F476995
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 715 | 312 | 710 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300031507|Ga0307509_10000365|Ga0307509_100003652 |
| Length | 173 |
| Sequence | VADEQQPTLTPPASDAPPSVDNNAMDINEVMRRLPHRYPFLLVDRVLECHSGKTIRALKNVTVNEPYFPGHFPHRPVLPGVIILEALAQTAGILAFVTAGVYPDEHRQLYFVGIDKARFRRPVVPGDQLILKATLERSLRGIWKFSTVAEVNGEEATSAEMMVAPGETAAEKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 2 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 3 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 4 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 5 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 179 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 192 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 193 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 211 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 214 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 215 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 219 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 220 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 221 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 222 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 223 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 224 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 225 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 226 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 227 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 228 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 229 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 230 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 231 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 232 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 234 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 235 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 236 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 237 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 238 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 239 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 240 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 241 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 242 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 243 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 246 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 247 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 248 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 249 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 250 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 270 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 271 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 274 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 275 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 276 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 277 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 278 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 299 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 300 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 301 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 302 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 303 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 304 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 305 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 306 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 307 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 308 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 309 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 310 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 312 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.04 |
| Metatranscriptomes | 1.26 |
| Isolates | 0.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.24 |
| Nodule | 0.28 |
| Rhizoplane | 2.94 |
| Rhizosphere | 86.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065714_10222308 | 3300005288 | Bacteria | 837 |
| 2 | Ga0065712_10089595 | 3300005290 | Bacteria | 2459 |
| 3 | Ga0065715_10095987 | 3300005293 | Bacteria | 3966 |
| 4 | Ga0065707_10088639 | 3300005295 | Bacteria | 4597 |
| 5 | Ga0070658_10168924 | 3300005327 | Bacteria | 1837 |
| 6 | Ga0070658_10241175 | 3300005327 | Bacteria | 1532 |
| 7 | Ga0070676_10431059 | 3300005328 | Bacteria | 923 |
| 8 | Ga0070683_100035698 | 3300005329 | Bacteria | 4544 |
| 9 | Ga0070683_100650461 | 3300005329 | Bacteria | 1009 |
| 10 | Ga0070690_100027547 | 3300005330 | Bacteria | 3513 |
| 11 | Ga0070670_100000015 | 3300005331 | Bacteria | 228819 |
| 12 | Ga0070670_100006956 | 3300005331 | Bacteria | 9588 |
| 13 | Ga0070670_100047907 | 3300005331 | Bacteria | 3678 |
| 14 | Ga0070670_100547530 | 3300005331 | Bacteria | 1032 |
| 15 | Ga0070677_10110098 | 3300005333 | Bacteria | 1228 |
| 16 | Ga0068869_100003904 | 3300005334 | Bacteria | 9197 |
| 17 | Ga0068869_100027255 | 3300005334 | Bacteria | 3981 |
| 18 | Ga0068869_100329772 | 3300005334 | Bacteria | 1240 |
| 19 | Ga0068869_101183805 | 3300005334 | Bacteria | 671 |
| 20 | Ga0070666_10000912 | 3300005335 | Bacteria | 17915 |
| 21 | Ga0070666_10030935 | 3300005335 | Bacteria | 3530 |
| 22 | Ga0070666_10041927 | 3300005335 | Bacteria | 3060 |
| 23 | Ga0070666_10227926 | 3300005335 | Bacteria | 1315 |
| 24 | Ga0070666_10250811 | 3300005335 | Bacteria | 1253 |
| 25 | Ga0070680_100407771 | 3300005336 | Bacteria | 1159 |
| 26 | Ga0068868_100007318 | 3300005338 | Bacteria | 7857 |
| 27 | Ga0068868_100180742 | 3300005338 | Bacteria | 1750 |
| 28 | Ga0068868_100209917 | 3300005338 | Bacteria | 1627 |
| 29 | Ga0068868_101234355 | 3300005338 | Bacteria | 692 |
| 30 | Ga0070689_100004887 | 3300005340 | Bacteria | 9093 |
| 31 | Ga0070687_100043515 | 3300005343 | Bacteria | 2282 |
| 32 | Ga0070687_100585443 | 3300005343 | Bacteria | 764 |
| 33 | Ga0070661_100018471 | 3300005344 | Bacteria | 4956 |
| 34 | Ga0070661_100157790 | 3300005344 | Bacteria | 1717 |
| 35 | Ga0070661_100567428 | 3300005344 | Bacteria | 915 |
| 36 | Ga0070692_10538689 | 3300005345 | Bacteria | 763 |
| 37 | Ga0070668_100002261 | 3300005347 | Bacteria | 14179 |
| 38 | Ga0070668_100356678 | 3300005347 | Bacteria | 1239 |
| 39 | Ga0070669_100002436 | 3300005353 | Bacteria | 13474 |
| 40 | Ga0070669_100037306 | 3300005353 | Bacteria | 3526 |
| 41 | Ga0070669_101269602 | 3300005353 | Bacteria | 637 |
| 42 | Ga0070675_100066009 | 3300005354 | Bacteria | 2992 |
| 43 | Ga0070675_100067476 | 3300005354 | Bacteria | 2960 |
| 44 | Ga0070675_100335136 | 3300005354 | Bacteria | 1339 |
| 45 | Ga0070675_100740971 | 3300005354 | Bacteria | 896 |
| 46 | Ga0070671_100000013 | 3300005355 | Bacteria | 173287 |
| 47 | Ga0070671_100021032 | 3300005355 | Bacteria | 5325 |
| 48 | Ga0070671_100067376 | 3300005355 | Bacteria | 2984 |
| 49 | Ga0070671_100193271 | 3300005355 | Bacteria | 1725 |
| 50 | Ga0070671_100837471 | 3300005355 | Bacteria | 802 |
| 51 | Ga0070673_100005910 | 3300005364 | Bacteria | 7901 |
| 52 | Ga0070673_100010204 | 3300005364 | Bacteria | 6345 |
| 53 | Ga0070673_100097039 | 3300005364 | Bacteria | 2420 |
| 54 | Ga0070673_100354037 | 3300005364 | Bacteria | 1304 |
| 55 | Ga0070688_100004864 | 3300005365 | Bacteria | 7027 |
| 56 | Ga0070688_100024544 | 3300005365 | Bacteria | 3559 |
| 57 | Ga0070688_100306842 | 3300005365 | Bacteria | 1149 |
| 58 | Ga0070688_101100106 | 3300005365 | Bacteria | 635 |
| 59 | Ga0070659_100327620 | 3300005366 | Bacteria | 1281 |
| 60 | Ga0070667_100000015 | 3300005367 | Bacteria | 238203 |
| 61 | Ga0070667_100003903 | 3300005367 | Bacteria | 12661 |
| 62 | Ga0070667_100038246 | 3300005367 | Bacteria | 4023 |
| 63 | Ga0070667_100292441 | 3300005367 | Bacteria | 1465 |
| 64 | Ga0070667_100311078 | 3300005367 | Bacteria | 1420 |
| 65 | Ga0070709_10103513 | 3300005434 | Bacteria | 1901 |
| 66 | Ga0070714_100018737 | 3300005435 | Bacteria | 5631 |
| 67 | Ga0070714_100061413 | 3300005435 | Bacteria | 3228 |
| 68 | Ga0070714_100064330 | 3300005435 | Bacteria | 3156 |
| 69 | Ga0070713_100510789 | 3300005436 | Bacteria | 1135 |
| 70 | Ga0070701_10105706 | 3300005438 | Bacteria | 1566 |
| 71 | Ga0070705_100269645 | 3300005440 | Bacteria | 1205 |
| 72 | Ga0070705_101240372 | 3300005440 | Bacteria | 616 |
| 73 | Ga0070705_101762899 | 3300005440 | Bacteria | 524 |
| 74 | Ga0070700_100338743 | 3300005441 | Bacteria | 1111 |
| 75 | Ga0070694_100005376 | 3300005444 | Bacteria | 7748 |
| 76 | Ga0070694_100256120 | 3300005444 | Bacteria | 1326 |
| 77 | Ga0070694_100302523 | 3300005444 | Bacteria | 1226 |
| 78 | Ga0070663_100714354 | 3300005455 | Bacteria | 853 |
| 79 | Ga0070678_100052998 | 3300005456 | Bacteria | 2948 |
| 80 | Ga0070678_100084624 | 3300005456 | Bacteria | 2415 |
| 81 | Ga0070678_100130988 | 3300005456 | Bacteria | 1992 |
| 82 | Ga0070662_100158230 | 3300005457 | Bacteria | 1770 |
| 83 | Ga0070662_100161987 | 3300005457 | Bacteria | 1750 |
| 84 | Ga0070681_10004922 | 3300005458 | Bacteria | 12830 |
| 85 | Ga0070681_10236206 | 3300005458 | Bacteria | 1742 |
| 86 | Ga0070681_10523724 | 3300005458 | Bacteria | 1099 |
| 87 | Ga0070681_10763045 | 3300005458 | Bacteria | 884 |
| 88 | Ga0068867_100036380 | 3300005459 | Bacteria | 3574 |
| 89 | Ga0068867_100349977 | 3300005459 | Bacteria | 1232 |
| 90 | Ga0068867_101081861 | 3300005459 | Bacteria | 731 |
| 91 | Ga0068867_101797744 | 3300005459 | Bacteria | 576 |
| 92 | Ga0070685_10000004 | 3300005466 | Bacteria | 246215 |
| 93 | Ga0070685_10037569 | 3300005466 | Bacteria | 2743 |
| 94 | Ga0070685_10062017 | 3300005466 | Bacteria | 2191 |
| 95 | Ga0070685_10710997 | 3300005466 | Bacteria | 733 |
| 96 | Ga0070706_100287774 | 3300005467 | Bacteria | 1533 |
| 97 | Ga0070706_100764759 | 3300005467 | Bacteria | 895 |
| 98 | Ga0070698_100547873 | 3300005471 | Bacteria | 1096 |
| 99 | Ga0070699_100023690 | 3300005518 | Bacteria | 5289 |
| 100 | Ga0070684_100007830 | 3300005535 | Bacteria | 8333 |
| 101 | Ga0070684_100227634 | 3300005535 | Bacteria | 1702 |
| 102 | Ga0070697_100008352 | 3300005536 | Bacteria | 8079 |
| 103 | Ga0070697_100452979 | 3300005536 | Bacteria | 1118 |
| 104 | Ga0070697_100500031 | 3300005536 | Bacteria | 1063 |
| 105 | Ga0068853_100008688 | 3300005539 | Bacteria | 8170 |
| 106 | Ga0068853_100794052 | 3300005539 | Bacteria | 906 |
| 107 | Ga0070672_100037746 | 3300005543 | Bacteria | 3687 |
| 108 | Ga0070686_100002369 | 3300005544 | Bacteria | 10385 |
| 109 | Ga0070695_100004111 | 3300005545 | Bacteria | 8511 |
| 110 | Ga0070695_100634886 | 3300005545 | Bacteria | 842 |
| 111 | Ga0070695_100778115 | 3300005545 | Bacteria | 765 |
| 112 | Ga0070696_100007424 | 3300005546 | Bacteria | 7329 |
| 113 | Ga0070696_100078172 | 3300005546 | Bacteria | 2339 |
| 114 | Ga0070696_100124509 | 3300005546 | Bacteria | 1869 |
| 115 | Ga0070693_100589755 | 3300005547 | Bacteria | 801 |
| 116 | Ga0070693_101049589 | 3300005547 | Bacteria | 619 |
| 117 | Ga0070665_100010167 | 3300005548 | Bacteria | 9515 |
| 118 | Ga0070665_100088154 | 3300005548 | Bacteria | 3109 |
| 119 | Ga0070665_100094876 | 3300005548 | Bacteria | 2988 |
| 120 | Ga0070665_100146477 | 3300005548 | Bacteria | 2364 |
| 121 | Ga0070704_100130014 | 3300005549 | Bacteria | 1950 |
| 122 | Ga0068855_100201866 | 3300005563 | Bacteria | 2238 |
| 123 | Ga0068855_100845492 | 3300005563 | Bacteria | 970 |
| 124 | Ga0070664_100004310 | 3300005564 | Bacteria | 11436 |
| 125 | Ga0070664_100022229 | 3300005564 | Bacteria | 5230 |
| 126 | Ga0068857_100029896 | 3300005577 | Bacteria | 4808 |
| 127 | Ga0068857_100034238 | 3300005577 | Bacteria | 4492 |
| 128 | Ga0068854_100010299 | 3300005578 | Bacteria | 6059 |
| 129 | Ga0068856_100526522 | 3300005614 | Bacteria | 1203 |
| 130 | Ga0068856_100688698 | 3300005614 | Bacteria | 1043 |
| 131 | Ga0070702_100018484 | 3300005615 | Bacteria | 3617 |
| 132 | Ga0070702_100122629 | 3300005615 | Bacteria | 1629 |
| 133 | Ga0070702_100189440 | 3300005615 | Bacteria | 1352 |
| 134 | Ga0070702_100374531 | 3300005615 | Bacteria | 1010 |
| 135 | Ga0068852_100005797 | 3300005616 | Bacteria | 8870 |
| 136 | Ga0068859_100000949 | 3300005617 | Bacteria | 29651 |
| 137 | Ga0068859_100011061 | 3300005617 | Bacteria | 9076 |
| 138 | Ga0068859_100024498 | 3300005617 | Bacteria | 6055 |
| 139 | Ga0068859_100096921 | 3300005617 | Bacteria | 3002 |
| 140 | Ga0068859_100210935 | 3300005617 | Bacteria | 2028 |
| 141 | Ga0068859_100680978 | 3300005617 | Bacteria | 1120 |
| 142 | Ga0068864_100000072 | 3300005618 | Bacteria | 110066 |
| 143 | Ga0068864_100006463 | 3300005618 | Bacteria | 9602 |
| 144 | Ga0068864_100017395 | 3300005618 | Bacteria | 5995 |
| 145 | Ga0068864_100143466 | 3300005618 | Bacteria | 2156 |
| 146 | Ga0068864_100247521 | 3300005618 | Bacteria | 1653 |
| 147 | Ga0068866_10108657 | 3300005718 | Bacteria | 1543 |
| 148 | Ga0068866_10120592 | 3300005718 | Bacteria | 1477 |
| 149 | Ga0068861_100012581 | 3300005719 | Bacteria | 5904 |
| 150 | Ga0068861_100066058 | 3300005719 | Bacteria | 2787 |
| 151 | Ga0068851_10090016 | 3300005834 | Bacteria | 1614 |
| 152 | Ga0068851_11025946 | 3300005834 | Bacteria | 521 |
| 153 | Ga0068870_10282549 | 3300005840 | Bacteria | 1041 |
| 154 | Ga0068863_100004762 | 3300005841 | Bacteria | 13370 |
| 155 | Ga0068863_100207589 | 3300005841 | Bacteria | 1886 |
| 156 | Ga0068863_100229975 | 3300005841 | Bacteria | 1788 |
| 157 | Ga0068863_102351757 | 3300005841 | Bacteria | 542 |
| 158 | Ga0068858_100006370 | 3300005842 | Bacteria | 11494 |
| 159 | Ga0068858_100022887 | 3300005842 | Bacteria | 5829 |
| 160 | Ga0068858_100059515 | 3300005842 | Bacteria | 3530 |
| 161 | Ga0068858_100276436 | 3300005842 | Bacteria | 1599 |
| 162 | Ga0068858_100347079 | 3300005842 | Bacteria | 1421 |
| 163 | Ga0068858_100584181 | 3300005842 | Bacteria | 1083 |
| 164 | Ga0068860_100000271 | 3300005843 | Bacteria | 75530 |
| 165 | Ga0068860_100019058 | 3300005843 | Bacteria | 6662 |
| 166 | Ga0068860_100059220 | 3300005843 | Bacteria | 3642 |
| 167 | Ga0068862_100001400 | 3300005844 | Bacteria | 22361 |
| 168 | Ga0068862_100002538 | 3300005844 | Bacteria | 16147 |
| 169 | Ga0068862_100002888 | 3300005844 | Bacteria | 15034 |
| 170 | Ga0068862_100056332 | 3300005844 | Bacteria | 3368 |
| 171 | Ga0068862_100199701 | 3300005844 | Bacteria | 1803 |
| 172 | Ga0068862_100748968 | 3300005844 | Bacteria | 950 |
| 173 | Ga0068862_100751655 | 3300005844 | Bacteria | 949 |
| 174 | Ga0068862_100953616 | 3300005844 | Bacteria | 846 |
| 175 | Ga0068862_101270022 | 3300005844 | Bacteria | 737 |
| 176 | Ga0081539_10001441 | 3300005985 | Bacteria | 40731 |
| 177 | Ga0075432_10299323 | 3300006058 | Bacteria | 667 |
| 178 | Ga0070716_100250656 | 3300006173 | Bacteria | 1206 |
| 179 | Ga0070716_100734426 | 3300006173 | Bacteria | 758 |
| 180 | Ga0070712_100108706 | 3300006175 | Bacteria | 2065 |
| 181 | Ga0097621_100003683 | 3300006237 | Bacteria | 10596 |
| 182 | Ga0097621_100056300 | 3300006237 | Bacteria | 3212 |
| 183 | Ga0097621_100220104 | 3300006237 | Bacteria | 1654 |
| 184 | Ga0097621_100578321 | 3300006237 | Bacteria | 1025 |
| 185 | Ga0068871_100024415 | 3300006358 | Bacteria | 4688 |
| 186 | Ga0068871_100029924 | 3300006358 | Bacteria | 4283 |
| 187 | Ga0068871_100289780 | 3300006358 | Bacteria | 1434 |
| 188 | Ga0075428_100005586 | 3300006844 | Bacteria | 13968 |
| 189 | Ga0075428_100010558 | 3300006844 | Bacteria | 10266 |
| 190 | Ga0075428_100015259 | 3300006844 | Bacteria | 8521 |
| 191 | Ga0075428_100697375 | 3300006844 | Bacteria | 1082 |
| 192 | Ga0075428_100699555 | 3300006844 | Bacteria | 1080 |
| 193 | Ga0075430_100004165 | 3300006846 | Bacteria | 12204 |
| 194 | Ga0075430_100011047 | 3300006846 | Bacteria | 7651 |
| 195 | Ga0075430_100289900 | 3300006846 | Bacteria | 1354 |
| 196 | Ga0075430_101260008 | 3300006846 | Bacteria | 608 |
| 197 | Ga0075431_100000318 | 3300006847 | Bacteria | 37976 |
| 198 | Ga0075431_100005721 | 3300006847 | Bacteria | 12288 |
| 199 | Ga0075431_100265923 | 3300006847 | Bacteria | 1739 |
| 200 | Ga0075431_100747149 | 3300006847 | Bacteria | 954 |
| 201 | Ga0075431_100936976 | 3300006847 | Bacteria | 835 |
| 202 | Ga0075431_101009158 | 3300006847 | Bacteria | 799 |
| 203 | Ga0075433_10463383 | 3300006852 | Bacteria | 1117 |
| 204 | Ga0075433_10570026 | 3300006852 | Bacteria | 995 |
| 205 | Ga0075434_100000004 | 3300006871 | Bacteria | 112839 |
| 206 | Ga0075434_100321078 | 3300006871 | Bacteria | 1569 |
| 207 | Ga0075429_100001918 | 3300006880 | Bacteria | 17254 |
| 208 | Ga0075429_100046537 | 3300006880 | Bacteria | 3775 |
| 209 | Ga0075429_101232132 | 3300006880 | Bacteria | 653 |
| 210 | Ga0068865_100017384 | 3300006881 | Bacteria | 4626 |
| 211 | Ga0068865_100359048 | 3300006881 | Bacteria | 1182 |
| 212 | Ga0075436_100005388 | 3300006914 | Bacteria | 8806 |
| 213 | Ga0075436_100005406 | 3300006914 | Bacteria | 8788 |
| 214 | Ga0075436_100021279 | 3300006914 | Bacteria | 4451 |
| 215 | Ga0075436_100077166 | 3300006914 | Bacteria | 2308 |
| 216 | Ga0075436_100106811 | 3300006914 | Bacteria | 1953 |
| 217 | Ga0075436_100285853 | 3300006914 | Bacteria | 1180 |
| 218 | Ga0097620_100000949 | 3300006931 | Bacteria | 29651 |
| 219 | Ga0097620_100011061 | 3300006931 | Bacteria | 9076 |
| 220 | Ga0097620_100024498 | 3300006931 | Bacteria | 6055 |
| 221 | Ga0097620_100096924 | 3300006931 | Bacteria | 3002 |
| 222 | Ga0097620_100210923 | 3300006931 | Bacteria | 2028 |
| 223 | Ga0097620_100680964 | 3300006931 | Bacteria | 1120 |
| 224 | Ga0099826_10089094 | 3300006948 | Bacteria | 1893 |
| 225 | Ga0075435_100018356 | 3300007076 | Bacteria | 5318 |
| 226 | Ga0075435_100224993 | 3300007076 | Bacteria | 1593 |
| 227 | Ga0075435_100716270 | 3300007076 | Bacteria | 870 |
| 228 | Ga0099794_10014358 | 3300007265 | Bacteria | 3469 |
| 229 | Ga0099795_10000015 | 3300007788 | Bacteria | 64331 |
| 230 | Ga0099795_10000075 | 3300007788 | Bacteria | 17387 |
| 231 | Ga0105240_10123251 | 3300009093 | Bacteria | 3118 |
| 232 | Ga0111539_10010862 | 3300009094 | Bacteria | 11460 |
| 233 | Ga0111539_10012306 | 3300009094 | Bacteria | 10722 |
| 234 | Ga0111539_10118141 | 3300009094 | Bacteria | 3108 |
| 235 | Ga0111539_10399075 | 3300009094 | Bacteria | 1602 |
| 236 | Ga0111539_11167520 | 3300009094 | Bacteria | 894 |
| 237 | Ga0105245_10001896 | 3300009098 | Bacteria | 18996 |
| 238 | Ga0105245_10006356 | 3300009098 | Bacteria | 10396 |
| 239 | Ga0105245_10539227 | 3300009098 | Bacteria | 1188 |
| 240 | Ga0105245_11110947 | 3300009098 | Bacteria | 837 |
| 241 | Ga0105247_10089033 | 3300009101 | Bacteria | 1957 |
| 242 | Ga0105247_10140548 | 3300009101 | Bacteria | 1582 |
| 243 | Ga0105247_10302504 | 3300009101 | Bacteria | 1110 |
| 244 | Ga0105247_10306958 | 3300009101 | Bacteria | 1103 |
| 245 | Ga0114129_10032479 | 3300009147 | Bacteria | 7378 |
| 246 | Ga0114129_10066916 | 3300009147 | Bacteria | 5010 |
| 247 | Ga0114129_10190939 | 3300009147 | Bacteria | 2781 |
| 248 | Ga0114129_11550813 | 3300009147 | Bacteria | 812 |
| 249 | Ga0105241_10298613 | 3300009174 | Bacteria | 1382 |
| 250 | Ga0105241_10318076 | 3300009174 | Bacteria | 1341 |
| 251 | Ga0105242_10004198 | 3300009176 | Bacteria | 11229 |
| 252 | Ga0105242_10228377 | 3300009176 | Bacteria | 1667 |
| 253 | Ga0105242_10411292 | 3300009176 | Bacteria | 1265 |
| 254 | Ga0105248_10002211 | 3300009177 | Bacteria | 21553 |
| 255 | Ga0105248_10002407 | 3300009177 | Bacteria | 20777 |
| 256 | Ga0105248_10003549 | 3300009177 | Bacteria | 17287 |
| 257 | Ga0105248_10024742 | 3300009177 | Bacteria | 6677 |
| 258 | Ga0105248_10088888 | 3300009177 | Bacteria | 3477 |
| 259 | Ga0105248_11301361 | 3300009177 | Bacteria | 822 |
| 260 | Ga0105238_10461206 | 3300009551 | Bacteria | 1268 |
| 261 | Ga0105249_10016579 | 3300009553 | Bacteria | 6538 |
| 262 | Ga0105249_10035648 | 3300009553 | Bacteria | 4511 |
| 263 | Ga0105249_10095997 | 3300009553 | Bacteria | 2780 |
| 264 | Ga0105249_10512266 | 3300009553 | Bacteria | 1246 |
| 265 | Ga0105249_11200792 | 3300009553 | Bacteria | 829 |
| 266 | Ga0099796_10000044 | 3300010159 | Bacteria | 24507 |
| 267 | Ga0099796_10002250 | 3300010159 | Bacteria | 4188 |
| 268 | Ga0099796_10023934 | 3300010159 | Bacteria | 1912 |
| 269 | Ga0105239_10179328 | 3300010375 | Bacteria | 2370 |
| 270 | Ga0105239_11568303 | 3300010375 | Bacteria | 761 |
| 271 | Ga0105246_10737918 | 3300011119 | Bacteria | 867 |
| 272 | Ga0157369_10189001 | 3300013105 | Bacteria | 2164 |
| 273 | Ga0157374_10013613 | 3300013296 | Bacteria | 7105 |
| 274 | Ga0157374_10045246 | 3300013296 | Bacteria | 4073 |
| 275 | Ga0157374_10080636 | 3300013296 | Bacteria | 3087 |
| 276 | Ga0157374_10945868 | 3300013296 | Bacteria | 880 |
| 277 | Ga0157378_10003991 | 3300013297 | Bacteria | 13038 |
| 278 | Ga0157378_10012745 | 3300013297 | Bacteria | 7359 |
| 279 | Ga0163162_10056038 | 3300013306 | Bacteria | 3970 |
| 280 | Ga0163162_10172493 | 3300013306 | Bacteria | 2288 |
| 281 | Ga0163162_11393311 | 3300013306 | Bacteria | 798 |
| 282 | Ga0163162_11552488 | 3300013306 | Bacteria | 755 |
| 283 | Ga0163162_11736138 | 3300013306 | Bacteria | 713 |
| 284 | Ga0157372_10606954 | 3300013307 | Bacteria | 1275 |
| 285 | Ga0157375_10008687 | 3300013308 | Bacteria | 8903 |
| 286 | Ga0157375_10052471 | 3300013308 | Bacteria | 4009 |
| 287 | Ga0157375_10071548 | 3300013308 | Bacteria | 3482 |
| 288 | Ga0157375_10219556 | 3300013308 | Bacteria | 2059 |
| 289 | Ga0163163_10000118 | 3300014325 | Bacteria | 84379 |
| 290 | Ga0163163_10012973 | 3300014325 | Bacteria | 7611 |
| 291 | Ga0163163_10244182 | 3300014325 | Bacteria | 1846 |
| 292 | Ga0157380_10044056 | 3300014326 | Bacteria | 3495 |
| 293 | Ga0157380_10587789 | 3300014326 | Bacteria | 1099 |
| 294 | Ga0157380_11139784 | 3300014326 | Bacteria | 821 |
| 295 | Ga0157377_10007978 | 3300014745 | Bacteria | 5142 |
| 296 | Ga0157377_10066758 | 3300014745 | Bacteria | 2069 |
| 297 | Ga0157377_10866286 | 3300014745 | Bacteria | 672 |
| 298 | Ga0157377_11279456 | 3300014745 | Bacteria | 572 |
| 299 | Ga0157379_10004582 | 3300014968 | Bacteria | 11860 |
| 300 | Ga0157379_10348196 | 3300014968 | Bacteria | 1356 |
| 301 | Ga0157379_10725484 | 3300014968 | Bacteria | 934 |
| 302 | Ga0157376_10000400 | 3300014969 | Bacteria | 28297 |
| 303 | Ga0157376_10011903 | 3300014969 | Bacteria | 6433 |
| 304 | Ga0157376_10020696 | 3300014969 | Bacteria | 5097 |
| 305 | Ga0163161_10169842 | 3300017792 | Bacteria | 1667 |
| 306 | Ga0213872_10016834 | 3300021361 | Bacteria | 3388 |
| 307 | Ga0213872_10053869 | 3300021361 | Bacteria | 1824 |
| 308 | Ga0213872_10076206 | 3300021361 | Bacteria | 1509 |
| 309 | Ga0207697_10144180 | 3300025315 | Bacteria | 1034 |
| 310 | Ga0207656_10061076 | 3300025321 | Bacteria | 1653 |
| 311 | Ga0207642_10029074 | 3300025899 | Bacteria | 2285 |
| 312 | Ga0207642_10104145 | 3300025899 | Bacteria | 1431 |
| 313 | Ga0207688_10018733 | 3300025901 | Bacteria | 3764 |
| 314 | Ga0207688_10565796 | 3300025901 | Bacteria | 715 |
| 315 | Ga0207680_10018290 | 3300025903 | Bacteria | 3721 |
| 316 | Ga0207680_10064240 | 3300025903 | Bacteria | 2250 |
| 317 | Ga0207680_10177627 | 3300025903 | Bacteria | 1438 |
| 318 | Ga0207680_10187724 | 3300025903 | Bacteria | 1401 |
| 319 | Ga0207699_10335113 | 3300025906 | Bacteria | 1064 |
| 320 | Ga0207645_10168452 | 3300025907 | Bacteria | 1435 |
| 321 | Ga0207643_10316863 | 3300025908 | Bacteria | 973 |
| 322 | Ga0207643_10360500 | 3300025908 | Bacteria | 914 |
| 323 | Ga0207643_10490146 | 3300025908 | Bacteria | 785 |
| 324 | Ga0207705_10061461 | 3300025909 | Bacteria | 2714 |
| 325 | Ga0207684_10461319 | 3300025910 | Bacteria | 1090 |
| 326 | Ga0207654_10073478 | 3300025911 | Bacteria | 2038 |
| 327 | Ga0207654_10196779 | 3300025911 | Bacteria | 1325 |
| 328 | Ga0207707_10027997 | 3300025912 | Bacteria | 4927 |
| 329 | Ga0207707_10035257 | 3300025912 | Bacteria | 4376 |
| 330 | Ga0207707_10234875 | 3300025912 | Bacteria | 1595 |
| 331 | Ga0207707_11113047 | 3300025912 | Bacteria | 643 |
| 332 | Ga0207671_10025884 | 3300025914 | Bacteria | 4403 |
| 333 | Ga0207660_10084613 | 3300025917 | Bacteria | 2338 |
| 334 | Ga0207660_10333540 | 3300025917 | Bacteria | 1213 |
| 335 | Ga0207662_10009609 | 3300025918 | Bacteria | 5329 |
| 336 | Ga0207662_10405553 | 3300025918 | Bacteria | 925 |
| 337 | Ga0207657_10523815 | 3300025919 | Bacteria | 928 |
| 338 | Ga0207649_10040772 | 3300025920 | Bacteria | 2824 |
| 339 | Ga0207649_10064552 | 3300025920 | Bacteria | 2315 |
| 340 | Ga0207649_10351884 | 3300025920 | Bacteria | 1090 |
| 341 | Ga0207649_10497559 | 3300025920 | Bacteria | 927 |
| 342 | Ga0207652_10130779 | 3300025921 | Bacteria | 2239 |
| 343 | Ga0207681_10002041 | 3300025923 | Bacteria | 12952 |
| 344 | Ga0207681_10012376 | 3300025923 | Bacteria | 5265 |
| 345 | Ga0207681_10423423 | 3300025923 | Bacteria | 1079 |
| 346 | Ga0207650_10000013 | 3300025925 | Bacteria | 409471 |
| 347 | Ga0207650_10131099 | 3300025925 | Bacteria | 1961 |
| 348 | Ga0207650_10167603 | 3300025925 | Bacteria | 1744 |
| 349 | Ga0207659_10010114 | 3300025926 | Bacteria | 5913 |
| 350 | Ga0207659_10039083 | 3300025926 | Bacteria | 3306 |
| 351 | Ga0207659_10224356 | 3300025926 | Bacteria | 1512 |
| 352 | Ga0207687_10296108 | 3300025927 | Bacteria | 1302 |
| 353 | Ga0207687_10831231 | 3300025927 | Bacteria | 789 |
| 354 | Ga0207700_10087161 | 3300025928 | Bacteria | 2455 |
| 355 | Ga0207664_10020611 | 3300025929 | Bacteria | 4889 |
| 356 | Ga0207664_10057026 | 3300025929 | Bacteria | 3104 |
| 357 | Ga0207664_10317217 | 3300025929 | Bacteria | 1375 |
| 358 | Ga0207644_10000015 | 3300025931 | Bacteria | 179880 |
| 359 | Ga0207644_10020618 | 3300025931 | Bacteria | 4485 |
| 360 | Ga0207644_10145980 | 3300025931 | Bacteria | 1826 |
| 361 | Ga0207644_10218041 | 3300025931 | Bacteria | 1511 |
| 362 | Ga0207690_10025157 | 3300025932 | Bacteria | 3734 |
| 363 | Ga0207690_10393410 | 3300025932 | Bacteria | 1104 |
| 364 | Ga0207706_10004055 | 3300025933 | Bacteria | 13854 |
| 365 | Ga0207706_10132128 | 3300025933 | Bacteria | 2195 |
| 366 | Ga0207706_10661564 | 3300025933 | Bacteria | 894 |
| 367 | Ga0207709_10813517 | 3300025935 | Bacteria | 755 |
| 368 | Ga0207704_10011084 | 3300025938 | Bacteria | 4424 |
| 369 | Ga0207704_10073923 | 3300025938 | Bacteria | 2173 |
| 370 | Ga0207665_10735341 | 3300025939 | Bacteria | 777 |
| 371 | Ga0207691_10007106 | 3300025940 | Bacteria | 10808 |
| 372 | Ga0207691_10036071 | 3300025940 | Bacteria | 4583 |
| 373 | Ga0207711_10000103 | 3300025941 | Bacteria | 90172 |
| 374 | Ga0207711_10000277 | 3300025941 | Bacteria | 55359 |
| 375 | Ga0207711_10004938 | 3300025941 | Bacteria | 11327 |
| 376 | Ga0207711_10011788 | 3300025941 | Bacteria | 7263 |
| 377 | Ga0207711_10427228 | 3300025941 | Bacteria | 1233 |
| 378 | Ga0207711_10679511 | 3300025941 | Bacteria | 960 |
| 379 | Ga0207689_10000974 | 3300025942 | Bacteria | 27470 |
| 380 | Ga0207689_10006698 | 3300025942 | Bacteria | 10164 |
| 381 | Ga0207689_10307491 | 3300025942 | Bacteria | 1314 |
| 382 | Ga0207689_11368155 | 3300025942 | Bacteria | 594 |
| 383 | Ga0207661_10183543 | 3300025944 | Bacteria | 1829 |
| 384 | Ga0207661_11016531 | 3300025944 | Bacteria | 763 |
| 385 | Ga0207679_10005967 | 3300025945 | Bacteria | 7665 |
| 386 | Ga0207679_10040593 | 3300025945 | Bacteria | 3333 |
| 387 | Ga0207679_10046570 | 3300025945 | Bacteria | 3144 |
| 388 | Ga0207667_10085553 | 3300025949 | Bacteria | 3264 |
| 389 | Ga0207667_11238969 | 3300025949 | Bacteria | 724 |
| 390 | Ga0207651_10021146 | 3300025960 | Bacteria | 3946 |
| 391 | Ga0207651_10114154 | 3300025960 | Bacteria | 2034 |
| 392 | Ga0207651_10140782 | 3300025960 | Bacteria | 1863 |
| 393 | Ga0207651_10551560 | 3300025960 | Bacteria | 1002 |
| 394 | Ga0207712_10011813 | 3300025961 | Bacteria | 5568 |
| 395 | Ga0207712_10127992 | 3300025961 | Bacteria | 1931 |
| 396 | Ga0207712_10420199 | 3300025961 | Bacteria | 1128 |
| 397 | Ga0207668_10006950 | 3300025972 | Bacteria | 6717 |
| 398 | Ga0207668_10321190 | 3300025972 | Bacteria | 1285 |
| 399 | Ga0207640_10068365 | 3300025981 | Bacteria | 2380 |
| 400 | Ga0207658_10000005 | 3300025986 | Bacteria | 408341 |
| 401 | Ga0207658_10020040 | 3300025986 | Bacteria | 4629 |
| 402 | Ga0207658_10125281 | 3300025986 | Bacteria | 2055 |
| 403 | Ga0207658_10595958 | 3300025986 | Bacteria | 992 |
| 404 | Ga0207677_10031535 | 3300026023 | Bacteria | 3395 |
| 405 | Ga0207677_10154054 | 3300026023 | Bacteria | 1777 |
| 406 | Ga0207677_10214924 | 3300026023 | Bacteria | 1538 |
| 407 | Ga0207703_10005017 | 3300026035 | Bacteria | 10732 |
| 408 | Ga0207703_10053560 | 3300026035 | Bacteria | 3279 |
| 409 | Ga0207703_10059027 | 3300026035 | Bacteria | 3134 |
| 410 | Ga0207703_10069201 | 3300026035 | Bacteria | 2910 |
| 411 | Ga0207703_10475782 | 3300026035 | Bacteria | 1170 |
| 412 | Ga0207639_10028853 | 3300026041 | Bacteria | 4056 |
| 413 | Ga0207639_11436094 | 3300026041 | Bacteria | 647 |
| 414 | Ga0207678_10225851 | 3300026067 | Bacteria | 1603 |
| 415 | Ga0207708_10507421 | 3300026075 | Bacteria | 1012 |
| 416 | Ga0207702_11191236 | 3300026078 | Bacteria | 756 |
| 417 | Ga0207641_10022587 | 3300026088 | Bacteria | 5178 |
| 418 | Ga0207641_10093434 | 3300026088 | Bacteria | 2636 |
| 419 | Ga0207641_10118468 | 3300026088 | Bacteria | 2359 |
| 420 | Ga0207641_10235840 | 3300026088 | Bacteria | 1702 |
| 421 | Ga0207641_10272783 | 3300026088 | Bacteria | 1588 |
| 422 | Ga0207641_12236201 | 3300026088 | Bacteria | 547 |
| 423 | Ga0207648_10032325 | 3300026089 | Bacteria | 4620 |
| 424 | Ga0207648_10188118 | 3300026089 | Bacteria | 1829 |
| 425 | Ga0207648_10749717 | 3300026089 | Bacteria | 907 |
| 426 | Ga0207648_10939727 | 3300026089 | Bacteria | 809 |
| 427 | Ga0207676_10000010 | 3300026095 | Bacteria | 519402 |
| 428 | Ga0207676_10007265 | 3300026095 | Bacteria | 7847 |
| 429 | Ga0207676_10012652 | 3300026095 | Bacteria | 6052 |
| 430 | Ga0207676_10328609 | 3300026095 | Bacteria | 1406 |
| 431 | Ga0207674_10013468 | 3300026116 | Bacteria | 9071 |
| 432 | Ga0207674_10020988 | 3300026116 | Bacteria | 7045 |
| 433 | Ga0207674_10403954 | 3300026116 | Bacteria | 1320 |
| 434 | Ga0207675_100003162 | 3300026118 | Bacteria | 16157 |
| 435 | Ga0207675_100006059 | 3300026118 | Bacteria | 11506 |
| 436 | Ga0207675_100013963 | 3300026118 | Bacteria | 7488 |
| 437 | Ga0207675_100565860 | 3300026118 | Bacteria | 1137 |
| 438 | Ga0207683_10003576 | 3300026121 | Bacteria | 13558 |
| 439 | Ga0207683_10051793 | 3300026121 | Bacteria | 3596 |
| 440 | Ga0207698_10025963 | 3300026142 | Bacteria | 4138 |
| 441 | Ga0209969_1004562 | 3300027360 | Bacteria | 1938 |
| 442 | Ga0209995_1001621 | 3300027471 | Bacteria | 3495 |
| 443 | Ga0209179_1000010 | 3300027512 | Bacteria | 68867 |
| 444 | Ga0209179_1007430 | 3300027512 | Bacteria | 1809 |
| 445 | Ga0209179_1027827 | 3300027512 | Bacteria | 1142 |
| 446 | Ga0209999_1001099 | 3300027543 | Bacteria | 4615 |
| 447 | Ga0209282_1201044 | 3300027666 | Bacteria | 918 |
| 448 | Ga0209971_1022551 | 3300027682 | Bacteria | 1500 |
| 449 | Ga0209974_10001583 | 3300027876 | Bacteria | 8236 |
| 450 | Ga0209974_10050958 | 3300027876 | Bacteria | 1391 |
| 451 | Ga0207428_10003362 | 3300027907 | Bacteria | 15546 |
| 452 | Ga0268266_10022886 | 3300028379 | Bacteria | 5318 |
| 453 | Ga0268266_10023031 | 3300028379 | Bacteria | 5301 |
| 454 | Ga0268266_10110772 | 3300028379 | Bacteria | 2432 |
| 455 | Ga0268266_10330724 | 3300028379 | Bacteria | 1428 |
| 456 | Ga0268266_10406896 | 3300028379 | Bacteria | 1287 |
| 457 | Ga0268265_10001515 | 3300028380 | Bacteria | 19408 |
| 458 | Ga0268265_10005465 | 3300028380 | Bacteria | 8683 |
| 459 | Ga0268265_10035383 | 3300028380 | Bacteria | 3649 |
| 460 | Ga0268265_10065120 | 3300028380 | Bacteria | 2811 |
| 461 | Ga0268265_10395545 | 3300028380 | Bacteria | 1276 |
| 462 | Ga0268265_10819584 | 3300028380 | Bacteria | 908 |
| 463 | Ga0268264_10000036 | 3300028381 | Bacteria | 392994 |
| 464 | Ga0268264_10018203 | 3300028381 | Bacteria | 5746 |
| 465 | Ga0268264_10041471 | 3300028381 | Bacteria | 3808 |
| 466 | Ga0268264_10896797 | 3300028381 | Bacteria | 890 |
| 467 | Ga0268264_11782931 | 3300028381 | Bacteria | 626 |
| 468 | Ga0265334_10000092 | 3300028573 | Bacteria | 64246 |
| 469 | Ga0265334_10020425 | 3300028573 | Bacteria | 2711 |
| 470 | Ga0265338_10005957 | 3300028800 | Bacteria | 15684 |
| 471 | Ga0265339_10260709 | 3300031249 | Bacteria | 836 |
| 472 | Ga0307509_10000365 | 3300031507 | Bacteria | 76187 |
| 473 | Ga0307408_100063639 | 3300031548 | Bacteria | 2699 |
| 474 | Ga0307408_100105824 | 3300031548 | Bacteria | 2151 |
| 475 | Ga0307408_100112043 | 3300031548 | Bacteria | 2097 |
| 476 | Ga0307408_100125213 | 3300031548 | Bacteria | 1997 |
| 477 | Ga0265313_10000109 | 3300031595 | Bacteria | 83136 |
| 478 | Ga0265313_10010261 | 3300031595 | Bacteria | 5955 |
| 479 | Ga0265313_10112395 | 3300031595 | Bacteria | 1196 |
| 480 | Ga0316575_10122421 | 3300031665 | Bacteria | 1064 |
| 481 | Ga0316575_10372420 | 3300031665 | Bacteria | 610 |
| 482 | Ga0316576_10250249 | 3300031727 | Bacteria | 1330 |
| 483 | Ga0307516_10000209 | 3300031730 | Bacteria | 75193 |
| 484 | Ga0307405_10180567 | 3300031731 | Bacteria | 1515 |
| 485 | Ga0307405_10224512 | 3300031731 | Bacteria | 1380 |
| 486 | Ga0307413_10713379 | 3300031824 | Bacteria | 834 |
| 487 | Ga0307413_10720323 | 3300031824 | Unclassified | 831 |
| 488 | Ga0307410_10065703 | 3300031852 | Unclassified | 2496 |
| 489 | Ga0307410_10469405 | 3300031852 | Bacteria | 1030 |
| 490 | Ga0307406_10016892 | 3300031901 | Bacteria | 4247 |
| 491 | Ga0307406_10670790 | 3300031901 | Bacteria | 863 |
| 492 | Ga0307407_10203608 | 3300031903 | Bacteria | 1328 |
| 493 | Ga0307412_10126396 | 3300031911 | Bacteria | 1850 |
| 494 | Ga0307412_11646992 | 3300031911 | Bacteria | 587 |
| 495 | Ga0307409_100834635 | 3300031995 | Bacteria | 931 |
| 496 | Ga0307416_102436284 | 3300032002 | Bacteria | 622 |
| 497 | Ga0307416_103544721 | 3300032002 | Bacteria | 522 |
| 498 | Ga0307414_10821446 | 3300032004 | Bacteria | 849 |
| 499 | Ga0307411_10217655 | 3300032005 | Bacteria | 1479 |
| 500 | Ga0307415_101112519 | 3300032126 | Bacteria | 740 |
| 501 | Ga0316593_10000692 | 3300032168 | Bacteria | 6574 |
| 502 | Ga0316593_10005117 | 3300032168 | Bacteria | 3430 |
| 503 | Ga0316593_10039782 | 3300032168 | Bacteria | 1561 |
| 504 | Ga0316592_1000870 | 3300033524 | Bacteria | 4567 |
| 505 | Ga0316592_1002547 | 3300033524 | Bacteria | 3165 |
| 506 | Ga0316587_1000489 | 3300033529 | Bacteria | 4022 |
| 507 | Ga0316587_1050155 | 3300033529 | Bacteria | 763 |
| 508 | Ga0316596_1000453 | 3300033541 | Bacteria | 6871 |
| 509 | Ga0316596_1002939 | 3300033541 | Bacteria | 3694 |
| 510 | Ga0373936_0031837 | 3300035113 | Bacteria | 2084 |
| 511 | Ga0373939_0219622 | 3300035114 | Bacteria | 727 |
| 512 | Ga0373960_0131864 | 3300035121 | Bacteria | 839 |
| 513 | Ga0373942_0065859 | 3300035207 | Bacteria | 1048 |
| 514 | Ga0373962_0209803 | 3300035242 | Bacteria | 662 |
| 515 | Ga0316574_0261688 | 3300035398 | Bacteria | 1104 |
| 516 | Ga0373931_0055499 | 3300035691 | Bacteria | 2120 |
| 517 | Ga0373927_0000003 | 3300035695 | Bacteria | 480348 |
| 518 | Ga0373937_0113993 | 3300036401 | Bacteria | 2516 |
| 519 | Ga0373937_0619724 | 3300036401 | Bacteria | 1027 |
| 520 | Ga0316582_0645729 | 3300036647 | Bacteria | 728 |
| 521 | Ga0316584_0150738 | 3300036712 | Bacteria | 1731 |
| 522 | Ga0316584_0163799 | 3300036712 | Bacteria | 1651 |
| 523 | Ga0316584_0337425 | 3300036712 | Bacteria | 1084 |
| 524 | Ga0400484_16028 | 3300038725 | Bacteria | 9868 |
| 525 | Ga0400484_22999 | 3300038725 | Bacteria | 40826 |
| 526 | Ga0400484_29948 | 3300038725 | Bacteria | 10111 |
| 527 | Ga0400484_36650 | 3300038725 | Bacteria | 3461 |
| 528 | Ga0400490_09976 | 3300038726 | Bacteria | 2238 |
| 529 | Ga0400490_14517 | 3300038726 | Bacteria | 5868 |
| 530 | Ga0400490_29153 | 3300038726 | Bacteria | 26709 |
| 531 | Ga0400490_31423 | 3300038726 | Bacteria | 6035 |
| 532 | Ga0400490_55744 | 3300038726 | Bacteria | 86921 |
| 533 | Ga0400491_02682 | 3300038727 | Bacteria | 1380 |
| 534 | Ga0400491_10039 | 3300038727 | Unclassified | 1294 |
| 535 | Ga0400491_20315 | 3300038727 | Bacteria | 1555 |
| 536 | Ga0400491_22710 | 3300038727 | Bacteria | 4330 |
| 537 | Ga0400491_26238 | 3300038727 | Bacteria | 5854 |
| 538 | Ga0400485_04462 | 3300038735 | Bacteria | 6670 |
| 539 | Ga0400485_11431 | 3300038735 | Bacteria | 142174 |
| 540 | Ga0400488_09389 | 3300038741 | Bacteria | 1707 |
| 541 | Ga0400488_19449 | 3300038741 | Bacteria | 2249 |
| 542 | Ga0400488_21215 | 3300038741 | Bacteria | 17200 |
| 543 | Ga0400488_24107 | 3300038741 | Bacteria | 1959 |
| 544 | Ga0400488_31647 | 3300038741 | Bacteria | 1041 |
| 545 | Ga0400488_33004 | 3300038741 | Bacteria | 10792 |
| 546 | Ga0400488_38891 | 3300038741 | Bacteria | 20773 |
| 547 | Ga0400488_42663 | 3300038741 | Bacteria | 2772 |
| 548 | Ga0400486_00233 | 3300038742 | Bacteria | 7497 |
| 549 | Ga0400486_08527 | 3300038742 | Bacteria | 3907 |
| 550 | Ga0400486_14851 | 3300038742 | Bacteria | 63108 |
| 551 | Ga0400486_18012 | 3300038742 | Bacteria | 99609 |
| 552 | Ga0400483_004216 | 3300039062 | Bacteria | 4538 |
| 553 | Ga0400483_053442 | 3300039062 | Unclassified | 1224 |
| 554 | Ga0400483_093565 | 3300039062 | Bacteria | 2573 |
| 555 | Ga0400483_108094 | 3300039062 | Bacteria | 15316 |
| 556 | Ga0400483_145565 | 3300039062 | Bacteria | 12981 |
| 557 | Ga0400483_175714 | 3300039062 | Bacteria | 1373 |
| 558 | Ga0400483_178062 | 3300039062 | Bacteria | 7395 |
| 559 | Ga0400483_202890 | 3300039062 | Bacteria | 2007 |
| 560 | Ga0400483_229521 | 3300039062 | Bacteria | 1270 |
| 561 | Ga0400483_241642 | 3300039062 | Bacteria | 19322 |
| 562 | Ga0400483_265824 | 3300039062 | Bacteria | 1032 |
| 563 | Ga0400483_268051 | 3300039062 | Bacteria | 17073 |
| 564 | Ga0400483_290185 | 3300039062 | Bacteria | 6932 |
| 565 | Ga0400489_80563 | 3300039093 | Bacteria | 3798 |
| 566 | Ga0400487_11274 | 3300039110 | Bacteria | 1629 |
| 567 | Ga0400487_11908 | 3300039110 | Bacteria | 3498 |
| 568 | Ga0400487_14076 | 3300039110 | Bacteria | 135338 |
| 569 | Ga0400487_17975 | 3300039110 | Bacteria | 1712 |
| 570 | Ga0400487_20104 | 3300039110 | Bacteria | 5320 |
| 571 | Ga0400487_24806 | 3300039110 | Bacteria | 35141 |
| 572 | Ga0400487_26238 | 3300039110 | Bacteria | 16964 |
| 573 | Ga0400487_54961 | 3300039110 | Bacteria | 48611 |
| 574 | Ga0436361_0022148 | 3300039447 | Bacteria | 4126 |
| 575 | Ga0436361_0060574 | 3300039447 | Bacteria | 787 |
| 576 | Ga0436361_0359769 | 3300039447 | Bacteria | 2171 |
| 577 | Ga0436361_0402051 | 3300039447 | Bacteria | 2484 |
| 578 | Ga0439439_0190229 | 3300041406 | Bacteria | 594 |
| 579 | Ga0439461_0002613 | 3300041410 | Bacteria | 2900 |
| 580 | Ga0451797_0371857 | 3300041453 | Bacteria | 1511 |
| 581 | Ga0439431_0049696 | 3300041997 | Bacteria | 1085 |
| 582 | Ga0439442_046765 | 3300042002 | Bacteria | 912 |
| 583 | Ga0439448_0028169 | 3300042005 | Bacteria | 1773 |
| 584 | Ga0439462_0120621 | 3300042015 | Bacteria | 729 |
| 585 | Ga0439463_051671 | 3300042016 | Bacteria | 1049 |
| 586 | Ga0450914_040850 | 3300042118 | Bacteria | 588 |
| 587 | Ga0450888_031509 | 3300042126 | Bacteria | 711 |
| 588 | Ga0439446_0004846 | 3300042156 | Bacteria | 3431 |
| 589 | Ga0439434_0004148 | 3300042435 | Bacteria | 4231 |
| 590 | Ga0439435_0000204 | 3300042436 | Bacteria | 8336 |
| 591 | Ga0439464_0097903 | 3300042439 | Bacteria | 889 |
| 592 | Ga0451577_0041337 | 3300042876 | Bacteria | 4138 |
| 593 | Ga0451577_1015112 | 3300042876 | Bacteria | 745 |
| 594 | Ga0466969_0007376 | 3300044656 | Bacteria | 5845 |
| 595 | Ga0466965_0103131 | 3300044683 | Bacteria | 1460 |
| 596 | Ga0466965_0136123 | 3300044683 | Bacteria | 1276 |
| 597 | Ga0466961_0000300 | 3300044693 | Bacteria | 32920 |
| 598 | Ga0453684_0456139 | 3300044712 | Bacteria | 1422 |
| 599 | Ga0451576_0016225 | 3300045051 | Bacteria | 8227 |
| 600 | Ga0451576_0047973 | 3300045051 | Bacteria | 4489 |
| 601 | Ga0451576_0212501 | 3300045051 | Bacteria | 2020 |
| 602 | Ga0451576_1010087 | 3300045051 | Bacteria | 872 |
| 603 | Ga0495638_0001192 | 3300046460 | Bacteria | 24878 |
| 604 | Ga0495638_0477398 | 3300046460 | Bacteria | 632 |
| 605 | Ga0495650_0013647 | 3300046471 | Bacteria | 4283 |
| 606 | Ga0495650_0208495 | 3300046471 | Bacteria | 677 |
| 607 | Ga0495630_0175917 | 3300046517 | Bacteria | 1631 |
| 608 | Ga0495632_0178624 | 3300046519 | Bacteria | 973 |
| 609 | Ga0495642_0232722 | 3300046528 | Bacteria | 805 |
| 610 | Ga0495598_0008886 | 3300046537 | Bacteria | 2353 |
| 611 | Ga0495621_0344983 | 3300046539 | Bacteria | 624 |
| 612 | Ga0495667_0258044 | 3300046559 | Bacteria | 1109 |
| 613 | Ga0495668_0243504 | 3300046616 | Bacteria | 985 |
| 614 | Ga0495625_0003539 | 3300046660 | Bacteria | 15446 |
| 615 | Ga0495625_0239180 | 3300046660 | Bacteria | 1183 |
| 616 | Ga0495674_0793990 | 3300047319 | Bacteria | 737 |
| 617 | Ga0495672_0044208 | 3300047320 | Bacteria | 2674 |
| 618 | Ga0495602_0190944 | 3300048088 | Bacteria | 1571 |
| 619 | Ga0496101_0291908 | 3300048904 | Bacteria | 1276 |
| 620 | Ga0496101_0615504 | 3300048904 | Bacteria | 858 |
| 621 | Ga0496104_0000384 | 3300048907 | Bacteria | 38678 |
| 622 | Ga0496104_0163884 | 3300048907 | Bacteria | 2132 |
| 623 | Ga0496104_0385982 | 3300048907 | Bacteria | 1313 |
| 624 | Ga0496104_0984103 | 3300048907 | Bacteria | 748 |
| 625 | Ga0496105_0019635 | 3300048908 | Bacteria | 5452 |
| 626 | Ga0496108_0005248 | 3300048911 | Bacteria | 10463 |
| 627 | Ga0496108_0100879 | 3300048911 | Bacteria | 2462 |
| 628 | Ga0496108_0151347 | 3300048911 | Bacteria | 2002 |
| 629 | Ga0496109_0087986 | 3300048912 | Bacteria | 2870 |
| 630 | Ga0496110_0000305 | 3300048913 | Bacteria | 32413 |
| 631 | Ga0496110_0528532 | 3300048913 | Bacteria | 1073 |
| 632 | Ga0496111_0432947 | 3300048914 | Bacteria | 971 |
| 633 | Ga0496112_1338753 | 3300048915 | Bacteria | 631 |
| 634 | Ga0496113_0101972 | 3300048916 | Bacteria | 2225 |
| 635 | Ga0496114_0162159 | 3300048917 | Bacteria | 1945 |
| 636 | Ga0496114_0170009 | 3300048917 | Bacteria | 1899 |
| 637 | Ga0496114_0202928 | 3300048917 | Bacteria | 1737 |
| 638 | Ga0496115_0488366 | 3300048918 | Bacteria | 991 |
| 639 | Ga0496117_0232093 | 3300048920 | Bacteria | 1019 |
| 640 | Ga0496121_0090713 | 3300048924 | Bacteria | 2388 |
| 641 | Ga0496124_0479451 | 3300048927 | Bacteria | 840 |
| 642 | Ga0496125_0435560 | 3300048928 | Bacteria | 755 |
| 643 | Ga0496126_0436630 | 3300048929 | Bacteria | 1056 |
| 644 | Ga0501034_0188223 | 3300049571 | Bacteria | 2027 |
| 645 | Ga0501039_0488210 | 3300049575 | Bacteria | 967 |
| 646 | Ga0501047_0023376 | 3300049581 | Bacteria | 5935 |
| 647 | Ga0501047_0323021 | 3300049581 | Bacteria | 1383 |
| 648 | Ga0501069_0018783 | 3300049585 | Bacteria | 3733 |
| 649 | Ga0501071_0397557 | 3300049587 | Bacteria | 1052 |
| 650 | Ga0501072_0272597 | 3300049588 | Bacteria | 1346 |
| 651 | Ga0501075_0576176 | 3300049591 | Bacteria | 859 |
| 652 | Ga0501077_0056905 | 3300049593 | Bacteria | 2483 |
| 653 | Ga0501035_0196440 | 3300049822 | Bacteria | 1733 |
| 654 | Ga0501044_0617669 | 3300049823 | Bacteria | 976 |
| 655 | nmdc:mga05p37_1468177_c1 | 3300050507 | Bacteria | 681 |
| 656 | nmdc:mga05p37_2025310_c1 | 3300050507 | Bacteria | 543 |
| 657 | nmdc:mga05p37_484178_c1 | 3300050507 | Bacteria | 1424 |
| 658 | nmdc:mga05p37_51204_c1 | 3300050507 | Bacteria | 5079 |
| 659 | nmdc:mga09592_3351_c1 | 3300050508 | Bacteria | 12959 |
| 660 | nmdc:mga09592_414837_c1 | 3300050508 | Bacteria | 1163 |
| 661 | nmdc:mga09592_98502_c1 | 3300050508 | Bacteria | 2503 |
| 662 | nmdc:mga0qj67_1124394_c1 | 3300050509 | Bacteria | 613 |
| 663 | nmdc:mga0qj67_1270602_c1 | 3300050509 | Bacteria | 571 |
| 664 | nmdc:mga0qj67_17344_c1 | 3300050509 | Bacteria | 5473 |
| 665 | nmdc:mga0qj67_18430_c1 | 3300050509 | Bacteria | 5320 |
| 666 | nmdc:mga0qj67_3821_c1 | 3300050509 | Bacteria | 10882 |
| 667 | nmdc:mga0qj67_931487_c1 | 3300050509 | Bacteria | 684 |
| 668 | nmdc:mga06r32_1129060_c1 | 3300050510 | Bacteria | 732 |
| 669 | nmdc:mga06r32_1292502_c1 | 3300050510 | Bacteria | 674 |
| 670 | nmdc:mga06r32_22643_c1 | 3300050510 | Bacteria | 5811 |
| 671 | nmdc:mga06r32_23_c1 | 3300050510 | Bacteria | 93533 |
| 672 | nmdc:mga06r32_3897_c1 | 3300050510 | Bacteria | 13374 |
| 673 | nmdc:mga08y16_10408_c1 | 3300050511 | Bacteria | 9756 |
| 674 | nmdc:mga08y16_12878_c1 | 3300050511 | Bacteria | 8796 |
| 675 | nmdc:mga08y16_451948_c1 | 3300050511 | Bacteria | 1310 |
| 676 | nmdc:mga08y16_820965_c1 | 3300050511 | Bacteria | 921 |
| 677 | nmdc:mga0n895_316603_c1 | 3300050512 | Bacteria | 1581 |
| 678 | nmdc:mga0n895_415_c1 | 3300050512 | Bacteria | 28635 |
| 679 | nmdc:mga0rr50_105517_c1 | 3300050513 | Bacteria | 2222 |
| 680 | nmdc:mga0rr50_1206_c1 | 3300050513 | Bacteria | 14042 |
| 681 | nmdc:mga0rr50_210356_c1 | 3300050513 | Bacteria | 1602 |
| 682 | nmdc:mga0rr50_395737_c1 | 3300050513 | Bacteria | 1166 |
| 683 | nmdc:mga0rr50_797402_c1 | 3300050513 | Bacteria | 806 |
| 684 | nmdc:mga08x19_14295_c1 | 3300050514 | Bacteria | 4814 |
| 685 | nmdc:mga08x19_156983_c1 | 3300050514 | Bacteria | 1543 |
| 686 | nmdc:mga08x19_265478_c1 | 3300050514 | Bacteria | 1187 |
| 687 | nmdc:mga08x19_285389_c1 | 3300050514 | Bacteria | 1144 |
| 688 | nmdc:mga08x19_43053_c1 | 3300050514 | Bacteria | 2880 |
| 689 | nmdc:mga08x19_61092_c1 | 3300050514 | Bacteria | 2442 |
| 690 | nmdc:mga08x19_625_c1 | 3300050514 | Bacteria | 22799 |
| 691 | nmdc:mga0a205_380733_c1 | 3300050515 | Bacteria | 1276 |
| 692 | nmdc:mga0a205_449096_c1 | 3300050515 | Bacteria | 1149 |
| 693 | Ga0500643_187964 | 3300053087 | Bacteria | 554 |
| 694 | Ga0500644_0233730 | 3300053088 | Bacteria | 770 |
| 695 | Ga0500581_359527 | 3300053089 | Bacteria | 547 |
| 696 | Ga0500646_0210523 | 3300053090 | Bacteria | 671 |
| 697 | Ga0500583_0013312 | 3300053092 | Bacteria | 3178 |
| 698 | Ga0500583_0083771 | 3300053092 | Bacteria | 1544 |
| 699 | Ga0500651_0577865 | 3300053093 | Bacteria | 612 |
| 700 | Ga0500569_013363 | 3300053109 | Bacteria | 2008 |
| 701 | Ga0500617_147203 | 3300053124 | Bacteria | 936 |
| 702 | Ga0500642_0095320 | 3300053130 | Bacteria | 1379 |
| 703 | Ga0500568_0119260 | 3300053139 | Bacteria | 983 |
| 704 | Ga0500588_0000210 | 3300053146 | Bacteria | 8184 |
| 705 | Ga0500622_0001473 | 3300053156 | Bacteria | 18746 |
| 706 | Ga0500622_0013289 | 3300053156 | Bacteria | 4441 |
| 707 | Ga0500627_0170845 | 3300053158 | Bacteria | 980 |
| 708 | Ga0500637_0319659 | 3300053178 | Bacteria | 839 |
| 709 | Ga0590071_054655 | 3300059421 | Bacteria | 971 |
| 710 | Ga0590071_065477 | 3300059421 | Bacteria | 892 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053087 | Ga0500643_187964 | Ga0500643_187964_16_438 | 137 |
| 2 | 3300042876 | Ga0451577_1015112 | Ga0451577_1015112_77_517 | 142 |
| 3 | 3300005329 | Ga0070683_100035698 | Ga0070683_1000356982 | 143 |
| 4 | 3300005331 | Ga0070670_100006956 | Ga0070670_1000069568 | 143 |
| 5 | 3300005336 | Ga0070680_100407771 | Ga0070680_1004077711 | 143 |
| 6 | 3300005338 | Ga0068868_100180742 | Ga0068868_1001807422 | 143 |
| 7 | 3300005355 | Ga0070671_100021032 | Ga0070671_1000210324 | 143 |
| 8 | 3300005364 | Ga0070673_100005910 | Ga0070673_1000059106 | 143 |
| 9 | 3300005435 | Ga0070714_100064330 | Ga0070714_1000643302 | 143 |
| 10 | 3300005456 | Ga0070678_100084624 | Ga0070678_1000846243 | 143 |
| 11 | 3300005458 | Ga0070681_10523724 | Ga0070681_105237241 | 143 |
| 12 | 3300005840 | Ga0068870_10282549 | Ga0068870_102825492 | 143 |
| 13 | 3300005844 | Ga0068862_100953616 | Ga0068862_1009536162 | 143 |
| 14 | 3300009098 | Ga0105245_11110947 | Ga0105245_111109472 | 143 |
| 15 | 3300009176 | Ga0105242_10228377 | Ga0105242_102283772 | 143 |
| 16 | 3300009177 | Ga0105248_10088888 | Ga0105248_100888884 | 143 |
| 17 | 3300009551 | Ga0105238_10461206 | Ga0105238_104612062 | 143 |
| 18 | 3300013296 | Ga0157374_10045246 | Ga0157374_100452464 | 143 |
| 19 | 3300013297 | Ga0157378_10003991 | Ga0157378_100039913 | 143 |
| 20 | 3300013306 | Ga0163162_10056038 | Ga0163162_100560382 | 143 |
| 21 | 3300013308 | Ga0157375_10071548 | Ga0157375_100715484 | 143 |
| 22 | 3300014326 | Ga0157380_11139784 | Ga0157380_111397842 | 143 |
| 23 | 3300014745 | Ga0157377_10066758 | Ga0157377_100667582 | 143 |
| 24 | 3300014969 | Ga0157376_10011903 | Ga0157376_100119036 | 143 |
| 25 | 3300025908 | Ga0207643_10490146 | Ga0207643_104901461 | 143 |
| 26 | 3300025912 | Ga0207707_11113047 | Ga0207707_111130472 | 143 |
| 27 | 3300025917 | Ga0207660_10333540 | Ga0207660_103335401 | 143 |
| 28 | 3300027360 | Ga0209969_1004562 | Ga0209969_10045623 | 143 |
| 29 | 3300027876 | Ga0209974_10050958 | Ga0209974_100509582 | 143 |
| 30 | 3300028380 | Ga0268265_10035383 | Ga0268265_100353832 | 143 |
| 31 | 3300031665 | Ga0316575_10122421 | Ga0316575_101224212 | 143 |
| 32 | 3300033529 | Ga0316587_1050155 | Ga0316587_10501551 | 143 |
| 33 | 3300035398 | Ga0316574_0261688 | Ga0316574_0261688_275_715 | 143 |
| 34 | 3300036712 | Ga0316584_0337425 | Ga0316584_0337425_189_626 | 143 |
| 35 | 3300038725 | Ga0400484_22999 | Ga0400484_22999_26173_26613 | 143 |
| 36 | 3300038725 | Ga0400484_29948 | Ga0400484_29948_5754_6194 | 143 |
| 37 | 3300038725 | Ga0400484_36650 | Ga0400484_36650_2801_3241 | 143 |
| 38 | 3300038726 | Ga0400490_09976 | Ga0400490_09976_194_631 | 143 |
| 39 | 3300038726 | Ga0400490_29153 | Ga0400490_29153_15574_16014 | 143 |
| 40 | 3300038726 | Ga0400490_55744 | Ga0400490_55744_64471_64911 | 143 |
| 41 | 3300038727 | Ga0400491_02682 | Ga0400491_02682_753_1193 | 143 |
| 42 | 3300038727 | Ga0400491_10039 | Ga0400491_10039_462_902 | 143 |
| 43 | 3300038727 | Ga0400491_26238 | Ga0400491_26238_4202_4642 | 143 |
| 44 | 3300038735 | Ga0400485_04462 | Ga0400485_04462_3767_4207 | 143 |
| 45 | 3300038741 | Ga0400488_09389 | Ga0400488_09389_575_1015 | 143 |
| 46 | 3300038741 | Ga0400488_19449 | Ga0400488_19449_413_853 | 143 |
| 47 | 3300038741 | Ga0400488_21215 | Ga0400488_21215_16634_17074 | 143 |
| 48 | 3300038741 | Ga0400488_24107 | Ga0400488_24107_251_691 | 143 |
| 49 | 3300038741 | Ga0400488_31647 | Ga0400488_31647_194_634 | 143 |
| 50 | 3300038741 | Ga0400488_38891 | Ga0400488_38891_8605_9045 | 143 |
| 51 | 3300038741 | Ga0400488_42663 | Ga0400488_42663_1536_1976 | 143 |
| 52 | 3300038742 | Ga0400486_08527 | Ga0400486_08527_3264_3701 | 143 |
| 53 | 3300038742 | Ga0400486_14851 | Ga0400486_14851_3801_4241 | 143 |
| 54 | 3300039062 | Ga0400483_093565 | Ga0400483_093565_412_852 | 143 |
| 55 | 3300039062 | Ga0400483_108094 | Ga0400483_108094_1069_1509 | 143 |
| 56 | 3300039062 | Ga0400483_175714 | Ga0400483_175714_386_826 | 143 |
| 57 | 3300039062 | Ga0400483_202890 | Ga0400483_202890_1365_1805 | 143 |
| 58 | 3300039062 | Ga0400483_241642 | Ga0400483_241642_14965_15405 | 143 |
| 59 | 3300039062 | Ga0400483_265824 | Ga0400483_265824_184_621 | 143 |
| 60 | 3300039062 | Ga0400483_290185 | Ga0400483_290185_4667_5107 | 143 |
| 61 | 3300039093 | Ga0400489_80563 | Ga0400489_80563_1957_2394 | 143 |
| 62 | 3300039110 | Ga0400487_11274 | Ga0400487_11274_347_787 | 143 |
| 63 | 3300039110 | Ga0400487_11908 | Ga0400487_11908_2882_3322 | 143 |
| 64 | 3300039110 | Ga0400487_14076 | Ga0400487_14076_16568_17008 | 143 |
| 65 | 3300039110 | Ga0400487_17975 | Ga0400487_17975_837_1277 | 143 |
| 66 | 3300039110 | Ga0400487_54961 | Ga0400487_54961_25090_25530 | 143 |
| 67 | 3300042015 | Ga0439462_0120621 | Ga0439462_0120621_173_616 | 143 |
| 68 | 3300045051 | Ga0451576_0047973 | Ga0451576_0047973_379_828 | 143 |
| 69 | 3300048904 | Ga0496101_0291908 | Ga0496101_0291908_693_1148 | 143 |
| 70 | 3300048907 | Ga0496104_0385982 | Ga0496104_0385982_309_764 | 143 |
| 71 | 3300048907 | Ga0496104_0984103 | Ga0496104_0984103_293_730 | 143 |
| 72 | 3300048911 | Ga0496108_0100879 | Ga0496108_0100879_310_765 | 143 |
| 73 | 3300048912 | Ga0496109_0087986 | Ga0496109_0087986_1146_1601 | 143 |
| 74 | 3300048917 | Ga0496114_0202928 | Ga0496114_0202928_722_1177 | 143 |
| 75 | 3300048920 | Ga0496117_0232093 | Ga0496117_0232093_35_484 | 143 |
| 76 | 3300048928 | Ga0496125_0435560 | Ga0496125_0435560_136_570 | 143 |
| 77 | 3300049585 | Ga0501069_0018783 | Ga0501069_0018783_3051_3494 | 143 |
| 78 | 3300049587 | Ga0501071_0397557 | Ga0501071_0397557_15_476 | 143 |
| 79 | 3300049588 | Ga0501072_0272597 | Ga0501072_0272597_530_973 | 143 |
| 80 | 3300050509 | nmdc:mga0qj67_18430_c1 | nmdc:mga0qj67_18430_c1_3433_3888 | 143 |
| 81 | 3300050513 | nmdc:mga0rr50_210356_c1 | nmdc:mga0rr50_210356_c1_952_1395 | 143 |
| 82 | 3300050514 | nmdc:mga08x19_156983_c1 | nmdc:mga08x19_156983_c1_549_992 | 143 |
| 83 | 3300053089 | Ga0500581_359527 | Ga0500581_359527_75_515 | 143 |
| 84 | 3300053158 | Ga0500627_0170845 | Ga0500627_0170845_480_923 | 143 |
| 85 | 3300005331 | Ga0070670_100000015 | Ga0070670_100000015155 | 144 |
| 86 | 3300005335 | Ga0070666_10030935 | Ga0070666_100309354 | 144 |
| 87 | 3300005353 | Ga0070669_100002436 | Ga0070669_1000024365 | 144 |
| 88 | 3300005355 | Ga0070671_100000013 | Ga0070671_100000013156 | 144 |
| 89 | 3300005365 | Ga0070688_100024544 | Ga0070688_1000245442 | 144 |
| 90 | 3300005367 | Ga0070667_100000015 | Ga0070667_10000001560 | 144 |
| 91 | 3300005466 | Ga0070685_10000004 | Ga0070685_1000000469 | 144 |
| 92 | 3300005467 | Ga0070706_100764759 | Ga0070706_1007647592 | 144 |
| 93 | 3300005548 | Ga0070665_100146477 | Ga0070665_1001464773 | 144 |
| 94 | 3300005617 | Ga0068859_100011061 | Ga0068859_1000110614 | 144 |
| 95 | 3300005618 | Ga0068864_100000072 | Ga0068864_10000007262 | 144 |
| 96 | 3300005841 | Ga0068863_102351757 | Ga0068863_1023517571 | 144 |
| 97 | 3300005842 | Ga0068858_100059515 | Ga0068858_1000595152 | 144 |
| 98 | 3300005843 | Ga0068860_100000271 | Ga0068860_10000027119 | 144 |
| 99 | 3300005844 | Ga0068862_100002888 | Ga0068862_1000028885 | 144 |
| 100 | 3300006931 | Ga0097620_100011061 | Ga0097620_1000110616 | 144 |
| 101 | 3300009101 | Ga0105247_10089033 | Ga0105247_100890333 | 144 |
| 102 | 3300009177 | Ga0105248_10024742 | Ga0105248_100247423 | 144 |
| 103 | 3300009553 | Ga0105249_10095997 | Ga0105249_100959973 | 144 |
| 104 | 3300014325 | Ga0163163_10000118 | Ga0163163_1000011860 | 144 |
| 105 | 3300021361 | Ga0213872_10076206 | Ga0213872_100762062 | 144 |
| 106 | 3300025903 | Ga0207680_10018290 | Ga0207680_100182905 | 144 |
| 107 | 3300025923 | Ga0207681_10002041 | Ga0207681_100020414 | 144 |
| 108 | 3300025925 | Ga0207650_10000013 | Ga0207650_10000013326 | 144 |
| 109 | 3300025931 | Ga0207644_10000015 | Ga0207644_10000015104 | 144 |
| 110 | 3300025941 | Ga0207711_10000103 | Ga0207711_1000010333 | 144 |
| 111 | 3300025941 | Ga0207711_10000277 | Ga0207711_1000027739 | 144 |
| 112 | 3300025961 | Ga0207712_10127992 | Ga0207712_101279923 | 144 |
| 113 | 3300025986 | Ga0207658_10000005 | Ga0207658_10000005327 | 144 |
| 114 | 3300026035 | Ga0207703_10005017 | Ga0207703_100050172 | 144 |
| 115 | 3300026088 | Ga0207641_10022587 | Ga0207641_100225872 | 144 |
| 116 | 3300026095 | Ga0207676_10000010 | Ga0207676_10000010424 | 144 |
| 117 | 3300028379 | Ga0268266_10023031 | Ga0268266_100230311 | 144 |
| 118 | 3300028380 | Ga0268265_10001515 | Ga0268265_1000151510 | 144 |
| 119 | 3300028381 | Ga0268264_10000036 | Ga0268264_10000036193 | 144 |
| 120 | 3300039447 | Ga0436361_0359769 | Ga0436361_0359769_922_1410 | 144 |
| 121 | 3300048927 | Ga0496124_0479451 | Ga0496124_0479451_228_668 | 144 |
| 122 | 3300048929 | Ga0496126_0436630 | Ga0496126_0436630_222_662 | 144 |
| 123 | 3300049575 | Ga0501039_0488210 | Ga0501039_0488210_447_887 | 144 |
| 124 | 3300049581 | Ga0501047_0023376 | Ga0501047_0023376_1796_2236 | 144 |
| 125 | iso_pu_bacteria | 2547132103 | 2547373956 | 144 |
| 126 | iso_pu_bacteria | 2843690924 | 2843692418 | 144 |
| 127 | iso_pu_bacteria | 2846033681 | 2846036266 | 144 |
| 128 | iso_pu_bacteria | 2846037992 | 2846041010 | 144 |
| 129 | 3300005331 | Ga0070670_100547530 | Ga0070670_1005475302 | 145 |
| 130 | 3300005334 | Ga0068869_100003904 | Ga0068869_1000039043 | 145 |
| 131 | 3300005335 | Ga0070666_10041927 | Ga0070666_100419272 | 145 |
| 132 | 3300005343 | Ga0070687_100585443 | Ga0070687_1005854432 | 145 |
| 133 | 3300005347 | Ga0070668_100356678 | Ga0070668_1003566782 | 145 |
| 134 | 3300005354 | Ga0070675_100067476 | Ga0070675_1000674763 | 145 |
| 135 | 3300005364 | Ga0070673_100354037 | Ga0070673_1003540372 | 145 |
| 136 | 3300005365 | Ga0070688_101100106 | Ga0070688_1011001061 | 145 |
| 137 | 3300005367 | Ga0070667_100311078 | Ga0070667_1003110782 | 145 |
| 138 | 3300005444 | Ga0070694_100256120 | Ga0070694_1002561202 | 145 |
| 139 | 3300005456 | Ga0070678_100130988 | Ga0070678_1001309882 | 145 |
| 140 | 3300005459 | Ga0068867_100036380 | Ga0068867_1000363804 | 145 |
| 141 | 3300005466 | Ga0070685_10062017 | Ga0070685_100620171 | 145 |
| 142 | 3300005548 | Ga0070665_100094876 | Ga0070665_1000948762 | 145 |
| 143 | 3300005617 | Ga0068859_100210935 | Ga0068859_1002109353 | 145 |
| 144 | 3300005618 | Ga0068864_100143466 | Ga0068864_1001434662 | 145 |
| 145 | 3300005841 | Ga0068863_100207589 | Ga0068863_1002075893 | 145 |
| 146 | 3300005842 | Ga0068858_100276436 | Ga0068858_1002764362 | 145 |
| 147 | 3300005844 | Ga0068862_100748968 | Ga0068862_1007489682 | 145 |
| 148 | 3300005844 | Ga0068862_101270022 | Ga0068862_1012700221 | 145 |
| 149 | 3300006237 | Ga0097621_100578321 | Ga0097621_1005783211 | 145 |
| 150 | 3300006358 | Ga0068871_100029924 | Ga0068871_1000299245 | 145 |
| 151 | 3300006881 | Ga0068865_100359048 | Ga0068865_1003590482 | 145 |
| 152 | 3300006931 | Ga0097620_100210923 | Ga0097620_1002109233 | 145 |
| 153 | 3300009094 | Ga0111539_10399075 | Ga0111539_103990752 | 145 |
| 154 | 3300009098 | Ga0105245_10539227 | Ga0105245_105392272 | 145 |
| 155 | 3300009101 | Ga0105247_10140548 | Ga0105247_101405482 | 145 |
| 156 | 3300009177 | Ga0105248_10002407 | Ga0105248_1000240718 | 145 |
| 157 | 3300009553 | Ga0105249_11200792 | Ga0105249_112007921 | 145 |
| 158 | 3300010375 | Ga0105239_11568303 | Ga0105239_115683031 | 145 |
| 159 | 3300013296 | Ga0157374_10080636 | Ga0157374_100806362 | 145 |
| 160 | 3300013306 | Ga0163162_11552488 | Ga0163162_115524882 | 145 |
| 161 | 3300013308 | Ga0157375_10052471 | Ga0157375_100524714 | 145 |
| 162 | 3300014326 | Ga0157380_10587789 | Ga0157380_105877892 | 145 |
| 163 | 3300014745 | Ga0157377_11279456 | Ga0157377_112794562 | 145 |
| 164 | 3300014968 | Ga0157379_10725484 | Ga0157379_107254842 | 145 |
| 165 | 3300014969 | Ga0157376_10020696 | Ga0157376_100206964 | 145 |
| 166 | 3300025899 | Ga0207642_10029074 | Ga0207642_100290743 | 145 |
| 167 | 3300025903 | Ga0207680_10187724 | Ga0207680_101877242 | 145 |
| 168 | 3300025908 | Ga0207643_10316863 | Ga0207643_103168632 | 145 |
| 169 | 3300025926 | Ga0207659_10039083 | Ga0207659_100390833 | 145 |
| 170 | 3300025935 | Ga0207709_10813517 | Ga0207709_108135172 | 145 |
| 171 | 3300025938 | Ga0207704_10073923 | Ga0207704_100739233 | 145 |
| 172 | 3300025941 | Ga0207711_10011788 | Ga0207711_100117885 | 145 |
| 173 | 3300025942 | Ga0207689_10000974 | Ga0207689_1000097426 | 145 |
| 174 | 3300025960 | Ga0207651_10551560 | Ga0207651_105515602 | 145 |
| 175 | 3300025972 | Ga0207668_10321190 | Ga0207668_103211902 | 145 |
| 176 | 3300025986 | Ga0207658_10125281 | Ga0207658_101252812 | 145 |
| 177 | 3300026023 | Ga0207677_10214924 | Ga0207677_102149242 | 145 |
| 178 | 3300026035 | Ga0207703_10053560 | Ga0207703_100535604 | 145 |
| 179 | 3300026088 | Ga0207641_10118468 | Ga0207641_101184683 | 145 |
| 180 | 3300026089 | Ga0207648_10032325 | Ga0207648_100323254 | 145 |
| 181 | 3300026095 | Ga0207676_10328609 | Ga0207676_103286092 | 145 |
| 182 | 3300026118 | Ga0207675_100565860 | Ga0207675_1005658602 | 145 |
| 183 | 3300028379 | Ga0268266_10406896 | Ga0268266_104068962 | 145 |
| 184 | 3300028380 | Ga0268265_10819584 | Ga0268265_108195841 | 145 |
| 185 | 3300028381 | Ga0268264_10896797 | Ga0268264_108967971 | 145 |
| 186 | 3300031665 | Ga0316575_10372420 | Ga0316575_103724201 | 145 |
| 187 | 3300039447 | Ga0436361_0060574 | Ga0436361_0060574_57_500 | 145 |
| 188 | 3300047319 | Ga0495674_0793990 | Ga0495674_0793990_65_505 | 145 |
| 189 | 3300050511 | nmdc:mga08y16_451948_c1 | nmdc:mga08y16_451948_c1_199_639 | 145 |
| 190 | 3300005327 | Ga0070658_10168924 | Ga0070658_101689242 | 146 |
| 191 | 3300005328 | Ga0070676_10431059 | Ga0070676_104310592 | 146 |
| 192 | 3300005333 | Ga0070677_10110098 | Ga0070677_101100982 | 146 |
| 193 | 3300005334 | Ga0068869_101183805 | Ga0068869_1011838052 | 146 |
| 194 | 3300005335 | Ga0070666_10227926 | Ga0070666_102279262 | 146 |
| 195 | 3300005338 | Ga0068868_100209917 | Ga0068868_1002099171 | 146 |
| 196 | 3300005344 | Ga0070661_100157790 | Ga0070661_1001577902 | 146 |
| 197 | 3300005353 | Ga0070669_101269602 | Ga0070669_1012696021 | 146 |
| 198 | 3300005354 | Ga0070675_100066009 | Ga0070675_1000660093 | 146 |
| 199 | 3300005354 | Ga0070675_100740971 | Ga0070675_1007409712 | 146 |
| 200 | 3300005355 | Ga0070671_100837471 | Ga0070671_1008374712 | 146 |
| 201 | 3300005365 | Ga0070688_100306842 | Ga0070688_1003068422 | 146 |
| 202 | 3300005366 | Ga0070659_100327620 | Ga0070659_1003276202 | 146 |
| 203 | 3300005367 | Ga0070667_100292441 | Ga0070667_1002924412 | 146 |
| 204 | 3300005435 | Ga0070714_100018737 | Ga0070714_1000187375 | 146 |
| 205 | 3300005435 | Ga0070714_100061413 | Ga0070714_1000614132 | 146 |
| 206 | 3300005440 | Ga0070705_100269645 | Ga0070705_1002696452 | 146 |
| 207 | 3300005440 | Ga0070705_101240372 | Ga0070705_1012403721 | 146 |
| 208 | 3300005440 | Ga0070705_101762899 | Ga0070705_1017628991 | 146 |
| 209 | 3300005444 | Ga0070694_100005376 | Ga0070694_1000053763 | 146 |
| 210 | 3300005457 | Ga0070662_100161987 | Ga0070662_1001619872 | 146 |
| 211 | 3300005458 | Ga0070681_10004922 | Ga0070681_100049229 | 146 |
| 212 | 3300005458 | Ga0070681_10763045 | Ga0070681_107630452 | 146 |
| 213 | 3300005459 | Ga0068867_101797744 | Ga0068867_1017977441 | 146 |
| 214 | 3300005467 | Ga0070706_100287774 | Ga0070706_1002877742 | 146 |
| 215 | 3300005518 | Ga0070699_100023690 | Ga0070699_1000236906 | 146 |
| 216 | 3300005535 | Ga0070684_100227634 | Ga0070684_1002276342 | 146 |
| 217 | 3300005536 | Ga0070697_100008352 | Ga0070697_1000083527 | 146 |
| 218 | 3300005536 | Ga0070697_100452979 | Ga0070697_1004529792 | 146 |
| 219 | 3300005536 | Ga0070697_100500031 | Ga0070697_1005000312 | 146 |
| 220 | 3300005539 | Ga0068853_100008688 | Ga0068853_1000086887 | 146 |
| 221 | 3300005539 | Ga0068853_100794052 | Ga0068853_1007940522 | 146 |
| 222 | 3300005545 | Ga0070695_100004111 | Ga0070695_1000041115 | 146 |
| 223 | 3300005545 | Ga0070695_100778115 | Ga0070695_1007781152 | 146 |
| 224 | 3300005546 | Ga0070696_100007424 | Ga0070696_1000074244 | 146 |
| 225 | 3300005546 | Ga0070696_100124509 | Ga0070696_1001245092 | 146 |
| 226 | 3300005547 | Ga0070693_101049589 | Ga0070693_1010495891 | 146 |
| 227 | 3300005549 | Ga0070704_100130014 | Ga0070704_1001300142 | 146 |
| 228 | 3300005563 | Ga0068855_100201866 | Ga0068855_1002018662 | 146 |
| 229 | 3300005564 | Ga0070664_100022229 | Ga0070664_1000222295 | 146 |
| 230 | 3300005577 | Ga0068857_100029896 | Ga0068857_1000298962 | 146 |
| 231 | 3300005578 | Ga0068854_100010299 | Ga0068854_1000102993 | 146 |
| 232 | 3300005614 | Ga0068856_100526522 | Ga0068856_1005265222 | 146 |
| 233 | 3300005614 | Ga0068856_100688698 | Ga0068856_1006886982 | 146 |
| 234 | 3300005615 | Ga0070702_100122629 | Ga0070702_1001226293 | 146 |
| 235 | 3300005615 | Ga0070702_100189440 | Ga0070702_1001894401 | 146 |
| 236 | 3300005615 | Ga0070702_100374531 | Ga0070702_1003745312 | 146 |
| 237 | 3300005616 | Ga0068852_100005797 | Ga0068852_1000057977 | 146 |
| 238 | 3300005617 | Ga0068859_100024498 | Ga0068859_1000244982 | 146 |
| 239 | 3300005618 | Ga0068864_100247521 | Ga0068864_1002475212 | 146 |
| 240 | 3300005718 | Ga0068866_10108657 | Ga0068866_101086572 | 146 |
| 241 | 3300005834 | Ga0068851_10090016 | Ga0068851_100900162 | 146 |
| 242 | 3300005842 | Ga0068858_100347079 | Ga0068858_1003470792 | 146 |
| 243 | 3300005842 | Ga0068858_100584181 | Ga0068858_1005841812 | 146 |
| 244 | 3300005844 | Ga0068862_100056332 | Ga0068862_1000563322 | 146 |
| 245 | 3300005985 | Ga0081539_10001441 | Ga0081539_100014417 | 146 |
| 246 | 3300006058 | Ga0075432_10299323 | Ga0075432_102993232 | 146 |
| 247 | 3300006173 | Ga0070716_100250656 | Ga0070716_1002506562 | 146 |
| 248 | 3300006173 | Ga0070716_100734426 | Ga0070716_1007344262 | 146 |
| 249 | 3300006237 | Ga0097621_100003683 | Ga0097621_1000036834 | 146 |
| 250 | 3300006358 | Ga0068871_100289780 | Ga0068871_1002897802 | 146 |
| 251 | 3300006844 | Ga0075428_100010558 | Ga0075428_1000105582 | 146 |
| 252 | 3300006844 | Ga0075428_100699555 | Ga0075428_1006995551 | 146 |
| 253 | 3300006846 | Ga0075430_100289900 | Ga0075430_1002899002 | 146 |
| 254 | 3300006847 | Ga0075431_101009158 | Ga0075431_1010091582 | 146 |
| 255 | 3300006852 | Ga0075433_10463383 | Ga0075433_104633832 | 146 |
| 256 | 3300006871 | Ga0075434_100000004 | Ga0075434_10000000463 | 146 |
| 257 | 3300006871 | Ga0075434_100321078 | Ga0075434_1003210782 | 146 |
| 258 | 3300006914 | Ga0075436_100005388 | Ga0075436_1000053887 | 146 |
| 259 | 3300006914 | Ga0075436_100005406 | Ga0075436_1000054067 | 146 |
| 260 | 3300006914 | Ga0075436_100021279 | Ga0075436_1000212792 | 146 |
| 261 | 3300006914 | Ga0075436_100077166 | Ga0075436_1000771663 | 146 |
| 262 | 3300006914 | Ga0075436_100106811 | Ga0075436_1001068112 | 146 |
| 263 | 3300006914 | Ga0075436_100285853 | Ga0075436_1002858532 | 146 |
| 264 | 3300006931 | Ga0097620_100024498 | Ga0097620_1000244982 | 146 |
| 265 | 3300007076 | Ga0075435_100018356 | Ga0075435_1000183566 | 146 |
| 266 | 3300007076 | Ga0075435_100224993 | Ga0075435_1002249933 | 146 |
| 267 | 3300007076 | Ga0075435_100716270 | Ga0075435_1007162702 | 146 |
| 268 | 3300009094 | Ga0111539_11167520 | Ga0111539_111675202 | 146 |
| 269 | 3300009098 | Ga0105245_10006356 | Ga0105245_100063567 | 146 |
| 270 | 3300009147 | Ga0114129_10190939 | Ga0114129_101909392 | 146 |
| 271 | 3300009147 | Ga0114129_11550813 | Ga0114129_115508132 | 146 |
| 272 | 3300009176 | Ga0105242_10004198 | Ga0105242_100041983 | 146 |
| 273 | 3300009177 | Ga0105248_11301361 | Ga0105248_113013612 | 146 |
| 274 | 3300014968 | Ga0157379_10348196 | Ga0157379_103481962 | 146 |
| 275 | 3300025315 | Ga0207697_10144180 | Ga0207697_101441802 | 146 |
| 276 | 3300025321 | Ga0207656_10061076 | Ga0207656_100610762 | 146 |
| 277 | 3300025903 | Ga0207680_10064240 | Ga0207680_100642403 | 146 |
| 278 | 3300025906 | Ga0207699_10335113 | Ga0207699_103351132 | 146 |
| 279 | 3300025909 | Ga0207705_10061461 | Ga0207705_100614614 | 146 |
| 280 | 3300025911 | Ga0207654_10073478 | Ga0207654_100734782 | 146 |
| 281 | 3300025912 | Ga0207707_10035257 | Ga0207707_100352573 | 146 |
| 282 | 3300025912 | Ga0207707_10234875 | Ga0207707_102348752 | 146 |
| 283 | 3300025914 | Ga0207671_10025884 | Ga0207671_100258843 | 146 |
| 284 | 3300025918 | Ga0207662_10405553 | Ga0207662_104055532 | 146 |
| 285 | 3300025920 | Ga0207649_10040772 | Ga0207649_100407723 | 146 |
| 286 | 3300025923 | Ga0207681_10423423 | Ga0207681_104234232 | 146 |
| 287 | 3300025926 | Ga0207659_10224356 | Ga0207659_102243562 | 146 |
| 288 | 3300025927 | Ga0207687_10831231 | Ga0207687_108312312 | 146 |
| 289 | 3300025929 | Ga0207664_10020611 | Ga0207664_100206115 | 146 |
| 290 | 3300025929 | Ga0207664_10057026 | Ga0207664_100570262 | 146 |
| 291 | 3300025929 | Ga0207664_10317217 | Ga0207664_103172172 | 146 |
| 292 | 3300025931 | Ga0207644_10020618 | Ga0207644_100206184 | 146 |
| 293 | 3300025932 | Ga0207690_10393410 | Ga0207690_103934102 | 146 |
| 294 | 3300025933 | Ga0207706_10132128 | Ga0207706_101321282 | 146 |
| 295 | 3300025939 | Ga0207665_10735341 | Ga0207665_107353412 | 146 |
| 296 | 3300025940 | Ga0207691_10007106 | Ga0207691_100071064 | 146 |
| 297 | 3300025941 | Ga0207711_10427228 | Ga0207711_104272282 | 146 |
| 298 | 3300025942 | Ga0207689_11368155 | Ga0207689_113681552 | 146 |
| 299 | 3300025944 | Ga0207661_10183543 | Ga0207661_101835432 | 146 |
| 300 | 3300025945 | Ga0207679_10005967 | Ga0207679_100059675 | 146 |
| 301 | 3300025949 | Ga0207667_10085553 | Ga0207667_100855533 | 146 |
| 302 | 3300025960 | Ga0207651_10140782 | Ga0207651_101407823 | 146 |
| 303 | 3300025981 | Ga0207640_10068365 | Ga0207640_100683653 | 146 |
| 304 | 3300026023 | Ga0207677_10031535 | Ga0207677_100315352 | 146 |
| 305 | 3300026035 | Ga0207703_10475782 | Ga0207703_104757822 | 146 |
| 306 | 3300026041 | Ga0207639_10028853 | Ga0207639_100288532 | 146 |
| 307 | 3300026041 | Ga0207639_11436094 | Ga0207639_114360942 | 146 |
| 308 | 3300026078 | Ga0207702_11191236 | Ga0207702_111912361 | 146 |
| 309 | 3300026088 | Ga0207641_10272783 | Ga0207641_102727832 | 146 |
| 310 | 3300026089 | Ga0207648_10749717 | Ga0207648_107497172 | 146 |
| 311 | 3300026116 | Ga0207674_10020988 | Ga0207674_100209882 | 146 |
| 312 | 3300026121 | Ga0207683_10003576 | Ga0207683_1000357613 | 146 |
| 313 | 3300026142 | Ga0207698_10025963 | Ga0207698_100259633 | 146 |
| 314 | 3300027471 | Ga0209995_1001621 | Ga0209995_10016212 | 146 |
| 315 | 3300027543 | Ga0209999_1001099 | Ga0209999_10010994 | 146 |
| 316 | 3300027682 | Ga0209971_1022551 | Ga0209971_10225512 | 146 |
| 317 | 3300027876 | Ga0209974_10001583 | Ga0209974_100015835 | 146 |
| 318 | 3300028380 | Ga0268265_10065120 | Ga0268265_100651202 | 146 |
| 319 | 3300028573 | Ga0265334_10020425 | Ga0265334_100204254 | 146 |
| 320 | 3300028800 | Ga0265338_10005957 | Ga0265338_100059574 | 146 |
| 321 | 3300031595 | Ga0265313_10010261 | Ga0265313_100102613 | 146 |
| 322 | 3300032002 | Ga0307416_103544721 | Ga0307416_1035447211 | 146 |
| 323 | 3300035114 | Ga0373939_0219622 | Ga0373939_0219622_73_531 | 146 |
| 324 | 3300035242 | Ga0373962_0209803 | Ga0373962_0209803_194_646 | 146 |
| 325 | 3300041406 | Ga0439439_0190229 | Ga0439439_0190229_75_524 | 146 |
| 326 | 3300041410 | Ga0439461_0002613 | Ga0439461_0002613_486_938 | 146 |
| 327 | 3300041997 | Ga0439431_0049696 | Ga0439431_0049696_280_732 | 146 |
| 328 | 3300042156 | Ga0439446_0004846 | Ga0439446_0004846_92_544 | 146 |
| 329 | 3300042435 | Ga0439434_0004148 | Ga0439434_0004148_483_935 | 146 |
| 330 | 3300042436 | Ga0439435_0000204 | Ga0439435_0000204_883_1335 | 146 |
| 331 | 3300045051 | Ga0451576_1010087 | Ga0451576_1010087_364_816 | 146 |
| 332 | 3300046528 | Ga0495642_0232722 | Ga0495642_0232722_162_614 | 146 |
| 333 | 3300046537 | Ga0495598_0008886 | Ga0495598_0008886_1641_2105 | 146 |
| 334 | 3300046539 | Ga0495621_0344983 | Ga0495621_0344983_108_572 | 146 |
| 335 | 3300049593 | Ga0501077_0056905 | Ga0501077_0056905_1230_1679 | 146 |
| 336 | 3300050507 | nmdc:mga05p37_1468177_c1 | nmdc:mga05p37_1468177_c1_97_549 | 146 |
| 337 | 3300050509 | nmdc:mga0qj67_1270602_c1 | nmdc:mga0qj67_1270602_c1_86_544 | 146 |
| 338 | 3300050510 | nmdc:mga06r32_1292502_c1 | nmdc:mga06r32_1292502_c1_146_604 | 146 |
| 339 | 3300050511 | nmdc:mga08y16_820965_c1 | nmdc:mga08y16_820965_c1_369_860 | 146 |
| 340 | 3300050512 | nmdc:mga0n895_415_c1 | nmdc:mga0n895_415_c1_8919_9371 | 146 |
| 341 | 3300050513 | nmdc:mga0rr50_105517_c1 | nmdc:mga0rr50_105517_c1_1630_2082 | 146 |
| 342 | 3300050513 | nmdc:mga0rr50_1206_c1 | nmdc:mga0rr50_1206_c1_4502_4954 | 146 |
| 343 | 3300050513 | nmdc:mga0rr50_395737_c1 | nmdc:mga0rr50_395737_c1_507_959 | 146 |
| 344 | 3300050513 | nmdc:mga0rr50_797402_c1 | nmdc:mga0rr50_797402_c1_94_546 | 146 |
| 345 | 3300050514 | nmdc:mga08x19_14295_c1 | nmdc:mga08x19_14295_c1_556_1008 | 146 |
| 346 | 3300050514 | nmdc:mga08x19_265478_c1 | nmdc:mga08x19_265478_c1_612_1064 | 146 |
| 347 | 3300050514 | nmdc:mga08x19_285389_c1 | nmdc:mga08x19_285389_c1_624_1076 | 146 |
| 348 | 3300050514 | nmdc:mga08x19_43053_c1 | nmdc:mga08x19_43053_c1_2283_2735 | 146 |
| 349 | 3300050514 | nmdc:mga08x19_61092_c1 | nmdc:mga08x19_61092_c1_621_1073 | 146 |
| 350 | 3300050514 | nmdc:mga08x19_625_c1 | nmdc:mga08x19_625_c1_18661_19113 | 146 |
| 351 | 3300050515 | nmdc:mga0a205_449096_c1 | nmdc:mga0a205_449096_c1_659_1111 | 146 |
| 352 | 3300059421 | Ga0590071_054655 | Ga0590071_054655_264_716 | 146 |
| 353 | 3300059421 | Ga0590071_065477 | Ga0590071_065477_282_734 | 146 |
| 354 | 3300005327 | Ga0070658_10241175 | Ga0070658_102411752 | 147 |
| 355 | 3300005335 | Ga0070666_10000912 | Ga0070666_1000091214 | 147 |
| 356 | 3300005338 | Ga0068868_100007318 | Ga0068868_1000073182 | 147 |
| 357 | 3300005344 | Ga0070661_100567428 | Ga0070661_1005674282 | 147 |
| 358 | 3300005355 | Ga0070671_100193271 | Ga0070671_1001932713 | 147 |
| 359 | 3300005364 | Ga0070673_100097039 | Ga0070673_1000970392 | 147 |
| 360 | 3300005367 | Ga0070667_100003903 | Ga0070667_1000039035 | 147 |
| 361 | 3300005459 | Ga0068867_101081861 | Ga0068867_1010818612 | 147 |
| 362 | 3300005466 | Ga0070685_10710997 | Ga0070685_107109971 | 147 |
| 363 | 3300005548 | Ga0070665_100010167 | Ga0070665_1000101675 | 147 |
| 364 | 3300005617 | Ga0068859_100096921 | Ga0068859_1000969213 | 147 |
| 365 | 3300005618 | Ga0068864_100017395 | Ga0068864_1000173954 | 147 |
| 366 | 3300005718 | Ga0068866_10120592 | Ga0068866_101205922 | 147 |
| 367 | 3300005841 | Ga0068863_100229975 | Ga0068863_1002299752 | 147 |
| 368 | 3300005842 | Ga0068858_100006370 | Ga0068858_1000063705 | 147 |
| 369 | 3300005843 | Ga0068860_100019058 | Ga0068860_1000190586 | 147 |
| 370 | 3300006175 | Ga0070712_100108706 | Ga0070712_1001087062 | 147 |
| 371 | 3300006237 | Ga0097621_100056300 | Ga0097621_1000563002 | 147 |
| 372 | 3300006358 | Ga0068871_100024415 | Ga0068871_1000244152 | 147 |
| 373 | 3300006881 | Ga0068865_100017384 | Ga0068865_1000173845 | 147 |
| 374 | 3300006931 | Ga0097620_100096924 | Ga0097620_1000969243 | 147 |
| 375 | 3300009098 | Ga0105245_10001896 | Ga0105245_1000189617 | 147 |
| 376 | 3300009101 | Ga0105247_10302504 | Ga0105247_103025042 | 147 |
| 377 | 3300009176 | Ga0105242_10411292 | Ga0105242_104112922 | 147 |
| 378 | 3300009177 | Ga0105248_10003549 | Ga0105248_1000354911 | 147 |
| 379 | 3300013296 | Ga0157374_10013613 | Ga0157374_100136133 | 147 |
| 380 | 3300013297 | Ga0157378_10012745 | Ga0157378_100127454 | 147 |
| 381 | 3300013306 | Ga0163162_10172493 | Ga0163162_101724932 | 147 |
| 382 | 3300014325 | Ga0163163_10244182 | Ga0163163_102441823 | 147 |
| 383 | 3300014968 | Ga0157379_10004582 | Ga0157379_100045825 | 147 |
| 384 | 3300014969 | Ga0157376_10000400 | Ga0157376_1000040022 | 147 |
| 385 | 3300017792 | Ga0163161_10169842 | Ga0163161_101698422 | 147 |
| 386 | 3300021361 | Ga0213872_10016834 | Ga0213872_100168344 | 147 |
| 387 | 3300021361 | Ga0213872_10053869 | Ga0213872_100538692 | 147 |
| 388 | 3300025899 | Ga0207642_10104145 | Ga0207642_101041451 | 147 |
| 389 | 3300025920 | Ga0207649_10497559 | Ga0207649_104975592 | 147 |
| 390 | 3300025927 | Ga0207687_10296108 | Ga0207687_102961082 | 147 |
| 391 | 3300025931 | Ga0207644_10218041 | Ga0207644_102180412 | 147 |
| 392 | 3300025941 | Ga0207711_10004938 | Ga0207711_100049385 | 147 |
| 393 | 3300025960 | Ga0207651_10114154 | Ga0207651_101141542 | 147 |
| 394 | 3300025986 | Ga0207658_10020040 | Ga0207658_100200404 | 147 |
| 395 | 3300026023 | Ga0207677_10154054 | Ga0207677_101540543 | 147 |
| 396 | 3300026035 | Ga0207703_10069201 | Ga0207703_100692013 | 147 |
| 397 | 3300026088 | Ga0207641_10235840 | Ga0207641_102358402 | 147 |
| 398 | 3300026089 | Ga0207648_10939727 | Ga0207648_109397272 | 147 |
| 399 | 3300026095 | Ga0207676_10012652 | Ga0207676_100126523 | 147 |
| 400 | 3300028379 | Ga0268266_10022886 | Ga0268266_100228864 | 147 |
| 401 | 3300028381 | Ga0268264_10018203 | Ga0268264_100182035 | 147 |
| 402 | 3300028573 | Ga0265334_10000092 | Ga0265334_1000009226 | 147 |
| 403 | 3300031595 | Ga0265313_10000109 | Ga0265313_1000010924 | 147 |
| 404 | 3300035695 | Ga0373927_0000003 | Ga0373927_0000003_41290_41745 | 147 |
| 405 | 3300036401 | Ga0373937_0113993 | Ga0373937_0113993_1708_2163 | 147 |
| 406 | 3300036401 | Ga0373937_0619724 | Ga0373937_0619724_72_527 | 147 |
| 407 | 3300039447 | Ga0436361_0022148 | Ga0436361_0022148_1268_1720 | 147 |
| 408 | 3300039447 | Ga0436361_0402051 | Ga0436361_0402051_175_627 | 147 |
| 409 | 3300044656 | Ga0466969_0007376 | Ga0466969_0007376_854_1303 | 147 |
| 410 | 3300044683 | Ga0466965_0136123 | Ga0466965_0136123_214_663 | 147 |
| 411 | 3300044693 | Ga0466961_0000300 | Ga0466961_0000300_19026_19475 | 147 |
| 412 | 3300046517 | Ga0495630_0175917 | Ga0495630_0175917_198_653 | 147 |
| 413 | 3300046559 | Ga0495667_0258044 | Ga0495667_0258044_109_564 | 147 |
| 414 | 3300048088 | Ga0495602_0190944 | Ga0495602_0190944_994_1449 | 147 |
| 415 | 3300048904 | Ga0496101_0615504 | Ga0496101_0615504_117_608 | 147 |
| 416 | 3300048907 | Ga0496104_0000384 | Ga0496104_0000384_36533_37024 | 147 |
| 417 | 3300048908 | Ga0496105_0019635 | Ga0496105_0019635_2420_2911 | 147 |
| 418 | 3300048911 | Ga0496108_0005248 | Ga0496108_0005248_4225_4716 | 147 |
| 419 | 3300048913 | Ga0496110_0000305 | Ga0496110_0000305_2696_3187 | 147 |
| 420 | 3300048914 | Ga0496111_0432947 | Ga0496111_0432947_366_857 | 147 |
| 421 | 3300048915 | Ga0496112_1338753 | Ga0496112_1338753_19_510 | 147 |
| 422 | 3300048917 | Ga0496114_0170009 | Ga0496114_0170009_764_1255 | 147 |
| 423 | 3300048918 | Ga0496115_0488366 | Ga0496115_0488366_469_960 | 147 |
| 424 | 3300053092 | Ga0500583_0013312 | Ga0500583_0013312_814_1263 | 147 |
| 425 | 3300053178 | Ga0500637_0319659 | Ga0500637_0319659_333_782 | 147 |
| 426 | 3300031903 | Ga0307407_10203608 | Ga0307407_102036082 | 148 |
| 427 | 3300038741 | Ga0400488_33004 | Ga0400488_33004_10276_10737 | 148 |
| 428 | 3300038742 | Ga0400486_00233 | Ga0400486_00233_473_934 | 148 |
| 429 | 3300039062 | Ga0400483_053442 | Ga0400483_053442_663_1124 | 148 |
| 430 | 3300053090 | Ga0500646_0210523 | Ga0500646_0210523_99_587 | 148 |
| 431 | 3300053092 | Ga0500583_0083771 | Ga0500583_0083771_547_1035 | 148 |
| 432 | 3300053124 | Ga0500617_147203 | Ga0500617_147203_79_567 | 148 |
| 433 | 3300053146 | Ga0500588_0000210 | Ga0500588_0000210_3694_4182 | 148 |
| 434 | iso_pu_bacteria | 2998344455 | 2998347214 | 148 |
| 435 | 3300005288 | Ga0065714_10222308 | Ga0065714_102223082 | 149 |
| 436 | 3300005290 | Ga0065712_10089595 | Ga0065712_100895952 | 149 |
| 437 | 3300005293 | Ga0065715_10095987 | Ga0065715_100959874 | 149 |
| 438 | 3300005295 | Ga0065707_10088639 | Ga0065707_100886394 | 149 |
| 439 | 3300005329 | Ga0070683_100650461 | Ga0070683_1006504612 | 149 |
| 440 | 3300005330 | Ga0070690_100027547 | Ga0070690_1000275472 | 149 |
| 441 | 3300005331 | Ga0070670_100047907 | Ga0070670_1000479072 | 149 |
| 442 | 3300005334 | Ga0068869_100027255 | Ga0068869_1000272554 | 149 |
| 443 | 3300005334 | Ga0068869_100329772 | Ga0068869_1003297722 | 149 |
| 444 | 3300005335 | Ga0070666_10250811 | Ga0070666_102508112 | 149 |
| 445 | 3300005338 | Ga0068868_101234355 | Ga0068868_1012343552 | 149 |
| 446 | 3300005340 | Ga0070689_100004887 | Ga0070689_1000048875 | 149 |
| 447 | 3300005343 | Ga0070687_100043515 | Ga0070687_1000435153 | 149 |
| 448 | 3300005344 | Ga0070661_100018471 | Ga0070661_1000184712 | 149 |
| 449 | 3300005345 | Ga0070692_10538689 | Ga0070692_105386892 | 149 |
| 450 | 3300005347 | Ga0070668_100002261 | Ga0070668_10000226112 | 149 |
| 451 | 3300005353 | Ga0070669_100037306 | Ga0070669_1000373064 | 149 |
| 452 | 3300005354 | Ga0070675_100335136 | Ga0070675_1003351362 | 149 |
| 453 | 3300005355 | Ga0070671_100067376 | Ga0070671_1000673763 | 149 |
| 454 | 3300005364 | Ga0070673_100010204 | Ga0070673_1000102045 | 149 |
| 455 | 3300005365 | Ga0070688_100004864 | Ga0070688_1000048643 | 149 |
| 456 | 3300005367 | Ga0070667_100038246 | Ga0070667_1000382462 | 149 |
| 457 | 3300005434 | Ga0070709_10103513 | Ga0070709_101035133 | 149 |
| 458 | 3300005436 | Ga0070713_100510789 | Ga0070713_1005107892 | 149 |
| 459 | 3300005438 | Ga0070701_10105706 | Ga0070701_101057062 | 149 |
| 460 | 3300005441 | Ga0070700_100338743 | Ga0070700_1003387432 | 149 |
| 461 | 3300005444 | Ga0070694_100302523 | Ga0070694_1003025232 | 149 |
| 462 | 3300005455 | Ga0070663_100714354 | Ga0070663_1007143542 | 149 |
| 463 | 3300005456 | Ga0070678_100052998 | Ga0070678_1000529984 | 149 |
| 464 | 3300005457 | Ga0070662_100158230 | Ga0070662_1001582302 | 149 |
| 465 | 3300005458 | Ga0070681_10236206 | Ga0070681_102362063 | 149 |
| 466 | 3300005459 | Ga0068867_100349977 | Ga0068867_1003499772 | 149 |
| 467 | 3300005466 | Ga0070685_10037569 | Ga0070685_100375694 | 149 |
| 468 | 3300005471 | Ga0070698_100547873 | Ga0070698_1005478732 | 149 |
| 469 | 3300005535 | Ga0070684_100007830 | Ga0070684_1000078305 | 149 |
| 470 | 3300005543 | Ga0070672_100037746 | Ga0070672_1000377462 | 149 |
| 471 | 3300005544 | Ga0070686_100002369 | Ga0070686_1000023697 | 149 |
| 472 | 3300005545 | Ga0070695_100634886 | Ga0070695_1006348862 | 149 |
| 473 | 3300005546 | Ga0070696_100078172 | Ga0070696_1000781722 | 149 |
| 474 | 3300005547 | Ga0070693_100589755 | Ga0070693_1005897552 | 149 |
| 475 | 3300005548 | Ga0070665_100088154 | Ga0070665_1000881543 | 149 |
| 476 | 3300005563 | Ga0068855_100845492 | Ga0068855_1008454922 | 149 |
| 477 | 3300005564 | Ga0070664_100004310 | Ga0070664_1000043105 | 149 |
| 478 | 3300005577 | Ga0068857_100034238 | Ga0068857_1000342382 | 149 |
| 479 | 3300005615 | Ga0070702_100018484 | Ga0070702_1000184842 | 149 |
| 480 | 3300005617 | Ga0068859_100000949 | Ga0068859_1000009494 | 149 |
| 481 | 3300005617 | Ga0068859_100680978 | Ga0068859_1006809782 | 149 |
| 482 | 3300005618 | Ga0068864_100006463 | Ga0068864_1000064634 | 149 |
| 483 | 3300005719 | Ga0068861_100012581 | Ga0068861_1000125815 | 149 |
| 484 | 3300005719 | Ga0068861_100066058 | Ga0068861_1000660584 | 149 |
| 485 | 3300005834 | Ga0068851_11025946 | Ga0068851_110259461 | 149 |
| 486 | 3300005841 | Ga0068863_100004762 | Ga0068863_1000047625 | 149 |
| 487 | 3300005842 | Ga0068858_100022887 | Ga0068858_1000228873 | 149 |
| 488 | 3300005843 | Ga0068860_100059220 | Ga0068860_1000592202 | 149 |
| 489 | 3300005844 | Ga0068862_100001400 | Ga0068862_10000140011 | 149 |
| 490 | 3300005844 | Ga0068862_100002538 | Ga0068862_10000253810 | 149 |
| 491 | 3300005844 | Ga0068862_100199701 | Ga0068862_1001997013 | 149 |
| 492 | 3300005844 | Ga0068862_100751655 | Ga0068862_1007516552 | 149 |
| 493 | 3300006237 | Ga0097621_100220104 | Ga0097621_1002201042 | 149 |
| 494 | 3300006844 | Ga0075428_100005586 | Ga0075428_10000558612 | 149 |
| 495 | 3300006844 | Ga0075428_100015259 | Ga0075428_1000152595 | 149 |
| 496 | 3300006844 | Ga0075428_100697375 | Ga0075428_1006973752 | 149 |
| 497 | 3300006846 | Ga0075430_100004165 | Ga0075430_1000041651 | 149 |
| 498 | 3300006846 | Ga0075430_100011047 | Ga0075430_1000110475 | 149 |
| 499 | 3300006846 | Ga0075430_101260008 | Ga0075430_1012600081 | 149 |
| 500 | 3300006847 | Ga0075431_100000318 | Ga0075431_10000031812 | 149 |
| 501 | 3300006847 | Ga0075431_100005721 | Ga0075431_10000572111 | 149 |
| 502 | 3300006847 | Ga0075431_100265923 | Ga0075431_1002659233 | 149 |
| 503 | 3300006847 | Ga0075431_100747149 | Ga0075431_1007471492 | 149 |
| 504 | 3300006847 | Ga0075431_100936976 | Ga0075431_1009369762 | 149 |
| 505 | 3300006852 | Ga0075433_10570026 | Ga0075433_105700262 | 149 |
| 506 | 3300006880 | Ga0075429_100001918 | Ga0075429_1000019185 | 149 |
| 507 | 3300006880 | Ga0075429_100046537 | Ga0075429_1000465374 | 149 |
| 508 | 3300006880 | Ga0075429_101232132 | Ga0075429_1012321321 | 149 |
| 509 | 3300006931 | Ga0097620_100000949 | Ga0097620_10000094929 | 149 |
| 510 | 3300006931 | Ga0097620_100680964 | Ga0097620_1006809642 | 149 |
| 511 | 3300006948 | Ga0099826_10089094 | Ga0099826_100890942 | 149 |
| 512 | 3300007265 | Ga0099794_10014358 | Ga0099794_100143583 | 149 |
| 513 | 3300007788 | Ga0099795_10000015 | Ga0099795_100000152 | 149 |
| 514 | 3300007788 | Ga0099795_10000075 | Ga0099795_100000755 | 149 |
| 515 | 3300009093 | Ga0105240_10123251 | Ga0105240_101232513 | 149 |
| 516 | 3300009094 | Ga0111539_10010862 | Ga0111539_100108626 | 149 |
| 517 | 3300009094 | Ga0111539_10012306 | Ga0111539_100123065 | 149 |
| 518 | 3300009094 | Ga0111539_10118141 | Ga0111539_101181413 | 149 |
| 519 | 3300009101 | Ga0105247_10306958 | Ga0105247_103069581 | 149 |
| 520 | 3300009147 | Ga0114129_10032479 | Ga0114129_100324795 | 149 |
| 521 | 3300009147 | Ga0114129_10066916 | Ga0114129_100669164 | 149 |
| 522 | 3300009174 | Ga0105241_10298613 | Ga0105241_102986132 | 149 |
| 523 | 3300009174 | Ga0105241_10318076 | Ga0105241_103180762 | 149 |
| 524 | 3300009177 | Ga0105248_10002211 | Ga0105248_100022115 | 149 |
| 525 | 3300009553 | Ga0105249_10016579 | Ga0105249_100165794 | 149 |
| 526 | 3300009553 | Ga0105249_10035648 | Ga0105249_100356484 | 149 |
| 527 | 3300009553 | Ga0105249_10512266 | Ga0105249_105122662 | 149 |
| 528 | 3300010159 | Ga0099796_10000044 | Ga0099796_1000004420 | 149 |
| 529 | 3300010159 | Ga0099796_10002250 | Ga0099796_100022504 | 149 |
| 530 | 3300010159 | Ga0099796_10023934 | Ga0099796_100239342 | 149 |
| 531 | 3300010375 | Ga0105239_10179328 | Ga0105239_101793282 | 149 |
| 532 | 3300011119 | Ga0105246_10737918 | Ga0105246_107379182 | 149 |
| 533 | 3300013105 | Ga0157369_10189001 | Ga0157369_101890013 | 149 |
| 534 | 3300013296 | Ga0157374_10945868 | Ga0157374_109458682 | 149 |
| 535 | 3300013306 | Ga0163162_11393311 | Ga0163162_113933111 | 149 |
| 536 | 3300013306 | Ga0163162_11736138 | Ga0163162_117361381 | 149 |
| 537 | 3300013307 | Ga0157372_10606954 | Ga0157372_106069542 | 149 |
| 538 | 3300013308 | Ga0157375_10008687 | Ga0157375_100086872 | 149 |
| 539 | 3300013308 | Ga0157375_10219556 | Ga0157375_102195562 | 149 |
| 540 | 3300014325 | Ga0163163_10012973 | Ga0163163_100129734 | 149 |
| 541 | 3300014326 | Ga0157380_10044056 | Ga0157380_100440564 | 149 |
| 542 | 3300014745 | Ga0157377_10007978 | Ga0157377_100079782 | 149 |
| 543 | 3300014745 | Ga0157377_10866286 | Ga0157377_108662861 | 149 |
| 544 | 3300025901 | Ga0207688_10018733 | Ga0207688_100187332 | 149 |
| 545 | 3300025901 | Ga0207688_10565796 | Ga0207688_105657962 | 149 |
| 546 | 3300025903 | Ga0207680_10177627 | Ga0207680_101776271 | 149 |
| 547 | 3300025907 | Ga0207645_10168452 | Ga0207645_101684522 | 149 |
| 548 | 3300025908 | Ga0207643_10360500 | Ga0207643_103605002 | 149 |
| 549 | 3300025910 | Ga0207684_10461319 | Ga0207684_104613192 | 149 |
| 550 | 3300025911 | Ga0207654_10196779 | Ga0207654_101967792 | 149 |
| 551 | 3300025912 | Ga0207707_10027997 | Ga0207707_100279974 | 149 |
| 552 | 3300025917 | Ga0207660_10084613 | Ga0207660_100846132 | 149 |
| 553 | 3300025918 | Ga0207662_10009609 | Ga0207662_100096093 | 149 |
| 554 | 3300025919 | Ga0207657_10523815 | Ga0207657_105238152 | 149 |
| 555 | 3300025920 | Ga0207649_10064552 | Ga0207649_100645522 | 149 |
| 556 | 3300025920 | Ga0207649_10351884 | Ga0207649_103518842 | 149 |
| 557 | 3300025921 | Ga0207652_10130779 | Ga0207652_101307793 | 149 |
| 558 | 3300025923 | Ga0207681_10012376 | Ga0207681_100123764 | 149 |
| 559 | 3300025925 | Ga0207650_10131099 | Ga0207650_101310991 | 149 |
| 560 | 3300025925 | Ga0207650_10167603 | Ga0207650_101676032 | 149 |
| 561 | 3300025926 | Ga0207659_10010114 | Ga0207659_100101142 | 149 |
| 562 | 3300025928 | Ga0207700_10087161 | Ga0207700_100871612 | 149 |
| 563 | 3300025931 | Ga0207644_10145980 | Ga0207644_101459801 | 149 |
| 564 | 3300025932 | Ga0207690_10025157 | Ga0207690_100251574 | 149 |
| 565 | 3300025933 | Ga0207706_10004055 | Ga0207706_1000405511 | 149 |
| 566 | 3300025933 | Ga0207706_10661564 | Ga0207706_106615642 | 149 |
| 567 | 3300025938 | Ga0207704_10011084 | Ga0207704_100110844 | 149 |
| 568 | 3300025940 | Ga0207691_10036071 | Ga0207691_100360714 | 149 |
| 569 | 3300025941 | Ga0207711_10679511 | Ga0207711_106795112 | 149 |
| 570 | 3300025942 | Ga0207689_10006698 | Ga0207689_100066983 | 149 |
| 571 | 3300025942 | Ga0207689_10307491 | Ga0207689_103074912 | 149 |
| 572 | 3300025944 | Ga0207661_11016531 | Ga0207661_110165312 | 149 |
| 573 | 3300025945 | Ga0207679_10040593 | Ga0207679_100405932 | 149 |
| 574 | 3300025945 | Ga0207679_10046570 | Ga0207679_100465702 | 149 |
| 575 | 3300025949 | Ga0207667_11238969 | Ga0207667_112389692 | 149 |
| 576 | 3300025960 | Ga0207651_10021146 | Ga0207651_100211464 | 149 |
| 577 | 3300025961 | Ga0207712_10011813 | Ga0207712_100118134 | 149 |
| 578 | 3300025961 | Ga0207712_10420199 | Ga0207712_104201992 | 149 |
| 579 | 3300025972 | Ga0207668_10006950 | Ga0207668_100069505 | 149 |
| 580 | 3300025986 | Ga0207658_10595958 | Ga0207658_105959582 | 149 |
| 581 | 3300026035 | Ga0207703_10059027 | Ga0207703_100590274 | 149 |
| 582 | 3300026067 | Ga0207678_10225851 | Ga0207678_102258512 | 149 |
| 583 | 3300026075 | Ga0207708_10507421 | Ga0207708_105074212 | 149 |
| 584 | 3300026088 | Ga0207641_10093434 | Ga0207641_100934344 | 149 |
| 585 | 3300026088 | Ga0207641_12236201 | Ga0207641_122362011 | 149 |
| 586 | 3300026089 | Ga0207648_10188118 | Ga0207648_101881183 | 149 |
| 587 | 3300026095 | Ga0207676_10007265 | Ga0207676_100072656 | 149 |
| 588 | 3300026116 | Ga0207674_10013468 | Ga0207674_100134685 | 149 |
| 589 | 3300026116 | Ga0207674_10403954 | Ga0207674_104039542 | 149 |
| 590 | 3300026118 | Ga0207675_100003162 | Ga0207675_10000316211 | 149 |
| 591 | 3300026118 | Ga0207675_100006059 | Ga0207675_1000060597 | 149 |
| 592 | 3300026118 | Ga0207675_100013963 | Ga0207675_1000139635 | 149 |
| 593 | 3300026121 | Ga0207683_10051793 | Ga0207683_100517934 | 149 |
| 594 | 3300027512 | Ga0209179_1000010 | Ga0209179_100001061 | 149 |
| 595 | 3300027512 | Ga0209179_1007430 | Ga0209179_10074302 | 149 |
| 596 | 3300027512 | Ga0209179_1027827 | Ga0209179_10278272 | 149 |
| 597 | 3300027666 | Ga0209282_1201044 | Ga0209282_12010442 | 149 |
| 598 | 3300027907 | Ga0207428_10003362 | Ga0207428_1000336210 | 149 |
| 599 | 3300028379 | Ga0268266_10110772 | Ga0268266_101107723 | 149 |
| 600 | 3300028379 | Ga0268266_10330724 | Ga0268266_103307242 | 149 |
| 601 | 3300028380 | Ga0268265_10005465 | Ga0268265_100054652 | 149 |
| 602 | 3300028380 | Ga0268265_10395545 | Ga0268265_103955452 | 149 |
| 603 | 3300028381 | Ga0268264_10041471 | Ga0268264_100414715 | 149 |
| 604 | 3300028381 | Ga0268264_11782931 | Ga0268264_117829312 | 149 |
| 605 | 3300031249 | Ga0265339_10260709 | Ga0265339_102607091 | 149 |
| 606 | 3300031507 | Ga0307509_10000365 | Ga0307509_100003652 | 149 |
| 607 | 3300031548 | Ga0307408_100063639 | Ga0307408_1000636392 | 149 |
| 608 | 3300031548 | Ga0307408_100105824 | Ga0307408_1001058242 | 149 |
| 609 | 3300031548 | Ga0307408_100112043 | Ga0307408_1001120431 | 149 |
| 610 | 3300031548 | Ga0307408_100125213 | Ga0307408_1001252132 | 149 |
| 611 | 3300031595 | Ga0265313_10112395 | Ga0265313_101123952 | 149 |
| 612 | 3300031727 | Ga0316576_10250249 | Ga0316576_102502492 | 149 |
| 613 | 3300031730 | Ga0307516_10000209 | Ga0307516_1000020949 | 149 |
| 614 | 3300031731 | Ga0307405_10180567 | Ga0307405_101805672 | 149 |
| 615 | 3300031731 | Ga0307405_10224512 | Ga0307405_102245122 | 149 |
| 616 | 3300031824 | Ga0307413_10713379 | Ga0307413_107133792 | 149 |
| 617 | 3300031824 | Ga0307413_10720323 | Ga0307413_107203232 | 149 |
| 618 | 3300031852 | Ga0307410_10065703 | Ga0307410_100657033 | 149 |
| 619 | 3300031852 | Ga0307410_10469405 | Ga0307410_104694052 | 149 |
| 620 | 3300031901 | Ga0307406_10016892 | Ga0307406_100168922 | 149 |
| 621 | 3300031901 | Ga0307406_10670790 | Ga0307406_106707902 | 149 |
| 622 | 3300031911 | Ga0307412_10126396 | Ga0307412_101263962 | 149 |
| 623 | 3300031911 | Ga0307412_11646992 | Ga0307412_116469921 | 149 |
| 624 | 3300031995 | Ga0307409_100834635 | Ga0307409_1008346352 | 149 |
| 625 | 3300032002 | Ga0307416_102436284 | Ga0307416_1024362842 | 149 |
| 626 | 3300032004 | Ga0307414_10821446 | Ga0307414_108214461 | 149 |
| 627 | 3300032005 | Ga0307411_10217655 | Ga0307411_102176552 | 149 |
| 628 | 3300032126 | Ga0307415_101112519 | Ga0307415_1011125191 | 149 |
| 629 | 3300032168 | Ga0316593_10000692 | Ga0316593_100006924 | 149 |
| 630 | 3300032168 | Ga0316593_10005117 | Ga0316593_100051174 | 149 |
| 631 | 3300032168 | Ga0316593_10039782 | Ga0316593_100397822 | 149 |
| 632 | 3300033524 | Ga0316592_1000870 | Ga0316592_10008704 | 149 |
| 633 | 3300033524 | Ga0316592_1002547 | Ga0316592_10025473 | 149 |
| 634 | 3300033529 | Ga0316587_1000489 | Ga0316587_10004895 | 149 |
| 635 | 3300033541 | Ga0316596_1000453 | Ga0316596_10004534 | 149 |
| 636 | 3300033541 | Ga0316596_1002939 | Ga0316596_10029393 | 149 |
| 637 | 3300035113 | Ga0373936_0031837 | Ga0373936_0031837_142_603 | 149 |
| 638 | 3300035121 | Ga0373960_0131864 | Ga0373960_0131864_82_531 | 149 |
| 639 | 3300035207 | Ga0373942_0065859 | Ga0373942_0065859_285_734 | 149 |
| 640 | 3300035691 | Ga0373931_0055499 | Ga0373931_0055499_551_1000 | 149 |
| 641 | 3300036647 | Ga0316582_0645729 | Ga0316582_0645729_97_570 | 149 |
| 642 | 3300036712 | Ga0316584_0150738 | Ga0316584_0150738_1226_1699 | 149 |
| 643 | 3300036712 | Ga0316584_0163799 | Ga0316584_0163799_1145_1618 | 149 |
| 644 | 3300038725 | Ga0400484_16028 | Ga0400484_16028_5993_6484 | 149 |
| 645 | 3300038726 | Ga0400490_14517 | Ga0400490_14517_923_1414 | 149 |
| 646 | 3300038726 | Ga0400490_31423 | Ga0400490_31423_5308_5781 | 149 |
| 647 | 3300038727 | Ga0400491_20315 | Ga0400491_20315_696_1169 | 149 |
| 648 | 3300038727 | Ga0400491_22710 | Ga0400491_22710_2985_3476 | 149 |
| 649 | 3300038735 | Ga0400485_11431 | Ga0400485_11431_97712_98185 | 149 |
| 650 | 3300038742 | Ga0400486_18012 | Ga0400486_18012_44031_44504 | 149 |
| 651 | 3300039062 | Ga0400483_004216 | Ga0400483_004216_221_685 | 149 |
| 652 | 3300039062 | Ga0400483_145565 | Ga0400483_145565_3769_4248 | 149 |
| 653 | 3300039062 | Ga0400483_178062 | Ga0400483_178062_5242_5706 | 149 |
| 654 | 3300039062 | Ga0400483_229521 | Ga0400483_229521_421_885 | 149 |
| 655 | 3300039062 | Ga0400483_268051 | Ga0400483_268051_15527_16006 | 149 |
| 656 | 3300039110 | Ga0400487_20104 | Ga0400487_20104_4712_5179 | 149 |
| 657 | 3300039110 | Ga0400487_24806 | Ga0400487_24806_29620_30087 | 149 |
| 658 | 3300039110 | Ga0400487_26238 | Ga0400487_26238_9904_10377 | 149 |
| 659 | 3300041453 | Ga0451797_0371857 | Ga0451797_0371857_919_1392 | 149 |
| 660 | 3300042002 | Ga0439442_046765 | Ga0439442_046765_74_526 | 149 |
| 661 | 3300042005 | Ga0439448_0028169 | Ga0439448_0028169_743_1195 | 149 |
| 662 | 3300042016 | Ga0439463_051671 | Ga0439463_051671_463_915 | 149 |
| 663 | 3300042118 | Ga0450914_040850 | Ga0450914_040850_113_565 | 149 |
| 664 | 3300042126 | Ga0450888_031509 | Ga0450888_031509_235_687 | 149 |
| 665 | 3300042439 | Ga0439464_0097903 | Ga0439464_0097903_273_725 | 149 |
| 666 | 3300042876 | Ga0451577_0041337 | Ga0451577_0041337_1756_2217 | 149 |
| 667 | 3300044683 | Ga0466965_0103131 | Ga0466965_0103131_925_1428 | 149 |
| 668 | 3300044712 | Ga0453684_0456139 | Ga0453684_0456139_579_1040 | 149 |
| 669 | 3300045051 | Ga0451576_0016225 | Ga0451576_0016225_5039_5488 | 149 |
| 670 | 3300045051 | Ga0451576_0212501 | Ga0451576_0212501_274_723 | 149 |
| 671 | 3300046460 | Ga0495638_0001192 | Ga0495638_0001192_5633_6142 | 149 |
| 672 | 3300046460 | Ga0495638_0477398 | Ga0495638_0477398_132_617 | 149 |
| 673 | 3300046471 | Ga0495650_0013647 | Ga0495650_0013647_1280_1798 | 149 |
| 674 | 3300046471 | Ga0495650_0208495 | Ga0495650_0208495_121_645 | 149 |
| 675 | 3300046519 | Ga0495632_0178624 | Ga0495632_0178624_112_591 | 149 |
| 676 | 3300046616 | Ga0495668_0243504 | Ga0495668_0243504_179_700 | 149 |
| 677 | 3300046660 | Ga0495625_0003539 | Ga0495625_0003539_13508_14017 | 149 |
| 678 | 3300046660 | Ga0495625_0239180 | Ga0495625_0239180_303_782 | 149 |
| 679 | 3300047320 | Ga0495672_0044208 | Ga0495672_0044208_1273_1767 | 149 |
| 680 | 3300048907 | Ga0496104_0163884 | Ga0496104_0163884_259_708 | 149 |
| 681 | 3300048911 | Ga0496108_0151347 | Ga0496108_0151347_200_649 | 149 |
| 682 | 3300048913 | Ga0496110_0528532 | Ga0496110_0528532_534_1016 | 149 |
| 683 | 3300048916 | Ga0496113_0101972 | Ga0496113_0101972_379_828 | 149 |
| 684 | 3300048917 | Ga0496114_0162159 | Ga0496114_0162159_585_1067 | 149 |
| 685 | 3300048924 | Ga0496121_0090713 | Ga0496121_0090713_1756_2265 | 149 |
| 686 | 3300049571 | Ga0501034_0188223 | Ga0501034_0188223_535_1017 | 149 |
| 687 | 3300049581 | Ga0501047_0323021 | Ga0501047_0323021_317_805 | 149 |
| 688 | 3300049591 | Ga0501075_0576176 | Ga0501075_0576176_71_526 | 149 |
| 689 | 3300049822 | Ga0501035_0196440 | Ga0501035_0196440_643_1122 | 149 |
| 690 | 3300049823 | Ga0501044_0617669 | Ga0501044_0617669_13_501 | 149 |
| 691 | 3300050507 | nmdc:mga05p37_2025310_c1 | nmdc:mga05p37_2025310_c1_44_517 | 149 |
| 692 | 3300050507 | nmdc:mga05p37_484178_c1 | nmdc:mga05p37_484178_c1_149_601 | 149 |
| 693 | 3300050507 | nmdc:mga05p37_51204_c1 | nmdc:mga05p37_51204_c1_1718_2167 | 149 |
| 694 | 3300050508 | nmdc:mga09592_3351_c1 | nmdc:mga09592_3351_c1_11816_12265 | 149 |
| 695 | 3300050508 | nmdc:mga09592_414837_c1 | nmdc:mga09592_414837_c1_57_530 | 149 |
| 696 | 3300050508 | nmdc:mga09592_98502_c1 | nmdc:mga09592_98502_c1_1025_1477 | 149 |
| 697 | 3300050509 | nmdc:mga0qj67_1124394_c1 | nmdc:mga0qj67_1124394_c1_63_521 | 149 |
| 698 | 3300050509 | nmdc:mga0qj67_17344_c1 | nmdc:mga0qj67_17344_c1_870_1319 | 149 |
| 699 | 3300050509 | nmdc:mga0qj67_3821_c1 | nmdc:mga0qj67_3821_c1_6946_7398 | 149 |
| 700 | 3300050509 | nmdc:mga0qj67_931487_c1 | nmdc:mga0qj67_931487_c1_171_656 | 149 |
| 701 | 3300050510 | nmdc:mga06r32_1129060_c1 | nmdc:mga06r32_1129060_c1_24_473 | 149 |
| 702 | 3300050510 | nmdc:mga06r32_22643_c1 | nmdc:mga06r32_22643_c1_3278_3727 | 149 |
| 703 | 3300050510 | nmdc:mga06r32_23_c1 | nmdc:mga06r32_23_c1_12005_12454 | 149 |
| 704 | 3300050510 | nmdc:mga06r32_3897_c1 | nmdc:mga06r32_3897_c1_7878_8330 | 149 |
| 705 | 3300050511 | nmdc:mga08y16_10408_c1 | nmdc:mga08y16_10408_c1_138_590 | 149 |
| 706 | 3300050511 | nmdc:mga08y16_12878_c1 | nmdc:mga08y16_12878_c1_3624_4073 | 149 |
| 707 | 3300050512 | nmdc:mga0n895_316603_c1 | nmdc:mga0n895_316603_c1_1035_1484 | 149 |
| 708 | 3300050515 | nmdc:mga0a205_380733_c1 | nmdc:mga0a205_380733_c1_398_850 | 149 |
| 709 | 3300053088 | Ga0500644_0233730 | Ga0500644_0233730_250_756 | 149 |
| 710 | 3300053093 | Ga0500651_0577865 | Ga0500651_0577865_65_541 | 149 |
| 711 | 3300053109 | Ga0500569_013363 | Ga0500569_013363_385_843 | 149 |
| 712 | 3300053130 | Ga0500642_0095320 | Ga0500642_0095320_151_672 | 149 |
| 713 | 3300053139 | Ga0500568_0119260 | Ga0500568_0119260_277_774 | 149 |
| 714 | 3300053156 | Ga0500622_0001473 | Ga0500622_0001473_17935_18432 | 149 |
| 715 | 3300053156 | Ga0500622_0013289 | Ga0500622_0013289_2370_2867 | 149 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4h4g-assembly1.cif.gz_B | crystal structure of (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase from burkholderia thailandensis e264 | 0.9485 | 7 | 144 |
| 5buw-assembly1.cif.gz_A | crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from yersinia pestis | 0.944 | 6 | 148 |
| 4h4g-assembly1.cif.gz_A | crystal structure of (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase from burkholderia thailandensis e264 | 0.9422 | 7 | 149 |
| 4h4g-assembly1.cif.gz_I | crystal structure of (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase from burkholderia thailandensis e264 | 0.9403 | 5 | 148 |
| 5buy-assembly1.cif.gz_F | crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from francisella tularensis | 0.9389 | 5 | 146 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4h4gA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9422 | 7 | 149 | 3.10.129.10 |
| 5buyF00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9389 | 5 | 146 | 3.10.129.10 |
| 4h4gA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9355 | 7 | 149 | 3.10.129.10 |
| 5buyF00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9255 | 5 | 146 | 3.10.129.10 |
| 3d6xF00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9249 | 7 | 145 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534II55-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) | 0.9608 | 1 | 141 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0019171 |
| AF-A0A7S1MYI3-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ | 0.9585 | 23 | 134 |
GO:0016829
|
| AF-A0A317CP42-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) | 0.9581 | 5 | 149 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0019171 |
| AF-A0A6N6THU7-F1-model_v4 | Multifunctional fusion protein [Includes: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase); UDP-3-O-acylglucosamine N-acyltransferase (EC 2.3.1.191)] | 0.9577 | 4 | 146 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0016410 GO:0019171 |
| AF-A0A1J5SG54-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.59) | 0.957 | 5 | 146 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0019171 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar