F477255
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 719 | 336 | 691 | 335 |
Family's Representative Sequence
| Representative Sequence | 3300039062|Ga0400483_095319|Ga0400483_095319_25782_26927 |
| Length | 381 |
| Sequence | MSWGFPCLIIVISVRIAYRTIFLMSQKMVFAIVWVRRCIIRAQSIQKEVFMSQWYLSYDGNPLGPFDYAQAVAQTRKNPNGYAWREGFAEWLPIGQISDLAPLEKPLPQAPPAARALVSDEIDFRIIGTEMQFVEVELDPGESAVAEAGAMMYKDAGVVMQTVFGDGSASTGGGFMDKLLGAGKRLLTGESLFMTVFSHTGDGKARVAFGAPYPGNIIPVHLNKFGGMLICQKDSFLCAAKGVAMGIYFQRKILTGLFGGEGFIMQKLEGDGLVFLHAGGTVADRTLSAGEVLHVDTGCIVAMEPSVQFEIEKAGGIKSALFGGEGLFFAKLLGPGKVWLQSLPFSRLAGRMLQAAPQRGGSKGEGSVLGALGGLLDGDNR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 3 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 4 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 5 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 6 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 7 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 8 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 9 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 10 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 11 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 12 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 13 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 14 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 15 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 16 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 17 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 18 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 19 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 20 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 21 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 22 | 2929206907 | Paenibacillus sp. R-74146 Hybrid assembly | Isolate | Unclassified |
| 23 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 24 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 25 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 26 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 27 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 28 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 29 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 30 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 31 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 32 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 33 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 35 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 36 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 39 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 46 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 50 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 95 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 101 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 102 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 103 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 104 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 105 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 192 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 193 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 194 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 208 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 209 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 210 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 212 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 213 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 214 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 221 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 222 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 223 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 224 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 225 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 226 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 227 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 228 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 229 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 230 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 231 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 233 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 234 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 235 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 236 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 237 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 238 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 239 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 240 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 241 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 242 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 243 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 244 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 245 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 284 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 285 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 286 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 287 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 288 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 289 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 290 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 291 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 292 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 293 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 317 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 318 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 327 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 328 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 329 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 330 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 333 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 334 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 335 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 336 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.11 |
| Metatranscriptomes | 0 |
| Isolates | 3.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.2 |
| Nodule | 0.14 |
| Rhizoplane | 0.56 |
| Rhizosphere | 85.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10025197 | 3300002067 | Bacteria | 1796 |
| 2 | JGI25152J39213_1000004 | 3300002773 | Bacteria | 191383 |
| 3 | JGI25150J39212_1000491 | 3300002774 | Bacteria | 16611 |
| 4 | JGI25151J46595_10000010 | 3300003187 | Bacteria | 277507 |
| 5 | JGI25406J46586_10000294 | 3300003203 | Bacteria | 22402 |
| 6 | JGI25406J46586_10000986 | 3300003203 | Bacteria | 13371 |
| 7 | JGI25406J46586_10047026 | 3300003203 | Bacteria | 1473 |
| 8 | JGI25153J46596_10000013 | 3300003215 | Bacteria | 303690 |
| 9 | rootH2_10006882 | 3300003320 | Bacteria | 14761 |
| 10 | rootH2_10081097 | 3300003320 | Bacteria | 7715 |
| 11 | Ga0058692_1000005 | 3300003856 | Bacteria | 398815 |
| 12 | Ga0065704_10071755 | 3300005289 | Bacteria | 10011 |
| 13 | Ga0065712_10002276 | 3300005290 | Bacteria | 8803 |
| 14 | Ga0065712_10017397 | 3300005290 | Bacteria | 1884 |
| 15 | Ga0065715_10002535 | 3300005293 | Bacteria | 6357 |
| 16 | Ga0070658_10129513 | 3300005327 | Bacteria | 2102 |
| 17 | Ga0070676_10002232 | 3300005328 | Bacteria | 9885 |
| 18 | Ga0070676_10036458 | 3300005328 | Bacteria | 2833 |
| 19 | Ga0070690_100010170 | 3300005330 | Bacteria | 5465 |
| 20 | Ga0070690_100021642 | 3300005330 | Bacteria | 3927 |
| 21 | Ga0070670_100000644 | 3300005331 | Bacteria | 27141 |
| 22 | Ga0070670_100001817 | 3300005331 | Bacteria | 17382 |
| 23 | Ga0070670_100008954 | 3300005331 | Bacteria | 8551 |
| 24 | Ga0070670_100026149 | 3300005331 | Bacteria | 5024 |
| 25 | Ga0070670_100398406 | 3300005331 | Bacteria | 1215 |
| 26 | Ga0070677_10016106 | 3300005333 | Bacteria | 2658 |
| 27 | Ga0068869_100002035 | 3300005334 | Bacteria | 12146 |
| 28 | Ga0068869_100003931 | 3300005334 | Bacteria | 9175 |
| 29 | Ga0068869_100150836 | 3300005334 | Bacteria | 1803 |
| 30 | Ga0070666_10049270 | 3300005335 | Bacteria | 2830 |
| 31 | Ga0070680_100193619 | 3300005336 | Bacteria | 1714 |
| 32 | Ga0070682_100039242 | 3300005337 | Bacteria | 2909 |
| 33 | Ga0068868_100025104 | 3300005338 | Bacteria | 4527 |
| 34 | Ga0068868_100119137 | 3300005338 | Bacteria | 2152 |
| 35 | Ga0070689_100084992 | 3300005340 | Bacteria | 2487 |
| 36 | Ga0070689_100212372 | 3300005340 | Bacteria | 1584 |
| 37 | Ga0070687_100008498 | 3300005343 | Bacteria | 4355 |
| 38 | Ga0070661_100199438 | 3300005344 | Bacteria | 1528 |
| 39 | Ga0070668_100003349 | 3300005347 | Bacteria | 11818 |
| 40 | Ga0070668_100077132 | 3300005347 | Bacteria | 2605 |
| 41 | Ga0070669_100005634 | 3300005353 | Bacteria | 9043 |
| 42 | Ga0070669_100029791 | 3300005353 | Bacteria | 3937 |
| 43 | Ga0070669_100157854 | 3300005353 | Bacteria | 1760 |
| 44 | Ga0070669_100243530 | 3300005353 | Bacteria | 1429 |
| 45 | Ga0070675_100000344 | 3300005354 | Bacteria | 31386 |
| 46 | Ga0070675_100002958 | 3300005354 | Bacteria | 12818 |
| 47 | Ga0070675_100016192 | 3300005354 | Bacteria | 5913 |
| 48 | Ga0070675_100018904 | 3300005354 | Bacteria | 5488 |
| 49 | Ga0070675_100038145 | 3300005354 | Bacteria | 3915 |
| 50 | Ga0070675_100054701 | 3300005354 | Bacteria | 3284 |
| 51 | Ga0070675_100193098 | 3300005354 | Bacteria | 1765 |
| 52 | Ga0070671_100064039 | 3300005355 | Bacteria | 3062 |
| 53 | Ga0070671_100268597 | 3300005355 | Bacteria | 1450 |
| 54 | Ga0070674_100000032 | 3300005356 | Bacteria | 64311 |
| 55 | Ga0070674_100162426 | 3300005356 | Unclassified | 1696 |
| 56 | Ga0070673_100004841 | 3300005364 | Bacteria | 8564 |
| 57 | Ga0070673_100009483 | 3300005364 | Bacteria | 6534 |
| 58 | Ga0070673_100175811 | 3300005364 | Bacteria | 1830 |
| 59 | Ga0070688_100010886 | 3300005365 | Bacteria | 5034 |
| 60 | Ga0070688_100023939 | 3300005365 | Bacteria | 3597 |
| 61 | Ga0070688_100159250 | 3300005365 | Bacteria | 1550 |
| 62 | Ga0070688_100162898 | 3300005365 | Bacteria | 1533 |
| 63 | Ga0070659_100064651 | 3300005366 | Bacteria | 2896 |
| 64 | Ga0070667_100008279 | 3300005367 | Bacteria | 8618 |
| 65 | Ga0070667_100302339 | 3300005367 | Bacteria | 1441 |
| 66 | Ga0070701_10063569 | 3300005438 | Bacteria | 1953 |
| 67 | Ga0070701_10106746 | 3300005438 | Bacteria | 1559 |
| 68 | Ga0070705_100153615 | 3300005440 | Bacteria | 1530 |
| 69 | Ga0070700_100027345 | 3300005441 | Bacteria | 3381 |
| 70 | Ga0070700_100068639 | 3300005441 | Bacteria | 2255 |
| 71 | Ga0070700_100073272 | 3300005441 | Bacteria | 2192 |
| 72 | Ga0070663_100044112 | 3300005455 | Bacteria | 3142 |
| 73 | Ga0070678_100040275 | 3300005456 | Bacteria | 3305 |
| 74 | Ga0070678_100081651 | 3300005456 | Bacteria | 2451 |
| 75 | Ga0070678_100090289 | 3300005456 | Bacteria | 2347 |
| 76 | Ga0070678_100205211 | 3300005456 | Bacteria | 1629 |
| 77 | Ga0070678_100223793 | 3300005456 | Bacteria | 1565 |
| 78 | Ga0070678_100248042 | 3300005456 | Bacteria | 1492 |
| 79 | Ga0070662_100123610 | 3300005457 | Bacteria | 1986 |
| 80 | Ga0070662_100214688 | 3300005457 | Bacteria | 1532 |
| 81 | Ga0068867_100000578 | 3300005459 | Bacteria | 24270 |
| 82 | Ga0068867_100051430 | 3300005459 | Bacteria | 3039 |
| 83 | Ga0068867_100094451 | 3300005459 | Bacteria | 2274 |
| 84 | Ga0070685_10009160 | 3300005466 | Bacteria | 5109 |
| 85 | Ga0070685_10009810 | 3300005466 | Bacteria | 4965 |
| 86 | Ga0070685_10304684 | 3300005466 | Bacteria | 1075 |
| 87 | Ga0070706_100027284 | 3300005467 | Bacteria | 5255 |
| 88 | Ga0070698_100002958 | 3300005471 | Bacteria | 18692 |
| 89 | Ga0070698_100043831 | 3300005471 | Bacteria | 4585 |
| 90 | Ga0070698_100354640 | 3300005471 | Bacteria | 1399 |
| 91 | Ga0070699_100053104 | 3300005518 | Bacteria | 3508 |
| 92 | Ga0070699_100237449 | 3300005518 | Bacteria | 1626 |
| 93 | Ga0068853_100003732 | 3300005539 | Bacteria | 11684 |
| 94 | Ga0068853_100225609 | 3300005539 | Bacteria | 1712 |
| 95 | Ga0070672_100009427 | 3300005543 | Bacteria | 6728 |
| 96 | Ga0070672_100015081 | 3300005543 | Bacteria | 5493 |
| 97 | Ga0070672_100068226 | 3300005543 | Bacteria | 2820 |
| 98 | Ga0070672_100083505 | 3300005543 | Bacteria | 2563 |
| 99 | Ga0070672_100104221 | 3300005543 | Bacteria | 2304 |
| 100 | Ga0070672_100188067 | 3300005543 | Bacteria | 1723 |
| 101 | Ga0070686_100013664 | 3300005544 | Bacteria | 4656 |
| 102 | Ga0070686_100167420 | 3300005544 | Bacteria | 1552 |
| 103 | Ga0070695_100005599 | 3300005545 | Bacteria | 7398 |
| 104 | Ga0070696_100101253 | 3300005546 | Bacteria | 2064 |
| 105 | Ga0070665_100000417 | 3300005548 | Bacteria | 62091 |
| 106 | Ga0070665_100093849 | 3300005548 | Bacteria | 3006 |
| 107 | Ga0070665_100132700 | 3300005548 | Bacteria | 2492 |
| 108 | Ga0070704_100074238 | 3300005549 | Bacteria | 2480 |
| 109 | Ga0070704_100177471 | 3300005549 | Bacteria | 1700 |
| 110 | Ga0068855_100294240 | 3300005563 | Bacteria | 1799 |
| 111 | Ga0070664_100005128 | 3300005564 | Bacteria | 10517 |
| 112 | Ga0070664_100040079 | 3300005564 | Bacteria | 3948 |
| 113 | Ga0070664_100044735 | 3300005564 | Bacteria | 3738 |
| 114 | Ga0070664_100078015 | 3300005564 | Bacteria | 2849 |
| 115 | Ga0068854_100229420 | 3300005578 | Bacteria | 1473 |
| 116 | Ga0068852_100409083 | 3300005616 | Bacteria | 1336 |
| 117 | Ga0068859_100006708 | 3300005617 | Bacteria | 11694 |
| 118 | Ga0068859_100078804 | 3300005617 | Bacteria | 3335 |
| 119 | Ga0068859_100123928 | 3300005617 | Bacteria | 2652 |
| 120 | Ga0068864_100027300 | 3300005618 | Bacteria | 4820 |
| 121 | Ga0068864_100100025 | 3300005618 | Bacteria | 2570 |
| 122 | Ga0068864_100138443 | 3300005618 | Bacteria | 2194 |
| 123 | Ga0068864_100326655 | 3300005618 | Bacteria | 1442 |
| 124 | Ga0068866_10056893 | 3300005718 | Bacteria | 2013 |
| 125 | Ga0068861_100064991 | 3300005719 | Bacteria | 2808 |
| 126 | Ga0068870_10015656 | 3300005840 | Bacteria | 3604 |
| 127 | Ga0068870_10016802 | 3300005840 | Bacteria | 3505 |
| 128 | Ga0068863_100016001 | 3300005841 | Bacteria | 7193 |
| 129 | Ga0068863_100441691 | 3300005841 | Bacteria | 1276 |
| 130 | Ga0068858_100023552 | 3300005842 | Bacteria | 5735 |
| 131 | Ga0068858_100077956 | 3300005842 | Bacteria | 3079 |
| 132 | Ga0068858_100324155 | 3300005842 | Bacteria | 1473 |
| 133 | Ga0068860_100057807 | 3300005843 | Bacteria | 3687 |
| 134 | Ga0068860_100108586 | 3300005843 | Bacteria | 2652 |
| 135 | Ga0068862_100031342 | 3300005844 | Bacteria | 4487 |
| 136 | Ga0081538_10050621 | 3300005981 | Bacteria | 2505 |
| 137 | Ga0081539_10000013 | 3300005985 | Bacteria | 432395 |
| 138 | Ga0081539_10000164 | 3300005985 | Bacteria | 154639 |
| 139 | Ga0081539_10000750 | 3300005985 | Bacteria | 64517 |
| 140 | Ga0081539_10038985 | 3300005985 | Bacteria | 2809 |
| 141 | Ga0081539_10046258 | 3300005985 | Bacteria | 2495 |
| 142 | Ga0075368_10070091 | 3300006042 | Bacteria | 1415 |
| 143 | Ga0075364_10000276 | 3300006051 | Bacteria | 25091 |
| 144 | Ga0075364_10158675 | 3300006051 | Bacteria | 1526 |
| 145 | Ga0075366_10071524 | 3300006195 | Bacteria | 2066 |
| 146 | Ga0097621_100117885 | 3300006237 | Bacteria | 2250 |
| 147 | Ga0068871_100231017 | 3300006358 | Bacteria | 1605 |
| 148 | Ga0068871_100334160 | 3300006358 | Bacteria | 1337 |
| 149 | Ga0075428_100000166 | 3300006844 | Bacteria | 60871 |
| 150 | Ga0075428_100015404 | 3300006844 | Bacteria | 8476 |
| 151 | Ga0075428_100027849 | 3300006844 | Bacteria | 6252 |
| 152 | Ga0075428_100083995 | 3300006844 | Bacteria | 3474 |
| 153 | Ga0075428_100151426 | 3300006844 | Bacteria | 2520 |
| 154 | Ga0075428_100256995 | 3300006844 | Bacteria | 1882 |
| 155 | Ga0075430_100000691 | 3300006846 | Bacteria | 25696 |
| 156 | Ga0075430_100054231 | 3300006846 | Bacteria | 3374 |
| 157 | Ga0075430_100162716 | 3300006846 | Bacteria | 1858 |
| 158 | Ga0075430_100173774 | 3300006846 | Bacteria | 1792 |
| 159 | Ga0075430_100354721 | 3300006846 | Bacteria | 1211 |
| 160 | Ga0075431_100001885 | 3300006847 | Bacteria | 19887 |
| 161 | Ga0075431_100044479 | 3300006847 | Bacteria | 4580 |
| 162 | Ga0075431_100066473 | 3300006847 | Bacteria | 3722 |
| 163 | Ga0075431_100131410 | 3300006847 | Bacteria | 2582 |
| 164 | Ga0075431_100179135 | 3300006847 | Bacteria | 2175 |
| 165 | Ga0075431_100181072 | 3300006847 | Bacteria | 2163 |
| 166 | Ga0075431_100389367 | 3300006847 | Bacteria | 1396 |
| 167 | Ga0075433_10000037 | 3300006852 | Bacteria | 53492 |
| 168 | Ga0075433_10001456 | 3300006852 | Bacteria | 17484 |
| 169 | Ga0075433_10005012 | 3300006852 | Bacteria | 10372 |
| 170 | Ga0075434_100000596 | 3300006871 | Bacteria | 27926 |
| 171 | Ga0075434_100003672 | 3300006871 | Bacteria | 13714 |
| 172 | Ga0075434_100027168 | 3300006871 | Bacteria | 5616 |
| 173 | Ga0075429_100048999 | 3300006880 | Bacteria | 3673 |
| 174 | Ga0075429_100062312 | 3300006880 | Bacteria | 3249 |
| 175 | Ga0075429_100107600 | 3300006880 | Bacteria | 2437 |
| 176 | Ga0075429_100250915 | 3300006880 | Bacteria | 1550 |
| 177 | Ga0075429_100285745 | 3300006880 | Bacteria | 1444 |
| 178 | Ga0068865_100001886 | 3300006881 | Bacteria | 12325 |
| 179 | Ga0068865_100105016 | 3300006881 | Bacteria | 2074 |
| 180 | Ga0068865_100215622 | 3300006881 | Bacteria | 1498 |
| 181 | Ga0097620_100006708 | 3300006931 | Bacteria | 11694 |
| 182 | Ga0097620_100078802 | 3300006931 | Bacteria | 3335 |
| 183 | Ga0097620_100123925 | 3300006931 | Bacteria | 2652 |
| 184 | Ga0075435_100016436 | 3300007076 | Bacteria | 5580 |
| 185 | Ga0075435_100040676 | 3300007076 | Bacteria | 3713 |
| 186 | Ga0075435_100201026 | 3300007076 | Bacteria | 1689 |
| 187 | Ga0105244_10003455 | 3300009036 | Bacteria | 11260 |
| 188 | Ga0105244_10023804 | 3300009036 | Bacteria | 3352 |
| 189 | Ga0111539_10000417 | 3300009094 | Bacteria | 53293 |
| 190 | Ga0111539_10002191 | 3300009094 | Bacteria | 26074 |
| 191 | Ga0111539_10002820 | 3300009094 | Bacteria | 23099 |
| 192 | Ga0111539_10004794 | 3300009094 | Bacteria | 17647 |
| 193 | Ga0111539_10007840 | 3300009094 | Bacteria | 13638 |
| 194 | Ga0111539_10015750 | 3300009094 | Bacteria | 9394 |
| 195 | Ga0111539_10027136 | 3300009094 | Bacteria | 6993 |
| 196 | Ga0111539_10033958 | 3300009094 | Bacteria | 6190 |
| 197 | Ga0111539_10042748 | 3300009094 | Bacteria | 5439 |
| 198 | Ga0111539_10077166 | 3300009094 | Bacteria | 3921 |
| 199 | Ga0111539_10162823 | 3300009094 | Bacteria | 2609 |
| 200 | Ga0105247_10002389 | 3300009101 | Bacteria | 12765 |
| 201 | Ga0114129_10009591 | 3300009147 | Bacteria | 13809 |
| 202 | Ga0114129_10034123 | 3300009147 | Bacteria | 7187 |
| 203 | Ga0114129_10048306 | 3300009147 | Bacteria | 5979 |
| 204 | Ga0114129_10076433 | 3300009147 | Bacteria | 4662 |
| 205 | Ga0114129_10116587 | 3300009147 | Bacteria | 3680 |
| 206 | Ga0114129_10267423 | 3300009147 | Bacteria | 2289 |
| 207 | Ga0114129_10695544 | 3300009147 | Bacteria | 1307 |
| 208 | Ga0105243_10015475 | 3300009148 | Bacteria | 5765 |
| 209 | Ga0105241_10000371 | 3300009174 | Bacteria | 34199 |
| 210 | Ga0105241_10098597 | 3300009174 | Bacteria | 2319 |
| 211 | Ga0105248_10111233 | 3300009177 | Bacteria | 3089 |
| 212 | Ga0105237_10007492 | 3300009545 | Bacteria | 11935 |
| 213 | Ga0105238_10013627 | 3300009551 | Bacteria | 8212 |
| 214 | Ga0105238_10115595 | 3300009551 | Bacteria | 2662 |
| 215 | Ga0105238_10181197 | 3300009551 | Bacteria | 2083 |
| 216 | Ga0105249_10007783 | 3300009553 | Bacteria | 9337 |
| 217 | Ga0105249_10009765 | 3300009553 | Bacteria | 8407 |
| 218 | Ga0105249_10015866 | 3300009553 | Bacteria | 6676 |
| 219 | Ga0105249_10147327 | 3300009553 | Bacteria | 2263 |
| 220 | Ga0105239_10250089 | 3300010375 | Bacteria | 1991 |
| 221 | Ga0105246_10231957 | 3300011119 | Bacteria | 1454 |
| 222 | Ga0157370_10103954 | 3300013104 | Bacteria | 2659 |
| 223 | Ga0163162_10019877 | 3300013306 | Bacteria | 6595 |
| 224 | Ga0163162_10308366 | 3300013306 | Unclassified | 1715 |
| 225 | Ga0157372_10119169 | 3300013307 | Bacteria | 3029 |
| 226 | Ga0157375_10042900 | 3300013308 | Bacteria | 4382 |
| 227 | Ga0157375_10477908 | 3300013308 | Bacteria | 1411 |
| 228 | Ga0163163_10207110 | 3300014325 | Bacteria | 2010 |
| 229 | Ga0157380_10000799 | 3300014326 | Bacteria | 19789 |
| 230 | Ga0157380_10005869 | 3300014326 | Bacteria | 8590 |
| 231 | Ga0182008_10000083 | 3300014497 | Bacteria | 73635 |
| 232 | Ga0157377_10001309 | 3300014745 | Bacteria | 10654 |
| 233 | Ga0157379_10058700 | 3300014968 | Bacteria | 3441 |
| 234 | Ga0157379_10093480 | 3300014968 | Bacteria | 2698 |
| 235 | Ga0183369_1013 | 3300015685 | Bacteria | 222738 |
| 236 | Ga0163161_10007719 | 3300017792 | Bacteria | 7442 |
| 237 | Ga0163161_10017406 | 3300017792 | Bacteria | 5029 |
| 238 | Ga0163161_10183547 | 3300017792 | Bacteria | 1605 |
| 239 | Ga0207425_1000015 | 3300025245 | Bacteria | 466368 |
| 240 | Ga0209129_1000074 | 3300025258 | Bacteria | 205648 |
| 241 | Ga0209676_1000104 | 3300025292 | Bacteria | 226581 |
| 242 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 243 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 244 | Ga0209050_1038650 | 3300025298 | Bacteria | 1357 |
| 245 | Ga0207697_10002637 | 3300025315 | Bacteria | 9195 |
| 246 | Ga0207655_1003689 | 3300025728 | Bacteria | 11283 |
| 247 | Ga0207655_1035463 | 3300025728 | Bacteria | 2226 |
| 248 | Ga0207653_10020057 | 3300025885 | Bacteria | 2113 |
| 249 | Ga0207682_10001038 | 3300025893 | Bacteria | 12802 |
| 250 | Ga0207682_10073052 | 3300025893 | Bacteria | 1456 |
| 251 | Ga0207682_10078534 | 3300025893 | Bacteria | 1410 |
| 252 | Ga0207642_10044334 | 3300025899 | Bacteria | 1968 |
| 253 | Ga0207688_10007643 | 3300025901 | Bacteria | 5886 |
| 254 | Ga0207645_10000611 | 3300025907 | Bacteria | 29564 |
| 255 | Ga0207645_10005408 | 3300025907 | Bacteria | 9262 |
| 256 | Ga0207643_10000068 | 3300025908 | Bacteria | 69282 |
| 257 | Ga0207643_10002433 | 3300025908 | Bacteria | 10070 |
| 258 | Ga0207643_10047403 | 3300025908 | Bacteria | 2431 |
| 259 | Ga0207705_10264858 | 3300025909 | Bacteria | 1313 |
| 260 | Ga0207660_10080772 | 3300025917 | Bacteria | 2388 |
| 261 | Ga0207662_10009971 | 3300025918 | Bacteria | 5242 |
| 262 | Ga0207649_10166394 | 3300025920 | Bacteria | 1532 |
| 263 | Ga0207681_10004748 | 3300025923 | Bacteria | 8360 |
| 264 | Ga0207681_10079435 | 3300025923 | Bacteria | 2311 |
| 265 | Ga0207681_10100840 | 3300025923 | Bacteria | 2082 |
| 266 | Ga0207681_10108179 | 3300025923 | Bacteria | 2018 |
| 267 | Ga0207694_10003531 | 3300025924 | Bacteria | 12413 |
| 268 | Ga0207694_10011457 | 3300025924 | Bacteria | 6692 |
| 269 | Ga0207694_10015837 | 3300025924 | Bacteria | 5687 |
| 270 | Ga0207650_10009832 | 3300025925 | Bacteria | 6543 |
| 271 | Ga0207650_10014393 | 3300025925 | Bacteria | 5498 |
| 272 | Ga0207650_10046351 | 3300025925 | Bacteria | 3201 |
| 273 | Ga0207650_10361400 | 3300025925 | Bacteria | 1196 |
| 274 | Ga0207659_10000353 | 3300025926 | Bacteria | 27408 |
| 275 | Ga0207659_10002915 | 3300025926 | Bacteria | 10188 |
| 276 | Ga0207659_10003941 | 3300025926 | Bacteria | 8960 |
| 277 | Ga0207659_10009215 | 3300025926 | Bacteria | 6166 |
| 278 | Ga0207659_10011872 | 3300025926 | Bacteria | 5518 |
| 279 | Ga0207659_10056571 | 3300025926 | Bacteria | 2810 |
| 280 | Ga0207659_10193622 | 3300025926 | Bacteria | 1619 |
| 281 | Ga0207659_10300465 | 3300025926 | Bacteria | 1318 |
| 282 | Ga0207687_10040448 | 3300025927 | Bacteria | 3196 |
| 283 | Ga0207687_10318467 | 3300025927 | Bacteria | 1258 |
| 284 | Ga0207644_10051921 | 3300025931 | Bacteria | 2945 |
| 285 | Ga0207644_10064505 | 3300025931 | Bacteria | 2661 |
| 286 | Ga0207644_10141485 | 3300025931 | Bacteria | 1853 |
| 287 | Ga0207690_10009308 | 3300025932 | Bacteria | 5836 |
| 288 | Ga0207706_10008244 | 3300025933 | Bacteria | 9613 |
| 289 | Ga0207706_10052029 | 3300025933 | Bacteria | 3616 |
| 290 | Ga0207706_10138031 | 3300025933 | Bacteria | 2145 |
| 291 | Ga0207706_10167026 | 3300025933 | Bacteria | 1934 |
| 292 | Ga0207709_10000954 | 3300025935 | Bacteria | 21622 |
| 293 | Ga0207709_10004516 | 3300025935 | Bacteria | 8024 |
| 294 | Ga0207670_10057930 | 3300025936 | Bacteria | 2630 |
| 295 | Ga0207670_10114634 | 3300025936 | Bacteria | 1948 |
| 296 | Ga0207669_10000642 | 3300025937 | Bacteria | 15113 |
| 297 | Ga0207704_10002632 | 3300025938 | Bacteria | 8101 |
| 298 | Ga0207691_10003313 | 3300025940 | Bacteria | 15693 |
| 299 | Ga0207691_10011105 | 3300025940 | Bacteria | 8646 |
| 300 | Ga0207691_10033132 | 3300025940 | Bacteria | 4812 |
| 301 | Ga0207691_10042552 | 3300025940 | Bacteria | 4187 |
| 302 | Ga0207691_10059555 | 3300025940 | Bacteria | 3472 |
| 303 | Ga0207691_10256827 | 3300025940 | Bacteria | 1507 |
| 304 | Ga0207711_10054368 | 3300025941 | Bacteria | 3436 |
| 305 | Ga0207689_10000219 | 3300025942 | Bacteria | 50693 |
| 306 | Ga0207689_10002433 | 3300025942 | Bacteria | 17334 |
| 307 | Ga0207689_10043379 | 3300025942 | Bacteria | 3718 |
| 308 | Ga0207689_10107077 | 3300025942 | Bacteria | 2297 |
| 309 | Ga0207689_10118812 | 3300025942 | Bacteria | 2174 |
| 310 | Ga0207679_10013441 | 3300025945 | Bacteria | 5368 |
| 311 | Ga0207679_10064008 | 3300025945 | Bacteria | 2747 |
| 312 | Ga0207679_10104385 | 3300025945 | Bacteria | 2224 |
| 313 | Ga0207679_10168820 | 3300025945 | Bacteria | 1799 |
| 314 | Ga0207679_10298136 | 3300025945 | Bacteria | 1388 |
| 315 | Ga0207679_10303437 | 3300025945 | Bacteria | 1377 |
| 316 | Ga0207667_10068982 | 3300025949 | Bacteria | 3680 |
| 317 | Ga0207651_10000813 | 3300025960 | Bacteria | 13454 |
| 318 | Ga0207651_10012886 | 3300025960 | Bacteria | 4755 |
| 319 | Ga0207651_10091094 | 3300025960 | Bacteria | 2231 |
| 320 | Ga0207651_10411410 | 3300025960 | Bacteria | 1152 |
| 321 | Ga0207712_10007668 | 3300025961 | Bacteria | 6825 |
| 322 | Ga0207668_10013679 | 3300025972 | Bacteria | 5006 |
| 323 | Ga0207668_10222610 | 3300025972 | Bacteria | 1516 |
| 324 | Ga0207640_10143130 | 3300025981 | Bacteria | 1746 |
| 325 | Ga0207658_10011784 | 3300025986 | Bacteria | 5956 |
| 326 | Ga0207677_10068506 | 3300026023 | Bacteria | 2491 |
| 327 | Ga0207703_10060611 | 3300026035 | Bacteria | 3095 |
| 328 | Ga0207703_10271081 | 3300026035 | Bacteria | 1537 |
| 329 | Ga0207639_10001388 | 3300026041 | Bacteria | 16358 |
| 330 | Ga0207678_10064681 | 3300026067 | Bacteria | 3142 |
| 331 | Ga0207708_10015509 | 3300026075 | Bacteria | 5715 |
| 332 | Ga0207708_10015853 | 3300026075 | Bacteria | 5657 |
| 333 | Ga0207708_10102955 | 3300026075 | Bacteria | 2211 |
| 334 | Ga0207641_10091615 | 3300026088 | Bacteria | 2660 |
| 335 | Ga0207641_10098826 | 3300026088 | Bacteria | 2567 |
| 336 | Ga0207648_10001252 | 3300026089 | Bacteria | 28387 |
| 337 | Ga0207648_10178439 | 3300026089 | Bacteria | 1879 |
| 338 | Ga0207676_10025450 | 3300026095 | Bacteria | 4391 |
| 339 | Ga0207676_10121225 | 3300026095 | Bacteria | 2206 |
| 340 | Ga0207676_10173795 | 3300026095 | Bacteria | 1879 |
| 341 | Ga0207676_10409490 | 3300026095 | Bacteria | 1269 |
| 342 | Ga0207674_10152404 | 3300026116 | Bacteria | 2268 |
| 343 | Ga0207675_100088473 | 3300026118 | Bacteria | 2909 |
| 344 | Ga0207683_10033861 | 3300026121 | Bacteria | 4439 |
| 345 | Ga0207683_10037554 | 3300026121 | Bacteria | 4218 |
| 346 | Ga0207683_10038335 | 3300026121 | Bacteria | 4176 |
| 347 | Ga0207683_10065501 | 3300026121 | Bacteria | 3204 |
| 348 | Ga0207683_10318098 | 3300026121 | Bacteria | 1425 |
| 349 | Ga0209371_1000031 | 3300027312 | Bacteria | 399263 |
| 350 | Ga0209974_10018478 | 3300027876 | Bacteria | 2313 |
| 351 | Ga0207428_10000444 | 3300027907 | Bacteria | 50619 |
| 352 | Ga0207428_10003654 | 3300027907 | Bacteria | 14827 |
| 353 | Ga0207428_10019347 | 3300027907 | Bacteria | 5806 |
| 354 | Ga0207428_10024118 | 3300027907 | Bacteria | 5108 |
| 355 | Ga0207428_10028854 | 3300027907 | Bacteria | 4605 |
| 356 | Ga0207428_10033872 | 3300027907 | Bacteria | 4190 |
| 357 | Ga0207428_10061782 | 3300027907 | Bacteria | 2964 |
| 358 | Ga0207428_10094480 | 3300027907 | Bacteria | 2318 |
| 359 | Ga0268266_10000646 | 3300028379 | Bacteria | 47334 |
| 360 | Ga0268266_10000688 | 3300028379 | Bacteria | 45589 |
| 361 | Ga0268266_10071310 | 3300028379 | Bacteria | 3011 |
| 362 | Ga0268264_10041798 | 3300028381 | Bacteria | 3793 |
| 363 | Ga0268264_10304043 | 3300028381 | Bacteria | 1502 |
| 364 | Ga0268256_1000034 | 3300030500 | Bacteria | 398909 |
| 365 | Ga0316176_1036236 | 3300030732 | Bacteria | 2719 |
| 366 | Ga0307408_100026796 | 3300031548 | Bacteria | 3964 |
| 367 | Ga0307408_100249465 | 3300031548 | Bacteria | 1463 |
| 368 | Ga0307408_100256067 | 3300031548 | Bacteria | 1446 |
| 369 | Ga0316575_10004403 | 3300031665 | Bacteria | 4957 |
| 370 | Ga0316575_10051417 | 3300031665 | Bacteria | 1641 |
| 371 | Ga0316579_10009229 | 3300031691 | Bacteria | 4143 |
| 372 | Ga0316579_10109556 | 3300031691 | Bacteria | 1325 |
| 373 | Ga0316576_10001606 | 3300031727 | Bacteria | 12342 |
| 374 | Ga0316576_10003024 | 3300031727 | Bacteria | 9771 |
| 375 | Ga0316576_10003307 | 3300031727 | Bacteria | 9411 |
| 376 | Ga0316576_10007410 | 3300031727 | Bacteria | 6912 |
| 377 | Ga0316576_10007966 | 3300031727 | Bacteria | 6711 |
| 378 | Ga0316576_10040530 | 3300031727 | Bacteria | 3348 |
| 379 | Ga0316576_10071225 | 3300031727 | Bacteria | 2564 |
| 380 | Ga0316576_10150142 | 3300031727 | Bacteria | 1756 |
| 381 | Ga0316576_10171913 | 3300031727 | Bacteria | 1635 |
| 382 | Ga0316578_10000406 | 3300031728 | Bacteria | 14022 |
| 383 | Ga0316578_10007802 | 3300031728 | Bacteria | 5402 |
| 384 | Ga0316578_10014816 | 3300031728 | Bacteria | 4178 |
| 385 | Ga0316578_10020356 | 3300031728 | Bacteria | 3665 |
| 386 | Ga0307405_10003265 | 3300031731 | Bacteria | 7402 |
| 387 | Ga0307405_10009616 | 3300031731 | Bacteria | 4966 |
| 388 | Ga0316577_10027166 | 3300031733 | Bacteria | 3191 |
| 389 | Ga0307413_10009265 | 3300031824 | Bacteria | 4703 |
| 390 | Ga0307410_10011351 | 3300031852 | Bacteria | 5091 |
| 391 | Ga0307410_10036143 | 3300031852 | Bacteria | 3214 |
| 392 | Ga0307410_10039157 | 3300031852 | Bacteria | 3110 |
| 393 | Ga0307410_10190881 | 3300031852 | Bacteria | 1558 |
| 394 | Ga0307406_10027319 | 3300031901 | Bacteria | 3438 |
| 395 | Ga0307407_10003095 | 3300031903 | Bacteria | 6721 |
| 396 | Ga0307412_10014576 | 3300031911 | Bacteria | 4640 |
| 397 | Ga0307412_10023477 | 3300031911 | Bacteria | 3795 |
| 398 | Ga0307409_100004703 | 3300031995 | Bacteria | 7727 |
| 399 | Ga0307409_100064353 | 3300031995 | Bacteria | 2880 |
| 400 | Ga0307409_100084635 | 3300031995 | Bacteria | 2576 |
| 401 | Ga0307409_100186988 | 3300031995 | Bacteria | 1840 |
| 402 | Ga0307416_100014475 | 3300032002 | Bacteria | 5411 |
| 403 | Ga0307416_100050742 | 3300032002 | Bacteria | 3309 |
| 404 | Ga0307416_100053949 | 3300032002 | Bacteria | 3228 |
| 405 | Ga0307416_100107092 | 3300032002 | Bacteria | 2452 |
| 406 | Ga0307416_100133426 | 3300032002 | Bacteria | 2241 |
| 407 | Ga0307416_100596403 | 3300032002 | Bacteria | 1184 |
| 408 | Ga0307414_10055384 | 3300032004 | Bacteria | 2776 |
| 409 | Ga0307414_10055409 | 3300032004 | Bacteria | 2776 |
| 410 | Ga0307411_10003472 | 3300032005 | Bacteria | 7321 |
| 411 | Ga0307411_10036389 | 3300032005 | Bacteria | 3084 |
| 412 | Ga0307415_100001761 | 3300032126 | Bacteria | 10574 |
| 413 | Ga0307415_100019882 | 3300032126 | Bacteria | 4087 |
| 414 | Ga0307415_100201023 | 3300032126 | Bacteria | 1581 |
| 415 | Ga0307415_100244426 | 3300032126 | Bacteria | 1454 |
| 416 | Ga0316583_10003725 | 3300032133 | Bacteria | 5393 |
| 417 | Ga0316585_10000650 | 3300032137 | Bacteria | 8577 |
| 418 | Ga0316580_10006382 | 3300032139 | Bacteria | 3485 |
| 419 | Ga0316580_10017769 | 3300032139 | Bacteria | 2188 |
| 420 | Ga0316580_10045856 | 3300032139 | Bacteria | 1348 |
| 421 | Ga0373961_0015297 | 3300035241 | Bacteria | 1960 |
| 422 | Ga0316574_0016859 | 3300035398 | Unclassified | 4263 |
| 423 | Ga0316574_0158144 | 3300035398 | Unclassified | 1460 |
| 424 | Ga0316582_0002036 | 3300036647 | Bacteria | 9299 |
| 425 | Ga0316582_0005548 | 3300036647 | Bacteria | 6514 |
| 426 | Ga0316582_0015154 | 3300036647 | Bacteria | 4398 |
| 427 | Ga0316582_0070413 | 3300036647 | Bacteria | 2263 |
| 428 | Ga0316582_0132388 | 3300036647 | Bacteria | 1676 |
| 429 | Ga0316584_0002001 | 3300036712 | Bacteria | 12732 |
| 430 | Ga0316584_0002281 | 3300036712 | Bacteria | 12072 |
| 431 | Ga0316584_0005005 | 3300036712 | Bacteria | 8829 |
| 432 | Ga0316584_0051174 | 3300036712 | Bacteria | 3089 |
| 433 | Ga0316584_0061836 | 3300036712 | Bacteria | 2804 |
| 434 | Ga0316584_0095851 | 3300036712 | Bacteria | 2221 |
| 435 | Ga0395899_0007681 | 3300037312 | Bacteria | 8313 |
| 436 | Ga0395899_0107908 | 3300037312 | Bacteria | 2003 |
| 437 | Ga0395900_0001792 | 3300037418 | Bacteria | 24630 |
| 438 | Ga0395900_0021154 | 3300037418 | Bacteria | 6648 |
| 439 | Ga0395900_0105645 | 3300037418 | Bacteria | 2893 |
| 440 | Ga0395898_0021442 | 3300037466 | Bacteria | 6551 |
| 441 | Ga0395898_0037984 | 3300037466 | Bacteria | 4774 |
| 442 | Ga0395898_0082078 | 3300037466 | Bacteria | 3107 |
| 443 | Ga0395898_0154467 | 3300037466 | Bacteria | 2195 |
| 444 | Ga0395898_0263108 | 3300037466 | Unclassified | 1645 |
| 445 | Ga0395905_0005868 | 3300037471 | Bacteria | 12470 |
| 446 | Ga0395905_0159651 | 3300037471 | Bacteria | 2119 |
| 447 | Ga0395905_0166445 | 3300037471 | Bacteria | 2072 |
| 448 | Ga0395905_0475261 | 3300037471 | Bacteria | 1149 |
| 449 | Ga0316581_0072207 | 3300037588 | Bacteria | 1061 |
| 450 | Ga0395901_0005884 | 3300038443 | Bacteria | 12410 |
| 451 | Ga0395901_0016478 | 3300038443 | Bacteria | 7529 |
| 452 | Ga0395901_0017096 | 3300038443 | Bacteria | 7394 |
| 453 | Ga0395901_0101173 | 3300038443 | Bacteria | 3024 |
| 454 | Ga0395901_0508565 | 3300038443 | Bacteria | 1226 |
| 455 | Ga0237819_07252 | 3300038705 | Bacteria | 1604 |
| 456 | Ga0400484_10749 | 3300038725 | Bacteria | 4779 |
| 457 | Ga0400484_11841 | 3300038725 | Bacteria | 7739 |
| 458 | Ga0400484_32425 | 3300038725 | Bacteria | 1880 |
| 459 | Ga0400490_04360 | 3300038726 | Bacteria | 4580 |
| 460 | Ga0400490_10536 | 3300038726 | Bacteria | 5004 |
| 461 | Ga0400490_11632 | 3300038726 | Bacteria | 4628 |
| 462 | Ga0400490_24154 | 3300038726 | Bacteria | 25221 |
| 463 | Ga0400490_55129 | 3300038726 | Bacteria | 10975 |
| 464 | Ga0400491_06558 | 3300038727 | Bacteria | 4193 |
| 465 | Ga0400485_07187 | 3300038735 | Bacteria | 1337 |
| 466 | Ga0400485_12416 | 3300038735 | Bacteria | 14304 |
| 467 | Ga0400485_18741 | 3300038735 | Bacteria | 31288 |
| 468 | Ga0400485_20208 | 3300038735 | Bacteria | 42303 |
| 469 | Ga0400488_17101 | 3300038741 | Bacteria | 3345 |
| 470 | Ga0400488_36447 | 3300038741 | Bacteria | 1414 |
| 471 | Ga0400488_56624 | 3300038741 | Bacteria | 33459 |
| 472 | Ga0400488_61529 | 3300038741 | Bacteria | 8471 |
| 473 | Ga0400486_01713 | 3300038742 | Bacteria | 7445 |
| 474 | Ga0400486_08357 | 3300038742 | Bacteria | 47260 |
| 475 | Ga0400486_13010 | 3300038742 | Bacteria | 13533 |
| 476 | Ga0400486_19352 | 3300038742 | Bacteria | 4221 |
| 477 | Ga0400486_32970 | 3300038742 | Bacteria | 19800 |
| 478 | Ga0400483_095319 | 3300039062 | Bacteria | 29855 |
| 479 | Ga0400483_113209 | 3300039062 | Bacteria | 4110 |
| 480 | Ga0400483_172553 | 3300039062 | Bacteria | 18169 |
| 481 | Ga0400483_202581 | 3300039062 | Bacteria | 1914 |
| 482 | Ga0400483_259742 | 3300039062 | Bacteria | 2269 |
| 483 | Ga0400489_19794 | 3300039093 | Bacteria | 11642 |
| 484 | Ga0400489_24659 | 3300039093 | Bacteria | 24146 |
| 485 | Ga0400489_56300 | 3300039093 | Bacteria | 20080 |
| 486 | Ga0400489_70520 | 3300039093 | Bacteria | 12186 |
| 487 | Ga0400489_94355 | 3300039093 | Bacteria | 9207 |
| 488 | Ga0400487_06632 | 3300039110 | Bacteria | 20467 |
| 489 | Ga0400487_15943 | 3300039110 | Unclassified | 1634 |
| 490 | Ga0400487_29500 | 3300039110 | Unclassified | 2176 |
| 491 | Ga0400487_49500 | 3300039110 | Bacteria | 2637 |
| 492 | Ga0439453_0008816 | 3300041408 | Bacteria | 1629 |
| 493 | Ga0451800_1190734 | 3300041459 | Bacteria | 1551 |
| 494 | Ga0451807_2431939 | 3300041486 | Bacteria | 1519 |
| 495 | Ga0439442_028246 | 3300042002 | Bacteria | 1170 |
| 496 | Ga0439450_003741 | 3300042008 | Bacteria | 2545 |
| 497 | Ga0450911_004969 | 3300042115 | Bacteria | 2116 |
| 498 | Ga0450894_012888 | 3300042131 | Bacteria | 1096 |
| 499 | Ga0450895_004883 | 3300042132 | Bacteria | 1069 |
| 500 | Ga0450896_002709 | 3300042133 | Bacteria | 2308 |
| 501 | Ga0450905_003275 | 3300042142 | Bacteria | 2124 |
| 502 | Ga0439435_0001971 | 3300042436 | Bacteria | 3956 |
| 503 | Ga0439435_0036416 | 3300042436 | Bacteria | 1360 |
| 504 | Ga0451577_0003629 | 3300042876 | Bacteria | 16952 |
| 505 | Ga0451577_0003928 | 3300042876 | Bacteria | 16057 |
| 506 | Ga0451577_0007132 | 3300042876 | Bacteria | 11021 |
| 507 | Ga0451577_0038348 | 3300042876 | Bacteria | 4310 |
| 508 | Ga0451577_0089686 | 3300042876 | Bacteria | 2744 |
| 509 | Ga0451577_0142465 | 3300042876 | Bacteria | 2154 |
| 510 | Ga0453683_0005885 | 3300044673 | Bacteria | 8482 |
| 511 | Ga0453683_0146652 | 3300044673 | Bacteria | 1490 |
| 512 | Ga0453684_0000107 | 3300044712 | Bacteria | 362864 |
| 513 | Ga0453684_0000414 | 3300044712 | Bacteria | 174278 |
| 514 | Ga0453684_0001111 | 3300044712 | Bacteria | 84488 |
| 515 | Ga0453684_0001479 | 3300044712 | Bacteria | 66322 |
| 516 | Ga0453684_0008066 | 3300044712 | Bacteria | 19041 |
| 517 | Ga0453684_0012382 | 3300044712 | Bacteria | 14081 |
| 518 | Ga0453684_0017106 | 3300044712 | Bacteria | 11261 |
| 519 | Ga0453684_0047924 | 3300044712 | Bacteria | 5659 |
| 520 | Ga0453684_0054288 | 3300044712 | Bacteria | 5220 |
| 521 | Ga0453684_0079097 | 3300044712 | Bacteria | 4111 |
| 522 | Ga0453684_0126419 | 3300044712 | Bacteria | 3076 |
| 523 | Ga0453684_0138113 | 3300044712 | Bacteria | 2915 |
| 524 | Ga0453684_0485231 | 3300044712 | Bacteria | 1370 |
| 525 | Ga0453684_0724351 | 3300044712 | Bacteria | 1079 |
| 526 | Ga0451576_0000171 | 3300045051 | Bacteria | 162452 |
| 527 | Ga0451576_0012714 | 3300045051 | Bacteria | 9450 |
| 528 | Ga0451576_0028416 | 3300045051 | Bacteria | 5991 |
| 529 | Ga0451576_0076467 | 3300045051 | Bacteria | 3484 |
| 530 | Ga0451576_0374292 | 3300045051 | Bacteria | 1492 |
| 531 | Ga0451576_0615425 | 3300045051 | Bacteria | 1141 |
| 532 | Ga0495627_006967 | 3300046453 | Bacteria | 4387 |
| 533 | Ga0495627_010488 | 3300046453 | Bacteria | 3367 |
| 534 | Ga0495638_0000923 | 3300046460 | Bacteria | 29918 |
| 535 | Ga0495650_0017522 | 3300046471 | Bacteria | 3589 |
| 536 | Ga0495605_0000036 | 3300046474 | Bacteria | 203902 |
| 537 | Ga0495594_0000608 | 3300046499 | Bacteria | 18446 |
| 538 | Ga0495594_0118132 | 3300046499 | Bacteria | 1498 |
| 539 | Ga0495583_0000028 | 3300046506 | Bacteria | 255787 |
| 540 | Ga0495608_0000358 | 3300046511 | Bacteria | 31895 |
| 541 | Ga0495610_0044263 | 3300046512 | Bacteria | 2210 |
| 542 | Ga0495620_0000073 | 3300046515 | Bacteria | 83446 |
| 543 | Ga0495643_0001805 | 3300046522 | Bacteria | 18329 |
| 544 | Ga0495648_0005020 | 3300046524 | Bacteria | 11120 |
| 545 | Ga0495663_0011415 | 3300046525 | Bacteria | 2472 |
| 546 | Ga0495663_0013141 | 3300046525 | Bacteria | 2314 |
| 547 | Ga0495654_0000246 | 3300046530 | Bacteria | 50620 |
| 548 | Ga0495609_0000115 | 3300046538 | Bacteria | 93419 |
| 549 | Ga0495621_0023854 | 3300046539 | Bacteria | 2038 |
| 550 | Ga0495597_0001109 | 3300046542 | Bacteria | 20383 |
| 551 | Ga0495633_0000028 | 3300046558 | Bacteria | 203214 |
| 552 | Ga0495633_0039461 | 3300046558 | Bacteria | 2253 |
| 553 | Ga0495667_0000569 | 3300046559 | Bacteria | 23532 |
| 554 | Ga0495656_0003673 | 3300046615 | Bacteria | 5208 |
| 555 | Ga0495656_0005742 | 3300046615 | Bacteria | 4306 |
| 556 | Ga0495656_0017989 | 3300046615 | Bacteria | 2706 |
| 557 | Ga0495668_0004574 | 3300046616 | Bacteria | 9731 |
| 558 | Ga0495611_0002080 | 3300046648 | Bacteria | 9410 |
| 559 | Ga0495625_0103741 | 3300046660 | Bacteria | 1949 |
| 560 | Ga0495659_0020578 | 3300046664 | Bacteria | 2217 |
| 561 | Ga0495661_0000211 | 3300046665 | Bacteria | 67481 |
| 562 | Ga0495613_0001198 | 3300046689 | Bacteria | 19793 |
| 563 | Ga0495670_0026477 | 3300046691 | Bacteria | 2870 |
| 564 | Ga0495589_0000402 | 3300046794 | Bacteria | 32574 |
| 565 | Ga0495660_0001852 | 3300046810 | Bacteria | 13881 |
| 566 | Ga0495636_0026359 | 3300047318 | Bacteria | 2364 |
| 567 | Ga0495672_0000214 | 3300047320 | Bacteria | 82882 |
| 568 | Ga0495672_0011967 | 3300047320 | Bacteria | 6082 |
| 569 | Ga0495683_0000091 | 3300047323 | Bacteria | 91313 |
| 570 | Ga0495679_000083 | 3300047446 | Bacteria | 87051 |
| 571 | Ga0495673_0015663 | 3300047469 | Bacteria | 3899 |
| 572 | Ga0495681_0020864 | 3300047470 | Bacteria | 3543 |
| 573 | Ga0495684_0005372 | 3300047471 | Bacteria | 9975 |
| 574 | Ga0495686_0008753 | 3300047472 | Bacteria | 7383 |
| 575 | Ga0496109_0013461 | 3300048912 | Bacteria | 7097 |
| 576 | Ga0496113_0168093 | 3300048916 | Bacteria | 1736 |
| 577 | Ga0496116_0001111 | 3300048919 | Bacteria | 32190 |
| 578 | Ga0496117_0001300 | 3300048920 | Bacteria | 36745 |
| 579 | Ga0496117_0002433 | 3300048920 | Bacteria | 23537 |
| 580 | Ga0496117_0065177 | 3300048920 | Bacteria | 2478 |
| 581 | Ga0496118_0000406 | 3300048921 | Bacteria | 71874 |
| 582 | Ga0496118_0000703 | 3300048921 | Bacteria | 54182 |
| 583 | Ga0496118_0075438 | 3300048921 | Bacteria | 2405 |
| 584 | Ga0496119_0114047 | 3300048922 | Bacteria | 1495 |
| 585 | Ga0496121_0000705 | 3300048924 | Bacteria | 62174 |
| 586 | Ga0496121_0146557 | 3300048924 | Bacteria | 1743 |
| 587 | Ga0496122_0047585 | 3300048925 | Bacteria | 3309 |
| 588 | Ga0496122_0048434 | 3300048925 | Bacteria | 3267 |
| 589 | Ga0496123_0104074 | 3300048926 | Bacteria | 1642 |
| 590 | Ga0496124_0010087 | 3300048927 | Bacteria | 9631 |
| 591 | Ga0496124_0074196 | 3300048927 | Bacteria | 2812 |
| 592 | Ga0496125_0077446 | 3300048928 | Bacteria | 2563 |
| 593 | Ga0496126_0209196 | 3300048929 | Bacteria | 1643 |
| 594 | Ga0495678_000020 | 3300049459 | Bacteria | 253654 |
| 595 | Ga0501034_0057034 | 3300049571 | Bacteria | 3928 |
| 596 | Ga0501034_0130797 | 3300049571 | Bacteria | 2493 |
| 597 | Ga0501036_0040305 | 3300049572 | Bacteria | 3950 |
| 598 | Ga0501037_0046762 | 3300049573 | Bacteria | 3173 |
| 599 | Ga0501038_0008714 | 3300049574 | Bacteria | 9310 |
| 600 | Ga0501040_0211126 | 3300049576 | Bacteria | 1380 |
| 601 | Ga0501041_0238114 | 3300049577 | Bacteria | 1143 |
| 602 | Ga0501042_0029378 | 3300049578 | Bacteria | 3876 |
| 603 | Ga0501046_0005153 | 3300049580 | Bacteria | 11714 |
| 604 | Ga0501047_0211453 | 3300049581 | Bacteria | 1798 |
| 605 | Ga0501047_0363103 | 3300049581 | Bacteria | 1283 |
| 606 | Ga0501048_0026046 | 3300049582 | Bacteria | 4260 |
| 607 | Ga0501067_0086371 | 3300049583 | Bacteria | 1741 |
| 608 | Ga0501070_0083722 | 3300049586 | Bacteria | 2641 |
| 609 | Ga0501070_0143736 | 3300049586 | Bacteria | 1969 |
| 610 | Ga0501071_0032418 | 3300049587 | Bacteria | 3710 |
| 611 | Ga0501072_0039227 | 3300049588 | Bacteria | 3719 |
| 612 | Ga0501073_0032803 | 3300049589 | Bacteria | 3701 |
| 613 | Ga0501074_0096470 | 3300049590 | Bacteria | 2117 |
| 614 | Ga0501074_0276950 | 3300049590 | Bacteria | 1193 |
| 615 | Ga0501075_0005648 | 3300049591 | Bacteria | 8560 |
| 616 | Ga0501075_0074216 | 3300049591 | Bacteria | 2573 |
| 617 | Ga0501075_0123032 | 3300049591 | Bacteria | 1975 |
| 618 | Ga0501076_0009612 | 3300049592 | Bacteria | 7143 |
| 619 | Ga0501076_0061862 | 3300049592 | Bacteria | 2980 |
| 620 | Ga0501076_0085931 | 3300049592 | Bacteria | 2528 |
| 621 | Ga0501076_0222157 | 3300049592 | Bacteria | 1544 |
| 622 | Ga0501080_0037427 | 3300049742 | Bacteria | 4532 |
| 623 | Ga0501080_0113976 | 3300049742 | Bacteria | 2506 |
| 624 | Ga0501035_0056757 | 3300049822 | Bacteria | 3492 |
| 625 | Ga0501044_0003608 | 3300049823 | Bacteria | 17419 |
| 626 | Ga0501045_0088061 | 3300049824 | Bacteria | 2293 |
| 627 | nmdc:mga00v17_158982_c1 | 3300050491 | Bacteria | 1454 |
| 628 | nmdc:mga00v17_308_c1 | 3300050491 | Bacteria | 28036 |
| 629 | nmdc:mga06z11_125702_c1 | 3300050494 | Bacteria | 1435 |
| 630 | nmdc:mga06z11_63686_c1 | 3300050494 | Bacteria | 1930 |
| 631 | nmdc:mga05p37_105144_c1 | 3300050507 | Bacteria | 3473 |
| 632 | nmdc:mga05p37_15154_c1 | 3300050507 | Bacteria | 9257 |
| 633 | nmdc:mga05p37_167625_c1 | 3300050507 | Bacteria | 2680 |
| 634 | nmdc:mga05p37_198058_c1 | 3300050507 | Bacteria | 2435 |
| 635 | nmdc:mga05p37_26140_c1 | 3300050507 | Bacteria | 7098 |
| 636 | nmdc:mga05p37_357485_c1 | 3300050507 | Bacteria | 1718 |
| 637 | nmdc:mga05p37_408122_c1 | 3300050507 | Bacteria | 1584 |
| 638 | nmdc:mga05p37_564673_c1 | 3300050507 | Bacteria | 1292 |
| 639 | nmdc:mga05p37_68215_c1 | 3300050507 | Bacteria | 4374 |
| 640 | nmdc:mga05p37_74450_c1 | 3300050507 | Bacteria | 4179 |
| 641 | nmdc:mga09592_186101_c1 | 3300050508 | Bacteria | 1797 |
| 642 | nmdc:mga09592_34058_c1 | 3300050508 | Bacteria | 4257 |
| 643 | nmdc:mga09592_45261_c1 | 3300050508 | Bacteria | 3706 |
| 644 | nmdc:mga09592_49274_c1 | 3300050508 | Bacteria | 3551 |
| 645 | nmdc:mga09592_77335_c1 | 3300050508 | Bacteria | 2831 |
| 646 | nmdc:mga0qj67_2782_c1 | 3300050509 | Bacteria | 12549 |
| 647 | nmdc:mga0qj67_34774_c1 | 3300050509 | Bacteria | 3938 |
| 648 | nmdc:mga0qj67_356695_c1 | 3300050509 | Bacteria | 1182 |
| 649 | nmdc:mga06r32_15677_c1 | 3300050510 | Bacteria | 6885 |
| 650 | nmdc:mga06r32_194757_c1 | 3300050510 | Bacteria | 2014 |
| 651 | nmdc:mga06r32_533696_c1 | 3300050510 | Bacteria | 1148 |
| 652 | nmdc:mga06r32_573928_c1 | 3300050510 | Bacteria | 1100 |
| 653 | nmdc:mga06r32_8270_c1 | 3300050510 | Bacteria | 9366 |
| 654 | nmdc:mga08y16_110480_c1 | 3300050511 | Bacteria | 2863 |
| 655 | nmdc:mga08y16_190862_c1 | 3300050511 | Bacteria | 2125 |
| 656 | nmdc:mga08y16_1926_c1 | 3300050511 | Bacteria | 21179 |
| 657 | nmdc:mga08y16_204146_c1 | 3300050511 | Unclassified | 2048 |
| 658 | nmdc:mga08y16_21348_c1 | 3300050511 | Bacteria | 6838 |
| 659 | nmdc:mga08y16_25726_c1 | 3300050511 | Bacteria | 6210 |
| 660 | nmdc:mga08y16_284929_c1 | 3300050511 | Bacteria | 1704 |
| 661 | nmdc:mga08y16_394121_c1 | 3300050511 | Bacteria | 1418 |
| 662 | nmdc:mga08y16_43821_c1 | 3300050511 | Bacteria | 4688 |
| 663 | nmdc:mga08y16_71485_c1 | 3300050511 | Bacteria | 3616 |
| 664 | nmdc:mga08y16_870_c1 | 3300050511 | Bacteria | 29078 |
| 665 | nmdc:mga08y16_9903_c1 | 3300050511 | Bacteria | 10004 |
| 666 | nmdc:mga0n895_115260_c1 | 3300050512 | Bacteria | 2705 |
| 667 | nmdc:mga0n895_16759_c1 | 3300050512 | Bacteria | 6733 |
| 668 | nmdc:mga0n895_64110_c1 | 3300050512 | Bacteria | 3634 |
| 669 | nmdc:mga0n895_76562_c1 | 3300050512 | Bacteria | 3327 |
| 670 | nmdc:mga0rr50_38400_c1 | 3300050513 | Bacteria | 3464 |
| 671 | nmdc:mga0rr50_708_c1 | 3300050513 | Bacteria | 17916 |
| 672 | nmdc:mga0a205_13094_c1 | 3300050515 | Bacteria | 7704 |
| 673 | nmdc:mga0a205_14896_c1 | 3300050515 | Bacteria | 7255 |
| 674 | nmdc:mga0a205_716_c1 | 3300050515 | Bacteria | 26671 |
| 675 | nmdc:mga0a205_84_c1 | 3300050515 | Bacteria | 51647 |
| 676 | Ga0500610_0090926 | 3300053079 | Bacteria | 1586 |
| 677 | Ga0500555_000051 | 3300053103 | Bacteria | 59969 |
| 678 | Ga0500568_0011205 | 3300053139 | Bacteria | 4175 |
| 679 | Ga0500616_0000306 | 3300053153 | Bacteria | 70571 |
| 680 | Ga0500645_000041 | 3300053730 | Bacteria | 110646 |
| 681 | Ga0501084_0089348 | 3300054114 | Bacteria | 2586 |
| 682 | Ga0501084_0213056 | 3300054114 | Bacteria | 1630 |
| 683 | Ga0590071_000235 | 3300059421 | Bacteria | 16189 |
| 684 | Ga0590071_000716 | 3300059421 | Bacteria | 9395 |
| 685 | Ga0590074_000382 | 3300059423 | Bacteria | 6308 |
| 686 | Ga0590075_002569 | 3300059424 | Bacteria | 4336 |
| 687 | Ga0590075_020193 | 3300059424 | Bacteria | 1658 |
| 688 | Ga0590077_000031 | 3300059426 | Bacteria | 33228 |
| 689 | Ga0590077_001251 | 3300059426 | Bacteria | 6081 |
| 690 | Ga0590077_013308 | 3300059426 | Bacteria | 1711 |
| 691 | Ga0501082_0262590 | 3300060353 | Bacteria | 1502 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_0142465 | Ga0451577_0142465_1137_1979 | 255 |
| 2 | 3300044712 | Ga0453684_0012382 | Ga0453684_0012382_6491_7333 | 255 |
| 3 | 3300045051 | Ga0451576_0615425 | Ga0451576_0615425_150_992 | 255 |
| 4 | iso_pu_bacteria | 2929206907 | 2929209037 | 255 |
| 5 | 3300044673 | Ga0453683_0005885 | Ga0453683_0005885_3230_4075 | 256 |
| 6 | 3300044712 | Ga0453684_0485231 | Ga0453684_0485231_375_1220 | 256 |
| 7 | 3300045051 | Ga0451576_0012714 | Ga0451576_0012714_1525_2370 | 256 |
| 8 | 3300037466 | Ga0395898_0263108 | Ga0395898_0263108_418_1209 | 262 |
| 9 | 3300046616 | Ga0495668_0004574 | Ga0495668_0004574_747_1538 | 263 |
| 10 | 3300028379 | Ga0268266_10000646 | Ga0268266_1000064626 | 273 |
| 11 | 3300025923 | Ga0207681_10108179 | Ga0207681_101081791 | 274 |
| 12 | 3300060353 | Ga0501082_0262590 | Ga0501082_0262590_19_933 | 281 |
| 13 | 3300044712 | Ga0453684_0000107 | Ga0453684_0000107_73889_74746 | 284 |
| 14 | 3300037471 | Ga0395905_0475261 | Ga0395905_0475261_18_947 | 285 |
| 15 | 3300050510 | nmdc:mga06r32_533696_c1 | nmdc:mga06r32_533696_c1_15_920 | 285 |
| 16 | 3300039062 | Ga0400483_202581 | Ga0400483_202581_52_954 | 292 |
| 17 | 3300042876 | Ga0451577_0089686 | Ga0451577_0089686_172_1188 | 292 |
| 18 | 3300009147 | Ga0114129_10695544 | Ga0114129_106955441 | 294 |
| 19 | 3300050507 | nmdc:mga05p37_564673_c1 | nmdc:mga05p37_564673_c1_150_1136 | 294 |
| 20 | 3300046689 | Ga0495613_0001198 | Ga0495613_0001198_4596_5630 | 296 |
| 21 | 3300047471 | Ga0495684_0005372 | Ga0495684_0005372_4823_5857 | 296 |
| 22 | 3300032126 | Ga0307415_100244426 | Ga0307415_1002444261 | 297 |
| 23 | 3300025942 | Ga0207689_10043379 | Ga0207689_100433792 | 298 |
| 24 | 3300009101 | Ga0105247_10002389 | Ga0105247_100023894 | 299 |
| 25 | 3300009174 | Ga0105241_10000371 | Ga0105241_100003711 | 299 |
| 26 | 3300009545 | Ga0105237_10007492 | Ga0105237_100074922 | 299 |
| 27 | 3300009553 | Ga0105249_10009765 | Ga0105249_100097652 | 299 |
| 28 | 3300010375 | Ga0105239_10250089 | Ga0105239_102500892 | 299 |
| 29 | 3300013308 | Ga0157375_10042900 | Ga0157375_100429003 | 299 |
| 30 | 3300014968 | Ga0157379_10093480 | Ga0157379_100934802 | 299 |
| 31 | 3300032126 | Ga0307415_100019882 | Ga0307415_1000198824 | 299 |
| 32 | 3300006880 | Ga0075429_100062312 | Ga0075429_1000623122 | 300 |
| 33 | 3300007076 | Ga0075435_100201026 | Ga0075435_1002010262 | 300 |
| 34 | 3300044712 | Ga0453684_0047924 | Ga0453684_0047924_2934_3971 | 303 |
| 35 | 3300048924 | Ga0496121_0146557 | Ga0496121_0146557_174_1178 | 304 |
| 36 | 3300050508 | nmdc:mga09592_186101_c1 | nmdc:mga09592_186101_c1_506_1531 | 304 |
| 37 | 3300036647 | Ga0316582_0070413 | Ga0316582_0070413_920_1864 | 305 |
| 38 | 3300035241 | Ga0373961_0015297 | Ga0373961_0015297_394_1356 | 306 |
| 39 | 3300031852 | Ga0307410_10036143 | Ga0307410_100361431 | 307 |
| 40 | 3300005471 | Ga0070698_100002958 | Ga0070698_10000295817 | 308 |
| 41 | 3300031995 | Ga0307409_100084635 | Ga0307409_1000846353 | 308 |
| 42 | 3300006846 | Ga0075430_100354721 | Ga0075430_1003547211 | 309 |
| 43 | 3300009094 | Ga0111539_10002191 | Ga0111539_100021918 | 309 |
| 44 | 3300025909 | Ga0207705_10264858 | Ga0207705_102648582 | 309 |
| 45 | 3300027907 | Ga0207428_10003654 | Ga0207428_1000365410 | 309 |
| 46 | 3300046558 | Ga0495633_0039461 | Ga0495633_0039461_527_1519 | 309 |
| 47 | 3300049571 | Ga0501034_0057034 | Ga0501034_0057034_2459_3469 | 309 |
| 48 | 3300049581 | Ga0501047_0211453 | Ga0501047_0211453_350_1360 | 309 |
| 49 | 3300049586 | Ga0501070_0083722 | Ga0501070_0083722_1570_2580 | 309 |
| 50 | 3300049742 | Ga0501080_0037427 | Ga0501080_0037427_1229_2239 | 309 |
| 51 | 3300049823 | Ga0501044_0003608 | Ga0501044_0003608_2600_3610 | 309 |
| 52 | 3300050509 | nmdc:mga0qj67_356695_c1 | nmdc:mga0qj67_356695_c1_78_1103 | 309 |
| 53 | 3300050511 | nmdc:mga08y16_1926_c1 | nmdc:mga08y16_1926_c1_13259_14269 | 309 |
| 54 | 3300050512 | nmdc:mga0n895_64110_c1 | nmdc:mga0n895_64110_c1_219_1229 | 309 |
| 55 | 3300050508 | nmdc:mga09592_34058_c1 | nmdc:mga09592_34058_c1_2859_3881 | 310 |
| 56 | 3300050510 | nmdc:mga06r32_573928_c1 | nmdc:mga06r32_573928_c1_23_1045 | 310 |
| 57 | 3300025986 | Ga0207658_10011784 | Ga0207658_100117843 | 311 |
| 58 | 3300031911 | Ga0307412_10023477 | Ga0307412_100234772 | 311 |
| 59 | 3300044712 | Ga0453684_0079097 | Ga0453684_0079097_2568_3584 | 311 |
| 60 | 3300049591 | Ga0501075_0123032 | Ga0501075_0123032_516_1619 | 311 |
| 61 | 3300054114 | Ga0501084_0213056 | Ga0501084_0213056_160_1263 | 311 |
| 62 | 3300005334 | Ga0068869_100150836 | Ga0068869_1001508361 | 312 |
| 63 | 3300005617 | Ga0068859_100078804 | Ga0068859_1000788042 | 312 |
| 64 | 3300006042 | Ga0075368_10070091 | Ga0075368_100700911 | 312 |
| 65 | 3300006051 | Ga0075364_10158675 | Ga0075364_101586752 | 312 |
| 66 | 3300006195 | Ga0075366_10071524 | Ga0075366_100715242 | 312 |
| 67 | 3300006931 | Ga0097620_100078802 | Ga0097620_1000788022 | 312 |
| 68 | 3300009553 | Ga0105249_10015866 | Ga0105249_100158662 | 312 |
| 69 | 3300025942 | Ga0207689_10107077 | Ga0207689_101070771 | 312 |
| 70 | 3300025961 | Ga0207712_10007668 | Ga0207712_100076686 | 312 |
| 71 | 3300042876 | Ga0451577_0038348 | Ga0451577_0038348_1172_2179 | 312 |
| 72 | 3300045051 | Ga0451576_0374292 | Ga0451576_0374292_472_1470 | 312 |
| 73 | 3300046525 | Ga0495663_0011415 | Ga0495663_0011415_569_1573 | 312 |
| 74 | 3300049591 | Ga0501075_0005648 | Ga0501075_0005648_471_1478 | 312 |
| 75 | 3300050491 | nmdc:mga00v17_158982_c1 | nmdc:mga00v17_158982_c1_393_1406 | 312 |
| 76 | 3300050494 | nmdc:mga06z11_125702_c1 | nmdc:mga06z11_125702_c1_368_1381 | 312 |
| 77 | 3300009147 | Ga0114129_10009591 | Ga0114129_100095912 | 313 |
| 78 | 3300038443 | Ga0395901_0508565 | Ga0395901_0508565_86_1138 | 313 |
| 79 | 3300042132 | Ga0450895_004883 | Ga0450895_004883_54_1052 | 313 |
| 80 | 3300048925 | Ga0496122_0047585 | Ga0496122_0047585_87_1091 | 313 |
| 81 | 3300048926 | Ga0496123_0104074 | Ga0496123_0104074_259_1263 | 313 |
| 82 | 3300049583 | Ga0501067_0086371 | Ga0501067_0086371_471_1487 | 313 |
| 83 | 3300049586 | Ga0501070_0143736 | Ga0501070_0143736_319_1335 | 313 |
| 84 | 3300050507 | nmdc:mga05p37_15154_c1 | nmdc:mga05p37_15154_c1_6923_7954 | 313 |
| 85 | 3300025292 | Ga0209676_1000104 | Ga0209676_100010473 | 314 |
| 86 | 3300025298 | Ga0209050_1038650 | Ga0209050_10386501 | 314 |
| 87 | 3300031995 | Ga0307409_100186988 | Ga0307409_1001869881 | 314 |
| 88 | 3300044712 | Ga0453684_0724351 | Ga0453684_0724351_29_1054 | 314 |
| 89 | 3300049576 | Ga0501040_0211126 | Ga0501040_0211126_229_1233 | 314 |
| 90 | 3300049578 | Ga0501042_0029378 | Ga0501042_0029378_1290_2294 | 314 |
| 91 | 3300049582 | Ga0501048_0026046 | Ga0501048_0026046_3154_4158 | 314 |
| 92 | 3300049587 | Ga0501071_0032418 | Ga0501071_0032418_602_1606 | 314 |
| 93 | 3300049588 | Ga0501072_0039227 | Ga0501072_0039227_610_1614 | 314 |
| 94 | 3300049590 | Ga0501074_0276950 | Ga0501074_0276950_118_1122 | 314 |
| 95 | 3300049591 | Ga0501075_0074216 | Ga0501075_0074216_1287_2291 | 314 |
| 96 | 3300049592 | Ga0501076_0009612 | Ga0501076_0009612_3003_4007 | 314 |
| 97 | 3300049824 | Ga0501045_0088061 | Ga0501045_0088061_901_1905 | 314 |
| 98 | 3300054114 | Ga0501084_0089348 | Ga0501084_0089348_919_1923 | 314 |
| 99 | 3300005365 | Ga0070688_100010886 | Ga0070688_1000108863 | 315 |
| 100 | 3300005466 | Ga0070685_10009810 | Ga0070685_100098106 | 315 |
| 101 | 3300005518 | Ga0070699_100237449 | Ga0070699_1002374491 | 315 |
| 102 | 3300006847 | Ga0075431_100044479 | Ga0075431_1000444791 | 315 |
| 103 | 3300006880 | Ga0075429_100250915 | Ga0075429_1002509151 | 315 |
| 104 | 3300025927 | Ga0207687_10318467 | Ga0207687_103184671 | 315 |
| 105 | 3300035398 | Ga0316574_0158144 | Ga0316574_0158144_147_1148 | 315 |
| 106 | 3300042876 | Ga0451577_0007132 | Ga0451577_0007132_7862_8887 | 315 |
| 107 | 3300044712 | Ga0453684_0008066 | Ga0453684_0008066_3417_4442 | 315 |
| 108 | 3300048922 | Ga0496119_0114047 | Ga0496119_0114047_409_1446 | 315 |
| 109 | 3300049592 | Ga0501076_0222157 | Ga0501076_0222157_412_1437 | 315 |
| 110 | 3300050508 | nmdc:mga09592_45261_c1 | nmdc:mga09592_45261_c1_1210_2196 | 315 |
| 111 | 3300005331 | Ga0070670_100026149 | Ga0070670_1000261493 | 316 |
| 112 | 3300005354 | Ga0070675_100193098 | Ga0070675_1001930981 | 316 |
| 113 | 3300005356 | Ga0070674_100162426 | Ga0070674_1001624261 | 316 |
| 114 | 3300006846 | Ga0075430_100162716 | Ga0075430_1001627163 | 316 |
| 115 | 3300006847 | Ga0075431_100181072 | Ga0075431_1001810723 | 316 |
| 116 | 3300009094 | Ga0111539_10077166 | Ga0111539_100771662 | 316 |
| 117 | 3300025925 | Ga0207650_10046351 | Ga0207650_100463511 | 316 |
| 118 | 3300049592 | Ga0501076_0085931 | Ga0501076_0085931_736_1773 | 316 |
| 119 | 3300050511 | nmdc:mga08y16_190862_c1 | nmdc:mga08y16_190862_c1_508_1521 | 316 |
| 120 | 3300003203 | JGI25406J46586_10047026 | JGI25406J46586_100470262 | 317 |
| 121 | 3300005340 | Ga0070689_100084992 | Ga0070689_1000849922 | 317 |
| 122 | 3300005471 | Ga0070698_100043831 | Ga0070698_1000438312 | 317 |
| 123 | 3300005985 | Ga0081539_10038985 | Ga0081539_100389854 | 317 |
| 124 | 3300006844 | Ga0075428_100015404 | Ga0075428_10001540412 | 317 |
| 125 | 3300006847 | Ga0075431_100131410 | Ga0075431_1001314103 | 317 |
| 126 | 3300041486 | Ga0451807_2431939 | Ga0451807_2431939_338_1354 | 317 |
| 127 | 3300042002 | Ga0439442_028246 | Ga0439442_028246_92_1156 | 317 |
| 128 | 3300047320 | Ga0495672_0011967 | Ga0495672_0011967_3168_4205 | 317 |
| 129 | 3300048928 | Ga0496125_0077446 | Ga0496125_0077446_816_1832 | 317 |
| 130 | 3300049577 | Ga0501041_0238114 | Ga0501041_0238114_28_1056 | 317 |
| 131 | 3300049592 | Ga0501076_0061862 | Ga0501076_0061862_249_1277 | 317 |
| 132 | 3300005354 | Ga0070675_100016192 | Ga0070675_1000161923 | 318 |
| 133 | 3300005365 | Ga0070688_100159250 | Ga0070688_1001592501 | 318 |
| 134 | 3300005466 | Ga0070685_10304684 | Ga0070685_103046841 | 318 |
| 135 | 3300005985 | Ga0081539_10046258 | Ga0081539_100462581 | 318 |
| 136 | 3300006844 | Ga0075428_100027849 | Ga0075428_1000278494 | 318 |
| 137 | 3300006846 | Ga0075430_100173774 | Ga0075430_1001737741 | 318 |
| 138 | 3300006880 | Ga0075429_100285745 | Ga0075429_1002857452 | 318 |
| 139 | 3300009094 | Ga0111539_10000417 | Ga0111539_1000041721 | 318 |
| 140 | 3300009094 | Ga0111539_10015750 | Ga0111539_100157502 | 318 |
| 141 | 3300009094 | Ga0111539_10027136 | Ga0111539_100271369 | 318 |
| 142 | 3300025926 | Ga0207659_10003941 | Ga0207659_100039413 | 318 |
| 143 | 3300026075 | Ga0207708_10102955 | Ga0207708_101029553 | 318 |
| 144 | 3300027907 | Ga0207428_10000444 | Ga0207428_1000044416 | 318 |
| 145 | 3300027907 | Ga0207428_10033872 | Ga0207428_100338727 | 318 |
| 146 | 3300031548 | Ga0307408_100249465 | Ga0307408_1002494651 | 318 |
| 147 | 3300031727 | Ga0316576_10007966 | Ga0316576_100079664 | 318 |
| 148 | 3300032002 | Ga0307416_100596403 | Ga0307416_1005964032 | 318 |
| 149 | 3300038735 | Ga0400485_07187 | Ga0400485_07187_296_1318 | 318 |
| 150 | 3300038742 | Ga0400486_08357 | Ga0400486_08357_45896_46918 | 318 |
| 151 | 3300042131 | Ga0450894_012888 | Ga0450894_012888_29_1048 | 318 |
| 152 | 3300042133 | Ga0450896_002709 | Ga0450896_002709_1189_2208 | 318 |
| 153 | 3300050507 | nmdc:mga05p37_198058_c1 | nmdc:mga05p37_198058_c1_329_1360 | 318 |
| 154 | 3300050508 | nmdc:mga09592_77335_c1 | nmdc:mga09592_77335_c1_281_1312 | 318 |
| 155 | 3300050511 | nmdc:mga08y16_25726_c1 | nmdc:mga08y16_25726_c1_2889_3920 | 318 |
| 156 | 3300053079 | Ga0500610_0090926 | Ga0500610_0090926_107_1132 | 318 |
| 157 | 3300059421 | Ga0590071_000716 | Ga0590071_000716_6448_7473 | 318 |
| 158 | 3300059426 | Ga0590077_000031 | Ga0590077_000031_6432_7463 | 318 |
| 159 | 3300059426 | Ga0590077_001251 | Ga0590077_001251_1522_2547 | 318 |
| 160 | iso_pu_bacteria | 2874220319 | 2874224088 | 318 |
| 161 | iso_pu_bacteria | 2919089067 | 2919089977 | 318 |
| 162 | iso_pu_bacteria | 2928496128 | 2928499988 | 318 |
| 163 | iso_pu_bacteria | 2931380184 | 2931382703 | 318 |
| 164 | iso_pu_bacteria | 2937610967 | 2937613420 | 318 |
| 165 | iso_pu_bacteria | 2939626828 | 2939628120 | 318 |
| 166 | iso_pu_bacteria | 2961047084 | 2961050852 | 318 |
| 167 | 3300005353 | Ga0070669_100243530 | Ga0070669_1002435302 | 319 |
| 168 | 3300005354 | Ga0070675_100054701 | Ga0070675_1000547012 | 319 |
| 169 | 3300005441 | Ga0070700_100068639 | Ga0070700_1000686391 | 319 |
| 170 | 3300025926 | Ga0207659_10011872 | Ga0207659_100118723 | 319 |
| 171 | 3300025933 | Ga0207706_10167026 | Ga0207706_101670262 | 319 |
| 172 | 3300025936 | Ga0207670_10057930 | Ga0207670_100579303 | 319 |
| 173 | 3300025945 | Ga0207679_10104385 | Ga0207679_101043852 | 319 |
| 174 | 3300026095 | Ga0207676_10173795 | Ga0207676_101737952 | 319 |
| 175 | 3300027907 | Ga0207428_10024118 | Ga0207428_100241184 | 319 |
| 176 | 3300027907 | Ga0207428_10094480 | Ga0207428_100944801 | 319 |
| 177 | 3300031691 | Ga0316579_10109556 | Ga0316579_101095561 | 319 |
| 178 | 3300031727 | Ga0316576_10001606 | Ga0316576_100016066 | 319 |
| 179 | 3300031728 | Ga0316578_10014816 | Ga0316578_100148165 | 319 |
| 180 | 3300031733 | Ga0316577_10027166 | Ga0316577_100271663 | 319 |
| 181 | 3300032139 | Ga0316580_10017769 | Ga0316580_100177692 | 319 |
| 182 | 3300036712 | Ga0316584_0061836 | Ga0316584_0061836_1703_2698 | 319 |
| 183 | 3300041408 | Ga0439453_0008816 | Ga0439453_0008816_519_1553 | 319 |
| 184 | 3300042436 | Ga0439435_0001971 | Ga0439435_0001971_1389_2423 | 319 |
| 185 | 3300046511 | Ga0495608_0000358 | Ga0495608_0000358_2855_3874 | 319 |
| 186 | 3300046559 | Ga0495667_0000569 | Ga0495667_0000569_20056_21075 | 319 |
| 187 | 3300048912 | Ga0496109_0013461 | Ga0496109_0013461_660_1691 | 319 |
| 188 | 3300050511 | nmdc:mga08y16_21348_c1 | nmdc:mga08y16_21348_c1_2846_3895 | 319 |
| 189 | 3300050511 | nmdc:mga08y16_394121_c1 | nmdc:mga08y16_394121_c1_345_1376 | 319 |
| 190 | 3300050511 | nmdc:mga08y16_9903_c1 | nmdc:mga08y16_9903_c1_6627_7637 | 319 |
| 191 | 3300059421 | Ga0590071_000235 | Ga0590071_000235_1239_2270 | 319 |
| 192 | 3300059423 | Ga0590074_000382 | Ga0590074_000382_4558_5589 | 319 |
| 193 | 3300059424 | Ga0590075_002569 | Ga0590075_002569_576_1607 | 319 |
| 194 | 3300005331 | Ga0070670_100001817 | Ga0070670_1000018173 | 320 |
| 195 | 3300005331 | Ga0070670_100398406 | Ga0070670_1003984061 | 320 |
| 196 | 3300005344 | Ga0070661_100199438 | Ga0070661_1001994382 | 320 |
| 197 | 3300005354 | Ga0070675_100018904 | Ga0070675_1000189046 | 320 |
| 198 | 3300005365 | Ga0070688_100023939 | Ga0070688_1000239393 | 320 |
| 199 | 3300005456 | Ga0070678_100205211 | Ga0070678_1002052111 | 320 |
| 200 | 3300005457 | Ga0070662_100214688 | Ga0070662_1002146881 | 320 |
| 201 | 3300005467 | Ga0070706_100027284 | Ga0070706_1000272844 | 320 |
| 202 | 3300005471 | Ga0070698_100354640 | Ga0070698_1003546401 | 320 |
| 203 | 3300005545 | Ga0070695_100005599 | Ga0070695_1000055995 | 320 |
| 204 | 3300005546 | Ga0070696_100101253 | Ga0070696_1001012533 | 320 |
| 205 | 3300005549 | Ga0070704_100177471 | Ga0070704_1001774711 | 320 |
| 206 | 3300005564 | Ga0070664_100040079 | Ga0070664_1000400793 | 320 |
| 207 | 3300005985 | Ga0081539_10000750 | Ga0081539_1000075034 | 320 |
| 208 | 3300006847 | Ga0075431_100389367 | Ga0075431_1003893672 | 320 |
| 209 | 3300006880 | Ga0075429_100048999 | Ga0075429_1000489994 | 320 |
| 210 | 3300006881 | Ga0068865_100105016 | Ga0068865_1001050163 | 320 |
| 211 | 3300009147 | Ga0114129_10048306 | Ga0114129_100483066 | 320 |
| 212 | 3300009553 | Ga0105249_10147327 | Ga0105249_101473272 | 320 |
| 213 | 3300014325 | Ga0163163_10207110 | Ga0163163_102071101 | 320 |
| 214 | 3300025885 | Ga0207653_10020057 | Ga0207653_100200572 | 320 |
| 215 | 3300025893 | Ga0207682_10001038 | Ga0207682_1000103811 | 320 |
| 216 | 3300025920 | Ga0207649_10166394 | Ga0207649_101663942 | 320 |
| 217 | 3300025923 | Ga0207681_10079435 | Ga0207681_100794352 | 320 |
| 218 | 3300025925 | Ga0207650_10361400 | Ga0207650_103614001 | 320 |
| 219 | 3300025926 | Ga0207659_10300465 | Ga0207659_103004652 | 320 |
| 220 | 3300025933 | Ga0207706_10052029 | Ga0207706_100520293 | 320 |
| 221 | 3300025940 | Ga0207691_10033132 | Ga0207691_100331325 | 320 |
| 222 | 3300025945 | Ga0207679_10303437 | Ga0207679_103034371 | 320 |
| 223 | 3300036647 | Ga0316582_0132388 | Ga0316582_0132388_51_1055 | 320 |
| 224 | 3300038705 | Ga0237819_07252 | Ga0237819_07252_134_1168 | 320 |
| 225 | 3300039062 | Ga0400483_259742 | Ga0400483_259742_1108_2112 | 320 |
| 226 | 3300042876 | Ga0451577_0003928 | Ga0451577_0003928_12289_13317 | 320 |
| 227 | 3300044712 | Ga0453684_0138113 | Ga0453684_0138113_1534_2562 | 320 |
| 228 | 3300046499 | Ga0495594_0118132 | Ga0495594_0118132_216_1244 | 320 |
| 229 | 3300049571 | Ga0501034_0130797 | Ga0501034_0130797_113_1099 | 320 |
| 230 | 3300050507 | nmdc:mga05p37_68215_c1 | nmdc:mga05p37_68215_c1_1647_2666 | 320 |
| 231 | 3300005616 | Ga0068852_100409083 | Ga0068852_1004090831 | 321 |
| 232 | 3300005618 | Ga0068864_100100025 | Ga0068864_1001000252 | 321 |
| 233 | 3300005842 | Ga0068858_100077956 | Ga0068858_1000779563 | 321 |
| 234 | 3300006847 | Ga0075431_100179135 | Ga0075431_1001791353 | 321 |
| 235 | 3300014326 | Ga0157380_10005869 | Ga0157380_100058692 | 321 |
| 236 | 3300026035 | Ga0207703_10060611 | Ga0207703_100606112 | 321 |
| 237 | 3300026095 | Ga0207676_10025450 | Ga0207676_100254503 | 321 |
| 238 | 3300031727 | Ga0316576_10171913 | Ga0316576_101719132 | 321 |
| 239 | 3300031852 | Ga0307410_10190881 | Ga0307410_101908812 | 321 |
| 240 | 3300038741 | Ga0400488_61529 | Ga0400488_61529_1079_2131 | 321 |
| 241 | 3300044712 | Ga0453684_0001479 | Ga0453684_0001479_22126_23130 | 321 |
| 242 | 3300044712 | Ga0453684_0126419 | Ga0453684_0126419_194_1192 | 321 |
| 243 | 3300050507 | nmdc:mga05p37_167625_c1 | nmdc:mga05p37_167625_c1_1626_2636 | 321 |
| 244 | 3300050509 | nmdc:mga0qj67_34774_c1 | nmdc:mga0qj67_34774_c1_1774_2784 | 321 |
| 245 | 3300050510 | nmdc:mga06r32_194757_c1 | nmdc:mga06r32_194757_c1_663_1688 | 321 |
| 246 | 3300003203 | JGI25406J46586_10000294 | JGI25406J46586_1000029414 | 322 |
| 247 | 3300005347 | Ga0070668_100003349 | Ga0070668_10000334910 | 322 |
| 248 | 3300005356 | Ga0070674_100000032 | Ga0070674_10000003243 | 322 |
| 249 | 3300005456 | Ga0070678_100040275 | Ga0070678_1000402752 | 322 |
| 250 | 3300005459 | Ga0068867_100094451 | Ga0068867_1000944512 | 322 |
| 251 | 3300005518 | Ga0070699_100053104 | Ga0070699_1000531043 | 322 |
| 252 | 3300005543 | Ga0070672_100188067 | Ga0070672_1001880672 | 322 |
| 253 | 3300005548 | Ga0070665_100093849 | Ga0070665_1000938493 | 322 |
| 254 | 3300005985 | Ga0081539_10000013 | Ga0081539_10000013279 | 322 |
| 255 | 3300006852 | Ga0075433_10005012 | Ga0075433_100050129 | 322 |
| 256 | 3300006871 | Ga0075434_100027168 | Ga0075434_1000271683 | 322 |
| 257 | 3300009147 | Ga0114129_10076433 | Ga0114129_100764335 | 322 |
| 258 | 3300009551 | Ga0105238_10181197 | Ga0105238_101811971 | 322 |
| 259 | 3300013308 | Ga0157375_10477908 | Ga0157375_104779081 | 322 |
| 260 | 3300014326 | Ga0157380_10000799 | Ga0157380_100007999 | 322 |
| 261 | 3300025893 | Ga0207682_10078534 | Ga0207682_100785342 | 322 |
| 262 | 3300025924 | Ga0207694_10011457 | Ga0207694_100114572 | 322 |
| 263 | 3300025937 | Ga0207669_10000642 | Ga0207669_100006424 | 322 |
| 264 | 3300025940 | Ga0207691_10256827 | Ga0207691_102568273 | 322 |
| 265 | 3300025972 | Ga0207668_10013679 | Ga0207668_100136792 | 322 |
| 266 | 3300026121 | Ga0207683_10033861 | Ga0207683_100338612 | 322 |
| 267 | 3300028379 | Ga0268266_10071310 | Ga0268266_100713103 | 322 |
| 268 | 3300031548 | Ga0307408_100026796 | Ga0307408_1000267965 | 322 |
| 269 | 3300031731 | Ga0307405_10009616 | Ga0307405_100096165 | 322 |
| 270 | 3300031824 | Ga0307413_10009265 | Ga0307413_100092652 | 322 |
| 271 | 3300031852 | Ga0307410_10011351 | Ga0307410_100113512 | 322 |
| 272 | 3300031901 | Ga0307406_10027319 | Ga0307406_100273194 | 322 |
| 273 | 3300031903 | Ga0307407_10003095 | Ga0307407_100030954 | 322 |
| 274 | 3300032002 | Ga0307416_100014475 | Ga0307416_1000144752 | 322 |
| 275 | 3300032002 | Ga0307416_100107092 | Ga0307416_1001070924 | 322 |
| 276 | 3300032005 | Ga0307411_10036389 | Ga0307411_100363891 | 322 |
| 277 | 3300032126 | Ga0307415_100201023 | Ga0307415_1002010232 | 322 |
| 278 | 3300039093 | Ga0400489_19794 | Ga0400489_19794_5579_6577 | 322 |
| 279 | 3300042115 | Ga0450911_004969 | Ga0450911_004969_559_1563 | 322 |
| 280 | 3300042876 | Ga0451577_0003629 | Ga0451577_0003629_3932_4966 | 322 |
| 281 | 3300044712 | Ga0453684_0000414 | Ga0453684_0000414_117231_118265 | 322 |
| 282 | 3300048919 | Ga0496116_0001111 | Ga0496116_0001111_20673_21677 | 322 |
| 283 | 3300048920 | Ga0496117_0065177 | Ga0496117_0065177_556_1560 | 322 |
| 284 | 3300048921 | Ga0496118_0075438 | Ga0496118_0075438_923_1927 | 322 |
| 285 | 3300048929 | Ga0496126_0209196 | Ga0496126_0209196_149_1153 | 322 |
| 286 | 3300050507 | nmdc:mga05p37_74450_c1 | nmdc:mga05p37_74450_c1_2500_3531 | 322 |
| 287 | 3300050512 | nmdc:mga0n895_76562_c1 | nmdc:mga0n895_76562_c1_1754_2785 | 322 |
| 288 | 3300050515 | nmdc:mga0a205_84_c1 | nmdc:mga0a205_84_c1_47845_48876 | 322 |
| 289 | 3300053103 | Ga0500555_000051 | Ga0500555_000051_39210_40241 | 322 |
| 290 | 3300053153 | Ga0500616_0000306 | Ga0500616_0000306_45692_46723 | 322 |
| 291 | 3300053730 | Ga0500645_000041 | Ga0500645_000041_12315_13346 | 322 |
| 292 | 3300003320 | rootH2_10081097 | rootH2_100810979 | 323 |
| 293 | 3300005440 | Ga0070705_100153615 | Ga0070705_1001536152 | 323 |
| 294 | 3300005456 | Ga0070678_100081651 | Ga0070678_1000816513 | 323 |
| 295 | 3300005548 | Ga0070665_100000417 | Ga0070665_10000041730 | 323 |
| 296 | 3300005617 | Ga0068859_100123928 | Ga0068859_1001239282 | 323 |
| 297 | 3300006237 | Ga0097621_100117885 | Ga0097621_1001178852 | 323 |
| 298 | 3300006844 | Ga0075428_100256995 | Ga0075428_1002569952 | 323 |
| 299 | 3300006931 | Ga0097620_100123925 | Ga0097620_1001239252 | 323 |
| 300 | 3300025893 | Ga0207682_10073052 | Ga0207682_100730522 | 323 |
| 301 | 3300026121 | Ga0207683_10038335 | Ga0207683_100383352 | 323 |
| 302 | 3300028379 | Ga0268266_10000688 | Ga0268266_100006883 | 323 |
| 303 | 3300031852 | Ga0307410_10039157 | Ga0307410_100391571 | 323 |
| 304 | 3300037471 | Ga0395905_0005868 | Ga0395905_0005868_11297_12310 | 323 |
| 305 | 3300037471 | Ga0395905_0159651 | Ga0395905_0159651_72_1091 | 323 |
| 306 | 3300037471 | Ga0395905_0166445 | Ga0395905_0166445_936_1949 | 323 |
| 307 | 3300044712 | Ga0453684_0001111 | Ga0453684_0001111_43938_44921 | 323 |
| 308 | 3300044712 | Ga0453684_0017106 | Ga0453684_0017106_6252_7235 | 323 |
| 309 | 3300044712 | Ga0453684_0054288 | Ga0453684_0054288_1921_2904 | 323 |
| 310 | 3300049589 | Ga0501073_0032803 | Ga0501073_0032803_2073_3128 | 323 |
| 311 | 3300049590 | Ga0501074_0096470 | Ga0501074_0096470_404_1459 | 323 |
| 312 | 3300050494 | nmdc:mga06z11_63686_c1 | nmdc:mga06z11_63686_c1_53_1078 | 323 |
| 313 | 3300050511 | nmdc:mga08y16_43821_c1 | nmdc:mga08y16_43821_c1_2971_3993 | 323 |
| 314 | 3300059424 | Ga0590075_020193 | Ga0590075_020193_560_1591 | 323 |
| 315 | 3300059426 | Ga0590077_013308 | Ga0590077_013308_267_1298 | 323 |
| 316 | 3300005290 | Ga0065712_10017397 | Ga0065712_100173972 | 324 |
| 317 | 3300005331 | Ga0070670_100000644 | Ga0070670_10000064420 | 324 |
| 318 | 3300005336 | Ga0070680_100193619 | Ga0070680_1001936191 | 324 |
| 319 | 3300005353 | Ga0070669_100029791 | Ga0070669_1000297914 | 324 |
| 320 | 3300005355 | Ga0070671_100268597 | Ga0070671_1002685972 | 324 |
| 321 | 3300005364 | Ga0070673_100009483 | Ga0070673_1000094833 | 324 |
| 322 | 3300005438 | Ga0070701_10063569 | Ga0070701_100635692 | 324 |
| 323 | 3300005438 | Ga0070701_10106746 | Ga0070701_101067462 | 324 |
| 324 | 3300005456 | Ga0070678_100248042 | Ga0070678_1002480422 | 324 |
| 325 | 3300005457 | Ga0070662_100123610 | Ga0070662_1001236101 | 324 |
| 326 | 3300005543 | Ga0070672_100009427 | Ga0070672_1000094276 | 324 |
| 327 | 3300005564 | Ga0070664_100005128 | Ga0070664_1000051288 | 324 |
| 328 | 3300005578 | Ga0068854_100229420 | Ga0068854_1002294202 | 324 |
| 329 | 3300005618 | Ga0068864_100027300 | Ga0068864_1000273002 | 324 |
| 330 | 3300005618 | Ga0068864_100326655 | Ga0068864_1003266551 | 324 |
| 331 | 3300005843 | Ga0068860_100108586 | Ga0068860_1001085862 | 324 |
| 332 | 3300006880 | Ga0075429_100107600 | Ga0075429_1001076003 | 324 |
| 333 | 3300006881 | Ga0068865_100215622 | Ga0068865_1002156222 | 324 |
| 334 | 3300009094 | Ga0111539_10033958 | Ga0111539_100339585 | 324 |
| 335 | 3300017792 | Ga0163161_10183547 | Ga0163161_101835471 | 324 |
| 336 | 3300025917 | Ga0207660_10080772 | Ga0207660_100807722 | 324 |
| 337 | 3300025925 | Ga0207650_10014393 | Ga0207650_100143936 | 324 |
| 338 | 3300025926 | Ga0207659_10193622 | Ga0207659_101936222 | 324 |
| 339 | 3300025931 | Ga0207644_10051921 | Ga0207644_100519214 | 324 |
| 340 | 3300025933 | Ga0207706_10138031 | Ga0207706_101380312 | 324 |
| 341 | 3300025940 | Ga0207691_10042552 | Ga0207691_100425522 | 324 |
| 342 | 3300025945 | Ga0207679_10013441 | Ga0207679_100134412 | 324 |
| 343 | 3300025960 | Ga0207651_10012886 | Ga0207651_100128863 | 324 |
| 344 | 3300026121 | Ga0207683_10318098 | Ga0207683_103180981 | 324 |
| 345 | 3300028381 | Ga0268264_10304043 | Ga0268264_103040432 | 324 |
| 346 | 3300031548 | Ga0307408_100256067 | Ga0307408_1002560672 | 324 |
| 347 | 3300031995 | Ga0307409_100064353 | Ga0307409_1000643532 | 324 |
| 348 | 3300032002 | Ga0307416_100050742 | Ga0307416_1000507423 | 324 |
| 349 | 3300042436 | Ga0439435_0036416 | Ga0439435_0036416_213_1265 | 324 |
| 350 | 3300046664 | Ga0495659_0020578 | Ga0495659_0020578_631_1653 | 324 |
| 351 | 3300050507 | nmdc:mga05p37_357485_c1 | nmdc:mga05p37_357485_c1_673_1698 | 324 |
| 352 | 3300053139 | Ga0500568_0011205 | Ga0500568_0011205_990_2018 | 324 |
| 353 | 3300005338 | Ga0068868_100119137 | Ga0068868_1001191372 | 325 |
| 354 | 3300005354 | Ga0070675_100038145 | Ga0070675_1000381453 | 325 |
| 355 | 3300006358 | Ga0068871_100334160 | Ga0068871_1003341602 | 325 |
| 356 | 3300006844 | Ga0075428_100083995 | Ga0075428_1000839953 | 325 |
| 357 | 3300009094 | Ga0111539_10004794 | Ga0111539_100047943 | 325 |
| 358 | 3300009094 | Ga0111539_10162823 | Ga0111539_101628231 | 325 |
| 359 | 3300009147 | Ga0114129_10116587 | Ga0114129_101165874 | 325 |
| 360 | 3300009177 | Ga0105248_10111233 | Ga0105248_101112333 | 325 |
| 361 | 3300013306 | Ga0163162_10308366 | Ga0163162_103083662 | 325 |
| 362 | 3300025926 | Ga0207659_10056571 | Ga0207659_100565712 | 325 |
| 363 | 3300025931 | Ga0207644_10141485 | Ga0207644_101414851 | 325 |
| 364 | 3300025941 | Ga0207711_10054368 | Ga0207711_100543683 | 325 |
| 365 | 3300027907 | Ga0207428_10028854 | Ga0207428_100288543 | 325 |
| 366 | 3300027907 | Ga0207428_10061782 | Ga0207428_100617822 | 325 |
| 367 | 3300031665 | Ga0316575_10004403 | Ga0316575_100044035 | 325 |
| 368 | 3300031691 | Ga0316579_10009229 | Ga0316579_100092293 | 325 |
| 369 | 3300031727 | Ga0316576_10003307 | Ga0316576_100033072 | 325 |
| 370 | 3300031727 | Ga0316576_10071225 | Ga0316576_100712253 | 325 |
| 371 | 3300031727 | Ga0316576_10150142 | Ga0316576_101501422 | 325 |
| 372 | 3300031728 | Ga0316578_10000406 | Ga0316578_100004069 | 325 |
| 373 | 3300031728 | Ga0316578_10020356 | Ga0316578_100203562 | 325 |
| 374 | 3300031731 | Ga0307405_10003265 | Ga0307405_1000326511 | 325 |
| 375 | 3300031911 | Ga0307412_10014576 | Ga0307412_100145766 | 325 |
| 376 | 3300031995 | Ga0307409_100004703 | Ga0307409_1000047035 | 325 |
| 377 | 3300032002 | Ga0307416_100053949 | Ga0307416_1000539495 | 325 |
| 378 | 3300032002 | Ga0307416_100133426 | Ga0307416_1001334263 | 325 |
| 379 | 3300032004 | Ga0307414_10055409 | Ga0307414_100554091 | 325 |
| 380 | 3300032005 | Ga0307411_10003472 | Ga0307411_100034726 | 325 |
| 381 | 3300032126 | Ga0307415_100001761 | Ga0307415_10000176114 | 325 |
| 382 | 3300032133 | Ga0316583_10003725 | Ga0316583_100037253 | 325 |
| 383 | 3300032137 | Ga0316585_10000650 | Ga0316585_100006505 | 325 |
| 384 | 3300032139 | Ga0316580_10006382 | Ga0316580_100063822 | 325 |
| 385 | 3300032139 | Ga0316580_10045856 | Ga0316580_100458562 | 325 |
| 386 | 3300035398 | Ga0316574_0016859 | Ga0316574_0016859_2863_3852 | 325 |
| 387 | 3300036647 | Ga0316582_0002036 | Ga0316582_0002036_7522_8511 | 325 |
| 388 | 3300036647 | Ga0316582_0005548 | Ga0316582_0005548_2659_3648 | 325 |
| 389 | 3300036712 | Ga0316584_0005005 | Ga0316584_0005005_3120_4109 | 325 |
| 390 | 3300036712 | Ga0316584_0051174 | Ga0316584_0051174_1462_2451 | 325 |
| 391 | 3300038725 | Ga0400484_10749 | Ga0400484_10749_1376_2461 | 325 |
| 392 | 3300039093 | Ga0400489_24659 | Ga0400489_24659_21979_22968 | 325 |
| 393 | 3300039093 | Ga0400489_56300 | Ga0400489_56300_18725_19714 | 325 |
| 394 | 3300045051 | Ga0451576_0076467 | Ga0451576_0076467_361_1380 | 325 |
| 395 | 3300048916 | Ga0496113_0168093 | Ga0496113_0168093_93_1133 | 325 |
| 396 | 3300050507 | nmdc:mga05p37_105144_c1 | nmdc:mga05p37_105144_c1_907_1926 | 325 |
| 397 | 3300050510 | nmdc:mga06r32_15677_c1 | nmdc:mga06r32_15677_c1_2313_3332 | 325 |
| 398 | 3300050511 | nmdc:mga08y16_110480_c1 | nmdc:mga08y16_110480_c1_1225_2244 | 325 |
| 399 | 3300050511 | nmdc:mga08y16_204146_c1 | nmdc:mga08y16_204146_c1_669_1688 | 325 |
| 400 | 3300050511 | nmdc:mga08y16_870_c1 | nmdc:mga08y16_870_c1_14407_15438 | 325 |
| 401 | 3300050512 | nmdc:mga0n895_115260_c1 | nmdc:mga0n895_115260_c1_1087_2106 | 325 |
| 402 | 3300050515 | nmdc:mga0a205_14896_c1 | nmdc:mga0a205_14896_c1_955_1974 | 325 |
| 403 | 3300003203 | JGI25406J46586_10000986 | JGI25406J46586_1000098610 | 326 |
| 404 | 3300005327 | Ga0070658_10129513 | Ga0070658_101295132 | 326 |
| 405 | 3300005328 | Ga0070676_10002232 | Ga0070676_100022328 | 326 |
| 406 | 3300005328 | Ga0070676_10036458 | Ga0070676_100364581 | 326 |
| 407 | 3300005330 | Ga0070690_100010170 | Ga0070690_1000101706 | 326 |
| 408 | 3300005330 | Ga0070690_100021642 | Ga0070690_1000216423 | 326 |
| 409 | 3300005331 | Ga0070670_100008954 | Ga0070670_1000089545 | 326 |
| 410 | 3300005333 | Ga0070677_10016106 | Ga0070677_100161063 | 326 |
| 411 | 3300005334 | Ga0068869_100002035 | Ga0068869_1000020355 | 326 |
| 412 | 3300005334 | Ga0068869_100003931 | Ga0068869_1000039317 | 326 |
| 413 | 3300005335 | Ga0070666_10049270 | Ga0070666_100492702 | 326 |
| 414 | 3300005338 | Ga0068868_100025104 | Ga0068868_1000251042 | 326 |
| 415 | 3300005340 | Ga0070689_100212372 | Ga0070689_1002123722 | 326 |
| 416 | 3300005343 | Ga0070687_100008498 | Ga0070687_1000084982 | 326 |
| 417 | 3300005347 | Ga0070668_100077132 | Ga0070668_1000771323 | 326 |
| 418 | 3300005353 | Ga0070669_100005634 | Ga0070669_1000056344 | 326 |
| 419 | 3300005353 | Ga0070669_100157854 | Ga0070669_1001578542 | 326 |
| 420 | 3300005354 | Ga0070675_100000344 | Ga0070675_10000034419 | 326 |
| 421 | 3300005354 | Ga0070675_100002958 | Ga0070675_1000029583 | 326 |
| 422 | 3300005355 | Ga0070671_100064039 | Ga0070671_1000640393 | 326 |
| 423 | 3300005364 | Ga0070673_100004841 | Ga0070673_1000048412 | 326 |
| 424 | 3300005364 | Ga0070673_100175811 | Ga0070673_1001758111 | 326 |
| 425 | 3300005365 | Ga0070688_100162898 | Ga0070688_1001628982 | 326 |
| 426 | 3300005367 | Ga0070667_100008279 | Ga0070667_1000082796 | 326 |
| 427 | 3300005367 | Ga0070667_100302339 | Ga0070667_1003023392 | 326 |
| 428 | 3300005441 | Ga0070700_100027345 | Ga0070700_1000273452 | 326 |
| 429 | 3300005455 | Ga0070663_100044112 | Ga0070663_1000441123 | 326 |
| 430 | 3300005456 | Ga0070678_100090289 | Ga0070678_1000902893 | 326 |
| 431 | 3300005456 | Ga0070678_100223793 | Ga0070678_1002237932 | 326 |
| 432 | 3300005459 | Ga0068867_100000578 | Ga0068867_1000005784 | 326 |
| 433 | 3300005459 | Ga0068867_100051430 | Ga0068867_1000514303 | 326 |
| 434 | 3300005466 | Ga0070685_10009160 | Ga0070685_100091601 | 326 |
| 435 | 3300005543 | Ga0070672_100015081 | Ga0070672_1000150815 | 326 |
| 436 | 3300005543 | Ga0070672_100068226 | Ga0070672_1000682262 | 326 |
| 437 | 3300005543 | Ga0070672_100083505 | Ga0070672_1000835052 | 326 |
| 438 | 3300005544 | Ga0070686_100013664 | Ga0070686_1000136645 | 326 |
| 439 | 3300005544 | Ga0070686_100167420 | Ga0070686_1001674202 | 326 |
| 440 | 3300005548 | Ga0070665_100132700 | Ga0070665_1001327003 | 326 |
| 441 | 3300005549 | Ga0070704_100074238 | Ga0070704_1000742383 | 326 |
| 442 | 3300005564 | Ga0070664_100044735 | Ga0070664_1000447354 | 326 |
| 443 | 3300005564 | Ga0070664_100078015 | Ga0070664_1000780152 | 326 |
| 444 | 3300005617 | Ga0068859_100006708 | Ga0068859_1000067086 | 326 |
| 445 | 3300005718 | Ga0068866_10056893 | Ga0068866_100568932 | 326 |
| 446 | 3300005719 | Ga0068861_100064991 | Ga0068861_1000649912 | 326 |
| 447 | 3300005840 | Ga0068870_10015656 | Ga0068870_100156564 | 326 |
| 448 | 3300005841 | Ga0068863_100016001 | Ga0068863_1000160018 | 326 |
| 449 | 3300005841 | Ga0068863_100441691 | Ga0068863_1004416912 | 326 |
| 450 | 3300005842 | Ga0068858_100023552 | Ga0068858_1000235523 | 326 |
| 451 | 3300005842 | Ga0068858_100324155 | Ga0068858_1003241552 | 326 |
| 452 | 3300005843 | Ga0068860_100057807 | Ga0068860_1000578073 | 326 |
| 453 | 3300005844 | Ga0068862_100031342 | Ga0068862_1000313424 | 326 |
| 454 | 3300005985 | Ga0081539_10000164 | Ga0081539_10000164136 | 326 |
| 455 | 3300006358 | Ga0068871_100231017 | Ga0068871_1002310172 | 326 |
| 456 | 3300006844 | Ga0075428_100000166 | Ga0075428_10000016612 | 326 |
| 457 | 3300006844 | Ga0075428_100151426 | Ga0075428_1001514262 | 326 |
| 458 | 3300006846 | Ga0075430_100000691 | Ga0075430_10000069113 | 326 |
| 459 | 3300006846 | Ga0075430_100054231 | Ga0075430_1000542313 | 326 |
| 460 | 3300006847 | Ga0075431_100001885 | Ga0075431_10000188512 | 326 |
| 461 | 3300006847 | Ga0075431_100066473 | Ga0075431_1000664733 | 326 |
| 462 | 3300006852 | Ga0075433_10000037 | Ga0075433_1000003720 | 326 |
| 463 | 3300006852 | Ga0075433_10001456 | Ga0075433_1000145613 | 326 |
| 464 | 3300006871 | Ga0075434_100000596 | Ga0075434_1000005963 | 326 |
| 465 | 3300006871 | Ga0075434_100003672 | Ga0075434_10000367211 | 326 |
| 466 | 3300006881 | Ga0068865_100001886 | Ga0068865_1000018869 | 326 |
| 467 | 3300006931 | Ga0097620_100006708 | Ga0097620_1000067086 | 326 |
| 468 | 3300007076 | Ga0075435_100016436 | Ga0075435_1000164362 | 326 |
| 469 | 3300007076 | Ga0075435_100040676 | Ga0075435_1000406764 | 326 |
| 470 | 3300009094 | Ga0111539_10002820 | Ga0111539_1000282014 | 326 |
| 471 | 3300009094 | Ga0111539_10007840 | Ga0111539_100078409 | 326 |
| 472 | 3300009094 | Ga0111539_10042748 | Ga0111539_100427486 | 326 |
| 473 | 3300009147 | Ga0114129_10034123 | Ga0114129_100341235 | 326 |
| 474 | 3300009147 | Ga0114129_10267423 | Ga0114129_102674233 | 326 |
| 475 | 3300009148 | Ga0105243_10015475 | Ga0105243_100154753 | 326 |
| 476 | 3300009553 | Ga0105249_10007783 | Ga0105249_100077833 | 326 |
| 477 | 3300011119 | Ga0105246_10231957 | Ga0105246_102319572 | 326 |
| 478 | 3300013306 | Ga0163162_10019877 | Ga0163162_100198776 | 326 |
| 479 | 3300014745 | Ga0157377_10001309 | Ga0157377_100013094 | 326 |
| 480 | 3300014968 | Ga0157379_10058700 | Ga0157379_100587003 | 326 |
| 481 | 3300017792 | Ga0163161_10017406 | Ga0163161_100174066 | 326 |
| 482 | 3300025315 | Ga0207697_10002637 | Ga0207697_100026372 | 326 |
| 483 | 3300025899 | Ga0207642_10044334 | Ga0207642_100443343 | 326 |
| 484 | 3300025901 | Ga0207688_10007643 | Ga0207688_100076436 | 326 |
| 485 | 3300025907 | Ga0207645_10000611 | Ga0207645_1000061122 | 326 |
| 486 | 3300025907 | Ga0207645_10005408 | Ga0207645_100054085 | 326 |
| 487 | 3300025908 | Ga0207643_10000068 | Ga0207643_1000006823 | 326 |
| 488 | 3300025908 | Ga0207643_10047403 | Ga0207643_100474032 | 326 |
| 489 | 3300025918 | Ga0207662_10009971 | Ga0207662_100099713 | 326 |
| 490 | 3300025923 | Ga0207681_10004748 | Ga0207681_100047485 | 326 |
| 491 | 3300025923 | Ga0207681_10100840 | Ga0207681_101008402 | 326 |
| 492 | 3300025925 | Ga0207650_10009832 | Ga0207650_100098322 | 326 |
| 493 | 3300025926 | Ga0207659_10000353 | Ga0207659_1000035317 | 326 |
| 494 | 3300025926 | Ga0207659_10002915 | Ga0207659_100029155 | 326 |
| 495 | 3300025926 | Ga0207659_10009215 | Ga0207659_100092156 | 326 |
| 496 | 3300025927 | Ga0207687_10040448 | Ga0207687_100404482 | 326 |
| 497 | 3300025931 | Ga0207644_10064505 | Ga0207644_100645052 | 326 |
| 498 | 3300025933 | Ga0207706_10008244 | Ga0207706_100082444 | 326 |
| 499 | 3300025935 | Ga0207709_10004516 | Ga0207709_100045164 | 326 |
| 500 | 3300025936 | Ga0207670_10114634 | Ga0207670_101146341 | 326 |
| 501 | 3300025938 | Ga0207704_10002632 | Ga0207704_100026322 | 326 |
| 502 | 3300025940 | Ga0207691_10003313 | Ga0207691_100033138 | 326 |
| 503 | 3300025940 | Ga0207691_10011105 | Ga0207691_100111053 | 326 |
| 504 | 3300025940 | Ga0207691_10059555 | Ga0207691_100595554 | 326 |
| 505 | 3300025942 | Ga0207689_10000219 | Ga0207689_100002199 | 326 |
| 506 | 3300025942 | Ga0207689_10002433 | Ga0207689_1000243312 | 326 |
| 507 | 3300025942 | Ga0207689_10118812 | Ga0207689_101188123 | 326 |
| 508 | 3300025945 | Ga0207679_10064008 | Ga0207679_100640082 | 326 |
| 509 | 3300025945 | Ga0207679_10168820 | Ga0207679_101688202 | 326 |
| 510 | 3300025945 | Ga0207679_10298136 | Ga0207679_102981361 | 326 |
| 511 | 3300025960 | Ga0207651_10000813 | Ga0207651_100008137 | 326 |
| 512 | 3300025960 | Ga0207651_10091094 | Ga0207651_100910943 | 326 |
| 513 | 3300025960 | Ga0207651_10411410 | Ga0207651_104114101 | 326 |
| 514 | 3300025972 | Ga0207668_10222610 | Ga0207668_102226101 | 326 |
| 515 | 3300025981 | Ga0207640_10143130 | Ga0207640_101431301 | 326 |
| 516 | 3300026023 | Ga0207677_10068506 | Ga0207677_100685062 | 326 |
| 517 | 3300026035 | Ga0207703_10271081 | Ga0207703_102710812 | 326 |
| 518 | 3300026067 | Ga0207678_10064681 | Ga0207678_100646813 | 326 |
| 519 | 3300026075 | Ga0207708_10015509 | Ga0207708_100155095 | 326 |
| 520 | 3300026075 | Ga0207708_10015853 | Ga0207708_100158533 | 326 |
| 521 | 3300026088 | Ga0207641_10091615 | Ga0207641_100916153 | 326 |
| 522 | 3300026088 | Ga0207641_10098826 | Ga0207641_100988263 | 326 |
| 523 | 3300026089 | Ga0207648_10001252 | Ga0207648_1000125214 | 326 |
| 524 | 3300026095 | Ga0207676_10121225 | Ga0207676_101212252 | 326 |
| 525 | 3300026116 | Ga0207674_10152404 | Ga0207674_101524042 | 326 |
| 526 | 3300026118 | Ga0207675_100088473 | Ga0207675_1000884733 | 326 |
| 527 | 3300026121 | Ga0207683_10037554 | Ga0207683_100375543 | 326 |
| 528 | 3300026121 | Ga0207683_10065501 | Ga0207683_100655012 | 326 |
| 529 | 3300027876 | Ga0209974_10018478 | Ga0209974_100184783 | 326 |
| 530 | 3300027907 | Ga0207428_10019347 | Ga0207428_100193472 | 326 |
| 531 | 3300028381 | Ga0268264_10041798 | Ga0268264_100417982 | 326 |
| 532 | 3300031727 | Ga0316576_10003024 | Ga0316576_100030244 | 326 |
| 533 | 3300031728 | Ga0316578_10007802 | Ga0316578_100078025 | 326 |
| 534 | 3300036647 | Ga0316582_0015154 | Ga0316582_0015154_3342_4334 | 326 |
| 535 | 3300036712 | Ga0316584_0002001 | Ga0316584_0002001_3200_4234 | 326 |
| 536 | 3300036712 | Ga0316584_0002281 | Ga0316584_0002281_7336_8328 | 326 |
| 537 | 3300037588 | Ga0316581_0072207 | Ga0316581_0072207_12_1004 | 326 |
| 538 | 3300038726 | Ga0400490_24154 | Ga0400490_24154_8140_9132 | 326 |
| 539 | 3300038727 | Ga0400491_06558 | Ga0400491_06558_938_1930 | 326 |
| 540 | 3300042008 | Ga0439450_003741 | Ga0439450_003741_481_1509 | 326 |
| 541 | 3300042142 | Ga0450905_003275 | Ga0450905_003275_646_1671 | 326 |
| 542 | 3300046539 | Ga0495621_0023854 | Ga0495621_0023854_525_1556 | 326 |
| 543 | 3300046615 | Ga0495656_0017989 | Ga0495656_0017989_515_1546 | 326 |
| 544 | 3300050507 | nmdc:mga05p37_26140_c1 | nmdc:mga05p37_26140_c1_3713_4744 | 326 |
| 545 | 3300050507 | nmdc:mga05p37_408122_c1 | nmdc:mga05p37_408122_c1_298_1320 | 326 |
| 546 | 3300050508 | nmdc:mga09592_49274_c1 | nmdc:mga09592_49274_c1_1055_2083 | 326 |
| 547 | 3300050509 | nmdc:mga0qj67_2782_c1 | nmdc:mga0qj67_2782_c1_1670_2698 | 326 |
| 548 | 3300050510 | nmdc:mga06r32_8270_c1 | nmdc:mga06r32_8270_c1_1952_2980 | 326 |
| 549 | 3300050511 | nmdc:mga08y16_284929_c1 | nmdc:mga08y16_284929_c1_427_1458 | 326 |
| 550 | 3300050511 | nmdc:mga08y16_71485_c1 | nmdc:mga08y16_71485_c1_1332_2360 | 326 |
| 551 | 3300050512 | nmdc:mga0n895_16759_c1 | nmdc:mga0n895_16759_c1_2510_3538 | 326 |
| 552 | 3300050513 | nmdc:mga0rr50_38400_c1 | nmdc:mga0rr50_38400_c1_575_1603 | 326 |
| 553 | 3300050513 | nmdc:mga0rr50_708_c1 | nmdc:mga0rr50_708_c1_10375_11406 | 326 |
| 554 | 3300050515 | nmdc:mga0a205_13094_c1 | nmdc:mga0a205_13094_c1_604_1632 | 326 |
| 555 | 3300050515 | nmdc:mga0a205_716_c1 | nmdc:mga0a205_716_c1_21574_22605 | 326 |
| 556 | iso_pu_bacteria | 2919134579 | 2919138254 | 326 |
| 557 | 3300005290 | Ga0065712_10002276 | Ga0065712_100022766 | 327 |
| 558 | 3300005293 | Ga0065715_10002535 | Ga0065715_100025353 | 327 |
| 559 | 3300005441 | Ga0070700_100073272 | Ga0070700_1000732721 | 327 |
| 560 | 3300005543 | Ga0070672_100104221 | Ga0070672_1001042213 | 327 |
| 561 | 3300005618 | Ga0068864_100138443 | Ga0068864_1001384432 | 327 |
| 562 | 3300005840 | Ga0068870_10016802 | Ga0068870_100168024 | 327 |
| 563 | 3300005981 | Ga0081538_10050621 | Ga0081538_100506212 | 327 |
| 564 | 3300025908 | Ga0207643_10002433 | Ga0207643_100024334 | 327 |
| 565 | 3300026089 | Ga0207648_10178439 | Ga0207648_101784392 | 327 |
| 566 | 3300026095 | Ga0207676_10409490 | Ga0207676_104094901 | 327 |
| 567 | 3300038725 | Ga0400484_32425 | Ga0400484_32425_363_1358 | 327 |
| 568 | 3300038726 | Ga0400490_10536 | Ga0400490_10536_703_1698 | 327 |
| 569 | 3300038726 | Ga0400490_11632 | Ga0400490_11632_580_1575 | 327 |
| 570 | 3300038726 | Ga0400490_55129 | Ga0400490_55129_504_1499 | 327 |
| 571 | 3300038735 | Ga0400485_12416 | Ga0400485_12416_3143_4138 | 327 |
| 572 | 3300038735 | Ga0400485_18741 | Ga0400485_18741_19247_20242 | 327 |
| 573 | 3300038735 | Ga0400485_20208 | Ga0400485_20208_10513_11508 | 327 |
| 574 | 3300038741 | Ga0400488_17101 | Ga0400488_17101_1947_2942 | 327 |
| 575 | 3300038741 | Ga0400488_36447 | Ga0400488_36447_324_1319 | 327 |
| 576 | 3300038742 | Ga0400486_01713 | Ga0400486_01713_3142_4137 | 327 |
| 577 | 3300038742 | Ga0400486_13010 | Ga0400486_13010_11069_12064 | 327 |
| 578 | 3300038742 | Ga0400486_19352 | Ga0400486_19352_2554_3549 | 327 |
| 579 | 3300038742 | Ga0400486_32970 | Ga0400486_32970_9241_10236 | 327 |
| 580 | 3300039062 | Ga0400483_095319 | Ga0400483_095319_25782_26927 | 327 |
| 581 | 3300039062 | Ga0400483_113209 | Ga0400483_113209_610_1605 | 327 |
| 582 | 3300039062 | Ga0400483_172553 | Ga0400483_172553_4835_5830 | 327 |
| 583 | 3300039093 | Ga0400489_70520 | Ga0400489_70520_9829_10824 | 327 |
| 584 | 3300039093 | Ga0400489_94355 | Ga0400489_94355_3368_4390 | 327 |
| 585 | 3300039110 | Ga0400487_06632 | Ga0400487_06632_9709_10704 | 327 |
| 586 | 3300039110 | Ga0400487_15943 | Ga0400487_15943_589_1584 | 327 |
| 587 | 3300039110 | Ga0400487_29500 | Ga0400487_29500_859_1854 | 327 |
| 588 | 3300039110 | Ga0400487_49500 | Ga0400487_49500_680_1696 | 327 |
| 589 | 3300046615 | Ga0495656_0003673 | Ga0495656_0003673_1675_2709 | 327 |
| 590 | 3300049572 | Ga0501036_0040305 | Ga0501036_0040305_2846_3853 | 327 |
| 591 | 3300049742 | Ga0501080_0113976 | Ga0501080_0113976_1373_2377 | 327 |
| 592 | 3300049822 | Ga0501035_0056757 | Ga0501035_0056757_224_1231 | 327 |
| 593 | iso_pu_bacteria | 2547132130 | 2547502318 | 327 |
| 594 | iso_pu_bacteria | 2842391507 | 2842393428 | 327 |
| 595 | iso_pu_bacteria | 2961064222 | 2961067932 | 327 |
| 596 | 3300006051 | Ga0075364_10000276 | Ga0075364_100002768 | 328 |
| 597 | 3300031665 | Ga0316575_10051417 | Ga0316575_100514172 | 328 |
| 598 | 3300031727 | Ga0316576_10007410 | Ga0316576_100074105 | 328 |
| 599 | 3300036712 | Ga0316584_0095851 | Ga0316584_0095851_1149_2150 | 328 |
| 600 | 3300038725 | Ga0400484_11841 | Ga0400484_11841_4671_5669 | 328 |
| 601 | 3300038726 | Ga0400490_04360 | Ga0400490_04360_3349_4347 | 328 |
| 602 | 3300038741 | Ga0400488_56624 | Ga0400488_56624_31485_32483 | 328 |
| 603 | 3300046453 | Ga0495627_006967 | Ga0495627_006967_2338_3462 | 328 |
| 604 | 3300046471 | Ga0495650_0017522 | Ga0495650_0017522_897_2021 | 328 |
| 605 | 3300046474 | Ga0495605_0000036 | Ga0495605_0000036_48430_49554 | 328 |
| 606 | 3300046499 | Ga0495594_0000608 | Ga0495594_0000608_16613_17737 | 328 |
| 607 | 3300046506 | Ga0495583_0000028 | Ga0495583_0000028_61681_62805 | 328 |
| 608 | 3300046512 | Ga0495610_0044263 | Ga0495610_0044263_1025_2149 | 328 |
| 609 | 3300046515 | Ga0495620_0000073 | Ga0495620_0000073_64120_65244 | 328 |
| 610 | 3300046524 | Ga0495648_0005020 | Ga0495648_0005020_1513_2637 | 328 |
| 611 | 3300046530 | Ga0495654_0000246 | Ga0495654_0000246_45598_46722 | 328 |
| 612 | 3300046538 | Ga0495609_0000115 | Ga0495609_0000115_48433_49557 | 328 |
| 613 | 3300046542 | Ga0495597_0001109 | Ga0495597_0001109_16852_17976 | 328 |
| 614 | 3300046558 | Ga0495633_0000028 | Ga0495633_0000028_184210_185334 | 328 |
| 615 | 3300046648 | Ga0495611_0002080 | Ga0495611_0002080_1796_2920 | 328 |
| 616 | 3300046665 | Ga0495661_0000211 | Ga0495661_0000211_47985_49109 | 328 |
| 617 | 3300046691 | Ga0495670_0026477 | Ga0495670_0026477_722_1846 | 328 |
| 618 | 3300046794 | Ga0495589_0000402 | Ga0495589_0000402_15851_16975 | 328 |
| 619 | 3300046810 | Ga0495660_0001852 | Ga0495660_0001852_11231_12355 | 328 |
| 620 | 3300047323 | Ga0495683_0000091 | Ga0495683_0000091_72003_73127 | 328 |
| 621 | 3300047446 | Ga0495679_000083 | Ga0495679_000083_68035_69159 | 328 |
| 622 | 3300047469 | Ga0495673_0015663 | Ga0495673_0015663_457_1581 | 328 |
| 623 | 3300047470 | Ga0495681_0020864 | Ga0495681_0020864_2309_3433 | 328 |
| 624 | 3300048925 | Ga0496122_0048434 | Ga0496122_0048434_1661_2785 | 328 |
| 625 | 3300049459 | Ga0495678_000020 | Ga0495678_000020_59784_60908 | 328 |
| 626 | 3300050491 | nmdc:mga00v17_308_c1 | nmdc:mga00v17_308_c1_8417_9442 | 328 |
| 627 | iso_pu_bacteria | 2765235840 | 2765577002 | 328 |
| 628 | iso_pu_bacteria | 2816332141 | 2816519629 | 328 |
| 629 | iso_pu_bacteria | 2895498888 | 2895503264 | 328 |
| 630 | iso_pu_bacteria | 2895522137 | 2895523102 | 328 |
| 631 | 3300032004 | Ga0307414_10055384 | Ga0307414_100553842 | 329 |
| 632 | 3300045051 | Ga0451576_0000171 | Ga0451576_0000171_11759_12895 | 329 |
| 633 | iso_pu_bacteria | 2747842428 | 2747950618 | 329 |
| 634 | iso_pu_bacteria | 2895511927 | 2895513090 | 329 |
| 635 | iso_pu_bacteria | 2895525241 | 2895527005 | 329 |
| 636 | 3300009036 | Ga0105244_10003455 | Ga0105244_100034554 | 330 |
| 637 | 3300025728 | Ga0207655_1003689 | Ga0207655_10036895 | 330 |
| 638 | 3300031727 | Ga0316576_10040530 | Ga0316576_100405302 | 330 |
| 639 | 3300041459 | Ga0451800_1190734 | Ga0451800_1190734_141_1154 | 330 |
| 640 | 3300048924 | Ga0496121_0000705 | Ga0496121_0000705_3214_4356 | 330 |
| 641 | iso_pu_bacteria | 2537561836 | 2538834869 | 330 |
| 642 | iso_pu_bacteria | 2576861471 | 2578460294 | 330 |
| 643 | iso_pu_bacteria | 2818991457 | 2819662074 | 330 |
| 644 | iso_pu_bacteria | 2842757796 | 2842760348 | 330 |
| 645 | iso_pu_bacteria | 2857442823 | 2857444084 | 330 |
| 646 | iso_pu_bacteria | 2895395659 | 2895397192 | 330 |
| 647 | iso_pu_bacteria | 2939622612 | 2939623274 | 330 |
| 648 | 3300003320 | rootH2_10006882 | rootH2_1000688210 | 331 |
| 649 | 3300009036 | Ga0105244_10023804 | Ga0105244_100238042 | 331 |
| 650 | 3300025728 | Ga0207655_1035463 | Ga0207655_10354632 | 331 |
| 651 | 3300025935 | Ga0207709_10000954 | Ga0207709_100009545 | 331 |
| 652 | 3300044673 | Ga0453683_0146652 | Ga0453683_0146652_46_1113 | 331 |
| 653 | 3300045051 | Ga0451576_0028416 | Ga0451576_0028416_2767_3834 | 331 |
| 654 | iso_pu_bacteria | 2643221577 | 2643893820 | 331 |
| 655 | iso_pu_bacteria | 2643221685 | 2644476045 | 331 |
| 656 | 3300002773 | JGI25152J39213_1000004 | JGI25152J39213_100000430 | 332 |
| 657 | 3300002774 | JGI25150J39212_1000491 | JGI25150J39212_100049112 | 332 |
| 658 | 3300003187 | JGI25151J46595_10000010 | JGI25151J46595_1000001030 | 332 |
| 659 | 3300003215 | JGI25153J46596_10000013 | JGI25153J46596_1000001330 | 332 |
| 660 | 3300025245 | Ga0207425_1000015 | Ga0207425_1000015260 | 332 |
| 661 | 3300025258 | Ga0209129_1000074 | Ga0209129_1000074141 | 332 |
| 662 | 3300025294 | Ga0209025_1000002 | Ga0209025_10000021158 | 332 |
| 663 | 3300025297 | Ga0209758_1000003 | Ga0209758_10000031165 | 332 |
| 664 | 3300003856 | Ga0058692_1000005 | Ga0058692_1000005260 | 333 |
| 665 | 3300005337 | Ga0070682_100039242 | Ga0070682_1000392422 | 333 |
| 666 | 3300005539 | Ga0068853_100003732 | Ga0068853_1000037327 | 333 |
| 667 | 3300005563 | Ga0068855_100294240 | Ga0068855_1002942402 | 333 |
| 668 | 3300009551 | Ga0105238_10013627 | Ga0105238_100136279 | 333 |
| 669 | 3300013104 | Ga0157370_10103954 | Ga0157370_101039543 | 333 |
| 670 | 3300013307 | Ga0157372_10119169 | Ga0157372_101191692 | 333 |
| 671 | 3300025924 | Ga0207694_10003531 | Ga0207694_100035313 | 333 |
| 672 | 3300025949 | Ga0207667_10068982 | Ga0207667_100689822 | 333 |
| 673 | 3300026041 | Ga0207639_10001388 | Ga0207639_1000138810 | 333 |
| 674 | 3300027312 | Ga0209371_1000031 | Ga0209371_1000031256 | 333 |
| 675 | 3300030500 | Ga0268256_1000034 | Ga0268256_100003495 | 333 |
| 676 | 3300005289 | Ga0065704_10071755 | Ga0065704_100717553 | 334 |
| 677 | 3300005366 | Ga0070659_100064651 | Ga0070659_1000646512 | 334 |
| 678 | 3300005539 | Ga0068853_100225609 | Ga0068853_1002256092 | 334 |
| 679 | 3300009174 | Ga0105241_10098597 | Ga0105241_100985972 | 334 |
| 680 | 3300009551 | Ga0105238_10115595 | Ga0105238_101155952 | 334 |
| 681 | 3300014497 | Ga0182008_10000083 | Ga0182008_1000008317 | 334 |
| 682 | 3300017792 | Ga0163161_10007719 | Ga0163161_100077192 | 334 |
| 683 | 3300025924 | Ga0207694_10015837 | Ga0207694_100158372 | 334 |
| 684 | 3300025932 | Ga0207690_10009308 | Ga0207690_100093082 | 334 |
| 685 | 3300030732 | Ga0316176_1036236 | Ga0316176_10362362 | 334 |
| 686 | 3300037418 | Ga0395900_0105645 | Ga0395900_0105645_1825_2835 | 334 |
| 687 | 3300038443 | Ga0395901_0005884 | Ga0395901_0005884_8860_9870 | 334 |
| 688 | 3300046453 | Ga0495627_010488 | Ga0495627_010488_983_2008 | 334 |
| 689 | 3300046460 | Ga0495638_0000923 | Ga0495638_0000923_15567_16592 | 334 |
| 690 | 3300046522 | Ga0495643_0001805 | Ga0495643_0001805_6333_7358 | 334 |
| 691 | 3300046525 | Ga0495663_0013141 | Ga0495663_0013141_775_1800 | 334 |
| 692 | 3300046615 | Ga0495656_0005742 | Ga0495656_0005742_1964_2986 | 334 |
| 693 | 3300046660 | Ga0495625_0103741 | Ga0495625_0103741_680_1705 | 334 |
| 694 | 3300047318 | Ga0495636_0026359 | Ga0495636_0026359_1204_2226 | 334 |
| 695 | 3300047320 | Ga0495672_0000214 | Ga0495672_0000214_65181_66206 | 334 |
| 696 | 3300047472 | Ga0495686_0008753 | Ga0495686_0008753_5238_6263 | 334 |
| 697 | 3300048920 | Ga0496117_0001300 | Ga0496117_0001300_35005_36030 | 334 |
| 698 | 3300048920 | Ga0496117_0002433 | Ga0496117_0002433_5647_6729 | 334 |
| 699 | 3300048921 | Ga0496118_0000406 | Ga0496118_0000406_53910_54992 | 334 |
| 700 | 3300048921 | Ga0496118_0000703 | Ga0496118_0000703_42436_43461 | 334 |
| 701 | 3300048927 | Ga0496124_0010087 | Ga0496124_0010087_4555_5580 | 334 |
| 702 | 3300048927 | Ga0496124_0074196 | Ga0496124_0074196_918_1943 | 334 |
| 703 | 3300002067 | JGI24735J21928_10025197 | JGI24735J21928_100251972 | 335 |
| 704 | 3300015685 | Ga0183369_1013 | Ga0183369_1013145 | 335 |
| 705 | 3300037312 | Ga0395899_0007681 | Ga0395899_0007681_3983_4990 | 335 |
| 706 | 3300037312 | Ga0395899_0107908 | Ga0395899_0107908_784_1791 | 335 |
| 707 | 3300037418 | Ga0395900_0001792 | Ga0395900_0001792_2748_3755 | 335 |
| 708 | 3300037418 | Ga0395900_0021154 | Ga0395900_0021154_2362_3369 | 335 |
| 709 | 3300037466 | Ga0395898_0021442 | Ga0395898_0021442_3537_4544 | 335 |
| 710 | 3300037466 | Ga0395898_0037984 | Ga0395898_0037984_412_1428 | 335 |
| 711 | 3300037466 | Ga0395898_0082078 | Ga0395898_0082078_369_1376 | 335 |
| 712 | 3300037466 | Ga0395898_0154467 | Ga0395898_0154467_166_1173 | 335 |
| 713 | 3300038443 | Ga0395901_0016478 | Ga0395901_0016478_6336_7352 | 335 |
| 714 | 3300038443 | Ga0395901_0017096 | Ga0395901_0017096_1366_2373 | 335 |
| 715 | 3300038443 | Ga0395901_0101173 | Ga0395901_0101173_14_1021 | 335 |
| 716 | 3300049573 | Ga0501037_0046762 | Ga0501037_0046762_228_1250 | 335 |
| 717 | 3300049574 | Ga0501038_0008714 | Ga0501038_0008714_4045_5058 | 335 |
| 718 | 3300049580 | Ga0501046_0005153 | Ga0501046_0005153_3952_4965 | 335 |
| 719 | 3300049581 | Ga0501047_0363103 | Ga0501047_0363103_30_1043 | 335 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1yox-assembly1.cif.gz_C | structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa | 0.9143 | 72 | 308 |
| 1yox-assembly2.cif.gz_E | structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa | 0.9098 | 70 | 307 |
| 1yox-assembly1.cif.gz_A | structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa | 0.9097 | 72 | 308 |
| 1yox-assembly2.cif.gz_F | structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa | 0.9062 | 72 | 308 |
| 1yox-assembly1.cif.gz_C | structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa | 0.9054 | 72 | 308 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1yoxA00 | Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 | 0.8913 | 72 | 308 | 3.60.160.10 |
| 1yoxA00 | Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 | 0.8504 | 72 | 308 | 3.60.160.10 |
| af_Q54F06_101_330_3.60.160.10 | Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 | 0.7968 | 68 | 308 | 3.60.160.10 |
| af_Q54F06_101_330_3.60.160.10 | Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 | 0.7874 | 68 | 308 | 3.60.160.10 |
| 1pg6A00 | Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 | 0.7729 | 74 | 307 | 3.60.160.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6M0BLV1-F1-model_v4 | AIM24 family protein | 0.9185 | 163 | 309 |
|
| AF-A0A7C6WUJ8-F1-model_v4 | AIM24 family protein | 0.9114 | 165 | 313 |
|
| AF-A0A7S1GJ19-F1-model_v4 | Altered inheritance of mitochondria protein 24, mitochondrial | 0.9075 | 162 | 296 |
|
| AF-A0A4Q3R9G4-F1-model_v4 | AIM24 family protein | 0.9068 | 164 | 300 |
|
| AF-A0A7C6WUJ8-F1-model_v4 | AIM24 family protein | 0.9056 | 165 | 313 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar