F477255

General Info

Members Datasets Scaffolds Average Seq Length
719 336 691 335

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_095319|Ga0400483_095319_25782_26927
Length 381
Sequence MSWGFPCLIIVISVRIAYRTIFLMSQKMVFAIVWVRRCIIRAQSIQKEVFMSQWYLSYDGNPLGPFDYAQAVAQTRKNPNGYAWREGFAEWLPIGQISDLAPLEKPLPQAPPAARALVSDEIDFRIIGTEMQFVEVELDPGESAVAEAGAMMYKDAGVVMQTVFGDGSASTGGGFMDKLLGAGKRLLTGESLFMTVFSHTGDGKARVAFGAPYPGNIIPVHLNKFGGMLICQKDSFLCAAKGVAMGIYFQRKILTGLFGGEGFIMQKLEGDGLVFLHAGGTVADRTLSAGEVLHVDTGCIVAMEPSVQFEIEKAGGIKSALFGGEGLFFAKLLGPGKVWLQSLPFSRLAGRMLQAAPQRGGSKGEGSVLGALGGLLDGDNR

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
5 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
6 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
7 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
8 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
9 2818991457 Xanthomonas translucens 569 Isolate Unclassified
10 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
11 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
12 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
13 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
14 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
15 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
16 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
17 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
18 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
19 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
20 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
21 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
22 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
23 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
24 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
25 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
26 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
27 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
28 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
29 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
30 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
31 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
32 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
33 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
39 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
63 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
70 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
189 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
192 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
193 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
194 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
208 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
209 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
210 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
211 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
212 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
213 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
221 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
222 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
223 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
224 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
225 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
226 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
227 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
228 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
229 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
230 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
231 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
232 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
233 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
234 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
235 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
236 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
237 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
238 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
239 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
240 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
241 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
242 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
245 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
248 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
253 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
256 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
257 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
258 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
259 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
260 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
261 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
264 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
265 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
266 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
267 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
268 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
272 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
273 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
274 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
275 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
276 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
277 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
278 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
316 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
317 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
320 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
321 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
327 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
333 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
334 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
335 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.11
Metatranscriptomes 0
Isolates 3.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 0.14
Rhizoplane 0.56
Rhizosphere 85.81
Stem 0
Stem Tuber 0
Unclassified 10.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10025197 3300002067 Bacteria 1796
2 JGI25152J39213_1000004 3300002773 Bacteria 191383
3 JGI25150J39212_1000491 3300002774 Bacteria 16611
4 JGI25151J46595_10000010 3300003187 Bacteria 277507
5 JGI25406J46586_10000294 3300003203 Bacteria 22402
6 JGI25406J46586_10000986 3300003203 Bacteria 13371
7 JGI25406J46586_10047026 3300003203 Bacteria 1473
8 JGI25153J46596_10000013 3300003215 Bacteria 303690
9 rootH2_10006882 3300003320 Bacteria 14761
10 rootH2_10081097 3300003320 Bacteria 7715
11 Ga0058692_1000005 3300003856 Bacteria 398815
12 Ga0065704_10071755 3300005289 Bacteria 10011
13 Ga0065712_10002276 3300005290 Bacteria 8803
14 Ga0065712_10017397 3300005290 Bacteria 1884
15 Ga0065715_10002535 3300005293 Bacteria 6357
16 Ga0070658_10129513 3300005327 Bacteria 2102
17 Ga0070676_10002232 3300005328 Bacteria 9885
18 Ga0070676_10036458 3300005328 Bacteria 2833
19 Ga0070690_100010170 3300005330 Bacteria 5465
20 Ga0070690_100021642 3300005330 Bacteria 3927
21 Ga0070670_100000644 3300005331 Bacteria 27141
22 Ga0070670_100001817 3300005331 Bacteria 17382
23 Ga0070670_100008954 3300005331 Bacteria 8551
24 Ga0070670_100026149 3300005331 Bacteria 5024
25 Ga0070670_100398406 3300005331 Bacteria 1215
26 Ga0070677_10016106 3300005333 Bacteria 2658
27 Ga0068869_100002035 3300005334 Bacteria 12146
28 Ga0068869_100003931 3300005334 Bacteria 9175
29 Ga0068869_100150836 3300005334 Bacteria 1803
30 Ga0070666_10049270 3300005335 Bacteria 2830
31 Ga0070680_100193619 3300005336 Bacteria 1714
32 Ga0070682_100039242 3300005337 Bacteria 2909
33 Ga0068868_100025104 3300005338 Bacteria 4527
34 Ga0068868_100119137 3300005338 Bacteria 2152
35 Ga0070689_100084992 3300005340 Bacteria 2487
36 Ga0070689_100212372 3300005340 Bacteria 1584
37 Ga0070687_100008498 3300005343 Bacteria 4355
38 Ga0070661_100199438 3300005344 Bacteria 1528
39 Ga0070668_100003349 3300005347 Bacteria 11818
40 Ga0070668_100077132 3300005347 Bacteria 2605
41 Ga0070669_100005634 3300005353 Bacteria 9043
42 Ga0070669_100029791 3300005353 Bacteria 3937
43 Ga0070669_100157854 3300005353 Bacteria 1760
44 Ga0070669_100243530 3300005353 Bacteria 1429
45 Ga0070675_100000344 3300005354 Bacteria 31386
46 Ga0070675_100002958 3300005354 Bacteria 12818
47 Ga0070675_100016192 3300005354 Bacteria 5913
48 Ga0070675_100018904 3300005354 Bacteria 5488
49 Ga0070675_100038145 3300005354 Bacteria 3915
50 Ga0070675_100054701 3300005354 Bacteria 3284
51 Ga0070675_100193098 3300005354 Bacteria 1765
52 Ga0070671_100064039 3300005355 Bacteria 3062
53 Ga0070671_100268597 3300005355 Bacteria 1450
54 Ga0070674_100000032 3300005356 Bacteria 64311
55 Ga0070674_100162426 3300005356 Unclassified 1696
56 Ga0070673_100004841 3300005364 Bacteria 8564
57 Ga0070673_100009483 3300005364 Bacteria 6534
58 Ga0070673_100175811 3300005364 Bacteria 1830
59 Ga0070688_100010886 3300005365 Bacteria 5034
60 Ga0070688_100023939 3300005365 Bacteria 3597
61 Ga0070688_100159250 3300005365 Bacteria 1550
62 Ga0070688_100162898 3300005365 Bacteria 1533
63 Ga0070659_100064651 3300005366 Bacteria 2896
64 Ga0070667_100008279 3300005367 Bacteria 8618
65 Ga0070667_100302339 3300005367 Bacteria 1441
66 Ga0070701_10063569 3300005438 Bacteria 1953
67 Ga0070701_10106746 3300005438 Bacteria 1559
68 Ga0070705_100153615 3300005440 Bacteria 1530
69 Ga0070700_100027345 3300005441 Bacteria 3381
70 Ga0070700_100068639 3300005441 Bacteria 2255
71 Ga0070700_100073272 3300005441 Bacteria 2192
72 Ga0070663_100044112 3300005455 Bacteria 3142
73 Ga0070678_100040275 3300005456 Bacteria 3305
74 Ga0070678_100081651 3300005456 Bacteria 2451
75 Ga0070678_100090289 3300005456 Bacteria 2347
76 Ga0070678_100205211 3300005456 Bacteria 1629
77 Ga0070678_100223793 3300005456 Bacteria 1565
78 Ga0070678_100248042 3300005456 Bacteria 1492
79 Ga0070662_100123610 3300005457 Bacteria 1986
80 Ga0070662_100214688 3300005457 Bacteria 1532
81 Ga0068867_100000578 3300005459 Bacteria 24270
82 Ga0068867_100051430 3300005459 Bacteria 3039
83 Ga0068867_100094451 3300005459 Bacteria 2274
84 Ga0070685_10009160 3300005466 Bacteria 5109
85 Ga0070685_10009810 3300005466 Bacteria 4965
86 Ga0070685_10304684 3300005466 Bacteria 1075
87 Ga0070706_100027284 3300005467 Bacteria 5255
88 Ga0070698_100002958 3300005471 Bacteria 18692
89 Ga0070698_100043831 3300005471 Bacteria 4585
90 Ga0070698_100354640 3300005471 Bacteria 1399
91 Ga0070699_100053104 3300005518 Bacteria 3508
92 Ga0070699_100237449 3300005518 Bacteria 1626
93 Ga0068853_100003732 3300005539 Bacteria 11684
94 Ga0068853_100225609 3300005539 Bacteria 1712
95 Ga0070672_100009427 3300005543 Bacteria 6728
96 Ga0070672_100015081 3300005543 Bacteria 5493
97 Ga0070672_100068226 3300005543 Bacteria 2820
98 Ga0070672_100083505 3300005543 Bacteria 2563
99 Ga0070672_100104221 3300005543 Bacteria 2304
100 Ga0070672_100188067 3300005543 Bacteria 1723
101 Ga0070686_100013664 3300005544 Bacteria 4656
102 Ga0070686_100167420 3300005544 Bacteria 1552
103 Ga0070695_100005599 3300005545 Bacteria 7398
104 Ga0070696_100101253 3300005546 Bacteria 2064
105 Ga0070665_100000417 3300005548 Bacteria 62091
106 Ga0070665_100093849 3300005548 Bacteria 3006
107 Ga0070665_100132700 3300005548 Bacteria 2492
108 Ga0070704_100074238 3300005549 Bacteria 2480
109 Ga0070704_100177471 3300005549 Bacteria 1700
110 Ga0068855_100294240 3300005563 Bacteria 1799
111 Ga0070664_100005128 3300005564 Bacteria 10517
112 Ga0070664_100040079 3300005564 Bacteria 3948
113 Ga0070664_100044735 3300005564 Bacteria 3738
114 Ga0070664_100078015 3300005564 Bacteria 2849
115 Ga0068854_100229420 3300005578 Bacteria 1473
116 Ga0068852_100409083 3300005616 Bacteria 1336
117 Ga0068859_100006708 3300005617 Bacteria 11694
118 Ga0068859_100078804 3300005617 Bacteria 3335
119 Ga0068859_100123928 3300005617 Bacteria 2652
120 Ga0068864_100027300 3300005618 Bacteria 4820
121 Ga0068864_100100025 3300005618 Bacteria 2570
122 Ga0068864_100138443 3300005618 Bacteria 2194
123 Ga0068864_100326655 3300005618 Bacteria 1442
124 Ga0068866_10056893 3300005718 Bacteria 2013
125 Ga0068861_100064991 3300005719 Bacteria 2808
126 Ga0068870_10015656 3300005840 Bacteria 3604
127 Ga0068870_10016802 3300005840 Bacteria 3505
128 Ga0068863_100016001 3300005841 Bacteria 7193
129 Ga0068863_100441691 3300005841 Bacteria 1276
130 Ga0068858_100023552 3300005842 Bacteria 5735
131 Ga0068858_100077956 3300005842 Bacteria 3079
132 Ga0068858_100324155 3300005842 Bacteria 1473
133 Ga0068860_100057807 3300005843 Bacteria 3687
134 Ga0068860_100108586 3300005843 Bacteria 2652
135 Ga0068862_100031342 3300005844 Bacteria 4487
136 Ga0081538_10050621 3300005981 Bacteria 2505
137 Ga0081539_10000013 3300005985 Bacteria 432395
138 Ga0081539_10000164 3300005985 Bacteria 154639
139 Ga0081539_10000750 3300005985 Bacteria 64517
140 Ga0081539_10038985 3300005985 Bacteria 2809
141 Ga0081539_10046258 3300005985 Bacteria 2495
142 Ga0075368_10070091 3300006042 Bacteria 1415
143 Ga0075364_10000276 3300006051 Bacteria 25091
144 Ga0075364_10158675 3300006051 Bacteria 1526
145 Ga0075366_10071524 3300006195 Bacteria 2066
146 Ga0097621_100117885 3300006237 Bacteria 2250
147 Ga0068871_100231017 3300006358 Bacteria 1605
148 Ga0068871_100334160 3300006358 Bacteria 1337
149 Ga0075428_100000166 3300006844 Bacteria 60871
150 Ga0075428_100015404 3300006844 Bacteria 8476
151 Ga0075428_100027849 3300006844 Bacteria 6252
152 Ga0075428_100083995 3300006844 Bacteria 3474
153 Ga0075428_100151426 3300006844 Bacteria 2520
154 Ga0075428_100256995 3300006844 Bacteria 1882
155 Ga0075430_100000691 3300006846 Bacteria 25696
156 Ga0075430_100054231 3300006846 Bacteria 3374
157 Ga0075430_100162716 3300006846 Bacteria 1858
158 Ga0075430_100173774 3300006846 Bacteria 1792
159 Ga0075430_100354721 3300006846 Bacteria 1211
160 Ga0075431_100001885 3300006847 Bacteria 19887
161 Ga0075431_100044479 3300006847 Bacteria 4580
162 Ga0075431_100066473 3300006847 Bacteria 3722
163 Ga0075431_100131410 3300006847 Bacteria 2582
164 Ga0075431_100179135 3300006847 Bacteria 2175
165 Ga0075431_100181072 3300006847 Bacteria 2163
166 Ga0075431_100389367 3300006847 Bacteria 1396
167 Ga0075433_10000037 3300006852 Bacteria 53492
168 Ga0075433_10001456 3300006852 Bacteria 17484
169 Ga0075433_10005012 3300006852 Bacteria 10372
170 Ga0075434_100000596 3300006871 Bacteria 27926
171 Ga0075434_100003672 3300006871 Bacteria 13714
172 Ga0075434_100027168 3300006871 Bacteria 5616
173 Ga0075429_100048999 3300006880 Bacteria 3673
174 Ga0075429_100062312 3300006880 Bacteria 3249
175 Ga0075429_100107600 3300006880 Bacteria 2437
176 Ga0075429_100250915 3300006880 Bacteria 1550
177 Ga0075429_100285745 3300006880 Bacteria 1444
178 Ga0068865_100001886 3300006881 Bacteria 12325
179 Ga0068865_100105016 3300006881 Bacteria 2074
180 Ga0068865_100215622 3300006881 Bacteria 1498
181 Ga0097620_100006708 3300006931 Bacteria 11694
182 Ga0097620_100078802 3300006931 Bacteria 3335
183 Ga0097620_100123925 3300006931 Bacteria 2652
184 Ga0075435_100016436 3300007076 Bacteria 5580
185 Ga0075435_100040676 3300007076 Bacteria 3713
186 Ga0075435_100201026 3300007076 Bacteria 1689
187 Ga0105244_10003455 3300009036 Bacteria 11260
188 Ga0105244_10023804 3300009036 Bacteria 3352
189 Ga0111539_10000417 3300009094 Bacteria 53293
190 Ga0111539_10002191 3300009094 Bacteria 26074
191 Ga0111539_10002820 3300009094 Bacteria 23099
192 Ga0111539_10004794 3300009094 Bacteria 17647
193 Ga0111539_10007840 3300009094 Bacteria 13638
194 Ga0111539_10015750 3300009094 Bacteria 9394
195 Ga0111539_10027136 3300009094 Bacteria 6993
196 Ga0111539_10033958 3300009094 Bacteria 6190
197 Ga0111539_10042748 3300009094 Bacteria 5439
198 Ga0111539_10077166 3300009094 Bacteria 3921
199 Ga0111539_10162823 3300009094 Bacteria 2609
200 Ga0105247_10002389 3300009101 Bacteria 12765
201 Ga0114129_10009591 3300009147 Bacteria 13809
202 Ga0114129_10034123 3300009147 Bacteria 7187
203 Ga0114129_10048306 3300009147 Bacteria 5979
204 Ga0114129_10076433 3300009147 Bacteria 4662
205 Ga0114129_10116587 3300009147 Bacteria 3680
206 Ga0114129_10267423 3300009147 Bacteria 2289
207 Ga0114129_10695544 3300009147 Bacteria 1307
208 Ga0105243_10015475 3300009148 Bacteria 5765
209 Ga0105241_10000371 3300009174 Bacteria 34199
210 Ga0105241_10098597 3300009174 Bacteria 2319
211 Ga0105248_10111233 3300009177 Bacteria 3089
212 Ga0105237_10007492 3300009545 Bacteria 11935
213 Ga0105238_10013627 3300009551 Bacteria 8212
214 Ga0105238_10115595 3300009551 Bacteria 2662
215 Ga0105238_10181197 3300009551 Bacteria 2083
216 Ga0105249_10007783 3300009553 Bacteria 9337
217 Ga0105249_10009765 3300009553 Bacteria 8407
218 Ga0105249_10015866 3300009553 Bacteria 6676
219 Ga0105249_10147327 3300009553 Bacteria 2263
220 Ga0105239_10250089 3300010375 Bacteria 1991
221 Ga0105246_10231957 3300011119 Bacteria 1454
222 Ga0157370_10103954 3300013104 Bacteria 2659
223 Ga0163162_10019877 3300013306 Bacteria 6595
224 Ga0163162_10308366 3300013306 Unclassified 1715
225 Ga0157372_10119169 3300013307 Bacteria 3029
226 Ga0157375_10042900 3300013308 Bacteria 4382
227 Ga0157375_10477908 3300013308 Bacteria 1411
228 Ga0163163_10207110 3300014325 Bacteria 2010
229 Ga0157380_10000799 3300014326 Bacteria 19789
230 Ga0157380_10005869 3300014326 Bacteria 8590
231 Ga0182008_10000083 3300014497 Bacteria 73635
232 Ga0157377_10001309 3300014745 Bacteria 10654
233 Ga0157379_10058700 3300014968 Bacteria 3441
234 Ga0157379_10093480 3300014968 Bacteria 2698
235 Ga0183369_1013 3300015685 Bacteria 222738
236 Ga0163161_10007719 3300017792 Bacteria 7442
237 Ga0163161_10017406 3300017792 Bacteria 5029
238 Ga0163161_10183547 3300017792 Bacteria 1605
239 Ga0207425_1000015 3300025245 Bacteria 466368
240 Ga0209129_1000074 3300025258 Bacteria 205648
241 Ga0209676_1000104 3300025292 Bacteria 226581
242 Ga0209025_1000002 3300025294 Bacteria 1393142
243 Ga0209758_1000003 3300025297 Bacteria 1398533
244 Ga0209050_1038650 3300025298 Bacteria 1357
245 Ga0207697_10002637 3300025315 Bacteria 9195
246 Ga0207655_1003689 3300025728 Bacteria 11283
247 Ga0207655_1035463 3300025728 Bacteria 2226
248 Ga0207653_10020057 3300025885 Bacteria 2113
249 Ga0207682_10001038 3300025893 Bacteria 12802
250 Ga0207682_10073052 3300025893 Bacteria 1456
251 Ga0207682_10078534 3300025893 Bacteria 1410
252 Ga0207642_10044334 3300025899 Bacteria 1968
253 Ga0207688_10007643 3300025901 Bacteria 5886
254 Ga0207645_10000611 3300025907 Bacteria 29564
255 Ga0207645_10005408 3300025907 Bacteria 9262
256 Ga0207643_10000068 3300025908 Bacteria 69282
257 Ga0207643_10002433 3300025908 Bacteria 10070
258 Ga0207643_10047403 3300025908 Bacteria 2431
259 Ga0207705_10264858 3300025909 Bacteria 1313
260 Ga0207660_10080772 3300025917 Bacteria 2388
261 Ga0207662_10009971 3300025918 Bacteria 5242
262 Ga0207649_10166394 3300025920 Bacteria 1532
263 Ga0207681_10004748 3300025923 Bacteria 8360
264 Ga0207681_10079435 3300025923 Bacteria 2311
265 Ga0207681_10100840 3300025923 Bacteria 2082
266 Ga0207681_10108179 3300025923 Bacteria 2018
267 Ga0207694_10003531 3300025924 Bacteria 12413
268 Ga0207694_10011457 3300025924 Bacteria 6692
269 Ga0207694_10015837 3300025924 Bacteria 5687
270 Ga0207650_10009832 3300025925 Bacteria 6543
271 Ga0207650_10014393 3300025925 Bacteria 5498
272 Ga0207650_10046351 3300025925 Bacteria 3201
273 Ga0207650_10361400 3300025925 Bacteria 1196
274 Ga0207659_10000353 3300025926 Bacteria 27408
275 Ga0207659_10002915 3300025926 Bacteria 10188
276 Ga0207659_10003941 3300025926 Bacteria 8960
277 Ga0207659_10009215 3300025926 Bacteria 6166
278 Ga0207659_10011872 3300025926 Bacteria 5518
279 Ga0207659_10056571 3300025926 Bacteria 2810
280 Ga0207659_10193622 3300025926 Bacteria 1619
281 Ga0207659_10300465 3300025926 Bacteria 1318
282 Ga0207687_10040448 3300025927 Bacteria 3196
283 Ga0207687_10318467 3300025927 Bacteria 1258
284 Ga0207644_10051921 3300025931 Bacteria 2945
285 Ga0207644_10064505 3300025931 Bacteria 2661
286 Ga0207644_10141485 3300025931 Bacteria 1853
287 Ga0207690_10009308 3300025932 Bacteria 5836
288 Ga0207706_10008244 3300025933 Bacteria 9613
289 Ga0207706_10052029 3300025933 Bacteria 3616
290 Ga0207706_10138031 3300025933 Bacteria 2145
291 Ga0207706_10167026 3300025933 Bacteria 1934
292 Ga0207709_10000954 3300025935 Bacteria 21622
293 Ga0207709_10004516 3300025935 Bacteria 8024
294 Ga0207670_10057930 3300025936 Bacteria 2630
295 Ga0207670_10114634 3300025936 Bacteria 1948
296 Ga0207669_10000642 3300025937 Bacteria 15113
297 Ga0207704_10002632 3300025938 Bacteria 8101
298 Ga0207691_10003313 3300025940 Bacteria 15693
299 Ga0207691_10011105 3300025940 Bacteria 8646
300 Ga0207691_10033132 3300025940 Bacteria 4812
301 Ga0207691_10042552 3300025940 Bacteria 4187
302 Ga0207691_10059555 3300025940 Bacteria 3472
303 Ga0207691_10256827 3300025940 Bacteria 1507
304 Ga0207711_10054368 3300025941 Bacteria 3436
305 Ga0207689_10000219 3300025942 Bacteria 50693
306 Ga0207689_10002433 3300025942 Bacteria 17334
307 Ga0207689_10043379 3300025942 Bacteria 3718
308 Ga0207689_10107077 3300025942 Bacteria 2297
309 Ga0207689_10118812 3300025942 Bacteria 2174
310 Ga0207679_10013441 3300025945 Bacteria 5368
311 Ga0207679_10064008 3300025945 Bacteria 2747
312 Ga0207679_10104385 3300025945 Bacteria 2224
313 Ga0207679_10168820 3300025945 Bacteria 1799
314 Ga0207679_10298136 3300025945 Bacteria 1388
315 Ga0207679_10303437 3300025945 Bacteria 1377
316 Ga0207667_10068982 3300025949 Bacteria 3680
317 Ga0207651_10000813 3300025960 Bacteria 13454
318 Ga0207651_10012886 3300025960 Bacteria 4755
319 Ga0207651_10091094 3300025960 Bacteria 2231
320 Ga0207651_10411410 3300025960 Bacteria 1152
321 Ga0207712_10007668 3300025961 Bacteria 6825
322 Ga0207668_10013679 3300025972 Bacteria 5006
323 Ga0207668_10222610 3300025972 Bacteria 1516
324 Ga0207640_10143130 3300025981 Bacteria 1746
325 Ga0207658_10011784 3300025986 Bacteria 5956
326 Ga0207677_10068506 3300026023 Bacteria 2491
327 Ga0207703_10060611 3300026035 Bacteria 3095
328 Ga0207703_10271081 3300026035 Bacteria 1537
329 Ga0207639_10001388 3300026041 Bacteria 16358
330 Ga0207678_10064681 3300026067 Bacteria 3142
331 Ga0207708_10015509 3300026075 Bacteria 5715
332 Ga0207708_10015853 3300026075 Bacteria 5657
333 Ga0207708_10102955 3300026075 Bacteria 2211
334 Ga0207641_10091615 3300026088 Bacteria 2660
335 Ga0207641_10098826 3300026088 Bacteria 2567
336 Ga0207648_10001252 3300026089 Bacteria 28387
337 Ga0207648_10178439 3300026089 Bacteria 1879
338 Ga0207676_10025450 3300026095 Bacteria 4391
339 Ga0207676_10121225 3300026095 Bacteria 2206
340 Ga0207676_10173795 3300026095 Bacteria 1879
341 Ga0207676_10409490 3300026095 Bacteria 1269
342 Ga0207674_10152404 3300026116 Bacteria 2268
343 Ga0207675_100088473 3300026118 Bacteria 2909
344 Ga0207683_10033861 3300026121 Bacteria 4439
345 Ga0207683_10037554 3300026121 Bacteria 4218
346 Ga0207683_10038335 3300026121 Bacteria 4176
347 Ga0207683_10065501 3300026121 Bacteria 3204
348 Ga0207683_10318098 3300026121 Bacteria 1425
349 Ga0209371_1000031 3300027312 Bacteria 399263
350 Ga0209974_10018478 3300027876 Bacteria 2313
351 Ga0207428_10000444 3300027907 Bacteria 50619
352 Ga0207428_10003654 3300027907 Bacteria 14827
353 Ga0207428_10019347 3300027907 Bacteria 5806
354 Ga0207428_10024118 3300027907 Bacteria 5108
355 Ga0207428_10028854 3300027907 Bacteria 4605
356 Ga0207428_10033872 3300027907 Bacteria 4190
357 Ga0207428_10061782 3300027907 Bacteria 2964
358 Ga0207428_10094480 3300027907 Bacteria 2318
359 Ga0268266_10000646 3300028379 Bacteria 47334
360 Ga0268266_10000688 3300028379 Bacteria 45589
361 Ga0268266_10071310 3300028379 Bacteria 3011
362 Ga0268264_10041798 3300028381 Bacteria 3793
363 Ga0268264_10304043 3300028381 Bacteria 1502
364 Ga0268256_1000034 3300030500 Bacteria 398909
365 Ga0316176_1036236 3300030732 Bacteria 2719
366 Ga0307408_100026796 3300031548 Bacteria 3964
367 Ga0307408_100249465 3300031548 Bacteria 1463
368 Ga0307408_100256067 3300031548 Bacteria 1446
369 Ga0316575_10004403 3300031665 Bacteria 4957
370 Ga0316575_10051417 3300031665 Bacteria 1641
371 Ga0316579_10009229 3300031691 Bacteria 4143
372 Ga0316579_10109556 3300031691 Bacteria 1325
373 Ga0316576_10001606 3300031727 Bacteria 12342
374 Ga0316576_10003024 3300031727 Bacteria 9771
375 Ga0316576_10003307 3300031727 Bacteria 9411
376 Ga0316576_10007410 3300031727 Bacteria 6912
377 Ga0316576_10007966 3300031727 Bacteria 6711
378 Ga0316576_10040530 3300031727 Bacteria 3348
379 Ga0316576_10071225 3300031727 Bacteria 2564
380 Ga0316576_10150142 3300031727 Bacteria 1756
381 Ga0316576_10171913 3300031727 Bacteria 1635
382 Ga0316578_10000406 3300031728 Bacteria 14022
383 Ga0316578_10007802 3300031728 Bacteria 5402
384 Ga0316578_10014816 3300031728 Bacteria 4178
385 Ga0316578_10020356 3300031728 Bacteria 3665
386 Ga0307405_10003265 3300031731 Bacteria 7402
387 Ga0307405_10009616 3300031731 Bacteria 4966
388 Ga0316577_10027166 3300031733 Bacteria 3191
389 Ga0307413_10009265 3300031824 Bacteria 4703
390 Ga0307410_10011351 3300031852 Bacteria 5091
391 Ga0307410_10036143 3300031852 Bacteria 3214
392 Ga0307410_10039157 3300031852 Bacteria 3110
393 Ga0307410_10190881 3300031852 Bacteria 1558
394 Ga0307406_10027319 3300031901 Bacteria 3438
395 Ga0307407_10003095 3300031903 Bacteria 6721
396 Ga0307412_10014576 3300031911 Bacteria 4640
397 Ga0307412_10023477 3300031911 Bacteria 3795
398 Ga0307409_100004703 3300031995 Bacteria 7727
399 Ga0307409_100064353 3300031995 Bacteria 2880
400 Ga0307409_100084635 3300031995 Bacteria 2576
401 Ga0307409_100186988 3300031995 Bacteria 1840
402 Ga0307416_100014475 3300032002 Bacteria 5411
403 Ga0307416_100050742 3300032002 Bacteria 3309
404 Ga0307416_100053949 3300032002 Bacteria 3228
405 Ga0307416_100107092 3300032002 Bacteria 2452
406 Ga0307416_100133426 3300032002 Bacteria 2241
407 Ga0307416_100596403 3300032002 Bacteria 1184
408 Ga0307414_10055384 3300032004 Bacteria 2776
409 Ga0307414_10055409 3300032004 Bacteria 2776
410 Ga0307411_10003472 3300032005 Bacteria 7321
411 Ga0307411_10036389 3300032005 Bacteria 3084
412 Ga0307415_100001761 3300032126 Bacteria 10574
413 Ga0307415_100019882 3300032126 Bacteria 4087
414 Ga0307415_100201023 3300032126 Bacteria 1581
415 Ga0307415_100244426 3300032126 Bacteria 1454
416 Ga0316583_10003725 3300032133 Bacteria 5393
417 Ga0316585_10000650 3300032137 Bacteria 8577
418 Ga0316580_10006382 3300032139 Bacteria 3485
419 Ga0316580_10017769 3300032139 Bacteria 2188
420 Ga0316580_10045856 3300032139 Bacteria 1348
421 Ga0373961_0015297 3300035241 Bacteria 1960
422 Ga0316574_0016859 3300035398 Unclassified 4263
423 Ga0316574_0158144 3300035398 Unclassified 1460
424 Ga0316582_0002036 3300036647 Bacteria 9299
425 Ga0316582_0005548 3300036647 Bacteria 6514
426 Ga0316582_0015154 3300036647 Bacteria 4398
427 Ga0316582_0070413 3300036647 Bacteria 2263
428 Ga0316582_0132388 3300036647 Bacteria 1676
429 Ga0316584_0002001 3300036712 Bacteria 12732
430 Ga0316584_0002281 3300036712 Bacteria 12072
431 Ga0316584_0005005 3300036712 Bacteria 8829
432 Ga0316584_0051174 3300036712 Bacteria 3089
433 Ga0316584_0061836 3300036712 Bacteria 2804
434 Ga0316584_0095851 3300036712 Bacteria 2221
435 Ga0395899_0007681 3300037312 Bacteria 8313
436 Ga0395899_0107908 3300037312 Bacteria 2003
437 Ga0395900_0001792 3300037418 Bacteria 24630
438 Ga0395900_0021154 3300037418 Bacteria 6648
439 Ga0395900_0105645 3300037418 Bacteria 2893
440 Ga0395898_0021442 3300037466 Bacteria 6551
441 Ga0395898_0037984 3300037466 Bacteria 4774
442 Ga0395898_0082078 3300037466 Bacteria 3107
443 Ga0395898_0154467 3300037466 Bacteria 2195
444 Ga0395898_0263108 3300037466 Unclassified 1645
445 Ga0395905_0005868 3300037471 Bacteria 12470
446 Ga0395905_0159651 3300037471 Bacteria 2119
447 Ga0395905_0166445 3300037471 Bacteria 2072
448 Ga0395905_0475261 3300037471 Bacteria 1149
449 Ga0316581_0072207 3300037588 Bacteria 1061
450 Ga0395901_0005884 3300038443 Bacteria 12410
451 Ga0395901_0016478 3300038443 Bacteria 7529
452 Ga0395901_0017096 3300038443 Bacteria 7394
453 Ga0395901_0101173 3300038443 Bacteria 3024
454 Ga0395901_0508565 3300038443 Bacteria 1226
455 Ga0237819_07252 3300038705 Bacteria 1604
456 Ga0400484_10749 3300038725 Bacteria 4779
457 Ga0400484_11841 3300038725 Bacteria 7739
458 Ga0400484_32425 3300038725 Bacteria 1880
459 Ga0400490_04360 3300038726 Bacteria 4580
460 Ga0400490_10536 3300038726 Bacteria 5004
461 Ga0400490_11632 3300038726 Bacteria 4628
462 Ga0400490_24154 3300038726 Bacteria 25221
463 Ga0400490_55129 3300038726 Bacteria 10975
464 Ga0400491_06558 3300038727 Bacteria 4193
465 Ga0400485_07187 3300038735 Bacteria 1337
466 Ga0400485_12416 3300038735 Bacteria 14304
467 Ga0400485_18741 3300038735 Bacteria 31288
468 Ga0400485_20208 3300038735 Bacteria 42303
469 Ga0400488_17101 3300038741 Bacteria 3345
470 Ga0400488_36447 3300038741 Bacteria 1414
471 Ga0400488_56624 3300038741 Bacteria 33459
472 Ga0400488_61529 3300038741 Bacteria 8471
473 Ga0400486_01713 3300038742 Bacteria 7445
474 Ga0400486_08357 3300038742 Bacteria 47260
475 Ga0400486_13010 3300038742 Bacteria 13533
476 Ga0400486_19352 3300038742 Bacteria 4221
477 Ga0400486_32970 3300038742 Bacteria 19800
478 Ga0400483_095319 3300039062 Bacteria 29855
479 Ga0400483_113209 3300039062 Bacteria 4110
480 Ga0400483_172553 3300039062 Bacteria 18169
481 Ga0400483_202581 3300039062 Bacteria 1914
482 Ga0400483_259742 3300039062 Bacteria 2269
483 Ga0400489_19794 3300039093 Bacteria 11642
484 Ga0400489_24659 3300039093 Bacteria 24146
485 Ga0400489_56300 3300039093 Bacteria 20080
486 Ga0400489_70520 3300039093 Bacteria 12186
487 Ga0400489_94355 3300039093 Bacteria 9207
488 Ga0400487_06632 3300039110 Bacteria 20467
489 Ga0400487_15943 3300039110 Unclassified 1634
490 Ga0400487_29500 3300039110 Unclassified 2176
491 Ga0400487_49500 3300039110 Bacteria 2637
492 Ga0439453_0008816 3300041408 Bacteria 1629
493 Ga0451800_1190734 3300041459 Bacteria 1551
494 Ga0451807_2431939 3300041486 Bacteria 1519
495 Ga0439442_028246 3300042002 Bacteria 1170
496 Ga0439450_003741 3300042008 Bacteria 2545
497 Ga0450911_004969 3300042115 Bacteria 2116
498 Ga0450894_012888 3300042131 Bacteria 1096
499 Ga0450895_004883 3300042132 Bacteria 1069
500 Ga0450896_002709 3300042133 Bacteria 2308
501 Ga0450905_003275 3300042142 Bacteria 2124
502 Ga0439435_0001971 3300042436 Bacteria 3956
503 Ga0439435_0036416 3300042436 Bacteria 1360
504 Ga0451577_0003629 3300042876 Bacteria 16952
505 Ga0451577_0003928 3300042876 Bacteria 16057
506 Ga0451577_0007132 3300042876 Bacteria 11021
507 Ga0451577_0038348 3300042876 Bacteria 4310
508 Ga0451577_0089686 3300042876 Bacteria 2744
509 Ga0451577_0142465 3300042876 Bacteria 2154
510 Ga0453683_0005885 3300044673 Bacteria 8482
511 Ga0453683_0146652 3300044673 Bacteria 1490
512 Ga0453684_0000107 3300044712 Bacteria 362864
513 Ga0453684_0000414 3300044712 Bacteria 174278
514 Ga0453684_0001111 3300044712 Bacteria 84488
515 Ga0453684_0001479 3300044712 Bacteria 66322
516 Ga0453684_0008066 3300044712 Bacteria 19041
517 Ga0453684_0012382 3300044712 Bacteria 14081
518 Ga0453684_0017106 3300044712 Bacteria 11261
519 Ga0453684_0047924 3300044712 Bacteria 5659
520 Ga0453684_0054288 3300044712 Bacteria 5220
521 Ga0453684_0079097 3300044712 Bacteria 4111
522 Ga0453684_0126419 3300044712 Bacteria 3076
523 Ga0453684_0138113 3300044712 Bacteria 2915
524 Ga0453684_0485231 3300044712 Bacteria 1370
525 Ga0453684_0724351 3300044712 Bacteria 1079
526 Ga0451576_0000171 3300045051 Bacteria 162452
527 Ga0451576_0012714 3300045051 Bacteria 9450
528 Ga0451576_0028416 3300045051 Bacteria 5991
529 Ga0451576_0076467 3300045051 Bacteria 3484
530 Ga0451576_0374292 3300045051 Bacteria 1492
531 Ga0451576_0615425 3300045051 Bacteria 1141
532 Ga0495627_006967 3300046453 Bacteria 4387
533 Ga0495627_010488 3300046453 Bacteria 3367
534 Ga0495638_0000923 3300046460 Bacteria 29918
535 Ga0495650_0017522 3300046471 Bacteria 3589
536 Ga0495605_0000036 3300046474 Bacteria 203902
537 Ga0495594_0000608 3300046499 Bacteria 18446
538 Ga0495594_0118132 3300046499 Bacteria 1498
539 Ga0495583_0000028 3300046506 Bacteria 255787
540 Ga0495608_0000358 3300046511 Bacteria 31895
541 Ga0495610_0044263 3300046512 Bacteria 2210
542 Ga0495620_0000073 3300046515 Bacteria 83446
543 Ga0495643_0001805 3300046522 Bacteria 18329
544 Ga0495648_0005020 3300046524 Bacteria 11120
545 Ga0495663_0011415 3300046525 Bacteria 2472
546 Ga0495663_0013141 3300046525 Bacteria 2314
547 Ga0495654_0000246 3300046530 Bacteria 50620
548 Ga0495609_0000115 3300046538 Bacteria 93419
549 Ga0495621_0023854 3300046539 Bacteria 2038
550 Ga0495597_0001109 3300046542 Bacteria 20383
551 Ga0495633_0000028 3300046558 Bacteria 203214
552 Ga0495633_0039461 3300046558 Bacteria 2253
553 Ga0495667_0000569 3300046559 Bacteria 23532
554 Ga0495656_0003673 3300046615 Bacteria 5208
555 Ga0495656_0005742 3300046615 Bacteria 4306
556 Ga0495656_0017989 3300046615 Bacteria 2706
557 Ga0495668_0004574 3300046616 Bacteria 9731
558 Ga0495611_0002080 3300046648 Bacteria 9410
559 Ga0495625_0103741 3300046660 Bacteria 1949
560 Ga0495659_0020578 3300046664 Bacteria 2217
561 Ga0495661_0000211 3300046665 Bacteria 67481
562 Ga0495613_0001198 3300046689 Bacteria 19793
563 Ga0495670_0026477 3300046691 Bacteria 2870
564 Ga0495589_0000402 3300046794 Bacteria 32574
565 Ga0495660_0001852 3300046810 Bacteria 13881
566 Ga0495636_0026359 3300047318 Bacteria 2364
567 Ga0495672_0000214 3300047320 Bacteria 82882
568 Ga0495672_0011967 3300047320 Bacteria 6082
569 Ga0495683_0000091 3300047323 Bacteria 91313
570 Ga0495679_000083 3300047446 Bacteria 87051
571 Ga0495673_0015663 3300047469 Bacteria 3899
572 Ga0495681_0020864 3300047470 Bacteria 3543
573 Ga0495684_0005372 3300047471 Bacteria 9975
574 Ga0495686_0008753 3300047472 Bacteria 7383
575 Ga0496109_0013461 3300048912 Bacteria 7097
576 Ga0496113_0168093 3300048916 Bacteria 1736
577 Ga0496116_0001111 3300048919 Bacteria 32190
578 Ga0496117_0001300 3300048920 Bacteria 36745
579 Ga0496117_0002433 3300048920 Bacteria 23537
580 Ga0496117_0065177 3300048920 Bacteria 2478
581 Ga0496118_0000406 3300048921 Bacteria 71874
582 Ga0496118_0000703 3300048921 Bacteria 54182
583 Ga0496118_0075438 3300048921 Bacteria 2405
584 Ga0496119_0114047 3300048922 Bacteria 1495
585 Ga0496121_0000705 3300048924 Bacteria 62174
586 Ga0496121_0146557 3300048924 Bacteria 1743
587 Ga0496122_0047585 3300048925 Bacteria 3309
588 Ga0496122_0048434 3300048925 Bacteria 3267
589 Ga0496123_0104074 3300048926 Bacteria 1642
590 Ga0496124_0010087 3300048927 Bacteria 9631
591 Ga0496124_0074196 3300048927 Bacteria 2812
592 Ga0496125_0077446 3300048928 Bacteria 2563
593 Ga0496126_0209196 3300048929 Bacteria 1643
594 Ga0495678_000020 3300049459 Bacteria 253654
595 Ga0501034_0057034 3300049571 Bacteria 3928
596 Ga0501034_0130797 3300049571 Bacteria 2493
597 Ga0501036_0040305 3300049572 Bacteria 3950
598 Ga0501037_0046762 3300049573 Bacteria 3173
599 Ga0501038_0008714 3300049574 Bacteria 9310
600 Ga0501040_0211126 3300049576 Bacteria 1380
601 Ga0501041_0238114 3300049577 Bacteria 1143
602 Ga0501042_0029378 3300049578 Bacteria 3876
603 Ga0501046_0005153 3300049580 Bacteria 11714
604 Ga0501047_0211453 3300049581 Bacteria 1798
605 Ga0501047_0363103 3300049581 Bacteria 1283
606 Ga0501048_0026046 3300049582 Bacteria 4260
607 Ga0501067_0086371 3300049583 Bacteria 1741
608 Ga0501070_0083722 3300049586 Bacteria 2641
609 Ga0501070_0143736 3300049586 Bacteria 1969
610 Ga0501071_0032418 3300049587 Bacteria 3710
611 Ga0501072_0039227 3300049588 Bacteria 3719
612 Ga0501073_0032803 3300049589 Bacteria 3701
613 Ga0501074_0096470 3300049590 Bacteria 2117
614 Ga0501074_0276950 3300049590 Bacteria 1193
615 Ga0501075_0005648 3300049591 Bacteria 8560
616 Ga0501075_0074216 3300049591 Bacteria 2573
617 Ga0501075_0123032 3300049591 Bacteria 1975
618 Ga0501076_0009612 3300049592 Bacteria 7143
619 Ga0501076_0061862 3300049592 Bacteria 2980
620 Ga0501076_0085931 3300049592 Bacteria 2528
621 Ga0501076_0222157 3300049592 Bacteria 1544
622 Ga0501080_0037427 3300049742 Bacteria 4532
623 Ga0501080_0113976 3300049742 Bacteria 2506
624 Ga0501035_0056757 3300049822 Bacteria 3492
625 Ga0501044_0003608 3300049823 Bacteria 17419
626 Ga0501045_0088061 3300049824 Bacteria 2293
627 nmdc:mga00v17_158982_c1 3300050491 Bacteria 1454
628 nmdc:mga00v17_308_c1 3300050491 Bacteria 28036
629 nmdc:mga06z11_125702_c1 3300050494 Bacteria 1435
630 nmdc:mga06z11_63686_c1 3300050494 Bacteria 1930
631 nmdc:mga05p37_105144_c1 3300050507 Bacteria 3473
632 nmdc:mga05p37_15154_c1 3300050507 Bacteria 9257
633 nmdc:mga05p37_167625_c1 3300050507 Bacteria 2680
634 nmdc:mga05p37_198058_c1 3300050507 Bacteria 2435
635 nmdc:mga05p37_26140_c1 3300050507 Bacteria 7098
636 nmdc:mga05p37_357485_c1 3300050507 Bacteria 1718
637 nmdc:mga05p37_408122_c1 3300050507 Bacteria 1584
638 nmdc:mga05p37_564673_c1 3300050507 Bacteria 1292
639 nmdc:mga05p37_68215_c1 3300050507 Bacteria 4374
640 nmdc:mga05p37_74450_c1 3300050507 Bacteria 4179
641 nmdc:mga09592_186101_c1 3300050508 Bacteria 1797
642 nmdc:mga09592_34058_c1 3300050508 Bacteria 4257
643 nmdc:mga09592_45261_c1 3300050508 Bacteria 3706
644 nmdc:mga09592_49274_c1 3300050508 Bacteria 3551
645 nmdc:mga09592_77335_c1 3300050508 Bacteria 2831
646 nmdc:mga0qj67_2782_c1 3300050509 Bacteria 12549
647 nmdc:mga0qj67_34774_c1 3300050509 Bacteria 3938
648 nmdc:mga0qj67_356695_c1 3300050509 Bacteria 1182
649 nmdc:mga06r32_15677_c1 3300050510 Bacteria 6885
650 nmdc:mga06r32_194757_c1 3300050510 Bacteria 2014
651 nmdc:mga06r32_533696_c1 3300050510 Bacteria 1148
652 nmdc:mga06r32_573928_c1 3300050510 Bacteria 1100
653 nmdc:mga06r32_8270_c1 3300050510 Bacteria 9366
654 nmdc:mga08y16_110480_c1 3300050511 Bacteria 2863
655 nmdc:mga08y16_190862_c1 3300050511 Bacteria 2125
656 nmdc:mga08y16_1926_c1 3300050511 Bacteria 21179
657 nmdc:mga08y16_204146_c1 3300050511 Unclassified 2048
658 nmdc:mga08y16_21348_c1 3300050511 Bacteria 6838
659 nmdc:mga08y16_25726_c1 3300050511 Bacteria 6210
660 nmdc:mga08y16_284929_c1 3300050511 Bacteria 1704
661 nmdc:mga08y16_394121_c1 3300050511 Bacteria 1418
662 nmdc:mga08y16_43821_c1 3300050511 Bacteria 4688
663 nmdc:mga08y16_71485_c1 3300050511 Bacteria 3616
664 nmdc:mga08y16_870_c1 3300050511 Bacteria 29078
665 nmdc:mga08y16_9903_c1 3300050511 Bacteria 10004
666 nmdc:mga0n895_115260_c1 3300050512 Bacteria 2705
667 nmdc:mga0n895_16759_c1 3300050512 Bacteria 6733
668 nmdc:mga0n895_64110_c1 3300050512 Bacteria 3634
669 nmdc:mga0n895_76562_c1 3300050512 Bacteria 3327
670 nmdc:mga0rr50_38400_c1 3300050513 Bacteria 3464
671 nmdc:mga0rr50_708_c1 3300050513 Bacteria 17916
672 nmdc:mga0a205_13094_c1 3300050515 Bacteria 7704
673 nmdc:mga0a205_14896_c1 3300050515 Bacteria 7255
674 nmdc:mga0a205_716_c1 3300050515 Bacteria 26671
675 nmdc:mga0a205_84_c1 3300050515 Bacteria 51647
676 Ga0500610_0090926 3300053079 Bacteria 1586
677 Ga0500555_000051 3300053103 Bacteria 59969
678 Ga0500568_0011205 3300053139 Bacteria 4175
679 Ga0500616_0000306 3300053153 Bacteria 70571
680 Ga0500645_000041 3300053730 Bacteria 110646
681 Ga0501084_0089348 3300054114 Bacteria 2586
682 Ga0501084_0213056 3300054114 Bacteria 1630
683 Ga0590071_000235 3300059421 Bacteria 16189
684 Ga0590071_000716 3300059421 Bacteria 9395
685 Ga0590074_000382 3300059423 Bacteria 6308
686 Ga0590075_002569 3300059424 Bacteria 4336
687 Ga0590075_020193 3300059424 Bacteria 1658
688 Ga0590077_000031 3300059426 Bacteria 33228
689 Ga0590077_001251 3300059426 Bacteria 6081
690 Ga0590077_013308 3300059426 Bacteria 1711
691 Ga0501082_0262590 3300060353 Bacteria 1502

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0142465 Ga0451577_0142465_1137_1979 255
2 3300044712 Ga0453684_0012382 Ga0453684_0012382_6491_7333 255
3 3300045051 Ga0451576_0615425 Ga0451576_0615425_150_992 255
4 iso_pu_bacteria 2929206907 2929209037 255
5 3300044673 Ga0453683_0005885 Ga0453683_0005885_3230_4075 256
6 3300044712 Ga0453684_0485231 Ga0453684_0485231_375_1220 256
7 3300045051 Ga0451576_0012714 Ga0451576_0012714_1525_2370 256
8 3300037466 Ga0395898_0263108 Ga0395898_0263108_418_1209 262
9 3300046616 Ga0495668_0004574 Ga0495668_0004574_747_1538 263
10 3300028379 Ga0268266_10000646 Ga0268266_1000064626 273
11 3300025923 Ga0207681_10108179 Ga0207681_101081791 274
12 3300060353 Ga0501082_0262590 Ga0501082_0262590_19_933 281
13 3300044712 Ga0453684_0000107 Ga0453684_0000107_73889_74746 284
14 3300037471 Ga0395905_0475261 Ga0395905_0475261_18_947 285
15 3300050510 nmdc:mga06r32_533696_c1 nmdc:mga06r32_533696_c1_15_920 285
16 3300039062 Ga0400483_202581 Ga0400483_202581_52_954 292
17 3300042876 Ga0451577_0089686 Ga0451577_0089686_172_1188 292
18 3300009147 Ga0114129_10695544 Ga0114129_106955441 294
19 3300050507 nmdc:mga05p37_564673_c1 nmdc:mga05p37_564673_c1_150_1136 294
20 3300046689 Ga0495613_0001198 Ga0495613_0001198_4596_5630 296
21 3300047471 Ga0495684_0005372 Ga0495684_0005372_4823_5857 296
22 3300032126 Ga0307415_100244426 Ga0307415_1002444261 297
23 3300025942 Ga0207689_10043379 Ga0207689_100433792 298
24 3300009101 Ga0105247_10002389 Ga0105247_100023894 299
25 3300009174 Ga0105241_10000371 Ga0105241_100003711 299
26 3300009545 Ga0105237_10007492 Ga0105237_100074922 299
27 3300009553 Ga0105249_10009765 Ga0105249_100097652 299
28 3300010375 Ga0105239_10250089 Ga0105239_102500892 299
29 3300013308 Ga0157375_10042900 Ga0157375_100429003 299
30 3300014968 Ga0157379_10093480 Ga0157379_100934802 299
31 3300032126 Ga0307415_100019882 Ga0307415_1000198824 299
32 3300006880 Ga0075429_100062312 Ga0075429_1000623122 300
33 3300007076 Ga0075435_100201026 Ga0075435_1002010262 300
34 3300044712 Ga0453684_0047924 Ga0453684_0047924_2934_3971 303
35 3300048924 Ga0496121_0146557 Ga0496121_0146557_174_1178 304
36 3300050508 nmdc:mga09592_186101_c1 nmdc:mga09592_186101_c1_506_1531 304
37 3300036647 Ga0316582_0070413 Ga0316582_0070413_920_1864 305
38 3300035241 Ga0373961_0015297 Ga0373961_0015297_394_1356 306
39 3300031852 Ga0307410_10036143 Ga0307410_100361431 307
40 3300005471 Ga0070698_100002958 Ga0070698_10000295817 308
41 3300031995 Ga0307409_100084635 Ga0307409_1000846353 308
42 3300006846 Ga0075430_100354721 Ga0075430_1003547211 309
43 3300009094 Ga0111539_10002191 Ga0111539_100021918 309
44 3300025909 Ga0207705_10264858 Ga0207705_102648582 309
45 3300027907 Ga0207428_10003654 Ga0207428_1000365410 309
46 3300046558 Ga0495633_0039461 Ga0495633_0039461_527_1519 309
47 3300049571 Ga0501034_0057034 Ga0501034_0057034_2459_3469 309
48 3300049581 Ga0501047_0211453 Ga0501047_0211453_350_1360 309
49 3300049586 Ga0501070_0083722 Ga0501070_0083722_1570_2580 309
50 3300049742 Ga0501080_0037427 Ga0501080_0037427_1229_2239 309
51 3300049823 Ga0501044_0003608 Ga0501044_0003608_2600_3610 309
52 3300050509 nmdc:mga0qj67_356695_c1 nmdc:mga0qj67_356695_c1_78_1103 309
53 3300050511 nmdc:mga08y16_1926_c1 nmdc:mga08y16_1926_c1_13259_14269 309
54 3300050512 nmdc:mga0n895_64110_c1 nmdc:mga0n895_64110_c1_219_1229 309
55 3300050508 nmdc:mga09592_34058_c1 nmdc:mga09592_34058_c1_2859_3881 310
56 3300050510 nmdc:mga06r32_573928_c1 nmdc:mga06r32_573928_c1_23_1045 310
57 3300025986 Ga0207658_10011784 Ga0207658_100117843 311
58 3300031911 Ga0307412_10023477 Ga0307412_100234772 311
59 3300044712 Ga0453684_0079097 Ga0453684_0079097_2568_3584 311
60 3300049591 Ga0501075_0123032 Ga0501075_0123032_516_1619 311
61 3300054114 Ga0501084_0213056 Ga0501084_0213056_160_1263 311
62 3300005334 Ga0068869_100150836 Ga0068869_1001508361 312
63 3300005617 Ga0068859_100078804 Ga0068859_1000788042 312
64 3300006042 Ga0075368_10070091 Ga0075368_100700911 312
65 3300006051 Ga0075364_10158675 Ga0075364_101586752 312
66 3300006195 Ga0075366_10071524 Ga0075366_100715242 312
67 3300006931 Ga0097620_100078802 Ga0097620_1000788022 312
68 3300009553 Ga0105249_10015866 Ga0105249_100158662 312
69 3300025942 Ga0207689_10107077 Ga0207689_101070771 312
70 3300025961 Ga0207712_10007668 Ga0207712_100076686 312
71 3300042876 Ga0451577_0038348 Ga0451577_0038348_1172_2179 312
72 3300045051 Ga0451576_0374292 Ga0451576_0374292_472_1470 312
73 3300046525 Ga0495663_0011415 Ga0495663_0011415_569_1573 312
74 3300049591 Ga0501075_0005648 Ga0501075_0005648_471_1478 312
75 3300050491 nmdc:mga00v17_158982_c1 nmdc:mga00v17_158982_c1_393_1406 312
76 3300050494 nmdc:mga06z11_125702_c1 nmdc:mga06z11_125702_c1_368_1381 312
77 3300009147 Ga0114129_10009591 Ga0114129_100095912 313
78 3300038443 Ga0395901_0508565 Ga0395901_0508565_86_1138 313
79 3300042132 Ga0450895_004883 Ga0450895_004883_54_1052 313
80 3300048925 Ga0496122_0047585 Ga0496122_0047585_87_1091 313
81 3300048926 Ga0496123_0104074 Ga0496123_0104074_259_1263 313
82 3300049583 Ga0501067_0086371 Ga0501067_0086371_471_1487 313
83 3300049586 Ga0501070_0143736 Ga0501070_0143736_319_1335 313
84 3300050507 nmdc:mga05p37_15154_c1 nmdc:mga05p37_15154_c1_6923_7954 313
85 3300025292 Ga0209676_1000104 Ga0209676_100010473 314
86 3300025298 Ga0209050_1038650 Ga0209050_10386501 314
87 3300031995 Ga0307409_100186988 Ga0307409_1001869881 314
88 3300044712 Ga0453684_0724351 Ga0453684_0724351_29_1054 314
89 3300049576 Ga0501040_0211126 Ga0501040_0211126_229_1233 314
90 3300049578 Ga0501042_0029378 Ga0501042_0029378_1290_2294 314
91 3300049582 Ga0501048_0026046 Ga0501048_0026046_3154_4158 314
92 3300049587 Ga0501071_0032418 Ga0501071_0032418_602_1606 314
93 3300049588 Ga0501072_0039227 Ga0501072_0039227_610_1614 314
94 3300049590 Ga0501074_0276950 Ga0501074_0276950_118_1122 314
95 3300049591 Ga0501075_0074216 Ga0501075_0074216_1287_2291 314
96 3300049592 Ga0501076_0009612 Ga0501076_0009612_3003_4007 314
97 3300049824 Ga0501045_0088061 Ga0501045_0088061_901_1905 314
98 3300054114 Ga0501084_0089348 Ga0501084_0089348_919_1923 314
99 3300005365 Ga0070688_100010886 Ga0070688_1000108863 315
100 3300005466 Ga0070685_10009810 Ga0070685_100098106 315
101 3300005518 Ga0070699_100237449 Ga0070699_1002374491 315
102 3300006847 Ga0075431_100044479 Ga0075431_1000444791 315
103 3300006880 Ga0075429_100250915 Ga0075429_1002509151 315
104 3300025927 Ga0207687_10318467 Ga0207687_103184671 315
105 3300035398 Ga0316574_0158144 Ga0316574_0158144_147_1148 315
106 3300042876 Ga0451577_0007132 Ga0451577_0007132_7862_8887 315
107 3300044712 Ga0453684_0008066 Ga0453684_0008066_3417_4442 315
108 3300048922 Ga0496119_0114047 Ga0496119_0114047_409_1446 315
109 3300049592 Ga0501076_0222157 Ga0501076_0222157_412_1437 315
110 3300050508 nmdc:mga09592_45261_c1 nmdc:mga09592_45261_c1_1210_2196 315
111 3300005331 Ga0070670_100026149 Ga0070670_1000261493 316
112 3300005354 Ga0070675_100193098 Ga0070675_1001930981 316
113 3300005356 Ga0070674_100162426 Ga0070674_1001624261 316
114 3300006846 Ga0075430_100162716 Ga0075430_1001627163 316
115 3300006847 Ga0075431_100181072 Ga0075431_1001810723 316
116 3300009094 Ga0111539_10077166 Ga0111539_100771662 316
117 3300025925 Ga0207650_10046351 Ga0207650_100463511 316
118 3300049592 Ga0501076_0085931 Ga0501076_0085931_736_1773 316
119 3300050511 nmdc:mga08y16_190862_c1 nmdc:mga08y16_190862_c1_508_1521 316
120 3300003203 JGI25406J46586_10047026 JGI25406J46586_100470262 317
121 3300005340 Ga0070689_100084992 Ga0070689_1000849922 317
122 3300005471 Ga0070698_100043831 Ga0070698_1000438312 317
123 3300005985 Ga0081539_10038985 Ga0081539_100389854 317
124 3300006844 Ga0075428_100015404 Ga0075428_10001540412 317
125 3300006847 Ga0075431_100131410 Ga0075431_1001314103 317
126 3300041486 Ga0451807_2431939 Ga0451807_2431939_338_1354 317
127 3300042002 Ga0439442_028246 Ga0439442_028246_92_1156 317
128 3300047320 Ga0495672_0011967 Ga0495672_0011967_3168_4205 317
129 3300048928 Ga0496125_0077446 Ga0496125_0077446_816_1832 317
130 3300049577 Ga0501041_0238114 Ga0501041_0238114_28_1056 317
131 3300049592 Ga0501076_0061862 Ga0501076_0061862_249_1277 317
132 3300005354 Ga0070675_100016192 Ga0070675_1000161923 318
133 3300005365 Ga0070688_100159250 Ga0070688_1001592501 318
134 3300005466 Ga0070685_10304684 Ga0070685_103046841 318
135 3300005985 Ga0081539_10046258 Ga0081539_100462581 318
136 3300006844 Ga0075428_100027849 Ga0075428_1000278494 318
137 3300006846 Ga0075430_100173774 Ga0075430_1001737741 318
138 3300006880 Ga0075429_100285745 Ga0075429_1002857452 318
139 3300009094 Ga0111539_10000417 Ga0111539_1000041721 318
140 3300009094 Ga0111539_10015750 Ga0111539_100157502 318
141 3300009094 Ga0111539_10027136 Ga0111539_100271369 318
142 3300025926 Ga0207659_10003941 Ga0207659_100039413 318
143 3300026075 Ga0207708_10102955 Ga0207708_101029553 318
144 3300027907 Ga0207428_10000444 Ga0207428_1000044416 318
145 3300027907 Ga0207428_10033872 Ga0207428_100338727 318
146 3300031548 Ga0307408_100249465 Ga0307408_1002494651 318
147 3300031727 Ga0316576_10007966 Ga0316576_100079664 318
148 3300032002 Ga0307416_100596403 Ga0307416_1005964032 318
149 3300038735 Ga0400485_07187 Ga0400485_07187_296_1318 318
150 3300038742 Ga0400486_08357 Ga0400486_08357_45896_46918 318
151 3300042131 Ga0450894_012888 Ga0450894_012888_29_1048 318
152 3300042133 Ga0450896_002709 Ga0450896_002709_1189_2208 318
153 3300050507 nmdc:mga05p37_198058_c1 nmdc:mga05p37_198058_c1_329_1360 318
154 3300050508 nmdc:mga09592_77335_c1 nmdc:mga09592_77335_c1_281_1312 318
155 3300050511 nmdc:mga08y16_25726_c1 nmdc:mga08y16_25726_c1_2889_3920 318
156 3300053079 Ga0500610_0090926 Ga0500610_0090926_107_1132 318
157 3300059421 Ga0590071_000716 Ga0590071_000716_6448_7473 318
158 3300059426 Ga0590077_000031 Ga0590077_000031_6432_7463 318
159 3300059426 Ga0590077_001251 Ga0590077_001251_1522_2547 318
160 iso_pu_bacteria 2874220319 2874224088 318
161 iso_pu_bacteria 2919089067 2919089977 318
162 iso_pu_bacteria 2928496128 2928499988 318
163 iso_pu_bacteria 2931380184 2931382703 318
164 iso_pu_bacteria 2937610967 2937613420 318
165 iso_pu_bacteria 2939626828 2939628120 318
166 iso_pu_bacteria 2961047084 2961050852 318
167 3300005353 Ga0070669_100243530 Ga0070669_1002435302 319
168 3300005354 Ga0070675_100054701 Ga0070675_1000547012 319
169 3300005441 Ga0070700_100068639 Ga0070700_1000686391 319
170 3300025926 Ga0207659_10011872 Ga0207659_100118723 319
171 3300025933 Ga0207706_10167026 Ga0207706_101670262 319
172 3300025936 Ga0207670_10057930 Ga0207670_100579303 319
173 3300025945 Ga0207679_10104385 Ga0207679_101043852 319
174 3300026095 Ga0207676_10173795 Ga0207676_101737952 319
175 3300027907 Ga0207428_10024118 Ga0207428_100241184 319
176 3300027907 Ga0207428_10094480 Ga0207428_100944801 319
177 3300031691 Ga0316579_10109556 Ga0316579_101095561 319
178 3300031727 Ga0316576_10001606 Ga0316576_100016066 319
179 3300031728 Ga0316578_10014816 Ga0316578_100148165 319
180 3300031733 Ga0316577_10027166 Ga0316577_100271663 319
181 3300032139 Ga0316580_10017769 Ga0316580_100177692 319
182 3300036712 Ga0316584_0061836 Ga0316584_0061836_1703_2698 319
183 3300041408 Ga0439453_0008816 Ga0439453_0008816_519_1553 319
184 3300042436 Ga0439435_0001971 Ga0439435_0001971_1389_2423 319
185 3300046511 Ga0495608_0000358 Ga0495608_0000358_2855_3874 319
186 3300046559 Ga0495667_0000569 Ga0495667_0000569_20056_21075 319
187 3300048912 Ga0496109_0013461 Ga0496109_0013461_660_1691 319
188 3300050511 nmdc:mga08y16_21348_c1 nmdc:mga08y16_21348_c1_2846_3895 319
189 3300050511 nmdc:mga08y16_394121_c1 nmdc:mga08y16_394121_c1_345_1376 319
190 3300050511 nmdc:mga08y16_9903_c1 nmdc:mga08y16_9903_c1_6627_7637 319
191 3300059421 Ga0590071_000235 Ga0590071_000235_1239_2270 319
192 3300059423 Ga0590074_000382 Ga0590074_000382_4558_5589 319
193 3300059424 Ga0590075_002569 Ga0590075_002569_576_1607 319
194 3300005331 Ga0070670_100001817 Ga0070670_1000018173 320
195 3300005331 Ga0070670_100398406 Ga0070670_1003984061 320
196 3300005344 Ga0070661_100199438 Ga0070661_1001994382 320
197 3300005354 Ga0070675_100018904 Ga0070675_1000189046 320
198 3300005365 Ga0070688_100023939 Ga0070688_1000239393 320
199 3300005456 Ga0070678_100205211 Ga0070678_1002052111 320
200 3300005457 Ga0070662_100214688 Ga0070662_1002146881 320
201 3300005467 Ga0070706_100027284 Ga0070706_1000272844 320
202 3300005471 Ga0070698_100354640 Ga0070698_1003546401 320
203 3300005545 Ga0070695_100005599 Ga0070695_1000055995 320
204 3300005546 Ga0070696_100101253 Ga0070696_1001012533 320
205 3300005549 Ga0070704_100177471 Ga0070704_1001774711 320
206 3300005564 Ga0070664_100040079 Ga0070664_1000400793 320
207 3300005985 Ga0081539_10000750 Ga0081539_1000075034 320
208 3300006847 Ga0075431_100389367 Ga0075431_1003893672 320
209 3300006880 Ga0075429_100048999 Ga0075429_1000489994 320
210 3300006881 Ga0068865_100105016 Ga0068865_1001050163 320
211 3300009147 Ga0114129_10048306 Ga0114129_100483066 320
212 3300009553 Ga0105249_10147327 Ga0105249_101473272 320
213 3300014325 Ga0163163_10207110 Ga0163163_102071101 320
214 3300025885 Ga0207653_10020057 Ga0207653_100200572 320
215 3300025893 Ga0207682_10001038 Ga0207682_1000103811 320
216 3300025920 Ga0207649_10166394 Ga0207649_101663942 320
217 3300025923 Ga0207681_10079435 Ga0207681_100794352 320
218 3300025925 Ga0207650_10361400 Ga0207650_103614001 320
219 3300025926 Ga0207659_10300465 Ga0207659_103004652 320
220 3300025933 Ga0207706_10052029 Ga0207706_100520293 320
221 3300025940 Ga0207691_10033132 Ga0207691_100331325 320
222 3300025945 Ga0207679_10303437 Ga0207679_103034371 320
223 3300036647 Ga0316582_0132388 Ga0316582_0132388_51_1055 320
224 3300038705 Ga0237819_07252 Ga0237819_07252_134_1168 320
225 3300039062 Ga0400483_259742 Ga0400483_259742_1108_2112 320
226 3300042876 Ga0451577_0003928 Ga0451577_0003928_12289_13317 320
227 3300044712 Ga0453684_0138113 Ga0453684_0138113_1534_2562 320
228 3300046499 Ga0495594_0118132 Ga0495594_0118132_216_1244 320
229 3300049571 Ga0501034_0130797 Ga0501034_0130797_113_1099 320
230 3300050507 nmdc:mga05p37_68215_c1 nmdc:mga05p37_68215_c1_1647_2666 320
231 3300005616 Ga0068852_100409083 Ga0068852_1004090831 321
232 3300005618 Ga0068864_100100025 Ga0068864_1001000252 321
233 3300005842 Ga0068858_100077956 Ga0068858_1000779563 321
234 3300006847 Ga0075431_100179135 Ga0075431_1001791353 321
235 3300014326 Ga0157380_10005869 Ga0157380_100058692 321
236 3300026035 Ga0207703_10060611 Ga0207703_100606112 321
237 3300026095 Ga0207676_10025450 Ga0207676_100254503 321
238 3300031727 Ga0316576_10171913 Ga0316576_101719132 321
239 3300031852 Ga0307410_10190881 Ga0307410_101908812 321
240 3300038741 Ga0400488_61529 Ga0400488_61529_1079_2131 321
241 3300044712 Ga0453684_0001479 Ga0453684_0001479_22126_23130 321
242 3300044712 Ga0453684_0126419 Ga0453684_0126419_194_1192 321
243 3300050507 nmdc:mga05p37_167625_c1 nmdc:mga05p37_167625_c1_1626_2636 321
244 3300050509 nmdc:mga0qj67_34774_c1 nmdc:mga0qj67_34774_c1_1774_2784 321
245 3300050510 nmdc:mga06r32_194757_c1 nmdc:mga06r32_194757_c1_663_1688 321
246 3300003203 JGI25406J46586_10000294 JGI25406J46586_1000029414 322
247 3300005347 Ga0070668_100003349 Ga0070668_10000334910 322
248 3300005356 Ga0070674_100000032 Ga0070674_10000003243 322
249 3300005456 Ga0070678_100040275 Ga0070678_1000402752 322
250 3300005459 Ga0068867_100094451 Ga0068867_1000944512 322
251 3300005518 Ga0070699_100053104 Ga0070699_1000531043 322
252 3300005543 Ga0070672_100188067 Ga0070672_1001880672 322
253 3300005548 Ga0070665_100093849 Ga0070665_1000938493 322
254 3300005985 Ga0081539_10000013 Ga0081539_10000013279 322
255 3300006852 Ga0075433_10005012 Ga0075433_100050129 322
256 3300006871 Ga0075434_100027168 Ga0075434_1000271683 322
257 3300009147 Ga0114129_10076433 Ga0114129_100764335 322
258 3300009551 Ga0105238_10181197 Ga0105238_101811971 322
259 3300013308 Ga0157375_10477908 Ga0157375_104779081 322
260 3300014326 Ga0157380_10000799 Ga0157380_100007999 322
261 3300025893 Ga0207682_10078534 Ga0207682_100785342 322
262 3300025924 Ga0207694_10011457 Ga0207694_100114572 322
263 3300025937 Ga0207669_10000642 Ga0207669_100006424 322
264 3300025940 Ga0207691_10256827 Ga0207691_102568273 322
265 3300025972 Ga0207668_10013679 Ga0207668_100136792 322
266 3300026121 Ga0207683_10033861 Ga0207683_100338612 322
267 3300028379 Ga0268266_10071310 Ga0268266_100713103 322
268 3300031548 Ga0307408_100026796 Ga0307408_1000267965 322
269 3300031731 Ga0307405_10009616 Ga0307405_100096165 322
270 3300031824 Ga0307413_10009265 Ga0307413_100092652 322
271 3300031852 Ga0307410_10011351 Ga0307410_100113512 322
272 3300031901 Ga0307406_10027319 Ga0307406_100273194 322
273 3300031903 Ga0307407_10003095 Ga0307407_100030954 322
274 3300032002 Ga0307416_100014475 Ga0307416_1000144752 322
275 3300032002 Ga0307416_100107092 Ga0307416_1001070924 322
276 3300032005 Ga0307411_10036389 Ga0307411_100363891 322
277 3300032126 Ga0307415_100201023 Ga0307415_1002010232 322
278 3300039093 Ga0400489_19794 Ga0400489_19794_5579_6577 322
279 3300042115 Ga0450911_004969 Ga0450911_004969_559_1563 322
280 3300042876 Ga0451577_0003629 Ga0451577_0003629_3932_4966 322
281 3300044712 Ga0453684_0000414 Ga0453684_0000414_117231_118265 322
282 3300048919 Ga0496116_0001111 Ga0496116_0001111_20673_21677 322
283 3300048920 Ga0496117_0065177 Ga0496117_0065177_556_1560 322
284 3300048921 Ga0496118_0075438 Ga0496118_0075438_923_1927 322
285 3300048929 Ga0496126_0209196 Ga0496126_0209196_149_1153 322
286 3300050507 nmdc:mga05p37_74450_c1 nmdc:mga05p37_74450_c1_2500_3531 322
287 3300050512 nmdc:mga0n895_76562_c1 nmdc:mga0n895_76562_c1_1754_2785 322
288 3300050515 nmdc:mga0a205_84_c1 nmdc:mga0a205_84_c1_47845_48876 322
289 3300053103 Ga0500555_000051 Ga0500555_000051_39210_40241 322
290 3300053153 Ga0500616_0000306 Ga0500616_0000306_45692_46723 322
291 3300053730 Ga0500645_000041 Ga0500645_000041_12315_13346 322
292 3300003320 rootH2_10081097 rootH2_100810979 323
293 3300005440 Ga0070705_100153615 Ga0070705_1001536152 323
294 3300005456 Ga0070678_100081651 Ga0070678_1000816513 323
295 3300005548 Ga0070665_100000417 Ga0070665_10000041730 323
296 3300005617 Ga0068859_100123928 Ga0068859_1001239282 323
297 3300006237 Ga0097621_100117885 Ga0097621_1001178852 323
298 3300006844 Ga0075428_100256995 Ga0075428_1002569952 323
299 3300006931 Ga0097620_100123925 Ga0097620_1001239252 323
300 3300025893 Ga0207682_10073052 Ga0207682_100730522 323
301 3300026121 Ga0207683_10038335 Ga0207683_100383352 323
302 3300028379 Ga0268266_10000688 Ga0268266_100006883 323
303 3300031852 Ga0307410_10039157 Ga0307410_100391571 323
304 3300037471 Ga0395905_0005868 Ga0395905_0005868_11297_12310 323
305 3300037471 Ga0395905_0159651 Ga0395905_0159651_72_1091 323
306 3300037471 Ga0395905_0166445 Ga0395905_0166445_936_1949 323
307 3300044712 Ga0453684_0001111 Ga0453684_0001111_43938_44921 323
308 3300044712 Ga0453684_0017106 Ga0453684_0017106_6252_7235 323
309 3300044712 Ga0453684_0054288 Ga0453684_0054288_1921_2904 323
310 3300049589 Ga0501073_0032803 Ga0501073_0032803_2073_3128 323
311 3300049590 Ga0501074_0096470 Ga0501074_0096470_404_1459 323
312 3300050494 nmdc:mga06z11_63686_c1 nmdc:mga06z11_63686_c1_53_1078 323
313 3300050511 nmdc:mga08y16_43821_c1 nmdc:mga08y16_43821_c1_2971_3993 323
314 3300059424 Ga0590075_020193 Ga0590075_020193_560_1591 323
315 3300059426 Ga0590077_013308 Ga0590077_013308_267_1298 323
316 3300005290 Ga0065712_10017397 Ga0065712_100173972 324
317 3300005331 Ga0070670_100000644 Ga0070670_10000064420 324
318 3300005336 Ga0070680_100193619 Ga0070680_1001936191 324
319 3300005353 Ga0070669_100029791 Ga0070669_1000297914 324
320 3300005355 Ga0070671_100268597 Ga0070671_1002685972 324
321 3300005364 Ga0070673_100009483 Ga0070673_1000094833 324
322 3300005438 Ga0070701_10063569 Ga0070701_100635692 324
323 3300005438 Ga0070701_10106746 Ga0070701_101067462 324
324 3300005456 Ga0070678_100248042 Ga0070678_1002480422 324
325 3300005457 Ga0070662_100123610 Ga0070662_1001236101 324
326 3300005543 Ga0070672_100009427 Ga0070672_1000094276 324
327 3300005564 Ga0070664_100005128 Ga0070664_1000051288 324
328 3300005578 Ga0068854_100229420 Ga0068854_1002294202 324
329 3300005618 Ga0068864_100027300 Ga0068864_1000273002 324
330 3300005618 Ga0068864_100326655 Ga0068864_1003266551 324
331 3300005843 Ga0068860_100108586 Ga0068860_1001085862 324
332 3300006880 Ga0075429_100107600 Ga0075429_1001076003 324
333 3300006881 Ga0068865_100215622 Ga0068865_1002156222 324
334 3300009094 Ga0111539_10033958 Ga0111539_100339585 324
335 3300017792 Ga0163161_10183547 Ga0163161_101835471 324
336 3300025917 Ga0207660_10080772 Ga0207660_100807722 324
337 3300025925 Ga0207650_10014393 Ga0207650_100143936 324
338 3300025926 Ga0207659_10193622 Ga0207659_101936222 324
339 3300025931 Ga0207644_10051921 Ga0207644_100519214 324
340 3300025933 Ga0207706_10138031 Ga0207706_101380312 324
341 3300025940 Ga0207691_10042552 Ga0207691_100425522 324
342 3300025945 Ga0207679_10013441 Ga0207679_100134412 324
343 3300025960 Ga0207651_10012886 Ga0207651_100128863 324
344 3300026121 Ga0207683_10318098 Ga0207683_103180981 324
345 3300028381 Ga0268264_10304043 Ga0268264_103040432 324
346 3300031548 Ga0307408_100256067 Ga0307408_1002560672 324
347 3300031995 Ga0307409_100064353 Ga0307409_1000643532 324
348 3300032002 Ga0307416_100050742 Ga0307416_1000507423 324
349 3300042436 Ga0439435_0036416 Ga0439435_0036416_213_1265 324
350 3300046664 Ga0495659_0020578 Ga0495659_0020578_631_1653 324
351 3300050507 nmdc:mga05p37_357485_c1 nmdc:mga05p37_357485_c1_673_1698 324
352 3300053139 Ga0500568_0011205 Ga0500568_0011205_990_2018 324
353 3300005338 Ga0068868_100119137 Ga0068868_1001191372 325
354 3300005354 Ga0070675_100038145 Ga0070675_1000381453 325
355 3300006358 Ga0068871_100334160 Ga0068871_1003341602 325
356 3300006844 Ga0075428_100083995 Ga0075428_1000839953 325
357 3300009094 Ga0111539_10004794 Ga0111539_100047943 325
358 3300009094 Ga0111539_10162823 Ga0111539_101628231 325
359 3300009147 Ga0114129_10116587 Ga0114129_101165874 325
360 3300009177 Ga0105248_10111233 Ga0105248_101112333 325
361 3300013306 Ga0163162_10308366 Ga0163162_103083662 325
362 3300025926 Ga0207659_10056571 Ga0207659_100565712 325
363 3300025931 Ga0207644_10141485 Ga0207644_101414851 325
364 3300025941 Ga0207711_10054368 Ga0207711_100543683 325
365 3300027907 Ga0207428_10028854 Ga0207428_100288543 325
366 3300027907 Ga0207428_10061782 Ga0207428_100617822 325
367 3300031665 Ga0316575_10004403 Ga0316575_100044035 325
368 3300031691 Ga0316579_10009229 Ga0316579_100092293 325
369 3300031727 Ga0316576_10003307 Ga0316576_100033072 325
370 3300031727 Ga0316576_10071225 Ga0316576_100712253 325
371 3300031727 Ga0316576_10150142 Ga0316576_101501422 325
372 3300031728 Ga0316578_10000406 Ga0316578_100004069 325
373 3300031728 Ga0316578_10020356 Ga0316578_100203562 325
374 3300031731 Ga0307405_10003265 Ga0307405_1000326511 325
375 3300031911 Ga0307412_10014576 Ga0307412_100145766 325
376 3300031995 Ga0307409_100004703 Ga0307409_1000047035 325
377 3300032002 Ga0307416_100053949 Ga0307416_1000539495 325
378 3300032002 Ga0307416_100133426 Ga0307416_1001334263 325
379 3300032004 Ga0307414_10055409 Ga0307414_100554091 325
380 3300032005 Ga0307411_10003472 Ga0307411_100034726 325
381 3300032126 Ga0307415_100001761 Ga0307415_10000176114 325
382 3300032133 Ga0316583_10003725 Ga0316583_100037253 325
383 3300032137 Ga0316585_10000650 Ga0316585_100006505 325
384 3300032139 Ga0316580_10006382 Ga0316580_100063822 325
385 3300032139 Ga0316580_10045856 Ga0316580_100458562 325
386 3300035398 Ga0316574_0016859 Ga0316574_0016859_2863_3852 325
387 3300036647 Ga0316582_0002036 Ga0316582_0002036_7522_8511 325
388 3300036647 Ga0316582_0005548 Ga0316582_0005548_2659_3648 325
389 3300036712 Ga0316584_0005005 Ga0316584_0005005_3120_4109 325
390 3300036712 Ga0316584_0051174 Ga0316584_0051174_1462_2451 325
391 3300038725 Ga0400484_10749 Ga0400484_10749_1376_2461 325
392 3300039093 Ga0400489_24659 Ga0400489_24659_21979_22968 325
393 3300039093 Ga0400489_56300 Ga0400489_56300_18725_19714 325
394 3300045051 Ga0451576_0076467 Ga0451576_0076467_361_1380 325
395 3300048916 Ga0496113_0168093 Ga0496113_0168093_93_1133 325
396 3300050507 nmdc:mga05p37_105144_c1 nmdc:mga05p37_105144_c1_907_1926 325
397 3300050510 nmdc:mga06r32_15677_c1 nmdc:mga06r32_15677_c1_2313_3332 325
398 3300050511 nmdc:mga08y16_110480_c1 nmdc:mga08y16_110480_c1_1225_2244 325
399 3300050511 nmdc:mga08y16_204146_c1 nmdc:mga08y16_204146_c1_669_1688 325
400 3300050511 nmdc:mga08y16_870_c1 nmdc:mga08y16_870_c1_14407_15438 325
401 3300050512 nmdc:mga0n895_115260_c1 nmdc:mga0n895_115260_c1_1087_2106 325
402 3300050515 nmdc:mga0a205_14896_c1 nmdc:mga0a205_14896_c1_955_1974 325
403 3300003203 JGI25406J46586_10000986 JGI25406J46586_1000098610 326
404 3300005327 Ga0070658_10129513 Ga0070658_101295132 326
405 3300005328 Ga0070676_10002232 Ga0070676_100022328 326
406 3300005328 Ga0070676_10036458 Ga0070676_100364581 326
407 3300005330 Ga0070690_100010170 Ga0070690_1000101706 326
408 3300005330 Ga0070690_100021642 Ga0070690_1000216423 326
409 3300005331 Ga0070670_100008954 Ga0070670_1000089545 326
410 3300005333 Ga0070677_10016106 Ga0070677_100161063 326
411 3300005334 Ga0068869_100002035 Ga0068869_1000020355 326
412 3300005334 Ga0068869_100003931 Ga0068869_1000039317 326
413 3300005335 Ga0070666_10049270 Ga0070666_100492702 326
414 3300005338 Ga0068868_100025104 Ga0068868_1000251042 326
415 3300005340 Ga0070689_100212372 Ga0070689_1002123722 326
416 3300005343 Ga0070687_100008498 Ga0070687_1000084982 326
417 3300005347 Ga0070668_100077132 Ga0070668_1000771323 326
418 3300005353 Ga0070669_100005634 Ga0070669_1000056344 326
419 3300005353 Ga0070669_100157854 Ga0070669_1001578542 326
420 3300005354 Ga0070675_100000344 Ga0070675_10000034419 326
421 3300005354 Ga0070675_100002958 Ga0070675_1000029583 326
422 3300005355 Ga0070671_100064039 Ga0070671_1000640393 326
423 3300005364 Ga0070673_100004841 Ga0070673_1000048412 326
424 3300005364 Ga0070673_100175811 Ga0070673_1001758111 326
425 3300005365 Ga0070688_100162898 Ga0070688_1001628982 326
426 3300005367 Ga0070667_100008279 Ga0070667_1000082796 326
427 3300005367 Ga0070667_100302339 Ga0070667_1003023392 326
428 3300005441 Ga0070700_100027345 Ga0070700_1000273452 326
429 3300005455 Ga0070663_100044112 Ga0070663_1000441123 326
430 3300005456 Ga0070678_100090289 Ga0070678_1000902893 326
431 3300005456 Ga0070678_100223793 Ga0070678_1002237932 326
432 3300005459 Ga0068867_100000578 Ga0068867_1000005784 326
433 3300005459 Ga0068867_100051430 Ga0068867_1000514303 326
434 3300005466 Ga0070685_10009160 Ga0070685_100091601 326
435 3300005543 Ga0070672_100015081 Ga0070672_1000150815 326
436 3300005543 Ga0070672_100068226 Ga0070672_1000682262 326
437 3300005543 Ga0070672_100083505 Ga0070672_1000835052 326
438 3300005544 Ga0070686_100013664 Ga0070686_1000136645 326
439 3300005544 Ga0070686_100167420 Ga0070686_1001674202 326
440 3300005548 Ga0070665_100132700 Ga0070665_1001327003 326
441 3300005549 Ga0070704_100074238 Ga0070704_1000742383 326
442 3300005564 Ga0070664_100044735 Ga0070664_1000447354 326
443 3300005564 Ga0070664_100078015 Ga0070664_1000780152 326
444 3300005617 Ga0068859_100006708 Ga0068859_1000067086 326
445 3300005718 Ga0068866_10056893 Ga0068866_100568932 326
446 3300005719 Ga0068861_100064991 Ga0068861_1000649912 326
447 3300005840 Ga0068870_10015656 Ga0068870_100156564 326
448 3300005841 Ga0068863_100016001 Ga0068863_1000160018 326
449 3300005841 Ga0068863_100441691 Ga0068863_1004416912 326
450 3300005842 Ga0068858_100023552 Ga0068858_1000235523 326
451 3300005842 Ga0068858_100324155 Ga0068858_1003241552 326
452 3300005843 Ga0068860_100057807 Ga0068860_1000578073 326
453 3300005844 Ga0068862_100031342 Ga0068862_1000313424 326
454 3300005985 Ga0081539_10000164 Ga0081539_10000164136 326
455 3300006358 Ga0068871_100231017 Ga0068871_1002310172 326
456 3300006844 Ga0075428_100000166 Ga0075428_10000016612 326
457 3300006844 Ga0075428_100151426 Ga0075428_1001514262 326
458 3300006846 Ga0075430_100000691 Ga0075430_10000069113 326
459 3300006846 Ga0075430_100054231 Ga0075430_1000542313 326
460 3300006847 Ga0075431_100001885 Ga0075431_10000188512 326
461 3300006847 Ga0075431_100066473 Ga0075431_1000664733 326
462 3300006852 Ga0075433_10000037 Ga0075433_1000003720 326
463 3300006852 Ga0075433_10001456 Ga0075433_1000145613 326
464 3300006871 Ga0075434_100000596 Ga0075434_1000005963 326
465 3300006871 Ga0075434_100003672 Ga0075434_10000367211 326
466 3300006881 Ga0068865_100001886 Ga0068865_1000018869 326
467 3300006931 Ga0097620_100006708 Ga0097620_1000067086 326
468 3300007076 Ga0075435_100016436 Ga0075435_1000164362 326
469 3300007076 Ga0075435_100040676 Ga0075435_1000406764 326
470 3300009094 Ga0111539_10002820 Ga0111539_1000282014 326
471 3300009094 Ga0111539_10007840 Ga0111539_100078409 326
472 3300009094 Ga0111539_10042748 Ga0111539_100427486 326
473 3300009147 Ga0114129_10034123 Ga0114129_100341235 326
474 3300009147 Ga0114129_10267423 Ga0114129_102674233 326
475 3300009148 Ga0105243_10015475 Ga0105243_100154753 326
476 3300009553 Ga0105249_10007783 Ga0105249_100077833 326
477 3300011119 Ga0105246_10231957 Ga0105246_102319572 326
478 3300013306 Ga0163162_10019877 Ga0163162_100198776 326
479 3300014745 Ga0157377_10001309 Ga0157377_100013094 326
480 3300014968 Ga0157379_10058700 Ga0157379_100587003 326
481 3300017792 Ga0163161_10017406 Ga0163161_100174066 326
482 3300025315 Ga0207697_10002637 Ga0207697_100026372 326
483 3300025899 Ga0207642_10044334 Ga0207642_100443343 326
484 3300025901 Ga0207688_10007643 Ga0207688_100076436 326
485 3300025907 Ga0207645_10000611 Ga0207645_1000061122 326
486 3300025907 Ga0207645_10005408 Ga0207645_100054085 326
487 3300025908 Ga0207643_10000068 Ga0207643_1000006823 326
488 3300025908 Ga0207643_10047403 Ga0207643_100474032 326
489 3300025918 Ga0207662_10009971 Ga0207662_100099713 326
490 3300025923 Ga0207681_10004748 Ga0207681_100047485 326
491 3300025923 Ga0207681_10100840 Ga0207681_101008402 326
492 3300025925 Ga0207650_10009832 Ga0207650_100098322 326
493 3300025926 Ga0207659_10000353 Ga0207659_1000035317 326
494 3300025926 Ga0207659_10002915 Ga0207659_100029155 326
495 3300025926 Ga0207659_10009215 Ga0207659_100092156 326
496 3300025927 Ga0207687_10040448 Ga0207687_100404482 326
497 3300025931 Ga0207644_10064505 Ga0207644_100645052 326
498 3300025933 Ga0207706_10008244 Ga0207706_100082444 326
499 3300025935 Ga0207709_10004516 Ga0207709_100045164 326
500 3300025936 Ga0207670_10114634 Ga0207670_101146341 326
501 3300025938 Ga0207704_10002632 Ga0207704_100026322 326
502 3300025940 Ga0207691_10003313 Ga0207691_100033138 326
503 3300025940 Ga0207691_10011105 Ga0207691_100111053 326
504 3300025940 Ga0207691_10059555 Ga0207691_100595554 326
505 3300025942 Ga0207689_10000219 Ga0207689_100002199 326
506 3300025942 Ga0207689_10002433 Ga0207689_1000243312 326
507 3300025942 Ga0207689_10118812 Ga0207689_101188123 326
508 3300025945 Ga0207679_10064008 Ga0207679_100640082 326
509 3300025945 Ga0207679_10168820 Ga0207679_101688202 326
510 3300025945 Ga0207679_10298136 Ga0207679_102981361 326
511 3300025960 Ga0207651_10000813 Ga0207651_100008137 326
512 3300025960 Ga0207651_10091094 Ga0207651_100910943 326
513 3300025960 Ga0207651_10411410 Ga0207651_104114101 326
514 3300025972 Ga0207668_10222610 Ga0207668_102226101 326
515 3300025981 Ga0207640_10143130 Ga0207640_101431301 326
516 3300026023 Ga0207677_10068506 Ga0207677_100685062 326
517 3300026035 Ga0207703_10271081 Ga0207703_102710812 326
518 3300026067 Ga0207678_10064681 Ga0207678_100646813 326
519 3300026075 Ga0207708_10015509 Ga0207708_100155095 326
520 3300026075 Ga0207708_10015853 Ga0207708_100158533 326
521 3300026088 Ga0207641_10091615 Ga0207641_100916153 326
522 3300026088 Ga0207641_10098826 Ga0207641_100988263 326
523 3300026089 Ga0207648_10001252 Ga0207648_1000125214 326
524 3300026095 Ga0207676_10121225 Ga0207676_101212252 326
525 3300026116 Ga0207674_10152404 Ga0207674_101524042 326
526 3300026118 Ga0207675_100088473 Ga0207675_1000884733 326
527 3300026121 Ga0207683_10037554 Ga0207683_100375543 326
528 3300026121 Ga0207683_10065501 Ga0207683_100655012 326
529 3300027876 Ga0209974_10018478 Ga0209974_100184783 326
530 3300027907 Ga0207428_10019347 Ga0207428_100193472 326
531 3300028381 Ga0268264_10041798 Ga0268264_100417982 326
532 3300031727 Ga0316576_10003024 Ga0316576_100030244 326
533 3300031728 Ga0316578_10007802 Ga0316578_100078025 326
534 3300036647 Ga0316582_0015154 Ga0316582_0015154_3342_4334 326
535 3300036712 Ga0316584_0002001 Ga0316584_0002001_3200_4234 326
536 3300036712 Ga0316584_0002281 Ga0316584_0002281_7336_8328 326
537 3300037588 Ga0316581_0072207 Ga0316581_0072207_12_1004 326
538 3300038726 Ga0400490_24154 Ga0400490_24154_8140_9132 326
539 3300038727 Ga0400491_06558 Ga0400491_06558_938_1930 326
540 3300042008 Ga0439450_003741 Ga0439450_003741_481_1509 326
541 3300042142 Ga0450905_003275 Ga0450905_003275_646_1671 326
542 3300046539 Ga0495621_0023854 Ga0495621_0023854_525_1556 326
543 3300046615 Ga0495656_0017989 Ga0495656_0017989_515_1546 326
544 3300050507 nmdc:mga05p37_26140_c1 nmdc:mga05p37_26140_c1_3713_4744 326
545 3300050507 nmdc:mga05p37_408122_c1 nmdc:mga05p37_408122_c1_298_1320 326
546 3300050508 nmdc:mga09592_49274_c1 nmdc:mga09592_49274_c1_1055_2083 326
547 3300050509 nmdc:mga0qj67_2782_c1 nmdc:mga0qj67_2782_c1_1670_2698 326
548 3300050510 nmdc:mga06r32_8270_c1 nmdc:mga06r32_8270_c1_1952_2980 326
549 3300050511 nmdc:mga08y16_284929_c1 nmdc:mga08y16_284929_c1_427_1458 326
550 3300050511 nmdc:mga08y16_71485_c1 nmdc:mga08y16_71485_c1_1332_2360 326
551 3300050512 nmdc:mga0n895_16759_c1 nmdc:mga0n895_16759_c1_2510_3538 326
552 3300050513 nmdc:mga0rr50_38400_c1 nmdc:mga0rr50_38400_c1_575_1603 326
553 3300050513 nmdc:mga0rr50_708_c1 nmdc:mga0rr50_708_c1_10375_11406 326
554 3300050515 nmdc:mga0a205_13094_c1 nmdc:mga0a205_13094_c1_604_1632 326
555 3300050515 nmdc:mga0a205_716_c1 nmdc:mga0a205_716_c1_21574_22605 326
556 iso_pu_bacteria 2919134579 2919138254 326
557 3300005290 Ga0065712_10002276 Ga0065712_100022766 327
558 3300005293 Ga0065715_10002535 Ga0065715_100025353 327
559 3300005441 Ga0070700_100073272 Ga0070700_1000732721 327
560 3300005543 Ga0070672_100104221 Ga0070672_1001042213 327
561 3300005618 Ga0068864_100138443 Ga0068864_1001384432 327
562 3300005840 Ga0068870_10016802 Ga0068870_100168024 327
563 3300005981 Ga0081538_10050621 Ga0081538_100506212 327
564 3300025908 Ga0207643_10002433 Ga0207643_100024334 327
565 3300026089 Ga0207648_10178439 Ga0207648_101784392 327
566 3300026095 Ga0207676_10409490 Ga0207676_104094901 327
567 3300038725 Ga0400484_32425 Ga0400484_32425_363_1358 327
568 3300038726 Ga0400490_10536 Ga0400490_10536_703_1698 327
569 3300038726 Ga0400490_11632 Ga0400490_11632_580_1575 327
570 3300038726 Ga0400490_55129 Ga0400490_55129_504_1499 327
571 3300038735 Ga0400485_12416 Ga0400485_12416_3143_4138 327
572 3300038735 Ga0400485_18741 Ga0400485_18741_19247_20242 327
573 3300038735 Ga0400485_20208 Ga0400485_20208_10513_11508 327
574 3300038741 Ga0400488_17101 Ga0400488_17101_1947_2942 327
575 3300038741 Ga0400488_36447 Ga0400488_36447_324_1319 327
576 3300038742 Ga0400486_01713 Ga0400486_01713_3142_4137 327
577 3300038742 Ga0400486_13010 Ga0400486_13010_11069_12064 327
578 3300038742 Ga0400486_19352 Ga0400486_19352_2554_3549 327
579 3300038742 Ga0400486_32970 Ga0400486_32970_9241_10236 327
580 3300039062 Ga0400483_095319 Ga0400483_095319_25782_26927 327
581 3300039062 Ga0400483_113209 Ga0400483_113209_610_1605 327
582 3300039062 Ga0400483_172553 Ga0400483_172553_4835_5830 327
583 3300039093 Ga0400489_70520 Ga0400489_70520_9829_10824 327
584 3300039093 Ga0400489_94355 Ga0400489_94355_3368_4390 327
585 3300039110 Ga0400487_06632 Ga0400487_06632_9709_10704 327
586 3300039110 Ga0400487_15943 Ga0400487_15943_589_1584 327
587 3300039110 Ga0400487_29500 Ga0400487_29500_859_1854 327
588 3300039110 Ga0400487_49500 Ga0400487_49500_680_1696 327
589 3300046615 Ga0495656_0003673 Ga0495656_0003673_1675_2709 327
590 3300049572 Ga0501036_0040305 Ga0501036_0040305_2846_3853 327
591 3300049742 Ga0501080_0113976 Ga0501080_0113976_1373_2377 327
592 3300049822 Ga0501035_0056757 Ga0501035_0056757_224_1231 327
593 iso_pu_bacteria 2547132130 2547502318 327
594 iso_pu_bacteria 2842391507 2842393428 327
595 iso_pu_bacteria 2961064222 2961067932 327
596 3300006051 Ga0075364_10000276 Ga0075364_100002768 328
597 3300031665 Ga0316575_10051417 Ga0316575_100514172 328
598 3300031727 Ga0316576_10007410 Ga0316576_100074105 328
599 3300036712 Ga0316584_0095851 Ga0316584_0095851_1149_2150 328
600 3300038725 Ga0400484_11841 Ga0400484_11841_4671_5669 328
601 3300038726 Ga0400490_04360 Ga0400490_04360_3349_4347 328
602 3300038741 Ga0400488_56624 Ga0400488_56624_31485_32483 328
603 3300046453 Ga0495627_006967 Ga0495627_006967_2338_3462 328
604 3300046471 Ga0495650_0017522 Ga0495650_0017522_897_2021 328
605 3300046474 Ga0495605_0000036 Ga0495605_0000036_48430_49554 328
606 3300046499 Ga0495594_0000608 Ga0495594_0000608_16613_17737 328
607 3300046506 Ga0495583_0000028 Ga0495583_0000028_61681_62805 328
608 3300046512 Ga0495610_0044263 Ga0495610_0044263_1025_2149 328
609 3300046515 Ga0495620_0000073 Ga0495620_0000073_64120_65244 328
610 3300046524 Ga0495648_0005020 Ga0495648_0005020_1513_2637 328
611 3300046530 Ga0495654_0000246 Ga0495654_0000246_45598_46722 328
612 3300046538 Ga0495609_0000115 Ga0495609_0000115_48433_49557 328
613 3300046542 Ga0495597_0001109 Ga0495597_0001109_16852_17976 328
614 3300046558 Ga0495633_0000028 Ga0495633_0000028_184210_185334 328
615 3300046648 Ga0495611_0002080 Ga0495611_0002080_1796_2920 328
616 3300046665 Ga0495661_0000211 Ga0495661_0000211_47985_49109 328
617 3300046691 Ga0495670_0026477 Ga0495670_0026477_722_1846 328
618 3300046794 Ga0495589_0000402 Ga0495589_0000402_15851_16975 328
619 3300046810 Ga0495660_0001852 Ga0495660_0001852_11231_12355 328
620 3300047323 Ga0495683_0000091 Ga0495683_0000091_72003_73127 328
621 3300047446 Ga0495679_000083 Ga0495679_000083_68035_69159 328
622 3300047469 Ga0495673_0015663 Ga0495673_0015663_457_1581 328
623 3300047470 Ga0495681_0020864 Ga0495681_0020864_2309_3433 328
624 3300048925 Ga0496122_0048434 Ga0496122_0048434_1661_2785 328
625 3300049459 Ga0495678_000020 Ga0495678_000020_59784_60908 328
626 3300050491 nmdc:mga00v17_308_c1 nmdc:mga00v17_308_c1_8417_9442 328
627 iso_pu_bacteria 2765235840 2765577002 328
628 iso_pu_bacteria 2816332141 2816519629 328
629 iso_pu_bacteria 2895498888 2895503264 328
630 iso_pu_bacteria 2895522137 2895523102 328
631 3300032004 Ga0307414_10055384 Ga0307414_100553842 329
632 3300045051 Ga0451576_0000171 Ga0451576_0000171_11759_12895 329
633 iso_pu_bacteria 2747842428 2747950618 329
634 iso_pu_bacteria 2895511927 2895513090 329
635 iso_pu_bacteria 2895525241 2895527005 329
636 3300009036 Ga0105244_10003455 Ga0105244_100034554 330
637 3300025728 Ga0207655_1003689 Ga0207655_10036895 330
638 3300031727 Ga0316576_10040530 Ga0316576_100405302 330
639 3300041459 Ga0451800_1190734 Ga0451800_1190734_141_1154 330
640 3300048924 Ga0496121_0000705 Ga0496121_0000705_3214_4356 330
641 iso_pu_bacteria 2537561836 2538834869 330
642 iso_pu_bacteria 2576861471 2578460294 330
643 iso_pu_bacteria 2818991457 2819662074 330
644 iso_pu_bacteria 2842757796 2842760348 330
645 iso_pu_bacteria 2857442823 2857444084 330
646 iso_pu_bacteria 2895395659 2895397192 330
647 iso_pu_bacteria 2939622612 2939623274 330
648 3300003320 rootH2_10006882 rootH2_1000688210 331
649 3300009036 Ga0105244_10023804 Ga0105244_100238042 331
650 3300025728 Ga0207655_1035463 Ga0207655_10354632 331
651 3300025935 Ga0207709_10000954 Ga0207709_100009545 331
652 3300044673 Ga0453683_0146652 Ga0453683_0146652_46_1113 331
653 3300045051 Ga0451576_0028416 Ga0451576_0028416_2767_3834 331
654 iso_pu_bacteria 2643221577 2643893820 331
655 iso_pu_bacteria 2643221685 2644476045 331
656 3300002773 JGI25152J39213_1000004 JGI25152J39213_100000430 332
657 3300002774 JGI25150J39212_1000491 JGI25150J39212_100049112 332
658 3300003187 JGI25151J46595_10000010 JGI25151J46595_1000001030 332
659 3300003215 JGI25153J46596_10000013 JGI25153J46596_1000001330 332
660 3300025245 Ga0207425_1000015 Ga0207425_1000015260 332
661 3300025258 Ga0209129_1000074 Ga0209129_1000074141 332
662 3300025294 Ga0209025_1000002 Ga0209025_10000021158 332
663 3300025297 Ga0209758_1000003 Ga0209758_10000031165 332
664 3300003856 Ga0058692_1000005 Ga0058692_1000005260 333
665 3300005337 Ga0070682_100039242 Ga0070682_1000392422 333
666 3300005539 Ga0068853_100003732 Ga0068853_1000037327 333
667 3300005563 Ga0068855_100294240 Ga0068855_1002942402 333
668 3300009551 Ga0105238_10013627 Ga0105238_100136279 333
669 3300013104 Ga0157370_10103954 Ga0157370_101039543 333
670 3300013307 Ga0157372_10119169 Ga0157372_101191692 333
671 3300025924 Ga0207694_10003531 Ga0207694_100035313 333
672 3300025949 Ga0207667_10068982 Ga0207667_100689822 333
673 3300026041 Ga0207639_10001388 Ga0207639_1000138810 333
674 3300027312 Ga0209371_1000031 Ga0209371_1000031256 333
675 3300030500 Ga0268256_1000034 Ga0268256_100003495 333
676 3300005289 Ga0065704_10071755 Ga0065704_100717553 334
677 3300005366 Ga0070659_100064651 Ga0070659_1000646512 334
678 3300005539 Ga0068853_100225609 Ga0068853_1002256092 334
679 3300009174 Ga0105241_10098597 Ga0105241_100985972 334
680 3300009551 Ga0105238_10115595 Ga0105238_101155952 334
681 3300014497 Ga0182008_10000083 Ga0182008_1000008317 334
682 3300017792 Ga0163161_10007719 Ga0163161_100077192 334
683 3300025924 Ga0207694_10015837 Ga0207694_100158372 334
684 3300025932 Ga0207690_10009308 Ga0207690_100093082 334
685 3300030732 Ga0316176_1036236 Ga0316176_10362362 334
686 3300037418 Ga0395900_0105645 Ga0395900_0105645_1825_2835 334
687 3300038443 Ga0395901_0005884 Ga0395901_0005884_8860_9870 334
688 3300046453 Ga0495627_010488 Ga0495627_010488_983_2008 334
689 3300046460 Ga0495638_0000923 Ga0495638_0000923_15567_16592 334
690 3300046522 Ga0495643_0001805 Ga0495643_0001805_6333_7358 334
691 3300046525 Ga0495663_0013141 Ga0495663_0013141_775_1800 334
692 3300046615 Ga0495656_0005742 Ga0495656_0005742_1964_2986 334
693 3300046660 Ga0495625_0103741 Ga0495625_0103741_680_1705 334
694 3300047318 Ga0495636_0026359 Ga0495636_0026359_1204_2226 334
695 3300047320 Ga0495672_0000214 Ga0495672_0000214_65181_66206 334
696 3300047472 Ga0495686_0008753 Ga0495686_0008753_5238_6263 334
697 3300048920 Ga0496117_0001300 Ga0496117_0001300_35005_36030 334
698 3300048920 Ga0496117_0002433 Ga0496117_0002433_5647_6729 334
699 3300048921 Ga0496118_0000406 Ga0496118_0000406_53910_54992 334
700 3300048921 Ga0496118_0000703 Ga0496118_0000703_42436_43461 334
701 3300048927 Ga0496124_0010087 Ga0496124_0010087_4555_5580 334
702 3300048927 Ga0496124_0074196 Ga0496124_0074196_918_1943 334
703 3300002067 JGI24735J21928_10025197 JGI24735J21928_100251972 335
704 3300015685 Ga0183369_1013 Ga0183369_1013145 335
705 3300037312 Ga0395899_0007681 Ga0395899_0007681_3983_4990 335
706 3300037312 Ga0395899_0107908 Ga0395899_0107908_784_1791 335
707 3300037418 Ga0395900_0001792 Ga0395900_0001792_2748_3755 335
708 3300037418 Ga0395900_0021154 Ga0395900_0021154_2362_3369 335
709 3300037466 Ga0395898_0021442 Ga0395898_0021442_3537_4544 335
710 3300037466 Ga0395898_0037984 Ga0395898_0037984_412_1428 335
711 3300037466 Ga0395898_0082078 Ga0395898_0082078_369_1376 335
712 3300037466 Ga0395898_0154467 Ga0395898_0154467_166_1173 335
713 3300038443 Ga0395901_0016478 Ga0395901_0016478_6336_7352 335
714 3300038443 Ga0395901_0017096 Ga0395901_0017096_1366_2373 335
715 3300038443 Ga0395901_0101173 Ga0395901_0101173_14_1021 335
716 3300049573 Ga0501037_0046762 Ga0501037_0046762_228_1250 335
717 3300049574 Ga0501038_0008714 Ga0501038_0008714_4045_5058 335
718 3300049580 Ga0501046_0005153 Ga0501046_0005153_3952_4965 335
719 3300049581 Ga0501047_0363103 Ga0501047_0363103_30_1043 335

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14237

GYF_2

GYF domain 2

54

100

0.97

PF01987

AIM24

Mitochondrial biogenesis AIM24

124

343

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yox-assembly1.cif.gz_C structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9143 72 308
1yox-assembly2.cif.gz_E structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9098 70 307
1yox-assembly1.cif.gz_A structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9097 72 308
1yox-assembly2.cif.gz_F structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9062 72 308
1yox-assembly1.cif.gz_C structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9054 72 308
ID Description Score Start End Superfamily
1yoxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.8913 72 308 3.60.160.10
1yoxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.8504 72 308 3.60.160.10
af_Q54F06_101_330_3.60.160.10 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.7968 68 308 3.60.160.10
af_Q54F06_101_330_3.60.160.10 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.7874 68 308 3.60.160.10
1pg6A00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.7729 74 307 3.60.160.10
ID Description Score Start End GO Terms
AF-A0A6M0BLV1-F1-model_v4 AIM24 family protein 0.9185 163 309
AF-A0A7C6WUJ8-F1-model_v4 AIM24 family protein 0.9114 165 313
AF-A0A7S1GJ19-F1-model_v4 Altered inheritance of mitochondria protein 24, mitochondrial 0.9075 162 296
AF-A0A4Q3R9G4-F1-model_v4 AIM24 family protein 0.9068 164 300
AF-A0A7C6WUJ8-F1-model_v4 AIM24 family protein 0.9056 165 313

Feature Viewer

pLDDT pTM Quality
73.87 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map