F477748

General Info

Members Datasets Scaffolds Average Seq Length
727 377 727 272

Family's Representative Sequence

Representative Sequence 3300027360|Ga0209969_1004401|Ga0209969_10044012
Length 335
Sequence LAEIIVVTSGKGGVGKTTTSASLACGLARHGKKVAVIDFDVGLRNLDLIMGCERRVVYDFVNVIHGEASLKQSLIKDKRFDNLFVLAASQTRDKDALTTEGVQKVLDDLAADGFDYIVCDSPAGIEKGAFLAMYFADQAVVVVNPEVSSVRDSDRILGLLASKTRRAEAGERVKEHLLLTRYSPARVETGEMLSIGDVEEVLGLKTIGVIPESGDVLNASNKGEPVILDMESPAGQAYDDAVAPRYNQLGRDTWADSVTNDAQRLTVNEILTVNGRGLGAVPNTGVKRDVVSMTPAHRWVNRSPSSWGKISKKCRASRSCEGDCSRRGSILPGKW

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
15 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
92 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
96 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
97 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
98 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
99 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
114 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
119 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
123 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
197 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
215 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
216 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
220 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
221 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
222 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
223 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
233 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
234 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
235 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
244 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
252 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
253 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
254 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
255 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
256 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
257 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
258 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
259 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
260 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
261 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
262 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
263 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
264 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
265 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
266 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
267 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
268 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
269 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
270 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
271 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
272 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
273 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
274 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
275 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
276 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
277 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
278 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
279 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
280 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
281 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
282 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
283 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
284 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
285 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
286 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
287 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
288 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
289 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
290 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
291 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
292 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
293 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
294 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
295 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
299 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
300 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
301 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
302 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
303 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
304 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
305 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
306 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
307 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
308 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
309 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
310 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
311 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
312 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
313 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
314 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
315 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
316 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
317 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
318 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
319 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
320 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
321 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
322 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
326 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
332 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
333 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
334 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
335 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
336 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
337 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
344 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
345 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
358 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
359 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
360 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
365 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
366 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
367 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
368 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
369 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
370 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
371 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
372 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
373 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
374 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
375 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
376 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.46
Metatranscriptomes 4.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.09
Nodule 0.28
Rhizoplane 2.75
Rhizosphere 72.35
Stem 0
Stem Tuber 0
Unclassified 8.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2648276 2162886007 Bacteria 3478
2 SwRhRL2b_contig_613501 2162886007 Bacteria 1245
3 JGI24740J21852_10022400 3300001979 Bacteria 2175
4 JGI24739J22299_10000089 3300001989 Bacteria 26418
5 JGI24737J22298_10030053 3300001990 Bacteria 1701
6 JGI24735J21928_10000702 3300002067 Bacteria 11875
7 JGI24735J21928_10002530 3300002067 Bacteria 6323
8 JGI25162J39368_1000057 3300002737 Bacteria 145686
9 JGI25162J39368_1007427 3300002737 Bacteria 1712
10 JGI25157J39369_1000538 3300002741 Bacteria 22762
11 JGI25157J39369_1001918 3300002741 Bacteria 6287
12 JGI25163J39215_1001422 3300002771 Bacteria 3978
13 JGI25164J39214_1000043 3300002772 Bacteria 126257
14 JGI25164J39214_1001165 3300002772 Bacteria 7293
15 JGI25150J39212_1000120 3300002774 Bacteria 44029
16 JGI25151J46595_10000107 3300003187 Bacteria 113288
17 JGI25151J46595_10000260 3300003187 Bacteria 61845
18 JGI25165J46597_1000113 3300003214 Bacteria 145686
19 JGI25165J46597_1003673 3300003214 Bacteria 3664
20 JGI25153J46596_10000078 3300003215 Bacteria 113288
21 JGI25153J46596_10040868 3300003215 Bacteria 1433
22 JGI26145J50221_1003303 3300003371 Bacteria 1283
23 Ga0006556J51387_1029963 3300003479 Bacteria 1270
24 Ga0006554J51385_1026984 3300003567 Bacteria 1441
25 Ga0006562J51391_1011820 3300003578 Bacteria 2148
26 Ga0006562J51391_1022863 3300003578 Bacteria 3210
27 Ga0055538_1001003 3300003751 Bacteria 6516
28 Ga0055533_1000782 3300003756 Bacteria 9978
29 Ga0055535_1000043 3300003761 Bacteria 145953
30 Ga0055542_1000067 3300003762 Bacteria 154585
31 Ga0055542_1000072 3300003762 Bacteria 145686
32 Ga0055529_1000339 3300003763 Bacteria 52374
33 Ga0055526_1000564 3300003771 Bacteria 29305
34 Ga0055526_1002454 3300003771 Bacteria 12538
35 Ga0055537_1000251 3300003773 Bacteria 39049
36 Ga0055537_1000954 3300003773 Bacteria 13306
37 Ga0055524_1001496 3300003775 Bacteria 13307
38 Ga0055524_1006561 3300003775 Bacteria 5033
39 Ga0055536_1004489 3300003781 Bacteria 7117
40 Ga0055534_1000913 3300003784 Bacteria 13307
41 Ga0055534_1001894 3300003784 Bacteria 7731
42 Ga0055528_1000533 3300003790 Bacteria 29305
43 Ga0055528_1002470 3300003790 Bacteria 9882
44 Ga0055530_10001071 3300003791 Bacteria 21561
45 Ga0055530_10008328 3300003791 Bacteria 4174
46 Ga0055540_1026696 3300003792 Bacteria 1393
47 Ga0055531_10003169 3300003794 Bacteria 10577
48 Ga0055531_10037499 3300003794 Bacteria 1473
49 Ga0058692_1000022 3300003856 Bacteria 237321
50 Ga0065165_1000108 3300005262 Bacteria 139605
51 Ga0065704_10088826 3300005289 Bacteria 2908
52 Ga0070658_10154552 3300005327 Bacteria 1922
53 Ga0070670_100008545 3300005331 Bacteria 8734
54 Ga0070670_100011146 3300005331 Bacteria 7682
55 Ga0070670_100029814 3300005331 Bacteria 4699
56 Ga0070680_100000676 3300005336 Bacteria 23705
57 Ga0070680_100064855 3300005336 Bacteria 2993
58 Ga0070682_100151034 3300005337 Bacteria 1594
59 Ga0070682_100275707 3300005337 Bacteria 1224
60 Ga0070660_100189112 3300005339 Bacteria 1667
61 Ga0070689_100001462 3300005340 Bacteria 15069
62 Ga0070661_100007538 3300005344 Bacteria 7508
63 Ga0070668_100609766 3300005347 Bacteria 956
64 Ga0070669_100052790 3300005353 Bacteria 2975
65 Ga0070675_100059966 3300005354 Bacteria 3141
66 Ga0070675_100198261 3300005354 Bacteria 1742
67 Ga0070671_100025253 3300005355 Bacteria 4874
68 Ga0070671_100143038 3300005355 Bacteria 2019
69 Ga0070671_100276600 3300005355 Bacteria 1427
70 Ga0070674_100133400 3300005356 Bacteria 1855
71 Ga0070659_100097915 3300005366 Bacteria 2358
72 Ga0070659_100223793 3300005366 Bacteria 1554
73 Ga0070667_100007996 3300005367 Bacteria 8772
74 Ga0070667_100164927 3300005367 Bacteria 1953
75 Ga0070667_100228753 3300005367 Bacteria 1657
76 Ga0070714_100089629 3300005435 Bacteria 2693
77 Ga0070713_100114561 3300005436 Bacteria 2356
78 Ga0070663_100025773 3300005455 Bacteria 3974
79 Ga0070663_100090499 3300005455 Bacteria 2266
80 Ga0070663_100118768 3300005455 Bacteria 1995
81 Ga0070663_100183284 3300005455 Bacteria 1625
82 Ga0070662_100013229 3300005457 Bacteria 5487
83 Ga0070681_10000099 3300005458 Bacteria 64409
84 Ga0070681_10003096 3300005458 Bacteria 15444
85 Ga0070681_10004417 3300005458 Bacteria 13396
86 Ga0070681_10027458 3300005458 Bacteria 5723
87 Ga0070681_10086744 3300005458 Bacteria 3083
88 Ga0070685_10015608 3300005466 Bacteria 4037
89 Ga0070679_100001851 3300005530 Bacteria 19019
90 Ga0070679_100041191 3300005530 Bacteria 4597
91 Ga0070679_100093771 3300005530 Bacteria 2989
92 Ga0068853_100161816 3300005539 Bacteria 2020
93 Ga0070672_100000943 3300005543 Bacteria 17491
94 Ga0070672_100005546 3300005543 Bacteria 8381
95 Ga0070672_100095766 3300005543 Bacteria 2401
96 Ga0070665_100001585 3300005548 Bacteria 26221
97 Ga0070665_100318368 3300005548 Bacteria 1560
98 Ga0070665_100447780 3300005548 Bacteria 1301
99 Ga0068855_100001765 3300005563 Bacteria 27005
100 Ga0068855_100004088 3300005563 Bacteria 17795
101 Ga0068855_100049342 3300005563 Bacteria 4964
102 Ga0068855_100066454 3300005563 Bacteria 4204
103 Ga0068855_100288107 3300005563 Bacteria 1821
104 Ga0070664_100143974 3300005564 Bacteria 2101
105 Ga0068857_100004412 3300005577 Bacteria 11893
106 Ga0068854_100023085 3300005578 Bacteria 4246
107 Ga0068856_100033193 3300005614 Bacteria 5054
108 Ga0068856_100391281 3300005614 Bacteria 1410
109 Ga0068852_100050040 3300005616 Bacteria 3578
110 Ga0068859_100347938 3300005617 Bacteria 1577
111 Ga0068864_100046699 3300005618 Bacteria 3716
112 Ga0068851_10000643 3300005834 Bacteria 14875
113 Ga0068851_10005136 3300005834 Bacteria 5936
114 Ga0068851_10018299 3300005834 Bacteria 3374
115 Ga0068851_10131723 3300005834 Bacteria 1353
116 Ga0068858_100002671 3300005842 Bacteria 17949
117 Ga0068858_100031901 3300005842 Bacteria 4895
118 Ga0068862_100035072 3300005844 Bacteria 4247
119 Ga0068862_100067754 3300005844 Bacteria 3078
120 Ga0081539_10040705 3300005985 Bacteria 2725
121 Ga0075365_10024305 3300006038 Bacteria 3820
122 Ga0075364_10065436 3300006051 Bacteria 2386
123 Ga0075364_10066556 3300006051 Bacteria 2367
124 Ga0075364_10215446 3300006051 Bacteria 1302
125 Ga0097621_100079375 3300006237 Bacteria 2728
126 Ga0068871_100081249 3300006358 Bacteria 2685
127 Ga0068871_100388063 3300006358 Bacteria 1241
128 Ga0068865_100020792 3300006881 Bacteria 4261
129 Ga0068865_100234792 3300006881 Bacteria 1440
130 Ga0097620_100347947 3300006931 Bacteria 1577
131 Ga0079104_1000008 3300006946 Bacteria 371223
132 Ga0105251_10000259 3300009011 Bacteria 53031
133 Ga0105251_10002216 3300009011 Bacteria 15497
134 Ga0105244_10026087 3300009036 Bacteria 3166
135 Ga0105250_10000043 3300009092 Bacteria 129336
136 Ga0105240_10000617 3300009093 Bacteria 65935
137 Ga0105240_10000755 3300009093 Bacteria 58976
138 Ga0105240_10013159 3300009093 Bacteria 11383
139 Ga0105240_10019235 3300009093 Bacteria 9128
140 Ga0105240_10019299 3300009093 Bacteria 9111
141 Ga0105240_10024140 3300009093 Bacteria 8025
142 Ga0111539_10058864 3300009094 Bacteria 4557
143 Ga0105245_10543391 3300009098 Bacteria 1183
144 Ga0105247_10002256 3300009101 Bacteria 13254
145 Ga0105243_10001498 3300009148 Bacteria 20434
146 Ga0105243_10002163 3300009148 Bacteria 16598
147 Ga0105243_10007322 3300009148 Bacteria 8487
148 Ga0105241_10041687 3300009174 Bacteria 3470
149 Ga0105248_10086868 3300009177 Bacteria 3519
150 Ga0105248_10166065 3300009177 Bacteria 2488
151 Ga0105237_10000063 3300009545 Bacteria 141759
152 Ga0105237_10200765 3300009545 Bacteria 1994
153 Ga0105237_10275591 3300009545 Bacteria 1685
154 Ga0105237_10301734 3300009545 Bacteria 1605
155 Ga0105237_10518034 3300009545 Bacteria 1199
156 Ga0105238_10001654 3300009551 Bacteria 22378
157 Ga0105238_10001944 3300009551 Bacteria 20782
158 Ga0105238_10057666 3300009551 Bacteria 3893
159 Ga0105238_10072874 3300009551 Bacteria 3429
160 Ga0105238_10093232 3300009551 Bacteria 2999
161 Ga0105249_10269449 3300009553 Bacteria 1696
162 Ga0105148_101777 3300009978 Bacteria 1509
163 Ga0105032_100374 3300009979 Bacteria 4513
164 Ga0105239_10014375 3300010375 Bacteria 8783
165 Ga0105239_10024562 3300010375 Bacteria 6639
166 Ga0105239_10571243 3300010375 Bacteria 1289
167 Ga0105239_11134771 3300010375 Bacteria 900
168 Ga0105246_10260825 3300011119 Bacteria 1380
169 Ga0157317_1001242 3300012475 Bacteria 1339
170 Ga0157337_1000899 3300012483 Bacteria 1430
171 Ga0157314_1000730 3300012500 Bacteria 2882
172 Ga0157316_1000171 3300012510 Bacteria 3153
173 Ga0157327_1001515 3300012512 Bacteria 1469
174 Ga0157371_10000819 3300013102 Bacteria 35696
175 Ga0157371_10075571 3300013102 Bacteria 2386
176 Ga0157370_10000272 3300013104 Bacteria 65739
177 Ga0157370_10017678 3300013104 Bacteria 7188
178 Ga0157370_10073786 3300013104 Bacteria 3219
179 Ga0157370_10078752 3300013104 Bacteria 3104
180 Ga0157370_10171157 3300013104 Bacteria 2019
181 Ga0157370_10177038 3300013104 Bacteria 1982
182 Ga0157369_10004930 3300013105 Bacteria 15633
183 Ga0157369_10024694 3300013105 Bacteria 6679
184 Ga0157369_10039054 3300013105 Bacteria 5189
185 Ga0157369_10062739 3300013105 Bacteria 4004
186 Ga0157369_10063781 3300013105 Bacteria 3969
187 Ga0157369_10109099 3300013105 Bacteria 2943
188 Ga0157369_10148651 3300013105 Bacteria 2476
189 Ga0163162_10000003 3300013306 Bacteria 698280
190 Ga0163162_10000541 3300013306 Bacteria 34925
191 Ga0163162_10043913 3300013306 Bacteria 4475
192 Ga0163162_10205823 3300013306 Bacteria 2097
193 Ga0163162_10986906 3300013306 Bacteria 952
194 Ga0157372_10023028 3300013307 Bacteria 6749
195 Ga0157372_10092934 3300013307 Bacteria 3432
196 Ga0157372_10477217 3300013307 Bacteria 1454
197 Ga0157375_10136397 3300013308 Bacteria 2578
198 Ga0163163_10029266 3300014325 Bacteria 5298
199 Ga0163163_10040831 3300014325 Bacteria 4533
200 Ga0182008_10000880 3300014497 Bacteria 20870
201 Ga0182008_10000889 3300014497 Bacteria 20766
202 Ga0157379_10035900 3300014968 Bacteria 4420
203 Ga0157379_10264993 3300014968 Bacteria 1562
204 Ga0157376_10030620 3300014969 Bacteria 4299
205 Ga0157376_10141880 3300014969 Bacteria 2156
206 Ga0182006_1000034 3300015261 Bacteria 232484
207 Ga0182006_1021593 3300015261 Bacteria 2683
208 Ga0182006_1105263 3300015261 Bacteria 996
209 Ga0182007_10000099 3300015262 Bacteria 60975
210 Ga0182007_10003139 3300015262 Bacteria 7942
211 Ga0182005_1000362 3300015265 Bacteria 25350
212 Ga0182005_1000495 3300015265 Bacteria 20104
213 Ga0182005_1000900 3300015265 Bacteria 13006
214 Ga0182005_1005127 3300015265 Bacteria 4126
215 Ga0183368_1002 3300015687 Bacteria 1865598
216 Ga0183360_10001 3300015689 Bacteria 3943671
217 Ga0163161_10014174 3300017792 Bacteria 5552
218 Ga0163161_10096973 3300017792 Bacteria 2190
219 Ga0163161_10115260 3300017792 Bacteria 2014
220 Ga0163161_10121279 3300017792 Bacteria 1965
221 Ga0197907_11509201 3300020069 Bacteria 2363
222 Ga0206356_10569860 3300020070 Bacteria 3765
223 Ga0206355_1088656 3300020076 Bacteria 1123
224 Ga0206351_10886011 3300020077 Bacteria 1669
225 Ga0206352_10703733 3300020078 Bacteria 1437
226 Ga0206353_10004922 3300020082 Bacteria 4078
227 Ga0213872_10041194 3300021361 Bacteria 2107
228 Ga0209784_100073 3300025224 Bacteria 146019
229 Ga0209566_101719 3300025225 Bacteria 5324
230 Ga0209674_100043 3300025226 Bacteria 369728
231 Ga0209674_100878 3300025226 Bacteria 9798
232 Ga0209672_101032 3300025228 Bacteria 12045
233 Ga0207427_100013 3300025231 Bacteria 581419
234 Ga0207427_102570 3300025231 Bacteria 4702
235 Ga0209437_100015 3300025233 Bacteria 713457
236 Ga0209437_100126 3300025233 Bacteria 192521
237 Ga0209437_101272 3300025233 Bacteria 6840
238 Ga0209437_102587 3300025233 Bacteria 3475
239 Ga0209258_100049 3300025242 Bacteria 358328
240 Ga0209258_100551 3300025242 Bacteria 33759
241 Ga0209258_104081 3300025242 Bacteria 2883
242 Ga0207425_1000028 3300025245 Bacteria 286333
243 Ga0207425_1028457 3300025245 Bacteria 1132
244 Ga0209646_1000393 3300025246 Bacteria 26898
245 Ga0209646_1006511 3300025246 Bacteria 1958
246 Ga0209026_1000094 3300025250 Bacteria 169671
247 Ga0209026_1000866 3300025250 Bacteria 15820
248 Ga0209148_1000002 3300025254 Bacteria 2399500
249 Ga0209148_1000010 3300025254 Bacteria 1265567
250 Ga0209148_1005036 3300025254 Bacteria 3101
251 Ga0209759_1000761 3300025256 Bacteria 27563
252 Ga0209759_1003734 3300025256 Bacteria 5954
253 Ga0209129_1000065 3300025258 Bacteria 232568
254 Ga0209129_1010470 3300025258 Bacteria 2308
255 Ga0209233_1000009 3300025261 Bacteria 1265567
256 Ga0209233_1001164 3300025261 Bacteria 10648
257 Ga0209233_1017570 3300025261 Bacteria 1946
258 Ga0209565_1000005 3300025263 Bacteria 947317
259 Ga0209565_1000031 3300025263 Bacteria 320341
260 Ga0209455_1000082 3300025272 Bacteria 257909
261 Ga0209455_1000327 3300025272 Bacteria 46194
262 Ga0209455_1016064 3300025272 Bacteria 1621
263 Ga0209673_1000011 3300025273 Bacteria 586604
264 Ga0209673_1000484 3300025273 Bacteria 66361
265 Ga0209673_1018095 3300025273 Bacteria 2575
266 Ga0209130_1006679 3300025284 Bacteria 3700
267 Ga0209130_1021705 3300025284 Bacteria 1444
268 Ga0209675_1000004 3300025291 Bacteria 947166
269 Ga0209675_1000015 3300025291 Bacteria 403517
270 Ga0209675_1006730 3300025291 Bacteria 4548
271 Ga0209676_1000034 3300025292 Bacteria 460125
272 Ga0209676_1000225 3300025292 Bacteria 124018
273 Ga0209676_1000892 3300025292 Bacteria 38056
274 Ga0209676_1001193 3300025292 Bacteria 27924
275 Ga0209025_1000002 3300025294 Bacteria 1393142
276 Ga0209025_1000036 3300025294 Bacteria 404113
277 Ga0209025_1008389 3300025294 Bacteria 7447
278 Ga0209025_1025631 3300025294 Bacteria 2993
279 Ga0209564_1000018 3300025295 Bacteria 586913
280 Ga0209564_1000480 3300025295 Bacteria 66421
281 Ga0209564_1004657 3300025295 Bacteria 8241
282 Ga0209758_1000003 3300025297 Bacteria 1398533
283 Ga0209758_1024688 3300025297 Bacteria 2670
284 Ga0209050_1000201 3300025298 Bacteria 134028
285 Ga0209050_1000998 3300025298 Bacteria 35642
286 Ga0209050_1005741 3300025298 Bacteria 7657
287 Ga0209256_1000021 3300025299 Bacteria 537097
288 Ga0209256_1005457 3300025299 Bacteria 7315
289 Ga0209256_1010568 3300025299 Bacteria 3841
290 Ga0207426_1009262 3300025302 Bacteria 3912
291 Ga0209051_1001219 3300025303 Bacteria 23138
292 Ga0209051_1003605 3300025303 Bacteria 10058
293 Ga0209051_1007665 3300025303 Bacteria 5865
294 Ga0209257_1000133 3300025304 Bacteria 208808
295 Ga0209257_1000208 3300025304 Bacteria 141393
296 Ga0209257_1000308 3300025304 Bacteria 105012
297 Ga0209257_1000585 3300025304 Bacteria 61004
298 Ga0209257_1002220 3300025304 Bacteria 19971
299 Ga0209257_1004172 3300025304 Bacteria 11472
300 Ga0207656_10002466 3300025321 Bacteria 6241
301 Ga0207656_10040174 3300025321 Bacteria 1982
302 Ga0207696_1000424 3300025711 Bacteria 38612
303 Ga0207655_1093954 3300025728 Bacteria 1049
304 Ga0207713_1000282 3300025735 Bacteria 59331
305 Ga0207713_1005483 3300025735 Bacteria 7921
306 Ga0207710_10009441 3300025900 Bacteria 4104
307 Ga0207680_10000002 3300025903 Bacteria 1018646
308 Ga0207680_10007823 3300025903 Bacteria 5225
309 Ga0207647_10000124 3300025904 Bacteria 60056
310 Ga0207647_10006001 3300025904 Bacteria 8850
311 Ga0207647_10008548 3300025904 Bacteria 7330
312 Ga0207647_10020227 3300025904 Bacteria 4465
313 Ga0207645_10055926 3300025907 Bacteria 2519
314 Ga0207654_10299644 3300025911 Bacteria 1093
315 Ga0207707_10000052 3300025912 Bacteria 117200
316 Ga0207707_10002396 3300025912 Bacteria 16876
317 Ga0207707_10019691 3300025912 Bacteria 5891
318 Ga0207707_10082068 3300025912 Bacteria 2814
319 Ga0207707_10229832 3300025912 Bacteria 1614
320 Ga0207707_10297703 3300025912 Bacteria 1395
321 Ga0207695_10000032 3300025913 Bacteria 521283
322 Ga0207695_10003509 3300025913 Bacteria 21983
323 Ga0207695_10005651 3300025913 Bacteria 16501
324 Ga0207695_10017386 3300025913 Bacteria 8367
325 Ga0207695_10042408 3300025913 Bacteria 4860
326 Ga0207695_10044959 3300025913 Bacteria 4692
327 Ga0207695_10062813 3300025913 Bacteria 3832
328 Ga0207695_10064043 3300025913 Bacteria 3788
329 Ga0207695_10215903 3300025913 Bacteria 1827
330 Ga0207671_10000021 3300025914 Bacteria 300409
331 Ga0207671_10000074 3300025914 Bacteria 156482
332 Ga0207671_10099946 3300025914 Bacteria 2196
333 Ga0207671_10103706 3300025914 Bacteria 2157
334 Ga0207671_10215037 3300025914 Bacteria 1505
335 Ga0207660_10005646 3300025917 Bacteria 8118
336 Ga0207660_10067465 3300025917 Bacteria 2591
337 Ga0207660_10172177 3300025917 Bacteria 1676
338 Ga0207660_10227604 3300025917 Bacteria 1465
339 Ga0207657_10020970 3300025919 Bacteria 6163
340 Ga0207649_10033212 3300025920 Bacteria 3081
341 Ga0207649_10074121 3300025920 Bacteria 2183
342 Ga0207652_10002038 3300025921 Bacteria 17384
343 Ga0207652_10126616 3300025921 Bacteria 2276
344 Ga0207652_10196091 3300025921 Bacteria 1817
345 Ga0207652_10210441 3300025921 Bacteria 1751
346 Ga0207652_10254728 3300025921 Bacteria 1583
347 Ga0207681_10072389 3300025923 Bacteria 2407
348 Ga0207681_10114324 3300025923 Bacteria 1969
349 Ga0207694_10002009 3300025924 Bacteria 16833
350 Ga0207694_10036893 3300025924 Bacteria 3751
351 Ga0207694_10068552 3300025924 Bacteria 2770
352 Ga0207694_10069526 3300025924 Bacteria 2751
353 Ga0207694_10156600 3300025924 Bacteria 1838
354 Ga0207694_10262912 3300025924 Bacteria 1414
355 Ga0207694_10300622 3300025924 Bacteria 1321
356 Ga0207650_10005386 3300025925 Bacteria 8727
357 Ga0207650_10019958 3300025925 Bacteria 4719
358 Ga0207659_10083890 3300025926 Bacteria 2363
359 Ga0207659_10298780 3300025926 Bacteria 1322
360 Ga0207687_10235868 3300025927 Bacteria 1447
361 Ga0207644_10065136 3300025931 Bacteria 2649
362 Ga0207690_10304855 3300025932 Bacteria 1247
363 Ga0207706_10034947 3300025933 Bacteria 4471
364 Ga0207709_10000070 3300025935 Bacteria 183020
365 Ga0207709_10001467 3300025935 Bacteria 16381
366 Ga0207709_10002281 3300025935 Bacteria 12175
367 Ga0207670_10001715 3300025936 Bacteria 11438
368 Ga0207704_10008276 3300025938 Bacteria 4960
369 Ga0207691_10000184 3300025940 Bacteria 59044
370 Ga0207691_10070446 3300025940 Bacteria 3157
371 Ga0207711_10069448 3300025941 Bacteria 3054
372 Ga0207689_10087947 3300025942 Bacteria 2552
373 Ga0207667_10000141 3300025949 Bacteria 109666
374 Ga0207667_10001686 3300025949 Bacteria 27833
375 Ga0207667_10017203 3300025949 Bacteria 8148
376 Ga0207667_10092175 3300025949 Bacteria 3130
377 Ga0207667_10252878 3300025949 Bacteria 1803
378 Ga0207651_10029033 3300025960 Bacteria 3499
379 Ga0207712_10021091 3300025961 Bacteria 4274
380 Ga0207668_10018364 3300025972 Bacteria 4399
381 Ga0207668_10019560 3300025972 Bacteria 4284
382 Ga0207668_10211352 3300025972 Bacteria 1552
383 Ga0207640_10012031 3300025981 Bacteria 4918
384 Ga0207640_10078236 3300025981 Bacteria 2250
385 Ga0207658_10021705 3300025986 Bacteria 4461
386 Ga0207658_10416735 3300025986 Bacteria 1183
387 Ga0207658_10650709 3300025986 Bacteria 950
388 Ga0207677_10191670 3300026023 Bacteria 1617
389 Ga0207703_10001626 3300026035 Bacteria 20244
390 Ga0207703_10019515 3300026035 Bacteria 5297
391 Ga0207639_10000465 3300026041 Bacteria 27917
392 Ga0207678_10001930 3300026067 Bacteria 18917
393 Ga0207678_10078089 3300026067 Bacteria 2835
394 Ga0207678_10122151 3300026067 Bacteria 2222
395 Ga0207702_10051044 3300026078 Bacteria 3493
396 Ga0207702_10171911 3300026078 Bacteria 1987
397 Ga0207648_10028187 3300026089 Bacteria 4980
398 Ga0207676_10270576 3300026095 Bacteria 1538
399 Ga0207674_10000168 3300026116 Bacteria 78785
400 Ga0207674_10442052 3300026116 Bacteria 1257
401 Ga0207698_10002152 3300026142 Bacteria 11636
402 Ga0207698_10125802 3300026142 Bacteria 2179
403 Ga0207698_10127115 3300026142 Bacteria 2170
404 Ga0209281_1000029 3300027111 Bacteria 431495
405 Ga0209973_1009782 3300027252 Bacteria 1122
406 Ga0209371_1000004 3300027312 Bacteria 1098197
407 Ga0209371_1000044 3300027312 Bacteria 327086
408 Ga0209969_1004401 3300027360 Bacteria 1969
409 Ga0209967_1009511 3300027364 Bacteria 1348
410 Ga0209981_1007700 3300027378 Bacteria 1456
411 Ga0209984_1004997 3300027424 Bacteria 1580
412 Ga0209995_1005784 3300027471 Bacteria 1988
413 Ga0209999_1000972 3300027543 Bacteria 4840
414 Ga0209982_1000533 3300027552 Bacteria 4742
415 Ga0209970_1000890 3300027614 Bacteria 5258
416 Ga0209983_1000051 3300027665 Bacteria 17495
417 Ga0209971_1001064 3300027682 Bacteria 6984
418 Ga0209974_10028918 3300027876 Bacteria 1836
419 Ga0268266_10000013 3300028379 Bacteria 649715
420 Ga0268266_10000851 3300028379 Bacteria 39762
421 Ga0268266_10162328 3300028379 Bacteria 2022
422 Ga0268265_10174602 3300028380 Bacteria 1840
423 Ga0268265_10243704 3300028380 Bacteria 1588
424 Ga0268264_10092928 3300028381 Bacteria 2605
425 Ga0268264_10430803 3300028381 Bacteria 1274
426 Ga0307515_10047768 3300028794 Bacteria 6495
427 Ga0268256_1000005 3300030500 Bacteria 1082342
428 Ga0268256_1000046 3300030500 Bacteria 327003
429 Ga0314311_1201706 3300030733 Bacteria 1421
430 Ga0316178_1134858 3300030735 Bacteria 1646
431 Ga0307513_10066968 3300031456 Bacteria 3771
432 Ga0307513_10100996 3300031456 Bacteria 2908
433 Ga0307408_100170665 3300031548 Bacteria 1736
434 Ga0316575_10128476 3300031665 Bacteria 1039
435 Ga0316579_10003171 3300031691 Bacteria 6362
436 Ga0316579_10013810 3300031691 Bacteria 3480
437 Ga0316579_10022481 3300031691 Bacteria 2819
438 Ga0316576_10008419 3300031727 Bacteria 6576
439 Ga0316576_10011926 3300031727 Bacteria 5719
440 Ga0316576_10014892 3300031727 Bacteria 5202
441 Ga0316576_10020551 3300031727 Bacteria 4548
442 Ga0316576_10382668 3300031727 Bacteria 1044
443 Ga0316578_10008010 3300031728 Bacteria 5342
444 Ga0316578_10017934 3300031728 Bacteria 3866
445 Ga0316578_10119133 3300031728 Bacteria 1586
446 Ga0316578_10130445 3300031728 Bacteria 1512
447 Ga0316577_10003874 3300031733 Bacteria 7625
448 Ga0307413_10020958 3300031824 Bacteria 3488
449 Ga0307413_10089992 3300031824 Bacteria 1995
450 Ga0307413_10202751 3300031824 Bacteria 1434
451 Ga0307406_10036900 3300031901 Bacteria 3014
452 Ga0307406_10350039 3300031901 Bacteria 1154
453 Ga0307407_10112034 3300031903 Bacteria 1714
454 Ga0307412_10000409 3300031911 Bacteria 26195
455 Ga0307412_10069421 3300031911 Bacteria 2399
456 Ga0307409_100152856 3300031995 Bacteria 2006
457 Ga0307416_100593481 3300032002 Bacteria 1186
458 Ga0307414_10000329 3300032004 Bacteria 27035
459 Ga0307414_10018957 3300032004 Bacteria 4252
460 Ga0307414_10041115 3300032004 Bacteria 3128
461 Ga0307414_10041175 3300032004 Bacteria 3126
462 Ga0307414_10117456 3300032004 Bacteria 2038
463 Ga0307414_10123146 3300032004 Bacteria 1997
464 Ga0307414_10182905 3300032004 Bacteria 1687
465 Ga0307414_10301714 3300032004 Bacteria 1355
466 Ga0307411_10170988 3300032005 Bacteria 1638
467 Ga0316583_10001437 3300032133 Bacteria 7944
468 Ga0316583_10022469 3300032133 Bacteria 2257
469 Ga0316585_10000275 3300032137 Bacteria 11263
470 Ga0316585_10012208 3300032137 Bacteria 2541
471 Ga0316580_10001002 3300032139 Bacteria 7048
472 Ga0316580_10023955 3300032139 Bacteria 1886
473 Ga0316593_10000128 3300032168 Bacteria 10385
474 Ga0316593_10004553 3300032168 Bacteria 3570
475 Ga0316593_10005144 3300032168 Bacteria 3424
476 Ga0316593_10030965 3300032168 Bacteria 1740
477 Ga0316593_10062911 3300032168 Bacteria 1271
478 Ga0316592_1002694 3300033524 Bacteria 3101
479 Ga0316592_1003547 3300033524 Bacteria 2824
480 Ga0316592_1011886 3300033524 Bacteria 1777
481 Ga0316592_1012680 3300033524 Bacteria 1731
482 Ga0316586_1010879 3300033527 Bacteria 1386
483 Ga0316588_1000497 3300033528 Bacteria 5381
484 Ga0316588_1001124 3300033528 Bacteria 4252
485 Ga0316587_1000129 3300033529 Bacteria 5821
486 Ga0316587_1005380 3300033529 Bacteria 1917
487 Ga0316596_1004992 3300033541 Bacteria 3008
488 Ga0316596_1005003 3300033541 Bacteria 3006
489 Ga0316596_1006902 3300033541 Bacteria 2660
490 Ga0316596_1007371 3300033541 Bacteria 2599
491 Ga0316596_1018008 3300033541 Bacteria 1782
492 Ga0316574_0006324 3300035398 Bacteria 6391
493 Ga0316574_0011135 3300035398 Bacteria 5103
494 Ga0316574_0154014 3300035398 Bacteria 1481
495 Ga0373931_0295856 3300035691 Bacteria 998
496 Ga0316582_0004634 3300036647 Bacteria 6980
497 Ga0316582_0171387 3300036647 Bacteria 1473
498 Ga0316584_0010088 3300036712 Bacteria 6585
499 Ga0316584_0061697 3300036712 Bacteria 2807
500 Ga0316584_0078523 3300036712 Bacteria 2472
501 Ga0316584_0104108 3300036712 Bacteria 2124
502 Ga0395899_0092009 3300037312 Bacteria 2196
503 Ga0395899_0116524 3300037312 Bacteria 1917
504 Ga0395900_0000092 3300037418 Bacteria 166966
505 Ga0395900_0002408 3300037418 Bacteria 20638
506 Ga0395900_0020686 3300037418 Bacteria 6724
507 Ga0395900_0164418 3300037418 Bacteria 2262
508 Ga0395898_0004660 3300037466 Bacteria 14947
509 Ga0395898_0018342 3300037466 Bacteria 7136
510 Ga0395898_0112378 3300037466 Bacteria 2611
511 Ga0395898_0177780 3300037466 Bacteria 2034
512 Ga0395905_0006744 3300037471 Bacteria 11500
513 Ga0395905_0036234 3300037471 Bacteria 4633
514 Ga0316581_0016438 3300037588 Bacteria 2124
515 Ga0395901_0061309 3300038443 Bacteria 3913
516 Ga0395901_0298803 3300038443 Bacteria 1669
517 Ga0395901_0338873 3300038443 Bacteria 1554
518 Ga0237819_00665 3300038705 Bacteria 11180
519 Ga0400483_243809 3300039062 Bacteria 4359
520 Ga0237816_00195 3300039145 Bacteria 4897
521 Ga0436360_0102938 3300039438 Bacteria 926
522 Ga0436361_1057408 3300039447 Bacteria 13864
523 Ga0436361_1092360 3300039447 Bacteria 6889
524 Ga0439436_0000157 3300041404 Bacteria 15861
525 Ga0439447_000418 3300041407 Bacteria 15789
526 Ga0439465_0000266 3300041413 Bacteria 14541
527 Ga0439465_0003036 3300041413 Bacteria 5490
528 Ga0451791_0175559 3300041451 Bacteria 2761
529 Ga0451791_0536344 3300041451 Bacteria 4138
530 Ga0451797_0545361 3300041453 Bacteria 1741
531 Ga0451797_0951842 3300041453 Bacteria 1405
532 Ga0451806_039266 3300041462 Bacteria 2363
533 Ga0451804_0087857 3300041463 Bacteria 2251
534 Ga0451804_0210285 3300041463 Bacteria 1001
535 Ga0451807_0979098 3300041486 Bacteria 8310
536 Ga0451841_0905478 3300041498 Bacteria 872
537 Ga0451843_0039220 3300041509 Bacteria 2218
538 Ga0451853_3664325 3300041512 Bacteria 1294
539 Ga0439432_058689 3300042006 Bacteria 1189
540 Ga0439449_0000143 3300042007 Bacteria 24455
541 Ga0439449_0003099 3300042007 Bacteria 6478
542 Ga0439449_0018158 3300042007 Bacteria 2639
543 Ga0450905_000523 3300042142 Bacteria 4707
544 Ga0450908_000031 3300042184 Bacteria 31856
545 Ga0439434_0016505 3300042435 Bacteria 2207
546 Ga0451577_0001339 3300042876 Bacteria 33424
547 Ga0451577_0005403 3300042876 Bacteria 13110
548 Ga0466969_0000600 3300044656 Bacteria 19514
549 Ga0466982_0000004 3300044672 Bacteria 386724
550 Ga0466982_0000036 3300044672 Bacteria 43109
551 Ga0466965_0038379 3300044683 Bacteria 2352
552 Ga0466966_0003574 3300044684 Bacteria 10260
553 Ga0466966_0005847 3300044684 Bacteria 8109
554 Ga0466966_0043432 3300044684 Bacteria 2881
555 Ga0466961_0033609 3300044693 Bacteria 3294
556 Ga0466961_0085395 3300044693 Bacteria 1996
557 Ga0453684_0000298 3300044712 Bacteria 209777
558 Ga0466971_0019109 3300044719 Bacteria 3041
559 Ga0466968_0004202 3300044735 Bacteria 5368
560 Ga0466968_0018973 3300044735 Bacteria 2763
561 Ga0466968_0054690 3300044735 Bacteria 1711
562 Ga0466970_0008080 3300044765 Bacteria 5282
563 Ga0466957_0087490 3300044842 Bacteria 1948
564 Ga0466960_0007681 3300044901 Bacteria 4391
565 Ga0466959_0010364 3300045049 Bacteria 6659
566 Ga0451576_0000033 3300045051 Bacteria 393131
567 Ga0495617_000083 3300046452 Bacteria 69141
568 Ga0495617_001456 3300046452 Bacteria 10381
569 Ga0495590_0074818 3300046457 Bacteria 1191
570 Ga0495638_0000007 3300046460 Bacteria 602783
571 Ga0495638_0000340 3300046460 Bacteria 58967
572 Ga0495638_0002252 3300046460 Bacteria 15992
573 Ga0495638_0030059 3300046460 Bacteria 3500
574 Ga0495638_0248113 3300046460 Bacteria 982
575 Ga0495650_0000078 3300046471 Bacteria 245487
576 Ga0495585_0000887 3300046492 Bacteria 25337
577 Ga0495607_0000247 3300046501 Bacteria 57993
578 Ga0495607_0006220 3300046501 Bacteria 8421
579 Ga0495607_0028180 3300046501 Bacteria 3467
580 Ga0495606_0000242 3300046507 Bacteria 96491
581 Ga0495606_0002571 3300046507 Bacteria 20791
582 Ga0495606_0015919 3300046507 Bacteria 5767
583 Ga0495606_0032337 3300046507 Bacteria 3625
584 Ga0495610_0002284 3300046512 Bacteria 16194
585 Ga0495610_0011396 3300046512 Bacteria 5439
586 Ga0495616_0029914 3300046513 Bacteria 2868
587 Ga0495620_0000791 3300046515 Bacteria 19421
588 Ga0495620_0006935 3300046515 Bacteria 6189
589 Ga0495631_0000153 3300046518 Bacteria 47259
590 Ga0495631_0000603 3300046518 Bacteria 23596
591 Ga0495632_0000008 3300046519 Bacteria 294056
592 Ga0495637_0011054 3300046520 Bacteria 4348
593 Ga0495648_0006713 3300046524 Bacteria 9312
594 Ga0495663_0000749 3300046525 Bacteria 11143
595 Ga0495663_0012113 3300046525 Bacteria 2404
596 Ga0495598_0001238 3300046537 Bacteria 4962
597 Ga0495598_0039833 3300046537 Bacteria 1368
598 Ga0495609_0004838 3300046538 Bacteria 7262
599 Ga0495621_0000225 3300046539 Bacteria 13202
600 Ga0495622_0006516 3300046557 Bacteria 5415
601 Ga0495633_0051344 3300046558 Bacteria 1943
602 Ga0495656_0002380 3300046615 Bacteria 6232
603 Ga0495668_0003638 3300046616 Bacteria 11412
604 Ga0495668_0018796 3300046616 Bacteria 3993
605 Ga0495611_0000029 3300046648 Bacteria 115887
606 Ga0495611_0000076 3300046648 Bacteria 69480
607 Ga0495625_0000260 3300046660 Bacteria 82175
608 Ga0495625_0343311 3300046660 Bacteria 945
609 Ga0495661_0003624 3300046665 Bacteria 11375
610 Ga0495670_0000523 3300046691 Bacteria 18177
611 Ga0495670_0006569 3300046691 Bacteria 5717
612 Ga0495670_0048214 3300046691 Bacteria 2131
613 Ga0495671_0000545 3300046692 Bacteria 28273
614 Ga0495649_0005342 3300046694 Bacteria 8196
615 Ga0495589_0000173 3300046794 Bacteria 58030
616 Ga0495660_0000235 3300046810 Bacteria 54297
617 Ga0495660_0000918 3300046810 Bacteria 21697
618 Ga0495636_0004741 3300047318 Bacteria 5334
619 Ga0495636_0025936 3300047318 Bacteria 2382
620 Ga0495672_0000230 3300047320 Bacteria 79829
621 Ga0495687_047033 3300047443 Bacteria 1859
622 Ga0495679_000091 3300047446 Bacteria 82366
623 Ga0495673_0000175 3300047469 Bacteria 105273
624 Ga0495673_0000392 3300047469 Bacteria 51434
625 Ga0495673_0000548 3300047469 Bacteria 38312
626 Ga0495686_0001098 3300047472 Bacteria 32179
627 Ga0495686_0101511 3300047472 Bacteria 1734
628 Ga0496100_0003750 3300048903 Bacteria 7957
629 Ga0496100_0335523 3300048903 Bacteria 1139
630 Ga0496101_0001114 3300048904 Bacteria 15992
631 Ga0496102_0079547 3300048905 Bacteria 3019
632 Ga0496102_0172043 3300048905 Bacteria 2039
633 Ga0496103_0086893 3300048906 Bacteria 1971
634 Ga0496108_0028586 3300048911 Bacteria 4613
635 Ga0496111_0032428 3300048914 Bacteria 3724
636 Ga0496113_0005362 3300048916 Bacteria 7993
637 Ga0496114_0003374 3300048917 Bacteria 12258
638 Ga0496114_0083210 3300048917 Bacteria 2707
639 Ga0496115_0000158 3300048918 Bacteria 63464
640 Ga0496116_0000107 3300048919 Bacteria 188067
641 Ga0496116_0020070 3300048919 Bacteria 5089
642 Ga0496116_0091412 3300048919 Bacteria 1849
643 Ga0496117_0001949 3300048920 Bacteria 27525
644 Ga0496117_0038210 3300048920 Bacteria 3564
645 Ga0496118_0001826 3300048921 Bacteria 30584
646 Ga0496118_0002205 3300048921 Bacteria 27034
647 Ga0496118_0002535 3300048921 Bacteria 24467
648 Ga0496118_0012510 3300048921 Bacteria 8136
649 Ga0496119_0000979 3300048922 Bacteria 36683
650 Ga0496121_0000260 3300048924 Bacteria 110424
651 Ga0496121_0000290 3300048924 Bacteria 104280
652 Ga0496121_0003326 3300048924 Bacteria 23084
653 Ga0496121_0005560 3300048924 Bacteria 16099
654 Ga0496121_0022928 3300048924 Bacteria 6033
655 Ga0496121_0053328 3300048924 Bacteria 3389
656 Ga0496121_0055485 3300048924 Bacteria 3300
657 Ga0496121_0125081 3300048924 Bacteria 1934
658 Ga0496121_0279446 3300048924 Bacteria 1143
659 Ga0496122_0015375 3300048925 Bacteria 7321
660 Ga0496122_0036592 3300048925 Bacteria 3965
661 Ga0496123_0009952 3300048926 Bacteria 8478
662 Ga0496123_0024992 3300048926 Bacteria 4518
663 Ga0496123_0034574 3300048926 Bacteria 3617
664 Ga0496123_0042350 3300048926 Bacteria 3143
665 Ga0496123_0151785 3300048926 Bacteria 1248
666 Ga0496124_0004391 3300048927 Bacteria 16476
667 Ga0496124_0005917 3300048927 Bacteria 13535
668 Ga0496124_0019963 3300048927 Bacteria 6213
669 Ga0496124_0024627 3300048927 Bacteria 5467
670 Ga0496124_0171644 3300048927 Bacteria 1678
671 Ga0496124_0441285 3300048927 Bacteria 890
672 Ga0496125_0000517 3300048928 Bacteria 67165
673 Ga0496125_0015924 3300048928 Bacteria 7241
674 Ga0496125_0032443 3300048928 Bacteria 4639
675 Ga0496125_0117126 3300048928 Bacteria 1911
676 Ga0496125_0119643 3300048928 Bacteria 1882
677 Ga0496126_0086921 3300048929 Bacteria 2755
678 Ga0496126_0121963 3300048929 Bacteria 2259
679 Ga0496126_0195718 3300048929 Bacteria 1709
680 Ga0496126_0457308 3300048929 Bacteria 1026
681 Ga0501306_005006 3300049127 Bacteria 1503
682 Ga0501308_004437 3300049128 Bacteria 1354
683 Ga0495682_0021799 3300049460 Bacteria 2398
684 Ga0495682_0024202 3300049460 Bacteria 2264
685 Ga0501290_000996 3300049513 Bacteria 4077
686 Ga0501323_015746 3300049539 Bacteria 957
687 Ga0501032_0110794 3300049569 Bacteria 1816
688 Ga0501033_0001185 3300049570 Bacteria 23529
689 Ga0501034_0000420 3300049571 Bacteria 71131
690 Ga0501034_0009706 3300049571 Bacteria 10064
691 Ga0501034_0219092 3300049571 Bacteria 1856
692 Ga0501036_0031485 3300049572 Bacteria 4482
693 Ga0501036_0161633 3300049572 Bacteria 1888
694 Ga0501037_0128953 3300049573 Bacteria 1814
695 Ga0501038_0140096 3300049574 Bacteria 1979
696 Ga0501042_0229098 3300049578 Bacteria 1340
697 Ga0501043_0007657 3300049579 Bacteria 8558
698 Ga0501047_0007374 3300049581 Bacteria 10343
699 Ga0501047_0030758 3300049581 Bacteria 5174
700 Ga0501048_0432001 3300049582 Bacteria 942
701 Ga0501076_0427275 3300049592 Bacteria 1090
702 Ga0501216_013397 3300049660 Bacteria 1359
703 Ga0501240_003223 3300049673 Bacteria 1801
704 Ga0501266_010067 3300049763 Bacteria 1200
705 Ga0501268_010600 3300049765 Bacteria 1438
706 Ga0501035_0081952 3300049822 Bacteria 2847
707 Ga0501044_0015211 3300049823 Bacteria 8287
708 Ga0501044_0164906 3300049823 Bacteria 2190
709 Ga0501044_0448216 3300049823 Bacteria 1197
710 Ga0501044_0448876 3300049823 Bacteria 1196
711 Ga0501045_0137649 3300049824 Bacteria 1816
712 Ga0501045_0146315 3300049824 Bacteria 1758
713 nmdc:mga00v17_38711_c1 3300050491 Bacteria 2853
714 nmdc:mga0yw44_8255_c1 3300050492 Bacteria 4837
715 nmdc:mga08y16_244865_c1 3300050511 Bacteria 1853
716 Ga0500643_000012 3300053087 Bacteria 369839
717 Ga0500644_0046847 3300053088 Bacteria 1464
718 Ga0500583_0023387 3300053092 Bacteria 2603
719 Ga0500641_0049052 3300053096 Bacteria 1731
720 Ga0500589_040476 3300053147 Bacteria 2176
721 Ga0500616_0000062 3300053153 Bacteria 245744
722 Ga0500622_0001420 3300053156 Bacteria 19283
723 Ga0500622_0009404 3300053156 Bacteria 5409
724 Ga0500637_0192675 3300053178 Bacteria 1164
725 Ga0500645_000820 3300053730 Bacteria 18519
726 Ga0587082_014096 3300059504 Bacteria 1215
727 Ga0466962_0001511 3300061719 Bacteria 10859

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0279446 Ga0496121_0279446_87_908 266
2 3300006038 Ga0075365_10024305 Ga0075365_100243051 267
3 3300025921 Ga0207652_10210441 Ga0207652_102104412 267
4 3300048919 Ga0496116_0000107 Ga0496116_0000107_179862_180686 267
5 3300048924 Ga0496121_0000260 Ga0496121_0000260_102085_102909 267
6 3300050492 nmdc:mga0yw44_8255_c1 nmdc:mga0yw44_8255_c1_3208_4032 267
7 3300005367 Ga0070667_100007996 Ga0070667_1000079966 268
8 3300013306 Ga0163162_10000541 Ga0163162_1000054132 268
9 3300025903 Ga0207680_10000002 Ga0207680_10000002682 268
10 3300025972 Ga0207668_10018364 Ga0207668_100183644 268
11 3300025986 Ga0207658_10021705 Ga0207658_100217054 268
12 3300028381 Ga0268264_10092928 Ga0268264_100929285 268
13 3300031665 Ga0316575_10128476 Ga0316575_101284761 268
14 3300031691 Ga0316579_10003171 Ga0316579_100031715 268
15 3300031691 Ga0316579_10013810 Ga0316579_100138103 268
16 3300031691 Ga0316579_10022481 Ga0316579_100224813 268
17 3300031727 Ga0316576_10008419 Ga0316576_100084192 268
18 3300031727 Ga0316576_10011926 Ga0316576_100119266 268
19 3300031727 Ga0316576_10014892 Ga0316576_100148922 268
20 3300031727 Ga0316576_10020551 Ga0316576_100205514 268
21 3300031727 Ga0316576_10382668 Ga0316576_103826682 268
22 3300031728 Ga0316578_10008010 Ga0316578_100080106 268
23 3300031728 Ga0316578_10017934 Ga0316578_100179344 268
24 3300031728 Ga0316578_10119133 Ga0316578_101191332 268
25 3300031728 Ga0316578_10130445 Ga0316578_101304452 268
26 3300031733 Ga0316577_10003874 Ga0316577_100038746 268
27 3300032133 Ga0316583_10001437 Ga0316583_100014377 268
28 3300032133 Ga0316583_10022469 Ga0316583_100224693 268
29 3300032137 Ga0316585_10000275 Ga0316585_100002758 268
30 3300032137 Ga0316585_10012208 Ga0316585_100122083 268
31 3300032139 Ga0316580_10001002 Ga0316580_100010026 268
32 3300032139 Ga0316580_10023955 Ga0316580_100239553 268
33 3300032168 Ga0316593_10000128 Ga0316593_100001287 268
34 3300032168 Ga0316593_10004553 Ga0316593_100045532 268
35 3300032168 Ga0316593_10005144 Ga0316593_100051442 268
36 3300032168 Ga0316593_10030965 Ga0316593_100309652 268
37 3300032168 Ga0316593_10062911 Ga0316593_100629111 268
38 3300033524 Ga0316592_1002694 Ga0316592_10026942 268
39 3300033524 Ga0316592_1003547 Ga0316592_10035474 268
40 3300033524 Ga0316592_1011886 Ga0316592_10118863 268
41 3300033524 Ga0316592_1012680 Ga0316592_10126802 268
42 3300033527 Ga0316586_1010879 Ga0316586_10108791 268
43 3300033528 Ga0316588_1000497 Ga0316588_10004976 268
44 3300033528 Ga0316588_1001124 Ga0316588_10011242 268
45 3300033529 Ga0316587_1000129 Ga0316587_10001296 268
46 3300033529 Ga0316587_1005380 Ga0316587_10053804 268
47 3300033541 Ga0316596_1004992 Ga0316596_10049922 268
48 3300033541 Ga0316596_1005003 Ga0316596_10050033 268
49 3300033541 Ga0316596_1006902 Ga0316596_10069022 268
50 3300033541 Ga0316596_1007371 Ga0316596_10073712 268
51 3300033541 Ga0316596_1018008 Ga0316596_10180082 268
52 3300035398 Ga0316574_0006324 Ga0316574_0006324_3800_4609 268
53 3300035398 Ga0316574_0011135 Ga0316574_0011135_3736_4608 268
54 3300035398 Ga0316574_0154014 Ga0316574_0154014_381_1190 268
55 3300036647 Ga0316582_0004634 Ga0316582_0004634_2015_2824 268
56 3300036647 Ga0316582_0171387 Ga0316582_0171387_333_1205 268
57 3300036712 Ga0316584_0010088 Ga0316584_0010088_5340_6209 268
58 3300036712 Ga0316584_0061697 Ga0316584_0061697_1667_2476 268
59 3300036712 Ga0316584_0078523 Ga0316584_0078523_1005_1814 268
60 3300036712 Ga0316584_0104108 Ga0316584_0104108_984_1856 268
61 3300037312 Ga0395899_0116524 Ga0395899_0116524_513_1325 268
62 3300037588 Ga0316581_0016438 Ga0316581_0016438_726_1598 268
63 3300039062 Ga0400483_243809 Ga0400483_243809_1914_2729 268
64 3300039438 Ga0436360_0102938 Ga0436360_0102938_102_911 268
65 3300042142 Ga0450905_000523 Ga0450905_000523_3319_4131 268
66 3300048917 Ga0496114_0003374 Ga0496114_0003374_2142_2951 268
67 3300048928 Ga0496125_0119643 Ga0496125_0119643_506_1318 268
68 3300049581 Ga0501047_0007374 Ga0501047_0007374_7135_7944 268
69 3300049822 Ga0501035_0081952 Ga0501035_0081952_699_1508 268
70 3300049823 Ga0501044_0015211 Ga0501044_0015211_2909_3718 268
71 2162886007 SwRhRL2b_contig_2648276 SwRhRL2b_0472.00001040 269
72 2162886007 SwRhRL2b_contig_613501 SwRhRL2b_0296.00005970 269
73 3300001979 JGI24740J21852_10022400 JGI24740J21852_100224002 269
74 3300001989 JGI24739J22299_10000089 JGI24739J22299_100000893 269
75 3300001990 JGI24737J22298_10030053 JGI24737J22298_100300532 269
76 3300002067 JGI24735J21928_10000702 JGI24735J21928_1000070210 269
77 3300002067 JGI24735J21928_10002530 JGI24735J21928_100025302 269
78 3300002737 JGI25162J39368_1000057 JGI25162J39368_100005733 269
79 3300002737 JGI25162J39368_1007427 JGI25162J39368_10074272 269
80 3300002741 JGI25157J39369_1000538 JGI25157J39369_100053824 269
81 3300002741 JGI25157J39369_1001918 JGI25157J39369_10019185 269
82 3300002771 JGI25163J39215_1001422 JGI25163J39215_10014222 269
83 3300002772 JGI25164J39214_1000043 JGI25164J39214_100004332 269
84 3300002772 JGI25164J39214_1001165 JGI25164J39214_10011659 269
85 3300002774 JGI25150J39212_1000120 JGI25150J39212_100012023 269
86 3300003187 JGI25151J46595_10000107 JGI25151J46595_1000010723 269
87 3300003187 JGI25151J46595_10000260 JGI25151J46595_1000026031 269
88 3300003214 JGI25165J46597_1000113 JGI25165J46597_1000113123 269
89 3300003214 JGI25165J46597_1003673 JGI25165J46597_10036732 269
90 3300003215 JGI25153J46596_10000078 JGI25153J46596_1000007823 269
91 3300003215 JGI25153J46596_10040868 JGI25153J46596_100408682 269
92 3300003371 JGI26145J50221_1003303 JGI26145J50221_10033032 269
93 3300003479 Ga0006556J51387_1029963 Ga0006556J51387_10299631 269
94 3300003567 Ga0006554J51385_1026984 Ga0006554J51385_10269842 269
95 3300003578 Ga0006562J51391_1011820 Ga0006562J51391_10118202 269
96 3300003578 Ga0006562J51391_1022863 Ga0006562J51391_10228632 269
97 3300003751 Ga0055538_1001003 Ga0055538_10010034 269
98 3300003756 Ga0055533_1000782 Ga0055533_10007822 269
99 3300003761 Ga0055535_1000043 Ga0055535_100004333 269
100 3300003762 Ga0055542_1000067 Ga0055542_100006733 269
101 3300003762 Ga0055542_1000072 Ga0055542_1000072123 269
102 3300003763 Ga0055529_1000339 Ga0055529_100033924 269
103 3300003771 Ga0055526_1000564 Ga0055526_100056419 269
104 3300003771 Ga0055526_1002454 Ga0055526_10024545 269
105 3300003773 Ga0055537_1000251 Ga0055537_100025115 269
106 3300003773 Ga0055537_1000954 Ga0055537_10009546 269
107 3300003775 Ga0055524_1001496 Ga0055524_10014966 269
108 3300003775 Ga0055524_1006561 Ga0055524_10065615 269
109 3300003781 Ga0055536_1004489 Ga0055536_10044896 269
110 3300003784 Ga0055534_1000913 Ga0055534_10009138 269
111 3300003784 Ga0055534_1001894 Ga0055534_10018949 269
112 3300003790 Ga0055528_1000533 Ga0055528_100053319 269
113 3300003790 Ga0055528_1002470 Ga0055528_10024703 269
114 3300003791 Ga0055530_10001071 Ga0055530_1000107115 269
115 3300003791 Ga0055530_10008328 Ga0055530_100083284 269
116 3300003792 Ga0055540_1026696 Ga0055540_10266962 269
117 3300003794 Ga0055531_10003169 Ga0055531_100031693 269
118 3300003794 Ga0055531_10037499 Ga0055531_100374991 269
119 3300003856 Ga0058692_1000022 Ga0058692_1000022197 269
120 3300005262 Ga0065165_1000108 Ga0065165_1000108106 269
121 3300005289 Ga0065704_10088826 Ga0065704_100888264 269
122 3300005327 Ga0070658_10154552 Ga0070658_101545522 269
123 3300005331 Ga0070670_100008545 Ga0070670_1000085454 269
124 3300005331 Ga0070670_100011146 Ga0070670_1000111467 269
125 3300005331 Ga0070670_100029814 Ga0070670_1000298143 269
126 3300005336 Ga0070680_100000676 Ga0070680_10000067617 269
127 3300005336 Ga0070680_100064855 Ga0070680_1000648553 269
128 3300005337 Ga0070682_100151034 Ga0070682_1001510343 269
129 3300005337 Ga0070682_100275707 Ga0070682_1002757071 269
130 3300005339 Ga0070660_100189112 Ga0070660_1001891122 269
131 3300005340 Ga0070689_100001462 Ga0070689_1000014623 269
132 3300005344 Ga0070661_100007538 Ga0070661_1000075385 269
133 3300005347 Ga0070668_100609766 Ga0070668_1006097661 269
134 3300005353 Ga0070669_100052790 Ga0070669_1000527904 269
135 3300005354 Ga0070675_100059966 Ga0070675_1000599664 269
136 3300005354 Ga0070675_100198261 Ga0070675_1001982612 269
137 3300005355 Ga0070671_100025253 Ga0070671_1000252533 269
138 3300005355 Ga0070671_100143038 Ga0070671_1001430383 269
139 3300005355 Ga0070671_100276600 Ga0070671_1002766001 269
140 3300005356 Ga0070674_100133400 Ga0070674_1001334003 269
141 3300005366 Ga0070659_100097915 Ga0070659_1000979153 269
142 3300005366 Ga0070659_100223793 Ga0070659_1002237933 269
143 3300005367 Ga0070667_100164927 Ga0070667_1001649273 269
144 3300005367 Ga0070667_100228753 Ga0070667_1002287532 269
145 3300005435 Ga0070714_100089629 Ga0070714_1000896293 269
146 3300005436 Ga0070713_100114561 Ga0070713_1001145613 269
147 3300005455 Ga0070663_100025773 Ga0070663_1000257733 269
148 3300005455 Ga0070663_100090499 Ga0070663_1000904993 269
149 3300005455 Ga0070663_100118768 Ga0070663_1001187683 269
150 3300005455 Ga0070663_100183284 Ga0070663_1001832843 269
151 3300005457 Ga0070662_100013229 Ga0070662_1000132293 269
152 3300005458 Ga0070681_10000099 Ga0070681_1000009946 269
153 3300005458 Ga0070681_10003096 Ga0070681_100030967 269
154 3300005458 Ga0070681_10004417 Ga0070681_1000441714 269
155 3300005458 Ga0070681_10027458 Ga0070681_100274585 269
156 3300005458 Ga0070681_10086744 Ga0070681_100867443 269
157 3300005466 Ga0070685_10015608 Ga0070685_100156082 269
158 3300005530 Ga0070679_100001851 Ga0070679_10000185118 269
159 3300005530 Ga0070679_100041191 Ga0070679_1000411914 269
160 3300005530 Ga0070679_100093771 Ga0070679_1000937711 269
161 3300005539 Ga0068853_100161816 Ga0068853_1001618162 269
162 3300005543 Ga0070672_100000943 Ga0070672_1000009434 269
163 3300005543 Ga0070672_100005546 Ga0070672_1000055469 269
164 3300005543 Ga0070672_100095766 Ga0070672_1000957663 269
165 3300005548 Ga0070665_100001585 Ga0070665_10000158521 269
166 3300005548 Ga0070665_100318368 Ga0070665_1003183683 269
167 3300005548 Ga0070665_100447780 Ga0070665_1004477802 269
168 3300005563 Ga0068855_100001765 Ga0068855_1000017655 269
169 3300005563 Ga0068855_100004088 Ga0068855_1000040883 269
170 3300005563 Ga0068855_100049342 Ga0068855_1000493422 269
171 3300005563 Ga0068855_100066454 Ga0068855_1000664544 269
172 3300005563 Ga0068855_100288107 Ga0068855_1002881072 269
173 3300005564 Ga0070664_100143974 Ga0070664_1001439743 269
174 3300005577 Ga0068857_100004412 Ga0068857_1000044127 269
175 3300005578 Ga0068854_100023085 Ga0068854_1000230855 269
176 3300005614 Ga0068856_100033193 Ga0068856_1000331935 269
177 3300005614 Ga0068856_100391281 Ga0068856_1003912812 269
178 3300005616 Ga0068852_100050040 Ga0068852_1000500402 269
179 3300005617 Ga0068859_100347938 Ga0068859_1003479382 269
180 3300005618 Ga0068864_100046699 Ga0068864_1000466993 269
181 3300005834 Ga0068851_10000643 Ga0068851_100006433 269
182 3300005834 Ga0068851_10005136 Ga0068851_100051362 269
183 3300005834 Ga0068851_10018299 Ga0068851_100182994 269
184 3300005834 Ga0068851_10131723 Ga0068851_101317232 269
185 3300005842 Ga0068858_100002671 Ga0068858_1000026719 269
186 3300005842 Ga0068858_100031901 Ga0068858_1000319014 269
187 3300005844 Ga0068862_100035072 Ga0068862_1000350724 269
188 3300005844 Ga0068862_100067754 Ga0068862_1000677541 269
189 3300005985 Ga0081539_10040705 Ga0081539_100407055 269
190 3300006051 Ga0075364_10065436 Ga0075364_100654362 269
191 3300006051 Ga0075364_10066556 Ga0075364_100665562 269
192 3300006051 Ga0075364_10215446 Ga0075364_102154463 269
193 3300006237 Ga0097621_100079375 Ga0097621_1000793754 269
194 3300006358 Ga0068871_100081249 Ga0068871_1000812493 269
195 3300006358 Ga0068871_100388063 Ga0068871_1003880632 269
196 3300006881 Ga0068865_100020792 Ga0068865_1000207925 269
197 3300006881 Ga0068865_100234792 Ga0068865_1002347922 269
198 3300006931 Ga0097620_100347947 Ga0097620_1003479472 269
199 3300006946 Ga0079104_1000008 Ga0079104_1000008168 269
200 3300009011 Ga0105251_10000259 Ga0105251_1000025919 269
201 3300009011 Ga0105251_10002216 Ga0105251_1000221616 269
202 3300009036 Ga0105244_10026087 Ga0105244_100260872 269
203 3300009092 Ga0105250_10000043 Ga0105250_1000004346 269
204 3300009093 Ga0105240_10000617 Ga0105240_1000061744 269
205 3300009093 Ga0105240_10000755 Ga0105240_100007553 269
206 3300009093 Ga0105240_10013159 Ga0105240_100131594 269
207 3300009093 Ga0105240_10019235 Ga0105240_100192353 269
208 3300009093 Ga0105240_10019299 Ga0105240_100192992 269
209 3300009093 Ga0105240_10024140 Ga0105240_100241408 269
210 3300009094 Ga0111539_10058864 Ga0111539_100588644 269
211 3300009098 Ga0105245_10543391 Ga0105245_105433912 269
212 3300009101 Ga0105247_10002256 Ga0105247_1000225612 269
213 3300009148 Ga0105243_10001498 Ga0105243_100014985 269
214 3300009148 Ga0105243_10002163 Ga0105243_1000216316 269
215 3300009148 Ga0105243_10007322 Ga0105243_100073225 269
216 3300009174 Ga0105241_10041687 Ga0105241_100416873 269
217 3300009177 Ga0105248_10086868 Ga0105248_100868684 269
218 3300009177 Ga0105248_10166065 Ga0105248_101660652 269
219 3300009545 Ga0105237_10000063 Ga0105237_100000639 269
220 3300009545 Ga0105237_10200765 Ga0105237_102007652 269
221 3300009545 Ga0105237_10275591 Ga0105237_102755912 269
222 3300009545 Ga0105237_10301734 Ga0105237_103017342 269
223 3300009545 Ga0105237_10518034 Ga0105237_105180342 269
224 3300009551 Ga0105238_10001654 Ga0105238_1000165410 269
225 3300009551 Ga0105238_10001944 Ga0105238_1000194419 269
226 3300009551 Ga0105238_10057666 Ga0105238_100576664 269
227 3300009551 Ga0105238_10072874 Ga0105238_100728743 269
228 3300009551 Ga0105238_10093232 Ga0105238_100932323 269
229 3300009553 Ga0105249_10269449 Ga0105249_102694492 269
230 3300009978 Ga0105148_101777 Ga0105148_1017773 269
231 3300009979 Ga0105032_100374 Ga0105032_1003745 269
232 3300010375 Ga0105239_10014375 Ga0105239_100143752 269
233 3300010375 Ga0105239_10024562 Ga0105239_100245623 269
234 3300010375 Ga0105239_10571243 Ga0105239_105712431 269
235 3300010375 Ga0105239_11134771 Ga0105239_111347711 269
236 3300011119 Ga0105246_10260825 Ga0105246_102608252 269
237 3300012475 Ga0157317_1001242 Ga0157317_10012422 269
238 3300012483 Ga0157337_1000899 Ga0157337_10008991 269
239 3300012500 Ga0157314_1000730 Ga0157314_10007303 269
240 3300012510 Ga0157316_1000171 Ga0157316_10001713 269
241 3300012512 Ga0157327_1001515 Ga0157327_10015152 269
242 3300013102 Ga0157371_10000819 Ga0157371_100008197 269
243 3300013102 Ga0157371_10075571 Ga0157371_100755711 269
244 3300013104 Ga0157370_10000272 Ga0157370_1000027236 269
245 3300013104 Ga0157370_10017678 Ga0157370_100176783 269
246 3300013104 Ga0157370_10073786 Ga0157370_100737862 269
247 3300013104 Ga0157370_10078752 Ga0157370_100787523 269
248 3300013104 Ga0157370_10171157 Ga0157370_101711573 269
249 3300013104 Ga0157370_10177038 Ga0157370_101770383 269
250 3300013105 Ga0157369_10004930 Ga0157369_100049306 269
251 3300013105 Ga0157369_10024694 Ga0157369_100246943 269
252 3300013105 Ga0157369_10039054 Ga0157369_100390542 269
253 3300013105 Ga0157369_10062739 Ga0157369_100627395 269
254 3300013105 Ga0157369_10063781 Ga0157369_100637814 269
255 3300013105 Ga0157369_10109099 Ga0157369_101090993 269
256 3300013105 Ga0157369_10148651 Ga0157369_101486512 269
257 3300013306 Ga0163162_10000003 Ga0163162_10000003104 269
258 3300013306 Ga0163162_10043913 Ga0163162_100439132 269
259 3300013306 Ga0163162_10205823 Ga0163162_102058231 269
260 3300013306 Ga0163162_10986906 Ga0163162_109869062 269
261 3300013307 Ga0157372_10023028 Ga0157372_100230284 269
262 3300013307 Ga0157372_10092934 Ga0157372_100929344 269
263 3300013307 Ga0157372_10477217 Ga0157372_104772171 269
264 3300013308 Ga0157375_10136397 Ga0157375_101363972 269
265 3300014325 Ga0163163_10029266 Ga0163163_100292664 269
266 3300014325 Ga0163163_10040831 Ga0163163_100408313 269
267 3300014497 Ga0182008_10000880 Ga0182008_1000088025 269
268 3300014497 Ga0182008_10000889 Ga0182008_100008899 269
269 3300014968 Ga0157379_10035900 Ga0157379_100359002 269
270 3300014968 Ga0157379_10264993 Ga0157379_102649932 269
271 3300014969 Ga0157376_10030620 Ga0157376_100306203 269
272 3300014969 Ga0157376_10141880 Ga0157376_101418803 269
273 3300015261 Ga0182006_1000034 Ga0182006_1000034195 269
274 3300015261 Ga0182006_1021593 Ga0182006_10215933 269
275 3300015261 Ga0182006_1105263 Ga0182006_11052632 269
276 3300015262 Ga0182007_10000099 Ga0182007_1000009934 269
277 3300015262 Ga0182007_10003139 Ga0182007_100031397 269
278 3300015265 Ga0182005_1000362 Ga0182005_10003622 269
279 3300015265 Ga0182005_1000495 Ga0182005_10004959 269
280 3300015265 Ga0182005_1000900 Ga0182005_10009009 269
281 3300015265 Ga0182005_1005127 Ga0182005_10051274 269
282 3300015687 Ga0183368_1002 Ga0183368_1002148 269
283 3300015689 Ga0183360_10001 Ga0183360_10001622 269
284 3300017792 Ga0163161_10014174 Ga0163161_100141745 269
285 3300017792 Ga0163161_10096973 Ga0163161_100969733 269
286 3300017792 Ga0163161_10115260 Ga0163161_101152603 269
287 3300017792 Ga0163161_10121279 Ga0163161_101212793 269
288 3300020069 Ga0197907_11509201 Ga0197907_115092013 269
289 3300020070 Ga0206356_10569860 Ga0206356_105698603 269
290 3300020076 Ga0206355_1088656 Ga0206355_10886561 269
291 3300020077 Ga0206351_10886011 Ga0206351_108860112 269
292 3300020078 Ga0206352_10703733 Ga0206352_107037332 269
293 3300020082 Ga0206353_10004922 Ga0206353_100049224 269
294 3300021361 Ga0213872_10041194 Ga0213872_100411942 269
295 3300025224 Ga0209784_100073 Ga0209784_100073119 269
296 3300025225 Ga0209566_101719 Ga0209566_1017192 269
297 3300025226 Ga0209674_100043 Ga0209674_100043133 269
298 3300025226 Ga0209674_100878 Ga0209674_1008784 269
299 3300025228 Ga0209672_101032 Ga0209672_1010329 269
300 3300025231 Ga0207427_100013 Ga0207427_100013322 269
301 3300025231 Ga0207427_102570 Ga0207427_1025702 269
302 3300025233 Ga0209437_100015 Ga0209437_100015215 269
303 3300025233 Ga0209437_100126 Ga0209437_100126141 269
304 3300025233 Ga0209437_101272 Ga0209437_1012728 269
305 3300025233 Ga0209437_102587 Ga0209437_1025875 269
306 3300025242 Ga0209258_100049 Ga0209258_100049322 269
307 3300025242 Ga0209258_100551 Ga0209258_10055129 269
308 3300025242 Ga0209258_104081 Ga0209258_1040814 269
309 3300025245 Ga0207425_1000028 Ga0207425_100002887 269
310 3300025245 Ga0207425_1028457 Ga0207425_10284571 269
311 3300025246 Ga0209646_1000393 Ga0209646_10003936 269
312 3300025246 Ga0209646_1006511 Ga0209646_10065112 269
313 3300025250 Ga0209026_1000094 Ga0209026_1000094138 269
314 3300025250 Ga0209026_1000866 Ga0209026_100086612 269
315 3300025254 Ga0209148_1000002 Ga0209148_10000021573 269
316 3300025254 Ga0209148_1000010 Ga0209148_1000010699 269
317 3300025254 Ga0209148_1005036 Ga0209148_10050362 269
318 3300025256 Ga0209759_1000761 Ga0209759_10007617 269
319 3300025256 Ga0209759_1003734 Ga0209759_10037345 269
320 3300025258 Ga0209129_1000065 Ga0209129_100006535 269
321 3300025258 Ga0209129_1010470 Ga0209129_10104703 269
322 3300025261 Ga0209233_1000009 Ga0209233_1000009472 269
323 3300025261 Ga0209233_1001164 Ga0209233_10011647 269
324 3300025261 Ga0209233_1017570 Ga0209233_10175701 269
325 3300025263 Ga0209565_1000005 Ga0209565_1000005492 269
326 3300025263 Ga0209565_1000031 Ga0209565_1000031284 269
327 3300025272 Ga0209455_1000082 Ga0209455_1000082215 269
328 3300025272 Ga0209455_1000327 Ga0209455_100032728 269
329 3300025272 Ga0209455_1016064 Ga0209455_10160641 269
330 3300025273 Ga0209673_1000011 Ga0209673_1000011147 269
331 3300025273 Ga0209673_1000484 Ga0209673_100048413 269
332 3300025273 Ga0209673_1018095 Ga0209673_10180953 269
333 3300025284 Ga0209130_1006679 Ga0209130_10066794 269
334 3300025284 Ga0209130_1021705 Ga0209130_10217052 269
335 3300025291 Ga0209675_1000004 Ga0209675_1000004492 269
336 3300025291 Ga0209675_1000015 Ga0209675_1000015383 269
337 3300025291 Ga0209675_1006730 Ga0209675_10067304 269
338 3300025292 Ga0209676_1000034 Ga0209676_100003496 269
339 3300025292 Ga0209676_1000225 Ga0209676_100022552 269
340 3300025292 Ga0209676_1000892 Ga0209676_100089215 269
341 3300025292 Ga0209676_1001193 Ga0209676_100119324 269
342 3300025294 Ga0209025_1000002 Ga0209025_1000002185 269
343 3300025294 Ga0209025_1000036 Ga0209025_1000036296 269
344 3300025294 Ga0209025_1008389 Ga0209025_10083896 269
345 3300025294 Ga0209025_1025631 Ga0209025_10256313 269
346 3300025295 Ga0209564_1000018 Ga0209564_1000018147 269
347 3300025295 Ga0209564_1000480 Ga0209564_100048016 269
348 3300025295 Ga0209564_1004657 Ga0209564_10046573 269
349 3300025297 Ga0209758_1000003 Ga0209758_1000003192 269
350 3300025297 Ga0209758_1024688 Ga0209758_10246882 269
351 3300025298 Ga0209050_1000201 Ga0209050_100020170 269
352 3300025298 Ga0209050_1000998 Ga0209050_100099814 269
353 3300025298 Ga0209050_1005741 Ga0209050_10057416 269
354 3300025299 Ga0209256_1000021 Ga0209256_100002195 269
355 3300025299 Ga0209256_1005457 Ga0209256_10054575 269
356 3300025299 Ga0209256_1010568 Ga0209256_10105684 269
357 3300025302 Ga0207426_1009262 Ga0207426_10092624 269
358 3300025303 Ga0209051_1001219 Ga0209051_100121912 269
359 3300025303 Ga0209051_1003605 Ga0209051_10036056 269
360 3300025303 Ga0209051_1007665 Ga0209051_10076654 269
361 3300025304 Ga0209257_1000133 Ga0209257_1000133113 269
362 3300025304 Ga0209257_1000208 Ga0209257_100020873 269
363 3300025304 Ga0209257_1000308 Ga0209257_100030893 269
364 3300025304 Ga0209257_1000585 Ga0209257_10005852 269
365 3300025304 Ga0209257_1002220 Ga0209257_10022201 269
366 3300025304 Ga0209257_1004172 Ga0209257_10041724 269
367 3300025321 Ga0207656_10002466 Ga0207656_100024662 269
368 3300025321 Ga0207656_10040174 Ga0207656_100401743 269
369 3300025711 Ga0207696_1000424 Ga0207696_100042415 269
370 3300025728 Ga0207655_1093954 Ga0207655_10939542 269
371 3300025735 Ga0207713_1000282 Ga0207713_100028219 269
372 3300025735 Ga0207713_1005483 Ga0207713_10054836 269
373 3300025900 Ga0207710_10009441 Ga0207710_100094414 269
374 3300025903 Ga0207680_10007823 Ga0207680_100078234 269
375 3300025904 Ga0207647_10000124 Ga0207647_1000012411 269
376 3300025904 Ga0207647_10006001 Ga0207647_100060016 269
377 3300025904 Ga0207647_10008548 Ga0207647_100085486 269
378 3300025904 Ga0207647_10020227 Ga0207647_100202273 269
379 3300025907 Ga0207645_10055926 Ga0207645_100559264 269
380 3300025911 Ga0207654_10299644 Ga0207654_102996442 269
381 3300025912 Ga0207707_10000052 Ga0207707_1000005218 269
382 3300025912 Ga0207707_10002396 Ga0207707_1000239617 269
383 3300025912 Ga0207707_10019691 Ga0207707_100196915 269
384 3300025912 Ga0207707_10082068 Ga0207707_100820682 269
385 3300025912 Ga0207707_10229832 Ga0207707_102298322 269
386 3300025912 Ga0207707_10297703 Ga0207707_102977032 269
387 3300025913 Ga0207695_10000032 Ga0207695_10000032297 269
388 3300025913 Ga0207695_10003509 Ga0207695_100035093 269
389 3300025913 Ga0207695_10005651 Ga0207695_1000565117 269
390 3300025913 Ga0207695_10017386 Ga0207695_100173866 269
391 3300025913 Ga0207695_10042408 Ga0207695_100424082 269
392 3300025913 Ga0207695_10044959 Ga0207695_100449594 269
393 3300025913 Ga0207695_10062813 Ga0207695_100628135 269
394 3300025913 Ga0207695_10064043 Ga0207695_100640435 269
395 3300025913 Ga0207695_10215903 Ga0207695_102159032 269
396 3300025914 Ga0207671_10000021 Ga0207671_10000021113 269
397 3300025914 Ga0207671_10000074 Ga0207671_1000007410 269
398 3300025914 Ga0207671_10099946 Ga0207671_100999462 269
399 3300025914 Ga0207671_10103706 Ga0207671_101037062 269
400 3300025914 Ga0207671_10215037 Ga0207671_102150373 269
401 3300025917 Ga0207660_10005646 Ga0207660_100056467 269
402 3300025917 Ga0207660_10067465 Ga0207660_100674652 269
403 3300025917 Ga0207660_10172177 Ga0207660_101721772 269
404 3300025917 Ga0207660_10227604 Ga0207660_102276043 269
405 3300025919 Ga0207657_10020970 Ga0207657_100209704 269
406 3300025920 Ga0207649_10033212 Ga0207649_100332124 269
407 3300025920 Ga0207649_10074121 Ga0207649_100741213 269
408 3300025921 Ga0207652_10002038 Ga0207652_1000203817 269
409 3300025921 Ga0207652_10126616 Ga0207652_101266162 269
410 3300025921 Ga0207652_10196091 Ga0207652_101960913 269
411 3300025921 Ga0207652_10254728 Ga0207652_102547282 269
412 3300025923 Ga0207681_10072389 Ga0207681_100723893 269
413 3300025923 Ga0207681_10114324 Ga0207681_101143242 269
414 3300025924 Ga0207694_10002009 Ga0207694_100020095 269
415 3300025924 Ga0207694_10036893 Ga0207694_100368934 269
416 3300025924 Ga0207694_10068552 Ga0207694_100685523 269
417 3300025924 Ga0207694_10069526 Ga0207694_100695263 269
418 3300025924 Ga0207694_10156600 Ga0207694_101566003 269
419 3300025924 Ga0207694_10262912 Ga0207694_102629122 269
420 3300025924 Ga0207694_10300622 Ga0207694_103006222 269
421 3300025925 Ga0207650_10005386 Ga0207650_100053864 269
422 3300025925 Ga0207650_10019958 Ga0207650_100199585 269
423 3300025926 Ga0207659_10083890 Ga0207659_100838903 269
424 3300025926 Ga0207659_10298780 Ga0207659_102987802 269
425 3300025927 Ga0207687_10235868 Ga0207687_102358682 269
426 3300025931 Ga0207644_10065136 Ga0207644_100651362 269
427 3300025932 Ga0207690_10304855 Ga0207690_103048551 269
428 3300025933 Ga0207706_10034947 Ga0207706_100349473 269
429 3300025935 Ga0207709_10000070 Ga0207709_100000704 269
430 3300025935 Ga0207709_10001467 Ga0207709_100014679 269
431 3300025935 Ga0207709_10002281 Ga0207709_100022815 269
432 3300025936 Ga0207670_10001715 Ga0207670_100017159 269
433 3300025938 Ga0207704_10008276 Ga0207704_100082765 269
434 3300025940 Ga0207691_10000184 Ga0207691_1000018460 269
435 3300025940 Ga0207691_10070446 Ga0207691_100704463 269
436 3300025941 Ga0207711_10069448 Ga0207711_100694484 269
437 3300025942 Ga0207689_10087947 Ga0207689_100879473 269
438 3300025949 Ga0207667_10000141 Ga0207667_1000014192 269
439 3300025949 Ga0207667_10001686 Ga0207667_1000168624 269
440 3300025949 Ga0207667_10017203 Ga0207667_100172033 269
441 3300025949 Ga0207667_10092175 Ga0207667_100921754 269
442 3300025949 Ga0207667_10252878 Ga0207667_102528782 269
443 3300025960 Ga0207651_10029033 Ga0207651_100290331 269
444 3300025961 Ga0207712_10021091 Ga0207712_100210914 269
445 3300025972 Ga0207668_10019560 Ga0207668_100195604 269
446 3300025972 Ga0207668_10211352 Ga0207668_102113522 269
447 3300025981 Ga0207640_10012031 Ga0207640_100120314 269
448 3300025981 Ga0207640_10078236 Ga0207640_100782362 269
449 3300025986 Ga0207658_10416735 Ga0207658_104167352 269
450 3300025986 Ga0207658_10650709 Ga0207658_106507092 269
451 3300026023 Ga0207677_10191670 Ga0207677_101916702 269
452 3300026035 Ga0207703_10001626 Ga0207703_100016269 269
453 3300026035 Ga0207703_10019515 Ga0207703_100195152 269
454 3300026041 Ga0207639_10000465 Ga0207639_1000046511 269
455 3300026067 Ga0207678_10001930 Ga0207678_1000193011 269
456 3300026067 Ga0207678_10078089 Ga0207678_100780893 269
457 3300026067 Ga0207678_10122151 Ga0207678_101221512 269
458 3300026078 Ga0207702_10051044 Ga0207702_100510443 269
459 3300026078 Ga0207702_10171911 Ga0207702_101719112 269
460 3300026089 Ga0207648_10028187 Ga0207648_100281875 269
461 3300026095 Ga0207676_10270576 Ga0207676_102705762 269
462 3300026116 Ga0207674_10000168 Ga0207674_1000016877 269
463 3300026116 Ga0207674_10442052 Ga0207674_104420522 269
464 3300026142 Ga0207698_10002152 Ga0207698_100021521 269
465 3300026142 Ga0207698_10125802 Ga0207698_101258022 269
466 3300026142 Ga0207698_10127115 Ga0207698_101271152 269
467 3300027111 Ga0209281_1000029 Ga0209281_1000029229 269
468 3300027252 Ga0209973_1009782 Ga0209973_10097821 269
469 3300027312 Ga0209371_1000004 Ga0209371_1000004732 269
470 3300027312 Ga0209371_1000044 Ga0209371_1000044170 269
471 3300027360 Ga0209969_1004401 Ga0209969_10044012 269
472 3300027364 Ga0209967_1009511 Ga0209967_10095112 269
473 3300027378 Ga0209981_1007700 Ga0209981_10077002 269
474 3300027424 Ga0209984_1004997 Ga0209984_10049972 269
475 3300027471 Ga0209995_1005784 Ga0209995_10057842 269
476 3300027543 Ga0209999_1000972 Ga0209999_10009726 269
477 3300027552 Ga0209982_1000533 Ga0209982_10005332 269
478 3300027614 Ga0209970_1000890 Ga0209970_10008902 269
479 3300027665 Ga0209983_1000051 Ga0209983_100005113 269
480 3300027682 Ga0209971_1001064 Ga0209971_10010644 269
481 3300027876 Ga0209974_10028918 Ga0209974_100289182 269
482 3300028379 Ga0268266_10000013 Ga0268266_10000013426 269
483 3300028379 Ga0268266_10000851 Ga0268266_100008517 269
484 3300028379 Ga0268266_10162328 Ga0268266_101623283 269
485 3300028380 Ga0268265_10174602 Ga0268265_101746023 269
486 3300028380 Ga0268265_10243704 Ga0268265_102437042 269
487 3300028381 Ga0268264_10430803 Ga0268264_104308032 269
488 3300028794 Ga0307515_10047768 Ga0307515_100477687 269
489 3300030500 Ga0268256_1000005 Ga0268256_1000005315 269
490 3300030500 Ga0268256_1000046 Ga0268256_1000046170 269
491 3300030733 Ga0314311_1201706 Ga0314311_12017062 269
492 3300030735 Ga0316178_1134858 Ga0316178_11348582 269
493 3300031456 Ga0307513_10066968 Ga0307513_100669683 269
494 3300031456 Ga0307513_10100996 Ga0307513_101009963 269
495 3300031548 Ga0307408_100170665 Ga0307408_1001706652 269
496 3300031824 Ga0307413_10020958 Ga0307413_100209584 269
497 3300031824 Ga0307413_10089992 Ga0307413_100899923 269
498 3300031824 Ga0307413_10202751 Ga0307413_102027512 269
499 3300031901 Ga0307406_10036900 Ga0307406_100369002 269
500 3300031901 Ga0307406_10350039 Ga0307406_103500391 269
501 3300031903 Ga0307407_10112034 Ga0307407_101120342 269
502 3300031911 Ga0307412_10000409 Ga0307412_1000040914 269
503 3300031911 Ga0307412_10069421 Ga0307412_100694213 269
504 3300031995 Ga0307409_100152856 Ga0307409_1001528563 269
505 3300032002 Ga0307416_100593481 Ga0307416_1005934812 269
506 3300032004 Ga0307414_10000329 Ga0307414_100003296 269
507 3300032004 Ga0307414_10018957 Ga0307414_100189573 269
508 3300032004 Ga0307414_10041115 Ga0307414_100411153 269
509 3300032004 Ga0307414_10041175 Ga0307414_100411754 269
510 3300032004 Ga0307414_10117456 Ga0307414_101174563 269
511 3300032004 Ga0307414_10123146 Ga0307414_101231462 269
512 3300032004 Ga0307414_10182905 Ga0307414_101829052 269
513 3300032004 Ga0307414_10301714 Ga0307414_103017142 269
514 3300032005 Ga0307411_10170988 Ga0307411_101709882 269
515 3300035691 Ga0373931_0295856 Ga0373931_0295856_176_985 269
516 3300037312 Ga0395899_0092009 Ga0395899_0092009_1164_1979 269
517 3300037418 Ga0395900_0000092 Ga0395900_0000092_160000_160812 269
518 3300037418 Ga0395900_0002408 Ga0395900_0002408_1009_1869 269
519 3300037418 Ga0395900_0020686 Ga0395900_0020686_5315_6130 269
520 3300037418 Ga0395900_0164418 Ga0395900_0164418_1416_2225 269
521 3300037466 Ga0395898_0004660 Ga0395898_0004660_2421_3281 269
522 3300037466 Ga0395898_0018342 Ga0395898_0018342_3557_4369 269
523 3300037466 Ga0395898_0112378 Ga0395898_0112378_1781_2590 269
524 3300037466 Ga0395898_0177780 Ga0395898_0177780_783_1592 269
525 3300037471 Ga0395905_0006744 Ga0395905_0006744_2221_3030 269
526 3300037471 Ga0395905_0036234 Ga0395905_0036234_1677_2486 269
527 3300038443 Ga0395901_0061309 Ga0395901_0061309_2948_3763 269
528 3300038443 Ga0395901_0298803 Ga0395901_0298803_385_1200 269
529 3300038443 Ga0395901_0338873 Ga0395901_0338873_689_1498 269
530 3300038705 Ga0237819_00665 Ga0237819_00665_321_1130 269
531 3300039145 Ga0237816_00195 Ga0237816_00195_371_1180 269
532 3300039447 Ga0436361_1057408 Ga0436361_1057408_6697_7506 269
533 3300039447 Ga0436361_1092360 Ga0436361_1092360_4692_5501 269
534 3300041404 Ga0439436_0000157 Ga0439436_0000157_6117_6929 269
535 3300041407 Ga0439447_000418 Ga0439447_000418_3842_4693 269
536 3300041413 Ga0439465_0000266 Ga0439465_0000266_4095_4907 269
537 3300041413 Ga0439465_0003036 Ga0439465_0003036_4168_4977 269
538 3300041451 Ga0451791_0175559 Ga0451791_0175559_1642_2451 269
539 3300041451 Ga0451791_0536344 Ga0451791_0536344_2820_3629 269
540 3300041453 Ga0451797_0545361 Ga0451797_0545361_442_1302 269
541 3300041453 Ga0451797_0951842 Ga0451797_0951842_331_1140 269
542 3300041462 Ga0451806_039266 Ga0451806_039266_396_1205 269
543 3300041463 Ga0451804_0087857 Ga0451804_0087857_318_1127 269
544 3300041463 Ga0451804_0210285 Ga0451804_0210285_65_877 269
545 3300041486 Ga0451807_0979098 Ga0451807_0979098_7094_7903 269
546 3300041498 Ga0451841_0905478 Ga0451841_0905478_16_825 269
547 3300041509 Ga0451843_0039220 Ga0451843_0039220_141_950 269
548 3300041512 Ga0451853_3664325 Ga0451853_3664325_391_1200 269
549 3300042006 Ga0439432_058689 Ga0439432_058689_286_1095 269
550 3300042007 Ga0439449_0000143 Ga0439449_0000143_10885_11694 269
551 3300042007 Ga0439449_0003099 Ga0439449_0003099_3184_3993 269
552 3300042007 Ga0439449_0018158 Ga0439449_0018158_1592_2401 269
553 3300042184 Ga0450908_000031 Ga0450908_000031_30193_31005 269
554 3300042435 Ga0439434_0016505 Ga0439434_0016505_386_1195 269
555 3300042876 Ga0451577_0001339 Ga0451577_0001339_21193_22008 269
556 3300042876 Ga0451577_0005403 Ga0451577_0005403_8836_9645 269
557 3300044656 Ga0466969_0000600 Ga0466969_0000600_4083_4895 269
558 3300044672 Ga0466982_0000004 Ga0466982_0000004_375581_376396 269
559 3300044672 Ga0466982_0000036 Ga0466982_0000036_42004_42816 269
560 3300044683 Ga0466965_0038379 Ga0466965_0038379_294_1109 269
561 3300044684 Ga0466966_0003574 Ga0466966_0003574_5144_5959 269
562 3300044684 Ga0466966_0005847 Ga0466966_0005847_4011_4826 269
563 3300044684 Ga0466966_0043432 Ga0466966_0043432_326_1138 269
564 3300044693 Ga0466961_0033609 Ga0466961_0033609_1803_2618 269
565 3300044693 Ga0466961_0085395 Ga0466961_0085395_448_1263 269
566 3300044712 Ga0453684_0000298 Ga0453684_0000298_76977_77786 269
567 3300044719 Ga0466971_0019109 Ga0466971_0019109_471_1286 269
568 3300044735 Ga0466968_0004202 Ga0466968_0004202_1587_2399 269
569 3300044735 Ga0466968_0018973 Ga0466968_0018973_153_983 269
570 3300044735 Ga0466968_0054690 Ga0466968_0054690_296_1111 269
571 3300044765 Ga0466970_0008080 Ga0466970_0008080_897_1712 269
572 3300044842 Ga0466957_0087490 Ga0466957_0087490_324_1136 269
573 3300044901 Ga0466960_0007681 Ga0466960_0007681_1014_1829 269
574 3300045049 Ga0466959_0010364 Ga0466959_0010364_3315_4127 269
575 3300045051 Ga0451576_0000033 Ga0451576_0000033_315346_316155 269
576 3300046452 Ga0495617_000083 Ga0495617_000083_62806_63618 269
577 3300046452 Ga0495617_001456 Ga0495617_001456_5226_6038 269
578 3300046457 Ga0495590_0074818 Ga0495590_0074818_206_1018 269
579 3300046460 Ga0495638_0000007 Ga0495638_0000007_492211_493026 269
580 3300046460 Ga0495638_0000340 Ga0495638_0000340_5889_6701 269
581 3300046460 Ga0495638_0002252 Ga0495638_0002252_2618_3427 269
582 3300046460 Ga0495638_0030059 Ga0495638_0030059_2331_3140 269
583 3300046460 Ga0495638_0248113 Ga0495638_0248113_134_949 269
584 3300046471 Ga0495650_0000078 Ga0495650_0000078_171941_172756 269
585 3300046492 Ga0495585_0000887 Ga0495585_0000887_5866_6678 269
586 3300046501 Ga0495607_0000247 Ga0495607_0000247_31865_32677 269
587 3300046501 Ga0495607_0006220 Ga0495607_0006220_1655_2467 269
588 3300046501 Ga0495607_0028180 Ga0495607_0028180_1253_2065 269
589 3300046507 Ga0495606_0000242 Ga0495606_0000242_63566_64381 269
590 3300046507 Ga0495606_0002571 Ga0495606_0002571_18579_19391 269
591 3300046507 Ga0495606_0015919 Ga0495606_0015919_2782_3591 269
592 3300046507 Ga0495606_0032337 Ga0495606_0032337_2480_3292 269
593 3300046512 Ga0495610_0002284 Ga0495610_0002284_14961_15773 269
594 3300046512 Ga0495610_0011396 Ga0495610_0011396_4577_5389 269
595 3300046513 Ga0495616_0029914 Ga0495616_0029914_943_1755 269
596 3300046515 Ga0495620_0000791 Ga0495620_0000791_5091_5903 269
597 3300046515 Ga0495620_0006935 Ga0495620_0006935_275_1087 269
598 3300046518 Ga0495631_0000153 Ga0495631_0000153_20402_21214 269
599 3300046518 Ga0495631_0000603 Ga0495631_0000603_3794_4606 269
600 3300046519 Ga0495632_0000008 Ga0495632_0000008_267830_268642 269
601 3300046520 Ga0495637_0011054 Ga0495637_0011054_306_1118 269
602 3300046524 Ga0495648_0006713 Ga0495648_0006713_5340_6152 269
603 3300046525 Ga0495663_0000749 Ga0495663_0000749_1881_2690 269
604 3300046525 Ga0495663_0012113 Ga0495663_0012113_492_1301 269
605 3300046537 Ga0495598_0001238 Ga0495598_0001238_923_1732 269
606 3300046537 Ga0495598_0039833 Ga0495598_0039833_37_846 269
607 3300046538 Ga0495609_0004838 Ga0495609_0004838_713_1525 269
608 3300046539 Ga0495621_0000225 Ga0495621_0000225_11091_11900 269
609 3300046557 Ga0495622_0006516 Ga0495622_0006516_4289_5104 269
610 3300046558 Ga0495633_0051344 Ga0495633_0051344_122_931 269
611 3300046615 Ga0495656_0002380 Ga0495656_0002380_690_1499 269
612 3300046616 Ga0495668_0003638 Ga0495668_0003638_468_1280 269
613 3300046616 Ga0495668_0018796 Ga0495668_0018796_2809_3618 269
614 3300046648 Ga0495611_0000029 Ga0495611_0000029_52248_53060 269
615 3300046648 Ga0495611_0000076 Ga0495611_0000076_26465_27277 269
616 3300046660 Ga0495625_0000260 Ga0495625_0000260_28381_29193 269
617 3300046660 Ga0495625_0343311 Ga0495625_0343311_69_881 269
618 3300046665 Ga0495661_0003624 Ga0495661_0003624_1308_2120 269
619 3300046691 Ga0495670_0000523 Ga0495670_0000523_1298_2110 269
620 3300046691 Ga0495670_0006569 Ga0495670_0006569_2443_3255 269
621 3300046691 Ga0495670_0048214 Ga0495670_0048214_625_1434 269
622 3300046692 Ga0495671_0000545 Ga0495671_0000545_11511_12323 269
623 3300046694 Ga0495649_0005342 Ga0495649_0005342_4689_5504 269
624 3300046794 Ga0495589_0000173 Ga0495589_0000173_4951_5763 269
625 3300046810 Ga0495660_0000235 Ga0495660_0000235_47978_48790 269
626 3300046810 Ga0495660_0000918 Ga0495660_0000918_1318_2130 269
627 3300047318 Ga0495636_0004741 Ga0495636_0004741_2259_3068 269
628 3300047318 Ga0495636_0025936 Ga0495636_0025936_704_1513 269
629 3300047320 Ga0495672_0000230 Ga0495672_0000230_18050_18859 269
630 3300047443 Ga0495687_047033 Ga0495687_047033_68_880 269
631 3300047446 Ga0495679_000091 Ga0495679_000091_29288_30100 269
632 3300047469 Ga0495673_0000175 Ga0495673_0000175_26884_27696 269
633 3300047469 Ga0495673_0000392 Ga0495673_0000392_1205_2017 269
634 3300047469 Ga0495673_0000548 Ga0495673_0000548_11538_12350 269
635 3300047472 Ga0495686_0001098 Ga0495686_0001098_31323_32135 269
636 3300047472 Ga0495686_0101511 Ga0495686_0101511_854_1666 269
637 3300048903 Ga0496100_0003750 Ga0496100_0003750_2194_3006 269
638 3300048903 Ga0496100_0335523 Ga0496100_0335523_235_1047 269
639 3300048904 Ga0496101_0001114 Ga0496101_0001114_14519_15331 269
640 3300048905 Ga0496102_0079547 Ga0496102_0079547_278_1090 269
641 3300048905 Ga0496102_0172043 Ga0496102_0172043_955_1764 269
642 3300048906 Ga0496103_0086893 Ga0496103_0086893_689_1498 269
643 3300048911 Ga0496108_0028586 Ga0496108_0028586_2771_3580 269
644 3300048914 Ga0496111_0032428 Ga0496111_0032428_2543_3352 269
645 3300048916 Ga0496113_0005362 Ga0496113_0005362_5939_6754 269
646 3300048917 Ga0496114_0083210 Ga0496114_0083210_287_1102 269
647 3300048918 Ga0496115_0000158 Ga0496115_0000158_54369_55184 269
648 3300048919 Ga0496116_0020070 Ga0496116_0020070_4083_4895 269
649 3300048919 Ga0496116_0091412 Ga0496116_0091412_35_844 269
650 3300048920 Ga0496117_0001949 Ga0496117_0001949_21172_21981 269
651 3300048920 Ga0496117_0038210 Ga0496117_0038210_1318_2127 269
652 3300048921 Ga0496118_0001826 Ga0496118_0001826_231_1043 269
653 3300048921 Ga0496118_0002205 Ga0496118_0002205_5517_6326 269
654 3300048921 Ga0496118_0002535 Ga0496118_0002535_19104_19913 269
655 3300048921 Ga0496118_0012510 Ga0496118_0012510_1662_2474 269
656 3300048922 Ga0496119_0000979 Ga0496119_0000979_19233_20042 269
657 3300048924 Ga0496121_0000290 Ga0496121_0000290_60490_61302 269
658 3300048924 Ga0496121_0003326 Ga0496121_0003326_5309_6160 269
659 3300048924 Ga0496121_0005560 Ga0496121_0005560_15230_16042 269
660 3300048924 Ga0496121_0022928 Ga0496121_0022928_4901_5716 269
661 3300048924 Ga0496121_0053328 Ga0496121_0053328_2497_3309 269
662 3300048924 Ga0496121_0055485 Ga0496121_0055485_1176_1985 269
663 3300048924 Ga0496121_0125081 Ga0496121_0125081_1106_1918 269
664 3300048925 Ga0496122_0015375 Ga0496122_0015375_773_1585 269
665 3300048925 Ga0496122_0036592 Ga0496122_0036592_25_837 269
666 3300048926 Ga0496123_0009952 Ga0496123_0009952_2451_3263 269
667 3300048926 Ga0496123_0024992 Ga0496123_0024992_751_1563 269
668 3300048926 Ga0496123_0034574 Ga0496123_0034574_845_1654 269
669 3300048926 Ga0496123_0042350 Ga0496123_0042350_2314_3129 269
670 3300048926 Ga0496123_0151785 Ga0496123_0151785_207_1016 269
671 3300048927 Ga0496124_0004391 Ga0496124_0004391_3848_4660 269
672 3300048927 Ga0496124_0005917 Ga0496124_0005917_3850_4662 269
673 3300048927 Ga0496124_0019963 Ga0496124_0019963_4119_4928 269
674 3300048927 Ga0496124_0024627 Ga0496124_0024627_329_1138 269
675 3300048927 Ga0496124_0171644 Ga0496124_0171644_542_1351 269
676 3300048927 Ga0496124_0441285 Ga0496124_0441285_29_838 269
677 3300048928 Ga0496125_0000517 Ga0496125_0000517_10441_11256 269
678 3300048928 Ga0496125_0015924 Ga0496125_0015924_5442_6251 269
679 3300048928 Ga0496125_0032443 Ga0496125_0032443_3640_4449 269
680 3300048928 Ga0496125_0117126 Ga0496125_0117126_1007_1819 269
681 3300048929 Ga0496126_0086921 Ga0496126_0086921_1128_1940 269
682 3300048929 Ga0496126_0121963 Ga0496126_0121963_1053_1868 269
683 3300048929 Ga0496126_0195718 Ga0496126_0195718_49_858 269
684 3300048929 Ga0496126_0457308 Ga0496126_0457308_184_999 269
685 3300049127 Ga0501306_005006 Ga0501306_005006_506_1315 269
686 3300049128 Ga0501308_004437 Ga0501308_004437_167_976 269
687 3300049460 Ga0495682_0021799 Ga0495682_0021799_211_1023 269
688 3300049460 Ga0495682_0024202 Ga0495682_0024202_1242_2054 269
689 3300049513 Ga0501290_000996 Ga0501290_000996_2944_3753 269
690 3300049539 Ga0501323_015746 Ga0501323_015746_26_835 269
691 3300049569 Ga0501032_0110794 Ga0501032_0110794_556_1371 269
692 3300049570 Ga0501033_0001185 Ga0501033_0001185_18948_19763 269
693 3300049571 Ga0501034_0000420 Ga0501034_0000420_10748_11557 269
694 3300049571 Ga0501034_0009706 Ga0501034_0009706_7944_8753 269
695 3300049571 Ga0501034_0219092 Ga0501034_0219092_873_1688 269
696 3300049572 Ga0501036_0031485 Ga0501036_0031485_15_830 269
697 3300049572 Ga0501036_0161633 Ga0501036_0161633_226_1086 269
698 3300049573 Ga0501037_0128953 Ga0501037_0128953_222_1037 269
699 3300049574 Ga0501038_0140096 Ga0501038_0140096_601_1416 269
700 3300049578 Ga0501042_0229098 Ga0501042_0229098_371_1186 269
701 3300049579 Ga0501043_0007657 Ga0501043_0007657_2704_3513 269
702 3300049581 Ga0501047_0030758 Ga0501047_0030758_2646_3506 269
703 3300049582 Ga0501048_0432001 Ga0501048_0432001_98_913 269
704 3300049592 Ga0501076_0427275 Ga0501076_0427275_136_1038 269
705 3300049660 Ga0501216_013397 Ga0501216_013397_278_1087 269
706 3300049673 Ga0501240_003223 Ga0501240_003223_326_1135 269
707 3300049763 Ga0501266_010067 Ga0501266_010067_143_952 269
708 3300049765 Ga0501268_010600 Ga0501268_010600_312_1121 269
709 3300049823 Ga0501044_0164906 Ga0501044_0164906_556_1416 269
710 3300049823 Ga0501044_0448216 Ga0501044_0448216_99_914 269
711 3300049823 Ga0501044_0448876 Ga0501044_0448876_46_861 269
712 3300049824 Ga0501045_0137649 Ga0501045_0137649_335_1150 269
713 3300049824 Ga0501045_0146315 Ga0501045_0146315_531_1340 269
714 3300050491 nmdc:mga00v17_38711_c1 nmdc:mga00v17_38711_c1_1220_2029 269
715 3300050511 nmdc:mga08y16_244865_c1 nmdc:mga08y16_244865_c1_685_1632 269
716 3300053087 Ga0500643_000012 Ga0500643_000012_363681_364493 269
717 3300053088 Ga0500644_0046847 Ga0500644_0046847_591_1403 269
718 3300053092 Ga0500583_0023387 Ga0500583_0023387_1361_2173 269
719 3300053096 Ga0500641_0049052 Ga0500641_0049052_463_1275 269
720 3300053147 Ga0500589_040476 Ga0500589_040476_194_1006 269
721 3300053153 Ga0500616_0000062 Ga0500616_0000062_70253_71065 269
722 3300053156 Ga0500622_0001420 Ga0500622_0001420_6898_7710 269
723 3300053156 Ga0500622_0009404 Ga0500622_0009404_720_1532 269
724 3300053178 Ga0500637_0192675 Ga0500637_0192675_298_1110 269
725 3300053730 Ga0500645_000820 Ga0500645_000820_12371_13183 269
726 3300059504 Ga0587082_014096 Ga0587082_014096_215_1030 269
727 3300061719 Ga0466962_0001511 Ga0466962_0001511_3573_4388 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02374

ArsA_ATPase

Anion-transporting ATPase

3

46

0.92

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

5

226

0.9

PF13614

AAA_31

AAA domain

2

168

0.82

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

1

244

0.77

PF09140

MipZ

ATPase MipZ

3

169

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q9l-assembly1.cif.gz_A the structure of the dimeric e.coli mind-atp complex 0.9834 2 257
3r9i-assembly2.cif.gz_C 2.6a resolution structure of mind complexed with mine (12-31) peptide 0.9817 2 257
3r9i-assembly2.cif.gz_C 2.6a resolution structure of mind complexed with mine (12-31) peptide 0.9778 2 257
3r9j-assembly1.cif.gz_B-1 4.3a resolution structure of a mind-mine(i24n) protein complex 0.9774 2 257
3r9j-assembly1.cif.gz_A-1 4.3a resolution structure of a mind-mine(i24n) protein complex 0.9761 2 257
ID Description Score Start End Superfamily
3r9iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9817 2 257 3.40.50.300
3r9iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9778 2 257 3.40.50.300
4v02A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9336 2 257 3.40.50.300
4v02A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9299 2 257 3.40.50.300
af_Q57633_4_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8983 4 244 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2M7WVW0-F1-model_v4 Septum site-determining protein MinD (Cell division inhibitor MinD) 0.9905 1 248 GO:0000917
GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782
AF-A0A3C0X9V9-F1-model_v4 deleted 0.9875 142 269
AF-A0A4U9HJR4-F1-model_v4 Cell division inhibitor MinD 0.9867 1 170 GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782
AF-A0A7C2RRJ6-F1-model_v4 Septum site-determining protein MinD (Cell division inhibitor MinD) 0.9865 1 238 GO:0000917
GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782
AF-A0A1W9SN23-F1-model_v4 Septum site-determining protein MinD 0.9864 1 198 GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782

Feature Viewer

pLDDT pTM Quality
92.91 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map