101191332 | 268 |
| 25 | 3300031728 | Ga0316578_10130445 | Ga0316578_101304452 | 268 |
| 26 | 3300031733 | Ga0316577_10003874 | Ga0316577_100038746 | 268 |
| 27 | 3300032133 | Ga0316583_10001437 | Ga0316583_100014377 | 268 |
| 28 | 3300032133 | Ga0316583_10022469 | Ga0316583_100224693 | 268 |
| 29 | 3300032137 | Ga0316585_10000275 | Ga0316585_100002758 | 268 |
| 30 | 3300032137 | Ga0316585_10012208 | Ga0316585_100122083 | 268 |
| 31 | 3300032139 | Ga0316580_10001002 | Ga0316580_100010026 | 268 |
| 32 | 3300032139 | Ga0316580_10023955 | Ga0316580_100239553 | 268 |
| 33 | 3300032168 | Ga0316593_10000128 | Ga0316593_100001287 | 268 |
| 34 | 3300032168 | Ga0316593_10004553 | Ga0316593_100045532 | 268 |
| 35 | 3300032168 | Ga0316593_10005144 | Ga0316593_100051442 | 268 |
| 36 | 3300032168 | Ga0316593_10030965 | Ga0316593_100309652 | 268 |
| 37 | 3300032168 | Ga0316593_10062911 | Ga0316593_100629111 | 268 |
| 38 | 3300033524 | Ga0316592_1002694 | Ga0316592_10026942 | 268 |
| 39 | 3300033524 | Ga0316592_1003547 | Ga0316592_10035474 | 268 |
| 40 | 3300033524 | Ga0316592_1011886 | Ga0316592_10118863 | 268 |
| 41 | 3300033524 | Ga0316592_1012680 | Ga0316592_10126802 | 268 |
| 42 | 3300033527 | Ga0316586_1010879 | Ga0316586_10108791 | 268 |
| 43 | 3300033528 | Ga0316588_1000497 | Ga0316588_10004976 | 268 |
| 44 | 3300033528 | Ga0316588_1001124 | Ga0316588_10011242 | 268 |
| 45 | 3300033529 | Ga0316587_1000129 | Ga0316587_10001296 | 268 |
| 46 | 3300033529 | Ga0316587_1005380 | Ga0316587_10053804 | 268 |
| 47 | 3300033541 | Ga0316596_1004992 | Ga0316596_10049922 | 268 |
| 48 | 3300033541 | Ga0316596_1005003 | Ga0316596_10050033 | 268 |
| 49 | 3300033541 | Ga0316596_1006902 | Ga0316596_10069022 | 268 |
| 50 | 3300033541 | Ga0316596_1007371 | Ga0316596_10073712 | 268 |
| 51 | 3300033541 | Ga0316596_1018008 | Ga0316596_10180082 | 268 |
| 52 | 3300035398 | Ga0316574_0006324 | Ga0316574_0006324_3800_4609 | 268 |
| 53 | 3300035398 | Ga0316574_0011135 | Ga0316574_0011135_3736_4608 | 268 |
| 54 | 3300035398 | Ga0316574_0154014 | Ga0316574_0154014_381_1190 | 268 |
| 55 | 3300036647 | Ga0316582_0004634 | Ga0316582_0004634_2015_2824 | 268 |
| 56 | 3300036647 | Ga0316582_0171387 | Ga0316582_0171387_333_1205 | 268 |
| 57 | 3300036712 | Ga0316584_0010088 | Ga0316584_0010088_5340_6209 | 268 |
| 58 | 3300036712 | Ga0316584_0061697 | Ga0316584_0061697_1667_2476 | 268 |
| 59 | 3300036712 | Ga0316584_0078523 | Ga0316584_0078523_1005_1814 | 268 |
| 60 | 3300036712 | Ga0316584_0104108 | Ga0316584_0104108_984_1856 | 268 |
| 61 | 3300037312 | Ga0395899_0116524 | Ga0395899_0116524_513_1325 | 268 |
| 62 | 3300037588 | Ga0316581_0016438 | Ga0316581_0016438_726_1598 | 268 |
| 63 | 3300039062 | Ga0400483_243809 | Ga0400483_243809_1914_2729 | 268 |
| 64 | 3300039438 | Ga0436360_0102938 | Ga0436360_0102938_102_911 | 268 |
| 65 | 3300042142 | Ga0450905_000523 | Ga0450905_000523_3319_4131 | 268 |
| 66 | 3300048917 | Ga0496114_0003374 | Ga0496114_0003374_2142_2951 | 268 |
| 67 | 3300048928 | Ga0496125_0119643 | Ga0496125_0119643_506_1318 | 268 |
| 68 | 3300049581 | Ga0501047_0007374 | Ga0501047_0007374_7135_7944 | 268 |
| 69 | 3300049822 | Ga0501035_0081952 | Ga0501035_0081952_699_1508 | 268 |
| 70 | 3300049823 | Ga0501044_0015211 | Ga0501044_0015211_2909_3718 | 268 |
| 71 | 2162886007 | SwRhRL2b_contig_2648276 | SwRhRL2b_0472.00001040 | 269 |
| 72 | 2162886007 | SwRhRL2b_contig_613501 | SwRhRL2b_0296.00005970 | 269 |
| 73 | 3300001979 | JGI24740J21852_10022400 | JGI24740J21852_100224002 | 269 |
| 74 | 3300001989 | JGI24739J22299_10000089 | JGI24739J22299_100000893 | 269 |
| 75 | 3300001990 | JGI24737J22298_10030053 | JGI24737J22298_100300532 | 269 |
| 76 | 3300002067 | JGI24735J21928_10000702 | JGI24735J21928_1000070210 | 269 |
| 77 | 3300002067 | JGI24735J21928_10002530 | JGI24735J21928_100025302 | 269 |
| 78 | 3300002737 | JGI25162J39368_1000057 | JGI25162J39368_100005733 | 269 |
| 79 | 3300002737 | JGI25162J39368_1007427 | JGI25162J39368_10074272 | 269 |
| 80 | 3300002741 | JGI25157J39369_1000538 | JGI25157J39369_100053824 | 269 |
| 81 | 3300002741 | JGI25157J39369_1001918 | JGI25157J39369_10019185 | 269 |
| 82 | 3300002771 | JGI25163J39215_1001422 | JGI25163J39215_10014222 | 269 |
| 83 | 3300002772 | JGI25164J39214_1000043 | JGI25164J39214_100004332 | 269 |
| 84 | 3300002772 | JGI25164J39214_1001165 | JGI25164J39214_10011659 | 269 |
| 85 | 3300002774 | JGI25150J39212_1000120 | JGI25150J39212_100012023 | 269 |
| 86 | 3300003187 | JGI25151J46595_10000107 | JGI25151J46595_1000010723 | 269 |
| 87 | 3300003187 | JGI25151J46595_10000260 | JGI25151J46595_1000026031 | 269 |
| 88 | 3300003214 | JGI25165J46597_1000113 | JGI25165J46597_1000113123 | 269 |
| 89 | 3300003214 | JGI25165J46597_1003673 | JGI25165J46597_10036732 | 269 |
| 90 | 3300003215 | JGI25153J46596_10000078 | JGI25153J46596_1000007823 | 269 |
| 91 | 3300003215 | JGI25153J46596_10040868 | JGI25153J46596_100408682 | 269 |
| 92 | 3300003371 | JGI26145J50221_1003303 | JGI26145J50221_10033032 | 269 |
| 93 | 3300003479 | Ga0006556J51387_1029963 | Ga0006556J51387_10299631 | 269 |
| 94 | 3300003567 | Ga0006554J51385_1026984 | Ga0006554J51385_10269842 | 269 |
| 95 | 3300003578 | Ga0006562J51391_1011820 | Ga0006562J51391_10118202 | 269 |
| 96 | 3300003578 | Ga0006562J51391_1022863 | Ga0006562J51391_10228632 | 269 |
| 97 | 3300003751 | Ga0055538_1001003 | Ga0055538_10010034 | 269 |
| 98 | 3300003756 | Ga0055533_1000782 | Ga0055533_10007822 | 269 |
| 99 | 3300003761 | Ga0055535_1000043 | Ga0055535_100004333 | 269 |
| 100 | 3300003762 | Ga0055542_1000067 | Ga0055542_100006733 | 269 |
| 101 | 3300003762 | Ga0055542_1000072 | Ga0055542_1000072123 | 269 |
| 102 | 3300003763 | Ga0055529_1000339 | Ga0055529_100033924 | 269 |
| 103 | 3300003771 | Ga0055526_1000564 | Ga0055526_100056419 | 269 |
| 104 | 3300003771 | Ga0055526_1002454 | Ga0055526_10024545 | 269 |
| 105 | 3300003773 | Ga0055537_1000251 | Ga0055537_100025115 | 269 |
| 106 | 3300003773 | Ga0055537_1000954 | Ga0055537_10009546 | 269 |
| 107 | 3300003775 | Ga0055524_1001496 | Ga0055524_10014966 | 269 |
| 108 | 3300003775 | Ga0055524_1006561 | Ga0055524_10065615 | 269 |
| 109 | 3300003781 | Ga0055536_1004489 | Ga0055536_10044896 | 269 |
| 110 | 3300003784 | Ga0055534_1000913 | Ga0055534_10009138 | 269 |
| 111 | 3300003784 | Ga0055534_1001894 | Ga0055534_10018949 | 269 |
| 112 | 3300003790 | Ga0055528_1000533 | Ga0055528_100053319 | 269 |
| 113 | 3300003790 | Ga0055528_1002470 | Ga0055528_10024703 | 269 |
| 114 | 3300003791 | Ga0055530_10001071 | Ga0055530_1000107115 | 269 |
| 115 | 3300003791 | Ga0055530_10008328 | Ga0055530_100083284 | 269 |
| 116 | 3300003792 | Ga0055540_1026696 | Ga0055540_10266962 | 269 |
| 117 | 3300003794 | Ga0055531_10003169 | Ga0055531_100031693 | 269 |
| 118 | 3300003794 | Ga0055531_10037499 | Ga0055531_100374991 | 269 |
| 119 | 3300003856 | Ga0058692_1000022 | Ga0058692_1000022197 | 269 |
| 120 | 3300005262 | Ga0065165_1000108 | Ga0065165_1000108106 | 269 |
| 121 | 3300005289 | Ga0065704_10088826 | Ga0065704_100888264 | 269 |
| 122 | 3300005327 | Ga0070658_10154552 | Ga0070658_101545522 | 269 |
| 123 | 3300005331 | Ga0070670_100008545 | Ga0070670_1000085454 | 269 |
| 124 | 3300005331 | Ga0070670_100011146 | Ga0070670_1000111467 | 269 |
| 125 | 3300005331 | Ga0070670_100029814 | Ga0070670_1000298143 | 269 |
| 126 | 3300005336 | Ga0070680_100000676 | Ga0070680_10000067617 | 269 |
| 127 | 3300005336 | Ga0070680_100064855 | Ga0070680_1000648553 | 269 |
| 128 | 3300005337 | Ga0070682_100151034 | Ga0070682_1001510343 | 269 |
| 129 | 3300005337 | Ga0070682_100275707 | Ga0070682_1002757071 | 269 |
| 130 | 3300005339 | Ga0070660_100189112 | Ga0070660_1001891122 | 269 |
| 131 | 3300005340 | Ga0070689_100001462 | Ga0070689_1000014623 | 269 |
| 132 | 3300005344 | Ga0070661_100007538 | Ga0070661_1000075385 | 269 |
| 133 | 3300005347 | Ga0070668_100609766 | Ga0070668_1006097661 | 269 |
| 134 | 3300005353 | Ga0070669_100052790 | Ga0070669_1000527904 | 269 |
| 135 | 3300005354 | Ga0070675_100059966 | Ga0070675_1000599664 | 269 |
| 136 | 3300005354 | Ga0070675_100198261 | Ga0070675_1001982612 | 269 |
| 137 | 3300005355 | Ga0070671_100025253 | Ga0070671_1000252533 | 269 |
| 138 | 3300005355 | Ga0070671_100143038 | Ga0070671_1001430383 | 269 |
| 139 | 3300005355 | Ga0070671_100276600 | Ga0070671_1002766001 | 269 |
| 140 | 3300005356 | Ga0070674_100133400 | Ga0070674_1001334003 | 269 |
| 141 | 3300005366 | Ga0070659_100097915 | Ga0070659_1000979153 | 269 |
| 142 | 3300005366 | Ga0070659_100223793 | Ga0070659_1002237933 | 269 |
| 143 | 3300005367 | Ga0070667_100164927 | Ga0070667_1001649273 | 269 |
| 144 | 3300005367 | Ga0070667_100228753 | Ga0070667_1002287532 | 269 |
| 145 | 3300005435 | Ga0070714_100089629 | Ga0070714_1000896293 | 269 |
| 146 | 3300005436 | Ga0070713_100114561 | Ga0070713_1001145613 | 269 |
| 147 | 3300005455 | Ga0070663_100025773 | Ga0070663_1000257733 | 269 |
| 148 | 3300005455 | Ga0070663_100090499 | Ga0070663_1000904993 | 269 |
| 149 | 3300005455 | Ga0070663_100118768 | Ga0070663_1001187683 | 269 |
| 150 | 3300005455 | Ga0070663_100183284 | Ga0070663_1001832843 | 269 |
| 151 | 3300005457 | Ga0070662_100013229 | Ga0070662_1000132293 | 269 |
| 152 | 3300005458 | Ga0070681_10000099 | Ga0070681_1000009946 | 269 |
| 153 | 3300005458 | Ga0070681_10003096 | Ga0070681_100030967 | 269 |
| 154 | 3300005458 | Ga0070681_10004417 | Ga0070681_1000441714 | 269 |
| 155 | 3300005458 | Ga0070681_10027458 | Ga0070681_100274585 | 269 |
| 156 | 3300005458 | Ga0070681_10086744 | Ga0070681_100867443 | 269 |
| 157 | 3300005466 | Ga0070685_10015608 | Ga0070685_100156082 | 269 |
| 158 | 3300005530 | Ga0070679_100001851 | Ga0070679_10000185118 | 269 |
| 159 | 3300005530 | Ga0070679_100041191 | Ga0070679_1000411914 | 269 |
| 160 | 3300005530 | Ga0070679_100093771 | Ga0070679_1000937711 | 269 |
| 161 | 3300005539 | Ga0068853_100161816 | Ga0068853_1001618162 | 269 |
| 162 | 3300005543 | Ga0070672_100000943 | Ga0070672_1000009434 | 269 |
| 163 | 3300005543 | Ga0070672_100005546 | Ga0070672_1000055469 | 269 |
| 164 | 3300005543 | Ga0070672_100095766 | Ga0070672_1000957663 | 269 |
| 165 | 3300005548 | Ga0070665_100001585 | Ga0070665_10000158521 | 269 |
| 166 | 3300005548 | Ga0070665_100318368 | Ga0070665_1003183683 | 269 |
| 167 | 3300005548 | Ga0070665_100447780 | Ga0070665_1004477802 | 269 |
| 168 | 3300005563 | Ga0068855_100001765 | Ga0068855_1000017655 | 269 |
| 169 | 3300005563 | Ga0068855_100004088 | Ga0068855_1000040883 | 269 |
| 170 | 3300005563 | Ga0068855_100049342 | Ga0068855_1000493422 | 269 |
| 171 | 3300005563 | Ga0068855_100066454 | Ga0068855_1000664544 | 269 |
| 172 | 3300005563 | Ga0068855_100288107 | Ga0068855_1002881072 | 269 |
| 173 | 3300005564 | Ga0070664_100143974 | Ga0070664_1001439743 | 269 |
| 174 | 3300005577 | Ga0068857_100004412 | Ga0068857_1000044127 | 269 |
| 175 | 3300005578 | Ga0068854_100023085 | Ga0068854_1000230855 | 269 |
| 176 | 3300005614 | Ga0068856_100033193 | Ga0068856_1000331935 | 269 |
| 177 | 3300005614 | Ga0068856_100391281 | Ga0068856_1003912812 | 269 |
| 178 | 3300005616 | Ga0068852_100050040 | Ga0068852_1000500402 | 269 |
| 179 | 3300005617 | Ga0068859_100347938 | Ga0068859_1003479382 | 269 |
| 180 | 3300005618 | Ga0068864_100046699 | Ga0068864_1000466993 | 269 |
| 181 | 3300005834 | Ga0068851_10000643 | Ga0068851_100006433 | 269 |
| 182 | 3300005834 | Ga0068851_10005136 | Ga0068851_100051362 | 269 |
| 183 | 3300005834 | Ga0068851_10018299 | Ga0068851_100182994 | 269 |
| 184 | 3300005834 | Ga0068851_10131723 | Ga0068851_101317232 | 269 |
| 185 | 3300005842 | Ga0068858_100002671 | Ga0068858_1000026719 | 269 |
| 186 | 3300005842 | Ga0068858_100031901 | Ga0068858_1000319014 | 269 |
| 187 | 3300005844 | Ga0068862_100035072 | Ga0068862_1000350724 | 269 |
| 188 | 3300005844 | Ga0068862_100067754 | Ga0068862_1000677541 | 269 |
| 189 | 3300005985 | Ga0081539_10040705 | Ga0081539_100407055 | 269 |
| 190 | 3300006051 | Ga0075364_10065436 | Ga0075364_100654362 | 269 |
| 191 | 3300006051 | Ga0075364_10066556 | Ga0075364_100665562 | 269 |
| 192 | 3300006051 | Ga0075364_10215446 | Ga0075364_102154463 | 269 |
| 193 | 3300006237 | Ga0097621_100079375 | Ga0097621_1000793754 | 269 |
| 194 | 3300006358 | Ga0068871_100081249 | Ga0068871_1000812493 | 269 |
| 195 | 3300006358 | Ga0068871_100388063 | Ga0068871_1003880632 | 269 |
| 196 | 3300006881 | Ga0068865_100020792 | Ga0068865_1000207925 | 269 |
| 197 | 3300006881 | Ga0068865_100234792 | Ga0068865_1002347922 | 269 |
| 198 | 3300006931 | Ga0097620_100347947 | Ga0097620_1003479472 | 269 |
| 199 | 3300006946 | Ga0079104_1000008 | Ga0079104_1000008168 | 269 |
| 200 | 3300009011 | Ga0105251_10000259 | Ga0105251_1000025919 | 269 |
| 201 | 3300009011 | Ga0105251_10002216 | Ga0105251_1000221616 | 269 |
| 202 | 3300009036 | Ga0105244_10026087 | Ga0105244_100260872 | 269 |
| 203 | 3300009092 | Ga0105250_10000043 | Ga0105250_1000004346 | 269 |
| 204 | 3300009093 | Ga0105240_10000617 | Ga0105240_1000061744 | 269 |
| 205 | 3300009093 | Ga0105240_10000755 | Ga0105240_100007553 | 269 |
| 206 | 3300009093 | Ga0105240_10013159 | Ga0105240_100131594 | 269 |
| 207 | 3300009093 | Ga0105240_10019235 | Ga0105240_100192353 | 269 |
| 208 | 3300009093 | Ga0105240_10019299 | Ga0105240_100192992 | 269 |
| 209 | 3300009093 | Ga0105240_10024140 | Ga0105240_100241408 | 269 |
| 210 | 3300009094 | Ga0111539_10058864 | Ga0111539_100588644 | 269 |
| 211 | 3300009098 | Ga0105245_10543391 | Ga0105245_105433912 | 269 |
| 212 | 3300009101 | Ga0105247_10002256 | Ga0105247_1000225612 | 269 |
| 213 | 3300009148 | Ga0105243_10001498 | Ga0105243_100014985 | 269 |
| 214 | 3300009148 | Ga0105243_10002163 | Ga0105243_1000216316 | 269 |
| 215 | 3300009148 | Ga0105243_10007322 | Ga0105243_100073225 | 269 |
| 216 | 3300009174 | Ga0105241_10041687 | Ga0105241_100416873 | 269 |
| 217 | 3300009177 | Ga0105248_10086868 | Ga0105248_100868684 | 269 |
| 218 | 3300009177 | Ga0105248_10166065 | Ga0105248_101660652 | 269 |
| 219 | 3300009545 | Ga0105237_10000063 | Ga0105237_100000639 | 269 |
| 220 | 3300009545 | Ga0105237_10200765 | Ga0105237_102007652 | 269 |
| 221 | 3300009545 | Ga0105237_10275591 | Ga0105237_102755912 | 269 |
| 222 | 3300009545 | Ga0105237_10301734 | Ga0105237_103017342 | 269 |
| 223 | 3300009545 | Ga0105237_10518034 | Ga0105237_105180342 | 269 |
| 224 | 3300009551 | Ga0105238_10001654 | Ga0105238_1000165410 | 269 |
| 225 | 3300009551 | Ga0105238_10001944 | Ga0105238_1000194419 | 269 |
| 226 | 3300009551 | Ga0105238_10057666 | Ga0105238_100576664 | 269 |
| 227 | 3300009551 | Ga0105238_10072874 | Ga0105238_100728743 | 269 |
| 228 | 3300009551 | Ga0105238_10093232 | Ga0105238_100932323 | 269 |
| 229 | 3300009553 | Ga0105249_10269449 | Ga0105249_102694492 | 269 |
| 230 | 3300009978 | Ga0105148_101777 | Ga0105148_1017773 | 269 |
| 231 | 3300009979 | Ga0105032_100374 | Ga0105032_1003745 | 269 |
| 232 | 3300010375 | Ga0105239_10014375 | Ga0105239_100143752 | 269 |
| 233 | 3300010375 | Ga0105239_10024562 | Ga0105239_100245623 | 269 |
| 234 | 3300010375 | Ga0105239_10571243 | Ga0105239_105712431 | 269 |
| 235 | 3300010375 | Ga0105239_11134771 | Ga0105239_111347711 | 269 |
| 236 | 3300011119 | Ga0105246_10260825 | Ga0105246_102608252 | 269 |
| 237 | 3300012475 | Ga0157317_1001242 | Ga0157317_10012422 | 269 |
| 238 | 3300012483 | Ga0157337_1000899 | Ga0157337_10008991 | 269 |
| 239 | 3300012500 | Ga0157314_1000730 | Ga0157314_10007303 | 269 |
| 240 | 3300012510 | Ga0157316_1000171 | Ga0157316_10001713 | 269 |
| 241 | 3300012512 | Ga0157327_1001515 | Ga0157327_10015152 | 269 |
| 242 | 3300013102 | Ga0157371_10000819 | Ga0157371_100008197 | 269 |
| 243 | 3300013102 | Ga0157371_10075571 | Ga0157371_100755711 | 269 |
| 244 | 3300013104 | Ga0157370_10000272 | Ga0157370_1000027236 | 269 |
| 245 | 3300013104 | Ga0157370_10017678 | Ga0157370_100176783 | 269 |
| 246 | 3300013104 | Ga0157370_10073786 | Ga0157370_100737862 | 269 |
| 247 | 3300013104 | Ga0157370_10078752 | Ga0157370_100787523 | 269 |
| 248 | 3300013104 | Ga0157370_10171157 | Ga0157370_101711573 | 269 |
| 249 | 3300013104 | Ga0157370_10177038 | Ga0157370_101770383 | 269 |
| 250 | 3300013105 | Ga0157369_10004930 | Ga0157369_100049306 | 269 |
| 251 | 3300013105 | Ga0157369_10024694 | Ga0157369_100246943 | 269 |
| 252 | 3300013105 | Ga0157369_10039054 | Ga0157369_100390542 | 269 |
| 253 | 3300013105 | Ga0157369_10062739 | Ga0157369_100627395 | 269 |
| 254 | 3300013105 | Ga0157369_10063781 | Ga0157369_100637814 | 269 |
| 255 | 3300013105 | Ga0157369_10109099 | Ga0157369_101090993 | 269 |
| 256 | 3300013105 | Ga0157369_10148651 | Ga0157369_101486512 | 269 |
| 257 | 3300013306 | Ga0163162_10000003 | Ga0163162_10000003104 | 269 |
| 258 | 3300013306 | Ga0163162_10043913 | Ga0163162_100439132 | 269 |
| 259 | 3300013306 | Ga0163162_10205823 | Ga0163162_102058231 | 269 |
| 260 | 3300013306 | Ga0163162_10986906 | Ga0163162_109869062 | 269 |
| 261 | 3300013307 | Ga0157372_10023028 | Ga0157372_100230284 | 269 |
| 262 | 3300013307 | Ga0157372_10092934 | Ga0157372_100929344 | 269 |
| 263 | 3300013307 | Ga0157372_10477217 | Ga0157372_104772171 | 269 |
| 264 | 3300013308 | Ga0157375_10136397 | Ga0157375_101363972 | 269 |
| 265 | 3300014325 | Ga0163163_10029266 | Ga0163163_100292664 | 269 |
| 266 | 3300014325 | Ga0163163_10040831 | Ga0163163_100408313 | 269 |
| 267 | 3300014497 | Ga0182008_10000880 | Ga0182008_1000088025 | 269 |
| 268 | 3300014497 | Ga0182008_10000889 | Ga0182008_100008899 | 269 |
| 269 | 3300014968 | Ga0157379_10035900 | Ga0157379_100359002 | 269 |
| 270 | 3300014968 | Ga0157379_10264993 | Ga0157379_102649932 | 269 |
| 271 | 3300014969 | Ga0157376_10030620 | Ga0157376_100306203 | 269 |
| 272 | 3300014969 | Ga0157376_10141880 | Ga0157376_101418803 | 269 |
| 273 | 3300015261 | Ga0182006_1000034 | Ga0182006_1000034195 | 269 |
| 274 | 3300015261 | Ga0182006_1021593 | Ga0182006_10215933 | 269 |
| 275 | 3300015261 | Ga0182006_1105263 | Ga0182006_11052632 | 269 |
| 276 | 3300015262 | Ga0182007_10000099 | Ga0182007_1000009934 | 269 |
| 277 | 3300015262 | Ga0182007_10003139 | Ga0182007_100031397 | 269 |
| 278 | 3300015265 | Ga0182005_1000362 | Ga0182005_10003622 | 269 |
| 279 | 3300015265 | Ga0182005_1000495 | Ga0182005_10004959 | 269 |
| 280 | 3300015265 | Ga0182005_1000900 | Ga0182005_10009009 | 269 |
| 281 | 3300015265 | Ga0182005_1005127 | Ga0182005_10051274 | 269 |
| 282 | 3300015687 | Ga0183368_1002 | Ga0183368_1002148 | 269 |
| 283 | 3300015689 | Ga0183360_10001 | Ga0183360_10001622 | 269 |
| 284 | 3300017792 | Ga0163161_10014174 | Ga0163161_100141745 | 269 |
| 285 | 3300017792 | Ga0163161_10096973 | Ga0163161_100969733 | 269 |
| 286 | 3300017792 | Ga0163161_10115260 | Ga0163161_101152603 | 269 |
| 287 | 3300017792 | Ga0163161_10121279 | Ga0163161_101212793 | 269 |
| 288 | 3300020069 | Ga0197907_11509201 | Ga0197907_115092013 | 269 |
| 289 | 3300020070 | Ga0206356_10569860 | Ga0206356_105698603 | 269 |
| 290 | 3300020076 | Ga0206355_1088656 | Ga0206355_10886561 | 269 |
| 291 | 3300020077 | Ga0206351_10886011 | Ga0206351_108860112 | 269 |
| 292 | 3300020078 | Ga0206352_10703733 | Ga0206352_107037332 | 269 |
| 293 | 3300020082 | Ga0206353_10004922 | Ga0206353_100049224 | 269 |
| 294 | 3300021361 | Ga0213872_10041194 | Ga0213872_100411942 | 269 |
| 295 | 3300025224 | Ga0209784_100073 | Ga0209784_100073119 | 269 |
| 296 | 3300025225 | Ga0209566_101719 | Ga0209566_1017192 | 269 |
| 297 | 3300025226 | Ga0209674_100043 | Ga0209674_100043133 | 269 |
| 298 | 3300025226 | Ga0209674_100878 | Ga0209674_1008784 | 269 |
| 299 | 3300025228 | Ga0209672_101032 | Ga0209672_1010329 | 269 |
| 300 | 3300025231 | Ga0207427_100013 | Ga0207427_100013322 | 269 |
| 301 | 3300025231 | Ga0207427_102570 | Ga0207427_1025702 | 269 |
| 302 | 3300025233 | Ga0209437_100015 | Ga0209437_100015215 | 269 |
| 303 | 3300025233 | Ga0209437_100126 | Ga0209437_100126141 | 269 |
| 304 | 3300025233 | Ga0209437_101272 | Ga0209437_1012728 | 269 |
| 305 | 3300025233 | Ga0209437_102587 | Ga0209437_1025875 | 269 |
| 306 | 3300025242 | Ga0209258_100049 | Ga0209258_100049322 | 269 |
| 307 | 3300025242 | Ga0209258_100551 | Ga0209258_10055129 | 269 |
| 308 | 3300025242 | Ga0209258_104081 | Ga0209258_1040814 | 269 |
| 309 | 3300025245 | Ga0207425_1000028 | Ga0207425_100002887 | 269 |
| 310 | 3300025245 | Ga0207425_1028457 | Ga0207425_10284571 | 269 |
| 311 | 3300025246 | Ga0209646_1000393 | Ga0209646_10003936 | 269 |
| 312 | 3300025246 | Ga0209646_1006511 | Ga0209646_10065112 | 269 |
| 313 | 3300025250 | Ga0209026_1000094 | Ga0209026_1000094138 | 269 |
| 314 | 3300025250 | Ga0209026_1000866 | Ga0209026_100086612 | 269 |
| 315 | 3300025254 | Ga0209148_1000002 | Ga0209148_10000021573 | 269 |
| 316 | 3300025254 | Ga0209148_1000010 | Ga0209148_1000010699 | 269 |
| 317 | 3300025254 | Ga0209148_1005036 | Ga0209148_10050362 | 269 |
| 318 | 3300025256 | Ga0209759_1000761 | Ga0209759_10007617 | 269 |
| 319 | 3300025256 | Ga0209759_1003734 | Ga0209759_10037345 | 269 |
| 320 | 3300025258 | Ga0209129_1000065 | Ga0209129_100006535 | 269 |
| 321 | 3300025258 | Ga0209129_1010470 | Ga0209129_10104703 | 269 |
| 322 | 3300025261 | Ga0209233_1000009 | Ga0209233_1000009472 | 269 |
| 323 | 3300025261 | Ga0209233_1001164 | Ga0209233_10011647 | 269 |
| 324 | 3300025261 | Ga0209233_1017570 | Ga0209233_10175701 | 269 |
| 325 | 3300025263 | Ga0209565_1000005 | Ga0209565_1000005492 | 269 |
| 326 | 3300025263 | Ga0209565_1000031 | Ga0209565_1000031284 | 269 |
| 327 | 3300025272 | Ga0209455_1000082 | Ga0209455_1000082215 | 269 |
| 328 | 3300025272 | Ga0209455_1000327 | Ga0209455_100032728 | 269 |
| 329 | 3300025272 | Ga0209455_1016064 | Ga0209455_10160641 | 269 |
| 330 | 3300025273 | Ga0209673_1000011 | Ga0209673_1000011147 | 269 |
| 331 | 3300025273 | Ga0209673_1000484 | Ga0209673_100048413 | 269 |
| 332 | 3300025273 | Ga0209673_1018095 | Ga0209673_10180953 | 269 |
| 333 | 3300025284 | Ga0209130_1006679 | Ga0209130_10066794 | 269 |
| 334 | 3300025284 | Ga0209130_1021705 | Ga0209130_10217052 | 269 |
| 335 | 3300025291 | Ga0209675_1000004 | Ga0209675_1000004492 | 269 |
| 336 | 3300025291 | Ga0209675_1000015 | Ga0209675_1000015383 | 269 |
| 337 | 3300025291 | Ga0209675_1006730 | Ga0209675_10067304 | 269 |
| 338 | 3300025292 | Ga0209676_1000034 | Ga0209676_100003496 | 269 |
| 339 | 3300025292 | Ga0209676_1000225 | Ga0209676_100022552 | 269 |
| 340 | 3300025292 | Ga0209676_1000892 | Ga0209676_100089215 | 269 |
| 341 | 3300025292 | Ga0209676_1001193 | Ga0209676_100119324 | 269 |
| 342 | 3300025294 | Ga0209025_1000002 | Ga0209025_1000002185 | 269 |
| 343 | 3300025294 | Ga0209025_1000036 | Ga0209025_1000036296 | 269 |
| 344 | 3300025294 | Ga0209025_1008389 | Ga0209025_10083896 | 269 |
| 345 | 3300025294 | Ga0209025_1025631 | Ga0209025_10256313 | 269 |
| 346 | 3300025295 | Ga0209564_1000018 | Ga0209564_1000018147 | 269 |
| 347 | 3300025295 | Ga0209564_1000480 | Ga0209564_100048016 | 269 |
| 348 | 3300025295 | Ga0209564_1004657 | Ga0209564_10046573 | 269 |
| 349 | 3300025297 | Ga0209758_1000003 | Ga0209758_1000003192 | 269 |
| 350 | 3300025297 | Ga0209758_1024688 | Ga0209758_10246882 | 269 |
| 351 | 3300025298 | Ga0209050_1000201 | Ga0209050_100020170 | 269 |
| 352 | 3300025298 | Ga0209050_1000998 | Ga0209050_100099814 | 269 |
| 353 | 3300025298 | Ga0209050_1005741 | Ga0209050_10057416 | 269 |
| 354 | 3300025299 | Ga0209256_1000021 | Ga0209256_100002195 | 269 |
| 355 | 3300025299 | Ga0209256_1005457 | Ga0209256_10054575 | 269 |
| 356 | 3300025299 | Ga0209256_1010568 | Ga0209256_10105684 | 269 |
| 357 | 3300025302 | Ga0207426_1009262 | Ga0207426_10092624 | 269 |
| 358 | 3300025303 | Ga0209051_1001219 | Ga0209051_100121912 | 269 |
| 359 | 3300025303 | Ga0209051_1003605 | Ga0209051_10036056 | 269 |
| 360 | 3300025303 | Ga0209051_1007665 | Ga0209051_10076654 | 269 |
| 361 | 3300025304 | Ga0209257_1000133 | Ga0209257_1000133113 | 269 |
| 362 | 3300025304 | Ga0209257_1000208 | Ga0209257_100020873 | 269 |
| 363 | 3300025304 | Ga0209257_1000308 | Ga0209257_100030893 | 269 |
| 364 | 3300025304 | Ga0209257_1000585 | Ga0209257_10005852 | 269 |
| 365 | 3300025304 | Ga0209257_1002220 | Ga0209257_10022201 | 269 |
| 366 | 3300025304 | Ga0209257_1004172 | Ga0209257_10041724 | 269 |
| 367 | 3300025321 | Ga0207656_10002466 | Ga0207656_100024662 | 269 |
| 368 | 3300025321 | Ga0207656_10040174 | Ga0207656_100401743 | 269 |
| 369 | 3300025711 | Ga0207696_1000424 | Ga0207696_100042415 | 269 |
| 370 | 3300025728 | Ga0207655_1093954 | Ga0207655_10939542 | 269 |
| 371 | 3300025735 | Ga0207713_1000282 | Ga0207713_100028219 | 269 |
| 372 | 3300025735 | Ga0207713_1005483 | Ga0207713_10054836 | 269 |
| 373 | 3300025900 | Ga0207710_10009441 | Ga0207710_100094414 | 269 |
| 374 | 3300025903 | Ga0207680_10007823 | Ga0207680_100078234 | 269 |
| 375 | 3300025904 | Ga0207647_10000124 | Ga0207647_1000012411 | 269 |
| 376 | 3300025904 | Ga0207647_10006001 | Ga0207647_100060016 | 269 |
| 377 | 3300025904 | Ga0207647_10008548 | Ga0207647_100085486 | 269 |
| 378 | 3300025904 | Ga0207647_10020227 | Ga0207647_100202273 | 269 |
| 379 | 3300025907 | Ga0207645_10055926 | Ga0207645_100559264 | 269 |
| 380 | 3300025911 | Ga0207654_10299644 | Ga0207654_102996442 | 269 |
| 381 | 3300025912 | Ga0207707_10000052 | Ga0207707_1000005218 | 269 |
| 382 | 3300025912 | Ga0207707_10002396 | Ga0207707_1000239617 | 269 |
| 383 | 3300025912 | Ga0207707_10019691 | Ga0207707_100196915 | 269 |
| 384 | 3300025912 | Ga0207707_10082068 | Ga0207707_100820682 | 269 |
| 385 | 3300025912 | Ga0207707_10229832 | Ga0207707_102298322 | 269 |
| 386 | 3300025912 | Ga0207707_10297703 | Ga0207707_102977032 | 269 |
| 387 | 3300025913 | Ga0207695_10000032 | Ga0207695_10000032297 | 269 |
| 388 | 3300025913 | Ga0207695_10003509 | Ga0207695_100035093 | 269 |
| 389 | 3300025913 | Ga0207695_10005651 | Ga0207695_1000565117 | 269 |
| 390 | 3300025913 | Ga0207695_10017386 | Ga0207695_100173866 | 269 |
| 391 | 3300025913 | Ga0207695_10042408 | Ga0207695_100424082 | 269 |
| 392 | 3300025913 | Ga0207695_10044959 | Ga0207695_100449594 | 269 |
| 393 | 3300025913 | Ga0207695_10062813 | Ga0207695_100628135 | 269 |
| 394 | 3300025913 | Ga0207695_10064043 | Ga0207695_100640435 | 269 |
| 395 | 3300025913 | Ga0207695_10215903 | Ga0207695_102159032 | 269 |
| 396 | 3300025914 | Ga0207671_10000021 | Ga0207671_10000021113 | 269 |
| 397 | 3300025914 | Ga0207671_10000074 | Ga0207671_1000007410 | 269 |
| 398 | 3300025914 | Ga0207671_10099946 | Ga0207671_100999462 | 269 |
| 399 | 3300025914 | Ga0207671_10103706 | Ga0207671_101037062 | 269 |
| 400 | 3300025914 | Ga0207671_10215037 | Ga0207671_102150373 | 269 |
| 401 | 3300025917 | Ga0207660_10005646 | Ga0207660_100056467 | 269 |
| 402 | 3300025917 | Ga0207660_10067465 | Ga0207660_100674652 | 269 |
| 403 | 3300025917 | Ga0207660_10172177 | Ga0207660_101721772 | 269 |
| 404 | 3300025917 | Ga0207660_10227604 | Ga0207660_102276043 | 269 |
| 405 | 3300025919 | Ga0207657_10020970 | Ga0207657_100209704 | 269 |
| 406 | 3300025920 | Ga0207649_10033212 | Ga0207649_100332124 | 269 |
| 407 | 3300025920 | Ga0207649_10074121 | Ga0207649_100741213 | 269 |
| 408 | 3300025921 | Ga0207652_10002038 | Ga0207652_1000203817 | 269 |
| 409 | 3300025921 | Ga0207652_10126616 | Ga0207652_101266162 | 269 |
| 410 | 3300025921 | Ga0207652_10196091 | Ga0207652_101960913 | 269 |
| 411 | 3300025921 | Ga0207652_10254728 | Ga0207652_102547282 | 269 |
| 412 | 3300025923 | Ga0207681_10072389 | Ga0207681_100723893 | 269 |
| 413 | 3300025923 | Ga0207681_10114324 | Ga0207681_101143242 | 269 |
| 414 | 3300025924 | Ga0207694_10002009 | Ga0207694_100020095 | 269 |
| 415 | 3300025924 | Ga0207694_10036893 | Ga0207694_100368934 | 269 |
| 416 | 3300025924 | Ga0207694_10068552 | Ga0207694_100685523 | 269 |
| 417 | 3300025924 | Ga0207694_10069526 | Ga0207694_100695263 | 269 |
| 418 | 3300025924 | Ga0207694_10156600 | Ga0207694_101566003 | 269 |
| 419 | 3300025924 | Ga0207694_10262912 | Ga0207694_102629122 | 269 |
| 420 | 3300025924 | Ga0207694_10300622 | Ga0207694_103006222 | 269 |
| 421 | 3300025925 | Ga0207650_10005386 | Ga0207650_100053864 | 269 |
| 422 | 3300025925 | Ga0207650_10019958 | Ga0207650_100199585 | 269 |
| 423 | 3300025926 | Ga0207659_10083890 | Ga0207659_100838903 | 269 |
| 424 | 3300025926 | Ga0207659_10298780 | Ga0207659_102987802 | 269 |
| 425 | 3300025927 | Ga0207687_10235868 | Ga0207687_102358682 | 269 |
| 426 | 3300025931 | Ga0207644_10065136 | Ga0207644_100651362 | 269 |
| 427 | 3300025932 | Ga0207690_10304855 | Ga0207690_103048551 | 269 |
| 428 | 3300025933 | Ga0207706_10034947 | Ga0207706_100349473 | 269 |
| 429 | 3300025935 | Ga0207709_10000070 | Ga0207709_100000704 | 269 |
| 430 | 3300025935 | Ga0207709_10001467 | Ga0207709_100014679 | 269 |
| 431 | 3300025935 | Ga0207709_10002281 | Ga0207709_100022815 | 269 |
| 432 | 3300025936 | Ga0207670_10001715 | Ga0207670_100017159 | 269 |
| 433 | 3300025938 | Ga0207704_10008276 | Ga0207704_100082765 | 269 |
| 434 | 3300025940 | Ga0207691_10000184 | Ga0207691_1000018460 | 269 |
| 435 | 3300025940 | Ga0207691_10070446 | Ga0207691_100704463 | 269 |
| 436 | 3300025941 | Ga0207711_10069448 | Ga0207711_100694484 | 269 |
| 437 | 3300025942 | Ga0207689_10087947 | Ga0207689_100879473 | 269 |
| 438 | 3300025949 | Ga0207667_10000141 | Ga0207667_1000014192 | 269 |
| 439 | 3300025949 | Ga0207667_10001686 | Ga0207667_1000168624 | 269 |
| 440 | 3300025949 | Ga0207667_10017203 | Ga0207667_100172033 | 269 |
| 441 | 3300025949 | Ga0207667_10092175 | Ga0207667_100921754 | 269 |
| 442 | 3300025949 | Ga0207667_10252878 | Ga0207667_102528782 | 269 |
| 443 | 3300025960 | Ga0207651_10029033 | Ga0207651_100290331 | 269 |
| 444 | 3300025961 | Ga0207712_10021091 | Ga0207712_100210914 | 269 |
| 445 | 3300025972 | Ga0207668_10019560 | Ga0207668_100195604 | 269 |
| 446 | 3300025972 | Ga0207668_10211352 | Ga0207668_102113522 | 269 |
| 447 | 3300025981 | Ga0207640_10012031 | Ga0207640_100120314 | 269 |
| 448 | 3300025981 | Ga0207640_10078236 | Ga0207640_100782362 | 269 |
| 449 | 3300025986 | Ga0207658_10416735 | Ga0207658_104167352 | 269 |
| 450 | 3300025986 | Ga0207658_10650709 | Ga0207658_106507092 | 269 |
| 451 | 3300026023 | Ga0207677_10191670 | Ga0207677_101916702 | 269 |
| 452 | 3300026035 | Ga0207703_10001626 | Ga0207703_100016269 | 269 |
| 453 | 3300026035 | Ga0207703_10019515 | Ga0207703_100195152 | 269 |
| 454 | 3300026041 | Ga0207639_10000465 | Ga0207639_1000046511 | 269 |
| 455 | 3300026067 | Ga0207678_10001930 | Ga0207678_1000193011 | 269 |
| 456 | 3300026067 | Ga0207678_10078089 | Ga0207678_100780893 | 269 |
| 457 | 3300026067 | Ga0207678_10122151 | Ga0207678_101221512 | 269 |
| 458 | 3300026078 | Ga0207702_10051044 | Ga0207702_100510443 | 269 |
| 459 | 3300026078 | Ga0207702_10171911 | Ga0207702_101719112 | 269 |
| 460 | 3300026089 | Ga0207648_10028187 | Ga0207648_100281875 | 269 |
| 461 | 3300026095 | Ga0207676_10270576 | Ga0207676_102705762 | 269 |
| 462 | 3300026116 | Ga0207674_10000168 | Ga0207674_1000016877 | 269 |
| 463 | 3300026116 | Ga0207674_10442052 | Ga0207674_104420522 | 269 |
| 464 | 3300026142 | Ga0207698_10002152 | Ga0207698_100021521 | 269 |
| 465 | 3300026142 | Ga0207698_10125802 | Ga0207698_101258022 | 269 |
| 466 | 3300026142 | Ga0207698_10127115 | Ga0207698_101271152 | 269 |
| 467 | 3300027111 | Ga0209281_1000029 | Ga0209281_1000029229 | 269 |
| 468 | 3300027252 | Ga0209973_1009782 | Ga0209973_10097821 | 269 |
| 469 | 3300027312 | Ga0209371_1000004 | Ga0209371_1000004732 | 269 |
| 470 | 3300027312 | Ga0209371_1000044 | Ga0209371_1000044170 | 269 |
| 471 | 3300027360 | Ga0209969_1004401 | Ga0209969_10044012 | 269 |
| 472 | 3300027364 | Ga0209967_1009511 | Ga0209967_10095112 | 269 |
| 473 | 3300027378 | Ga0209981_1007700 | Ga0209981_10077002 | 269 |
| 474 | 3300027424 | Ga0209984_1004997 | Ga0209984_10049972 | 269 |
| 475 | 3300027471 | Ga0209995_1005784 | Ga0209995_10057842 | 269 |
| 476 | 3300027543 | Ga0209999_1000972 | Ga0209999_10009726 | 269 |
| 477 | 3300027552 | Ga0209982_1000533 | Ga0209982_10005332 | 269 |
| 478 | 3300027614 | Ga0209970_1000890 | Ga0209970_10008902 | 269 |
| 479 | 3300027665 | Ga0209983_1000051 | Ga0209983_100005113 | 269 |
| 480 | 3300027682 | Ga0209971_1001064 | Ga0209971_10010644 | 269 |
| 481 | 3300027876 | Ga0209974_10028918 | Ga0209974_100289182 | 269 |
| 482 | 3300028379 | Ga0268266_10000013 | Ga0268266_10000013426 | 269 |
| 483 | 3300028379 | Ga0268266_10000851 | Ga0268266_100008517 | 269 |
| 484 | 3300028379 | Ga0268266_10162328 | Ga0268266_101623283 | 269 |
| 485 | 3300028380 | Ga0268265_10174602 | Ga0268265_101746023 | 269 |
| 486 | 3300028380 | Ga0268265_10243704 | Ga0268265_102437042 | 269 |
| 487 | 3300028381 | Ga0268264_10430803 | Ga0268264_104308032 | 269 |
| 488 | 3300028794 | Ga0307515_10047768 | Ga0307515_100477687 | 269 |
| 489 | 3300030500 | Ga0268256_1000005 | Ga0268256_1000005315 | 269 |
| 490 | 3300030500 | Ga0268256_1000046 | Ga0268256_1000046170 | 269 |
| 491 | 3300030733 | Ga0314311_1201706 | Ga0314311_12017062 | 269 |
| 492 | 3300030735 | Ga0316178_1134858 | Ga0316178_11348582 | 269 |
| 493 | 3300031456 | Ga0307513_10066968 | Ga0307513_100669683 | 269 |
| 494 | 3300031456 | Ga0307513_10100996 | Ga0307513_101009963 | 269 |
| 495 | 3300031548 | Ga0307408_100170665 | Ga0307408_1001706652 | 269 |
| 496 | 3300031824 | Ga0307413_10020958 | Ga0307413_100209584 | 269 |
| 497 | 3300031824 | Ga0307413_10089992 | Ga0307413_100899923 | 269 |
| 498 | 3300031824 | Ga0307413_10202751 | Ga0307413_102027512 | 269 |
| 499 | 3300031901 | Ga0307406_10036900 | Ga0307406_100369002 | 269 |
| 500 | 3300031901 | Ga0307406_10350039 | Ga0307406_103500391 | 269 |
| 501 | 3300031903 | Ga0307407_10112034 | Ga0307407_101120342 | 269 |
| 502 | 3300031911 | Ga0307412_10000409 | Ga0307412_1000040914 | 269 |
| 503 | 3300031911 | Ga0307412_10069421 | Ga0307412_100694213 | 269 |
| 504 | 3300031995 | Ga0307409_100152856 | Ga0307409_1001528563 | 269 |
| 505 | 3300032002 | Ga0307416_100593481 | Ga0307416_1005934812 | 269 |
| 506 | 3300032004 | Ga0307414_10000329 | Ga0307414_100003296 | 269 |
| 507 | 3300032004 | Ga0307414_10018957 | Ga0307414_100189573 | 269 |
| 508 | 3300032004 | Ga0307414_10041115 | Ga0307414_100411153 | 269 |
| 509 | 3300032004 | Ga0307414_10041175 | Ga0307414_100411754 | 269 |
| 510 | 3300032004 | Ga0307414_10117456 | Ga0307414_101174563 | 269 |
| 511 | 3300032004 | Ga0307414_10123146 | Ga0307414_101231462 | 269 |
| 512 | 3300032004 | Ga0307414_10182905 | Ga0307414_101829052 | 269 |
| 513 | 3300032004 | Ga0307414_10301714 | Ga0307414_103017142 | 269 |
| 514 | 3300032005 | Ga0307411_10170988 | Ga0307411_101709882 | 269 |
| 515 | 3300035691 | Ga0373931_0295856 | Ga0373931_0295856_176_985 | 269 |
| 516 | 3300037312 | Ga0395899_0092009 | Ga0395899_0092009_1164_1979 | 269 |
| 517 | 3300037418 | Ga0395900_0000092 | Ga0395900_0000092_160000_160812 | 269 |
| 518 | 3300037418 | Ga0395900_0002408 | Ga0395900_0002408_1009_1869 | 269 |
| 519 | 3300037418 | Ga0395900_0020686 | Ga0395900_0020686_5315_6130 | 269 |
| 520 | 3300037418 | Ga0395900_0164418 | Ga0395900_0164418_1416_2225 | 269 |
| 521 | 3300037466 | Ga0395898_0004660 | Ga0395898_0004660_2421_3281 | 269 |
| 522 | 3300037466 | Ga0395898_0018342 | Ga0395898_0018342_3557_4369 | 269 |
| 523 | 3300037466 | Ga0395898_0112378 | Ga0395898_0112378_1781_2590 | 269 |
| 524 | 3300037466 | Ga0395898_0177780 | Ga0395898_0177780_783_1592 | 269 |
| 525 | 3300037471 | Ga0395905_0006744 | Ga0395905_0006744_2221_3030 | 269 |
| 526 | 3300037471 | Ga0395905_0036234 | Ga0395905_0036234_1677_2486 | 269 |
| 527 | 3300038443 | Ga0395901_0061309 | Ga0395901_0061309_2948_3763 | 269 |
| 528 | 3300038443 | Ga0395901_0298803 | Ga0395901_0298803_385_1200 | 269 |
| 529 | 3300038443 | Ga0395901_0338873 | Ga0395901_0338873_689_1498 | 269 |
| 530 | 3300038705 | Ga0237819_00665 | Ga0237819_00665_321_1130 | 269 |
| 531 | 3300039145 | Ga0237816_00195 | Ga0237816_00195_371_1180 | 269 |
| 532 | 3300039447 | Ga0436361_1057408 | Ga0436361_1057408_6697_7506 | 269 |
| 533 | 3300039447 | Ga0436361_1092360 | Ga0436361_1092360_4692_5501 | 269 |
| 534 | 3300041404 | Ga0439436_0000157 | Ga0439436_0000157_6117_6929 | 269 |
| 535 | 3300041407 | Ga0439447_000418 | Ga0439447_000418_3842_4693 | 269 |
| 536 | 3300041413 | Ga0439465_0000266 | Ga0439465_0000266_4095_4907 | 269 |
| 537 | 3300041413 | Ga0439465_0003036 | Ga0439465_0003036_4168_4977 | 269 |
| 538 | 3300041451 | Ga0451791_0175559 | Ga0451791_0175559_1642_2451 | 269 |
| 539 | 3300041451 | Ga0451791_0536344 | Ga0451791_0536344_2820_3629 | 269 |
| 540 | 3300041453 | Ga0451797_0545361 | Ga0451797_0545361_442_1302 | 269 |
| 541 | 3300041453 | Ga0451797_0951842 | Ga0451797_0951842_331_1140 | 269 |
| 542 | 3300041462 | Ga0451806_039266 | Ga0451806_039266_396_1205 | 269 |
| 543 | 3300041463 | Ga0451804_0087857 | Ga0451804_0087857_318_1127 | 269 |
| 544 | 3300041463 | Ga0451804_0210285 | Ga0451804_0210285_65_877 | 269 |
| 545 | 3300041486 | Ga0451807_0979098 | Ga0451807_0979098_7094_7903 | 269 |
| 546 | 3300041498 | Ga0451841_0905478 | Ga0451841_0905478_16_825 | 269 |
| 547 | 3300041509 | Ga0451843_0039220 | Ga0451843_0039220_141_950 | 269 |
| 548 | 3300041512 | Ga0451853_3664325 | Ga0451853_3664325_391_1200 | 269 |
| 549 | 3300042006 | Ga0439432_058689 | Ga0439432_058689_286_1095 | 269 |
| 550 | 3300042007 | Ga0439449_0000143 | Ga0439449_0000143_10885_11694 | 269 |
| 551 | 3300042007 | Ga0439449_0003099 | Ga0439449_0003099_3184_3993 | 269 |
| 552 | 3300042007 | Ga0439449_0018158 | Ga0439449_0018158_1592_2401 | 269 |
| 553 | 3300042184 | Ga0450908_000031 | Ga0450908_000031_30193_31005 | 269 |
| 554 | 3300042435 | Ga0439434_0016505 | Ga0439434_0016505_386_1195 | 269 |
| 555 | 3300042876 | Ga0451577_0001339 | Ga0451577_0001339_21193_22008 | 269 |
| 556 | 3300042876 | Ga0451577_0005403 | Ga0451577_0005403_8836_9645 | 269 |
| 557 | 3300044656 | Ga0466969_0000600 | Ga0466969_0000600_4083_4895 | 269 |
| 558 | 3300044672 | Ga0466982_0000004 | Ga0466982_0000004_375581_376396 | 269 |
| 559 | 3300044672 | Ga0466982_0000036 | Ga0466982_0000036_42004_42816 | 269 |
| 560 | 3300044683 | Ga0466965_0038379 | Ga0466965_0038379_294_1109 | 269 |
| 561 | 3300044684 | Ga0466966_0003574 | Ga0466966_0003574_5144_5959 | 269 |
| 562 | 3300044684 | Ga0466966_0005847 | Ga0466966_0005847_4011_4826 | 269 |
| 563 | 3300044684 | Ga0466966_0043432 | Ga0466966_0043432_326_1138 | 269 |
| 564 | 3300044693 | Ga0466961_0033609 | Ga0466961_0033609_1803_2618 | 269 |
| 565 | 3300044693 | Ga0466961_0085395 | Ga0466961_0085395_448_1263 | 269 |
| 566 | 3300044712 | Ga0453684_0000298 | Ga0453684_0000298_76977_77786 | 269 |
| 567 | 3300044719 | Ga0466971_0019109 | Ga0466971_0019109_471_1286 | 269 |
| 568 | 3300044735 | Ga0466968_0004202 | Ga0466968_0004202_1587_2399 | 269 |
| 569 | 3300044735 | Ga0466968_0018973 | Ga0466968_0018973_153_983 | 269 |
| 570 | 3300044735 | Ga0466968_0054690 | Ga0466968_0054690_296_1111 | 269 |
| 571 | 3300044765 | Ga0466970_0008080 | Ga0466970_0008080_897_1712 | 269 |
| 572 | 3300044842 | Ga0466957_0087490 | Ga0466957_0087490_324_1136 | 269 |
| 573 | 3300044901 | Ga0466960_0007681 | Ga0466960_0007681_1014_1829 | 269 |
| 574 | 3300045049 | Ga0466959_0010364 | Ga0466959_0010364_3315_4127 | 269 |
| 575 | 3300045051 | Ga0451576_0000033 | Ga0451576_0000033_315346_316155 | 269 |
| 576 | 3300046452 | Ga0495617_000083 | Ga0495617_000083_62806_63618 | 269 |
| 577 | 3300046452 | Ga0495617_001456 | Ga0495617_001456_5226_6038 | 269 |
| 578 | 3300046457 | Ga0495590_0074818 | Ga0495590_0074818_206_1018 | 269 |
| 579 | 3300046460 | Ga0495638_0000007 | Ga0495638_0000007_492211_493026 | 269 |
| 580 | 3300046460 | Ga0495638_0000340 | Ga0495638_0000340_5889_6701 | 269 |
| 581 | 3300046460 | Ga0495638_0002252 | Ga0495638_0002252_2618_3427 | 269 |
| 582 | 3300046460 | Ga0495638_0030059 | Ga0495638_0030059_2331_3140 | 269 |
| 583 | 3300046460 | Ga0495638_0248113 | Ga0495638_0248113_134_949 | 269 |
| 584 | 3300046471 | Ga0495650_0000078 | Ga0495650_0000078_171941_172756 | 269 |
| 585 | 3300046492 | Ga0495585_0000887 | Ga0495585_0000887_5866_6678 | 269 |
| 586 | 3300046501 | Ga0495607_0000247 | Ga0495607_0000247_31865_32677 | 269 |
| 587 | 3300046501 | Ga0495607_0006220 | Ga0495607_0006220_1655_2467 | 269 |
| 588 | 3300046501 | Ga0495607_0028180 | Ga0495607_0028180_1253_2065 | 269 |
| 589 | 3300046507 | Ga0495606_0000242 | Ga0495606_0000242_63566_64381 | 269 |
| 590 | 3300046507 | Ga0495606_0002571 | Ga0495606_0002571_18579_19391 | 269 |
| 591 | 3300046507 | Ga0495606_0015919 | Ga0495606_0015919_2782_3591 | 269 |
| 592 | 3300046507 | Ga0495606_0032337 | Ga0495606_0032337_2480_3292 | 269 |
| 593 | 3300046512 | Ga0495610_0002284 | Ga0495610_0002284_14961_15773 | 269 |
| 594 | 3300046512 | Ga0495610_0011396 | Ga0495610_0011396_4577_5389 | 269 |
| 595 | 3300046513 | Ga0495616_0029914 | Ga0495616_0029914_943_1755 | 269 |
| 596 | 3300046515 | Ga0495620_0000791 | Ga0495620_0000791_5091_5903 | 269 |
| 597 | 3300046515 | Ga0495620_0006935 | Ga0495620_0006935_275_1087 | 269 |
| 598 | 3300046518 | Ga0495631_0000153 | Ga0495631_0000153_20402_21214 | 269 |
| 599 | 3300046518 | Ga0495631_0000603 | Ga0495631_0000603_3794_4606 | 269 |
| 600 | 3300046519 | Ga0495632_0000008 | Ga0495632_0000008_267830_268642 | 269 |
| 601 | 3300046520 | Ga0495637_0011054 | Ga0495637_0011054_306_1118 | 269 |
| 602 | 3300046524 | Ga0495648_0006713 | Ga0495648_0006713_5340_6152 | 269 |
| 603 | 3300046525 | Ga0495663_0000749 | Ga0495663_0000749_1881_2690 | 269 |
| 604 | 3300046525 | Ga0495663_0012113 | Ga0495663_0012113_492_1301 | 269 |
| 605 | 3300046537 | Ga0495598_0001238 | Ga0495598_0001238_923_1732 | 269 |
| 606 | 3300046537 | Ga0495598_0039833 | Ga0495598_0039833_37_846 | 269 |
| 607 | 3300046538 | Ga0495609_0004838 | Ga0495609_0004838_713_1525 | 269 |
| 608 | 3300046539 | Ga0495621_0000225 | Ga0495621_0000225_11091_11900 | 269 |
| 609 | 3300046557 | Ga0495622_0006516 | Ga0495622_0006516_4289_5104 | 269 |
| 610 | 3300046558 | Ga0495633_0051344 | Ga0495633_0051344_122_931 | 269 |
| 611 | 3300046615 | Ga0495656_0002380 | Ga0495656_0002380_690_1499 | 269 |
| 612 | 3300046616 | Ga0495668_0003638 | Ga0495668_0003638_468_1280 | 269 |
| 613 | 3300046616 | Ga0495668_0018796 | Ga0495668_0018796_2809_3618 | 269 |
| 614 | 3300046648 | Ga0495611_0000029 | Ga0495611_0000029_52248_53060 | 269 |
| 615 | 3300046648 | Ga0495611_0000076 | Ga0495611_0000076_26465_27277 | 269 |
| 616 | 3300046660 | Ga0495625_0000260 | Ga0495625_0000260_28381_29193 | 269 |
| 617 | 3300046660 | Ga0495625_0343311 | Ga0495625_0343311_69_881 | 269 |
| 618 | 3300046665 | Ga0495661_0003624 | Ga0495661_0003624_1308_2120 | 269 |
| 619 | 3300046691 | Ga0495670_0000523 | Ga0495670_0000523_1298_2110 | 269 |
| 620 | 3300046691 | Ga0495670_0006569 | Ga0495670_0006569_2443_3255 | 269 |
| 621 | 3300046691 | Ga0495670_0048214 | Ga0495670_0048214_625_1434 | 269 |
| 622 | 3300046692 | Ga0495671_0000545 | Ga0495671_0000545_11511_12323 | 269 |
| 623 | 3300046694 | Ga0495649_0005342 | Ga0495649_0005342_4689_5504 | 269 |
| 624 | 3300046794 | Ga0495589_0000173 | Ga0495589_0000173_4951_5763 | 269 |
| 625 | 3300046810 | Ga0495660_0000235 | Ga0495660_0000235_47978_48790 | 269 |
| 626 | 3300046810 | Ga0495660_0000918 | Ga0495660_0000918_1318_2130 | 269 |
| 627 | 3300047318 | Ga0495636_0004741 | Ga0495636_0004741_2259_3068 | 269 |
| 628 | 3300047318 | Ga0495636_0025936 | Ga0495636_0025936_704_1513 | 269 |
| 629 | 3300047320 | Ga0495672_0000230 | Ga0495672_0000230_18050_18859 | 269 |
| 630 | 3300047443 | Ga0495687_047033 | Ga0495687_047033_68_880 | 269 |
| 631 | 3300047446 | Ga0495679_000091 | Ga0495679_000091_29288_30100 | 269 |
| 632 | 3300047469 | Ga0495673_0000175 | Ga0495673_0000175_26884_27696 | 269 |
| 633 | 3300047469 | Ga0495673_0000392 | Ga0495673_0000392_1205_2017 | 269 |
| 634 | 3300047469 | Ga0495673_0000548 | Ga0495673_0000548_11538_12350 | 269 |
| 635 | 3300047472 | Ga0495686_0001098 | Ga0495686_0001098_31323_32135 | 269 |
| 636 | 3300047472 | Ga0495686_0101511 | Ga0495686_0101511_854_1666 | 269 |
| 637 | 3300048903 | Ga0496100_0003750 | Ga0496100_0003750_2194_3006 | 269 |
| 638 | 3300048903 | Ga0496100_0335523 | Ga0496100_0335523_235_1047 | 269 |
| 639 | 3300048904 | Ga0496101_0001114 | Ga0496101_0001114_14519_15331 | 269 |
| 640 | 3300048905 | Ga0496102_0079547 | Ga0496102_0079547_278_1090 | 269 |
| 641 | 3300048905 | Ga0496102_0172043 | Ga0496102_0172043_955_1764 | 269 |
| 642 | 3300048906 | Ga0496103_0086893 | Ga0496103_0086893_689_1498 | 269 |
| 643 | 3300048911 | Ga0496108_0028586 | Ga0496108_0028586_2771_3580 | 269 |
| 644 | 3300048914 | Ga0496111_0032428 | Ga0496111_0032428_2543_3352 | 269 |
| 645 | 3300048916 | Ga0496113_0005362 | Ga0496113_0005362_5939_6754 | 269 |
| 646 | 3300048917 | Ga0496114_0083210 | Ga0496114_0083210_287_1102 | 269 |
| 647 | 3300048918 | Ga0496115_0000158 | Ga0496115_0000158_54369_55184 | 269 |
| 648 | 3300048919 | Ga0496116_0020070 | Ga0496116_0020070_4083_4895 | 269 |
| 649 | 3300048919 | Ga0496116_0091412 | Ga0496116_0091412_35_844 | 269 |
| 650 | 3300048920 | Ga0496117_0001949 | Ga0496117_0001949_21172_21981 | 269 |
| 651 | 3300048920 | Ga0496117_0038210 | Ga0496117_0038210_1318_2127 | 269 |
| 652 | 3300048921 | Ga0496118_0001826 | Ga0496118_0001826_231_1043 | 269 |
| 653 | 3300048921 | Ga0496118_0002205 | Ga0496118_0002205_5517_6326 | 269 |
| 654 | 3300048921 | Ga0496118_0002535 | Ga0496118_0002535_19104_19913 | 269 |
| 655 | 3300048921 | Ga0496118_0012510 | Ga0496118_0012510_1662_2474 | 269 |
| 656 | 3300048922 | Ga0496119_0000979 | Ga0496119_0000979_19233_20042 | 269 |
| 657 | 3300048924 | Ga0496121_0000290 | Ga0496121_0000290_60490_61302 | 269 |
| 658 | 3300048924 | Ga0496121_0003326 | Ga0496121_0003326_5309_6160 | 269 |
| 659 | 3300048924 | Ga0496121_0005560 | Ga0496121_0005560_15230_16042 | 269 |
| 660 | 3300048924 | Ga0496121_0022928 | Ga0496121_0022928_4901_5716 | 269 |
| 661 | 3300048924 | Ga0496121_0053328 | Ga0496121_0053328_2497_3309 | 269 |
| 662 | 3300048924 | Ga0496121_0055485 | Ga0496121_0055485_1176_1985 | 269 |
| 663 | 3300048924 | Ga0496121_0125081 | Ga0496121_0125081_1106_1918 | 269 |
| 664 | 3300048925 | Ga0496122_0015375 | Ga0496122_0015375_773_1585 | 269 |
| 665 | 3300048925 | Ga0496122_0036592 | Ga0496122_0036592_25_837 | 269 |
| 666 | 3300048926 | Ga0496123_0009952 | Ga0496123_0009952_2451_3263 | 269 |
| 667 | 3300048926 | Ga0496123_0024992 | Ga0496123_0024992_751_1563 | 269 |
| 668 | 3300048926 | Ga0496123_0034574 | Ga0496123_0034574_845_1654 | 269 |
| 669 | 3300048926 | Ga0496123_0042350 | Ga0496123_0042350_2314_3129 | 269 |
| 670 | 3300048926 | Ga0496123_0151785 | Ga0496123_0151785_207_1016 | 269 |
| 671 | 3300048927 | Ga0496124_0004391 | Ga0496124_0004391_3848_4660 | 269 |
| 672 | 3300048927 | Ga0496124_0005917 | Ga0496124_0005917_3850_4662 | 269 |
| 673 | 3300048927 | Ga0496124_0019963 | Ga0496124_0019963_4119_4928 | 269 |
| 674 | 3300048927 | Ga0496124_0024627 | Ga0496124_0024627_329_1138 | 269 |
| 675 | 3300048927 | Ga0496124_0171644 | Ga0496124_0171644_542_1351 | 269 |
| 676 | 3300048927 | Ga0496124_0441285 | Ga0496124_0441285_29_838 | 269 |
| 677 | 3300048928 | Ga0496125_0000517 | Ga0496125_0000517_10441_11256 | 269 |
| 678 | 3300048928 | Ga0496125_0015924 | Ga0496125_0015924_5442_6251 | 269 |
| 679 | 3300048928 | Ga0496125_0032443 | Ga0496125_0032443_3640_4449 | 269 |
| 680 | 3300048928 | Ga0496125_0117126 | Ga0496125_0117126_1007_1819 | 269 |
| 681 | 3300048929 | Ga0496126_0086921 | Ga0496126_0086921_1128_1940 | 269 |
| 682 | 3300048929 | Ga0496126_0121963 | Ga0496126_0121963_1053_1868 | 269 |
| 683 | 3300048929 | Ga0496126_0195718 | Ga0496126_0195718_49_858 | 269 |
| 684 | 3300048929 | Ga0496126_0457308 | Ga0496126_0457308_184_999 | 269 |
| 685 | 3300049127 | Ga0501306_005006 | Ga0501306_005006_506_1315 | 269 |
| 686 | 3300049128 | Ga0501308_004437 | Ga0501308_004437_167_976 | 269 |
| 687 | 3300049460 | Ga0495682_0021799 | Ga0495682_0021799_211_1023 | 269 |
| 688 | 3300049460 | Ga0495682_0024202 | Ga0495682_0024202_1242_2054 | 269 |
| 689 | 3300049513 | Ga0501290_000996 | Ga0501290_000996_2944_3753 | 269 |
| 690 | 3300049539 | Ga0501323_015746 | Ga0501323_015746_26_835 | 269 |
| 691 | 3300049569 | Ga0501032_0110794 | Ga0501032_0110794_556_1371 | 269 |
| 692 | 3300049570 | Ga0501033_0001185 | Ga0501033_0001185_18948_19763 | 269 |
| 693 | 3300049571 | Ga0501034_0000420 | Ga0501034_0000420_10748_11557 | 269 |
| 694 | 3300049571 | Ga0501034_0009706 | Ga0501034_0009706_7944_8753 | 269 |
| 695 | 3300049571 | Ga0501034_0219092 | Ga0501034_0219092_873_1688 | 269 |
| 696 | 3300049572 | Ga0501036_0031485 | Ga0501036_0031485_15_830 | 269 |
| 697 | 3300049572 | Ga0501036_0161633 | Ga0501036_0161633_226_1086 | 269 |
| 698 | 3300049573 | Ga0501037_0128953 | Ga0501037_0128953_222_1037 | 269 |
| 699 | 3300049574 | Ga0501038_0140096 | Ga0501038_0140096_601_1416 | 269 |
| 700 | 3300049578 | Ga0501042_0229098 | Ga0501042_0229098_371_1186 | 269 |
| 701 | 3300049579 | Ga0501043_0007657 | Ga0501043_0007657_2704_3513 | 269 |
| 702 | 3300049581 | Ga0501047_0030758 | Ga0501047_0030758_2646_3506 | 269 |
| 703 | 3300049582 | Ga0501048_0432001 | Ga0501048_0432001_98_913 | 269 |
| 704 | 3300049592 | Ga0501076_0427275 | Ga0501076_0427275_136_1038 | 269 |
| 705 | 3300049660 | Ga0501216_013397 | Ga0501216_013397_278_1087 | 269 |
| 706 | 3300049673 | Ga0501240_003223 | Ga0501240_003223_326_1135 | 269 |
| 707 | 3300049763 | Ga0501266_010067 | Ga0501266_010067_143_952 | 269 |
| 708 | 3300049765 | Ga0501268_010600 | Ga0501268_010600_312_1121 | 269 |
| 709 | 3300049823 | Ga0501044_0164906 | Ga0501044_0164906_556_1416 | 269 |
| 710 | 3300049823 | Ga0501044_0448216 | Ga0501044_0448216_99_914 | 269 |
| 711 | 3300049823 | Ga0501044_0448876 | Ga0501044_0448876_46_861 | 269 |
| 712 | 3300049824 | Ga0501045_0137649 | Ga0501045_0137649_335_1150 | 269 |
| 713 | 3300049824 | Ga0501045_0146315 | Ga0501045_0146315_531_1340 | 269 |
| 714 | 3300050491 | nmdc:mga00v17_38711_c1 | nmdc:mga00v17_38711_c1_1220_2029 | 269 |
| 715 | 3300050511 | nmdc:mga08y16_244865_c1 | nmdc:mga08y16_244865_c1_685_1632 | 269 |
| 716 | 3300053087 | Ga0500643_000012 | Ga0500643_000012_363681_364493 | 269 |
| 717 | 3300053088 | Ga0500644_0046847 | Ga0500644_0046847_591_1403 | 269 |
| 718 | 3300053092 | Ga0500583_0023387 | Ga0500583_0023387_1361_2173 | 269 |
| 719 | 3300053096 | Ga0500641_0049052 | Ga0500641_0049052_463_1275 | 269 |
| 720 | 3300053147 | Ga0500589_040476 | Ga0500589_040476_194_1006 | 269 |
| 721 | 3300053153 | Ga0500616_0000062 | Ga0500616_0000062_70253_71065 | 269 |
| 722 | 3300053156 | Ga0500622_0001420 | Ga0500622_0001420_6898_7710 | 269 |
| 723 | 3300053156 | Ga0500622_0009404 | Ga0500622_0009404_720_1532 | 269 |
| 724 | 3300053178 | Ga0500637_0192675 | Ga0500637_0192675_298_1110 | 269 |
| 725 | 3300053730 | Ga0500645_000820 | Ga0500645_000820_12371_13183 | 269 |
| 726 | 3300059504 | Ga0587082_014096 | Ga0587082_014096_215_1030 | 269 |
| 727 | 3300061719 | Ga0466962_0001511 | Ga0466962_0001511_3573_4388 | 269 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3q9l-assembly1.cif.gz_A | the structure of the dimeric e.coli mind-atp complex | 0.9834 | 2 | 257 |
| 3r9i-assembly2.cif.gz_C | 2.6a resolution structure of mind complexed with mine (12-31) peptide | 0.9817 | 2 | 257 |
| 3r9i-assembly2.cif.gz_C | 2.6a resolution structure of mind complexed with mine (12-31) peptide | 0.9778 | 2 | 257 |
| 3r9j-assembly1.cif.gz_B-1 | 4.3a resolution structure of a mind-mine(i24n) protein complex | 0.9774 | 2 | 257 |
| 3r9j-assembly1.cif.gz_A-1 | 4.3a resolution structure of a mind-mine(i24n) protein complex | 0.9761 | 2 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3r9iC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9817 | 2 | 257 | 3.40.50.300 |
| 3r9iC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9778 | 2 | 257 | 3.40.50.300 |
| 4v02A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9336 | 2 | 257 | 3.40.50.300 |
| 4v02A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9299 | 2 | 257 | 3.40.50.300 |
| af_Q57633_4_233_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8983 | 4 | 244 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M7WVW0-F1-model_v4 | Septum site-determining protein MinD (Cell division inhibitor MinD) | 0.9905 | 1 | 248 |
GO:0000917
GO:0005524 GO:0005829 GO:0009898 GO:0016887 GO:0051782 |
| AF-A0A3C0X9V9-F1-model_v4 | deleted | 0.9875 | 142 | 269 |
|
| AF-A0A4U9HJR4-F1-model_v4 | Cell division inhibitor MinD | 0.9867 | 1 | 170 |
GO:0005524
GO:0005829 GO:0009898 GO:0016887 GO:0051782 |
| AF-A0A7C2RRJ6-F1-model_v4 | Septum site-determining protein MinD (Cell division inhibitor MinD) | 0.9865 | 1 | 238 |
GO:0000917
GO:0005524 GO:0005829 GO:0009898 GO:0016887 GO:0051782 |
| AF-A0A1W9SN23-F1-model_v4 | Septum site-determining protein MinD | 0.9864 | 1 | 198 |
GO:0005524
GO:0005829 GO:0009898 GO:0016887 GO:0051782 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar