F476995

General Info

Members Datasets Scaffolds Average Seq Length
715 312 710 152

Family's Representative Sequence

Representative Sequence 3300031507|Ga0307509_10000365|Ga0307509_100003652
Length 173
Sequence VADEQQPTLTPPASDAPPSVDNNAMDINEVMRRLPHRYPFLLVDRVLECHSGKTIRALKNVTVNEPYFPGHFPHRPVLPGVIILEALAQTAGILAFVTAGVYPDEHRQLYFVGIDKARFRRPVVPGDQLILKATLERSLRGIWKFSTVAEVNGEEATSAEMMVAPGETAAEKK

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
3 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
4 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
5 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
179 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
192 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
211 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
212 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
213 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
214 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
219 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
220 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
221 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
222 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
223 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
224 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
225 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
226 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
227 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
228 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
229 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
230 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
231 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
232 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
233 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
234 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
235 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
236 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
237 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
238 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
239 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
240 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
241 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
242 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
243 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
246 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
247 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
254 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
255 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
256 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
275 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
286 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
296 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
297 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
298 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
299 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
300 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
301 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
302 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
303 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
304 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
305 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
306 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
307 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
308 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
309 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
310 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
311 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
312 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 1.26
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.24
Nodule 0.28
Rhizoplane 2.94
Rhizosphere 86.57
Stem 0
Stem Tuber 0
Unclassified 7.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10222308 3300005288 Bacteria 837
2 Ga0065712_10089595 3300005290 Bacteria 2459
3 Ga0065715_10095987 3300005293 Bacteria 3966
4 Ga0065707_10088639 3300005295 Bacteria 4597
5 Ga0070658_10168924 3300005327 Bacteria 1837
6 Ga0070658_10241175 3300005327 Bacteria 1532
7 Ga0070676_10431059 3300005328 Bacteria 923
8 Ga0070683_100035698 3300005329 Bacteria 4544
9 Ga0070683_100650461 3300005329 Bacteria 1009
10 Ga0070690_100027547 3300005330 Bacteria 3513
11 Ga0070670_100000015 3300005331 Bacteria 228819
12 Ga0070670_100006956 3300005331 Bacteria 9588
13 Ga0070670_100047907 3300005331 Bacteria 3678
14 Ga0070670_100547530 3300005331 Bacteria 1032
15 Ga0070677_10110098 3300005333 Bacteria 1228
16 Ga0068869_100003904 3300005334 Bacteria 9197
17 Ga0068869_100027255 3300005334 Bacteria 3981
18 Ga0068869_100329772 3300005334 Bacteria 1240
19 Ga0068869_101183805 3300005334 Bacteria 671
20 Ga0070666_10000912 3300005335 Bacteria 17915
21 Ga0070666_10030935 3300005335 Bacteria 3530
22 Ga0070666_10041927 3300005335 Bacteria 3060
23 Ga0070666_10227926 3300005335 Bacteria 1315
24 Ga0070666_10250811 3300005335 Bacteria 1253
25 Ga0070680_100407771 3300005336 Bacteria 1159
26 Ga0068868_100007318 3300005338 Bacteria 7857
27 Ga0068868_100180742 3300005338 Bacteria 1750
28 Ga0068868_100209917 3300005338 Bacteria 1627
29 Ga0068868_101234355 3300005338 Bacteria 692
30 Ga0070689_100004887 3300005340 Bacteria 9093
31 Ga0070687_100043515 3300005343 Bacteria 2282
32 Ga0070687_100585443 3300005343 Bacteria 764
33 Ga0070661_100018471 3300005344 Bacteria 4956
34 Ga0070661_100157790 3300005344 Bacteria 1717
35 Ga0070661_100567428 3300005344 Bacteria 915
36 Ga0070692_10538689 3300005345 Bacteria 763
37 Ga0070668_100002261 3300005347 Bacteria 14179
38 Ga0070668_100356678 3300005347 Bacteria 1239
39 Ga0070669_100002436 3300005353 Bacteria 13474
40 Ga0070669_100037306 3300005353 Bacteria 3526
41 Ga0070669_101269602 3300005353 Bacteria 637
42 Ga0070675_100066009 3300005354 Bacteria 2992
43 Ga0070675_100067476 3300005354 Bacteria 2960
44 Ga0070675_100335136 3300005354 Bacteria 1339
45 Ga0070675_100740971 3300005354 Bacteria 896
46 Ga0070671_100000013 3300005355 Bacteria 173287
47 Ga0070671_100021032 3300005355 Bacteria 5325
48 Ga0070671_100067376 3300005355 Bacteria 2984
49 Ga0070671_100193271 3300005355 Bacteria 1725
50 Ga0070671_100837471 3300005355 Bacteria 802
51 Ga0070673_100005910 3300005364 Bacteria 7901
52 Ga0070673_100010204 3300005364 Bacteria 6345
53 Ga0070673_100097039 3300005364 Bacteria 2420
54 Ga0070673_100354037 3300005364 Bacteria 1304
55 Ga0070688_100004864 3300005365 Bacteria 7027
56 Ga0070688_100024544 3300005365 Bacteria 3559
57 Ga0070688_100306842 3300005365 Bacteria 1149
58 Ga0070688_101100106 3300005365 Bacteria 635
59 Ga0070659_100327620 3300005366 Bacteria 1281
60 Ga0070667_100000015 3300005367 Bacteria 238203
61 Ga0070667_100003903 3300005367 Bacteria 12661
62 Ga0070667_100038246 3300005367 Bacteria 4023
63 Ga0070667_100292441 3300005367 Bacteria 1465
64 Ga0070667_100311078 3300005367 Bacteria 1420
65 Ga0070709_10103513 3300005434 Bacteria 1901
66 Ga0070714_100018737 3300005435 Bacteria 5631
67 Ga0070714_100061413 3300005435 Bacteria 3228
68 Ga0070714_100064330 3300005435 Bacteria 3156
69 Ga0070713_100510789 3300005436 Bacteria 1135
70 Ga0070701_10105706 3300005438 Bacteria 1566
71 Ga0070705_100269645 3300005440 Bacteria 1205
72 Ga0070705_101240372 3300005440 Bacteria 616
73 Ga0070705_101762899 3300005440 Bacteria 524
74 Ga0070700_100338743 3300005441 Bacteria 1111
75 Ga0070694_100005376 3300005444 Bacteria 7748
76 Ga0070694_100256120 3300005444 Bacteria 1326
77 Ga0070694_100302523 3300005444 Bacteria 1226
78 Ga0070663_100714354 3300005455 Bacteria 853
79 Ga0070678_100052998 3300005456 Bacteria 2948
80 Ga0070678_100084624 3300005456 Bacteria 2415
81 Ga0070678_100130988 3300005456 Bacteria 1992
82 Ga0070662_100158230 3300005457 Bacteria 1770
83 Ga0070662_100161987 3300005457 Bacteria 1750
84 Ga0070681_10004922 3300005458 Bacteria 12830
85 Ga0070681_10236206 3300005458 Bacteria 1742
86 Ga0070681_10523724 3300005458 Bacteria 1099
87 Ga0070681_10763045 3300005458 Bacteria 884
88 Ga0068867_100036380 3300005459 Bacteria 3574
89 Ga0068867_100349977 3300005459 Bacteria 1232
90 Ga0068867_101081861 3300005459 Bacteria 731
91 Ga0068867_101797744 3300005459 Bacteria 576
92 Ga0070685_10000004 3300005466 Bacteria 246215
93 Ga0070685_10037569 3300005466 Bacteria 2743
94 Ga0070685_10062017 3300005466 Bacteria 2191
95 Ga0070685_10710997 3300005466 Bacteria 733
96 Ga0070706_100287774 3300005467 Bacteria 1533
97 Ga0070706_100764759 3300005467 Bacteria 895
98 Ga0070698_100547873 3300005471 Bacteria 1096
99 Ga0070699_100023690 3300005518 Bacteria 5289
100 Ga0070684_100007830 3300005535 Bacteria 8333
101 Ga0070684_100227634 3300005535 Bacteria 1702
102 Ga0070697_100008352 3300005536 Bacteria 8079
103 Ga0070697_100452979 3300005536 Bacteria 1118
104 Ga0070697_100500031 3300005536 Bacteria 1063
105 Ga0068853_100008688 3300005539 Bacteria 8170
106 Ga0068853_100794052 3300005539 Bacteria 906
107 Ga0070672_100037746 3300005543 Bacteria 3687
108 Ga0070686_100002369 3300005544 Bacteria 10385
109 Ga0070695_100004111 3300005545 Bacteria 8511
110 Ga0070695_100634886 3300005545 Bacteria 842
111 Ga0070695_100778115 3300005545 Bacteria 765
112 Ga0070696_100007424 3300005546 Bacteria 7329
113 Ga0070696_100078172 3300005546 Bacteria 2339
114 Ga0070696_100124509 3300005546 Bacteria 1869
115 Ga0070693_100589755 3300005547 Bacteria 801
116 Ga0070693_101049589 3300005547 Bacteria 619
117 Ga0070665_100010167 3300005548 Bacteria 9515
118 Ga0070665_100088154 3300005548 Bacteria 3109
119 Ga0070665_100094876 3300005548 Bacteria 2988
120 Ga0070665_100146477 3300005548 Bacteria 2364
121 Ga0070704_100130014 3300005549 Bacteria 1950
122 Ga0068855_100201866 3300005563 Bacteria 2238
123 Ga0068855_100845492 3300005563 Bacteria 970
124 Ga0070664_100004310 3300005564 Bacteria 11436
125 Ga0070664_100022229 3300005564 Bacteria 5230
126 Ga0068857_100029896 3300005577 Bacteria 4808
127 Ga0068857_100034238 3300005577 Bacteria 4492
128 Ga0068854_100010299 3300005578 Bacteria 6059
129 Ga0068856_100526522 3300005614 Bacteria 1203
130 Ga0068856_100688698 3300005614 Bacteria 1043
131 Ga0070702_100018484 3300005615 Bacteria 3617
132 Ga0070702_100122629 3300005615 Bacteria 1629
133 Ga0070702_100189440 3300005615 Bacteria 1352
134 Ga0070702_100374531 3300005615 Bacteria 1010
135 Ga0068852_100005797 3300005616 Bacteria 8870
136 Ga0068859_100000949 3300005617 Bacteria 29651
137 Ga0068859_100011061 3300005617 Bacteria 9076
138 Ga0068859_100024498 3300005617 Bacteria 6055
139 Ga0068859_100096921 3300005617 Bacteria 3002
140 Ga0068859_100210935 3300005617 Bacteria 2028
141 Ga0068859_100680978 3300005617 Bacteria 1120
142 Ga0068864_100000072 3300005618 Bacteria 110066
143 Ga0068864_100006463 3300005618 Bacteria 9602
144 Ga0068864_100017395 3300005618 Bacteria 5995
145 Ga0068864_100143466 3300005618 Bacteria 2156
146 Ga0068864_100247521 3300005618 Bacteria 1653
147 Ga0068866_10108657 3300005718 Bacteria 1543
148 Ga0068866_10120592 3300005718 Bacteria 1477
149 Ga0068861_100012581 3300005719 Bacteria 5904
150 Ga0068861_100066058 3300005719 Bacteria 2787
151 Ga0068851_10090016 3300005834 Bacteria 1614
152 Ga0068851_11025946 3300005834 Bacteria 521
153 Ga0068870_10282549 3300005840 Bacteria 1041
154 Ga0068863_100004762 3300005841 Bacteria 13370
155 Ga0068863_100207589 3300005841 Bacteria 1886
156 Ga0068863_100229975 3300005841 Bacteria 1788
157 Ga0068863_102351757 3300005841 Bacteria 542
158 Ga0068858_100006370 3300005842 Bacteria 11494
159 Ga0068858_100022887 3300005842 Bacteria 5829
160 Ga0068858_100059515 3300005842 Bacteria 3530
161 Ga0068858_100276436 3300005842 Bacteria 1599
162 Ga0068858_100347079 3300005842 Bacteria 1421
163 Ga0068858_100584181 3300005842 Bacteria 1083
164 Ga0068860_100000271 3300005843 Bacteria 75530
165 Ga0068860_100019058 3300005843 Bacteria 6662
166 Ga0068860_100059220 3300005843 Bacteria 3642
167 Ga0068862_100001400 3300005844 Bacteria 22361
168 Ga0068862_100002538 3300005844 Bacteria 16147
169 Ga0068862_100002888 3300005844 Bacteria 15034
170 Ga0068862_100056332 3300005844 Bacteria 3368
171 Ga0068862_100199701 3300005844 Bacteria 1803
172 Ga0068862_100748968 3300005844 Bacteria 950
173 Ga0068862_100751655 3300005844 Bacteria 949
174 Ga0068862_100953616 3300005844 Bacteria 846
175 Ga0068862_101270022 3300005844 Bacteria 737
176 Ga0081539_10001441 3300005985 Bacteria 40731
177 Ga0075432_10299323 3300006058 Bacteria 667
178 Ga0070716_100250656 3300006173 Bacteria 1206
179 Ga0070716_100734426 3300006173 Bacteria 758
180 Ga0070712_100108706 3300006175 Bacteria 2065
181 Ga0097621_100003683 3300006237 Bacteria 10596
182 Ga0097621_100056300 3300006237 Bacteria 3212
183 Ga0097621_100220104 3300006237 Bacteria 1654
184 Ga0097621_100578321 3300006237 Bacteria 1025
185 Ga0068871_100024415 3300006358 Bacteria 4688
186 Ga0068871_100029924 3300006358 Bacteria 4283
187 Ga0068871_100289780 3300006358 Bacteria 1434
188 Ga0075428_100005586 3300006844 Bacteria 13968
189 Ga0075428_100010558 3300006844 Bacteria 10266
190 Ga0075428_100015259 3300006844 Bacteria 8521
191 Ga0075428_100697375 3300006844 Bacteria 1082
192 Ga0075428_100699555 3300006844 Bacteria 1080
193 Ga0075430_100004165 3300006846 Bacteria 12204
194 Ga0075430_100011047 3300006846 Bacteria 7651
195 Ga0075430_100289900 3300006846 Bacteria 1354
196 Ga0075430_101260008 3300006846 Bacteria 608
197 Ga0075431_100000318 3300006847 Bacteria 37976
198 Ga0075431_100005721 3300006847 Bacteria 12288
199 Ga0075431_100265923 3300006847 Bacteria 1739
200 Ga0075431_100747149 3300006847 Bacteria 954
201 Ga0075431_100936976 3300006847 Bacteria 835
202 Ga0075431_101009158 3300006847 Bacteria 799
203 Ga0075433_10463383 3300006852 Bacteria 1117
204 Ga0075433_10570026 3300006852 Bacteria 995
205 Ga0075434_100000004 3300006871 Bacteria 112839
206 Ga0075434_100321078 3300006871 Bacteria 1569
207 Ga0075429_100001918 3300006880 Bacteria 17254
208 Ga0075429_100046537 3300006880 Bacteria 3775
209 Ga0075429_101232132 3300006880 Bacteria 653
210 Ga0068865_100017384 3300006881 Bacteria 4626
211 Ga0068865_100359048 3300006881 Bacteria 1182
212 Ga0075436_100005388 3300006914 Bacteria 8806
213 Ga0075436_100005406 3300006914 Bacteria 8788
214 Ga0075436_100021279 3300006914 Bacteria 4451
215 Ga0075436_100077166 3300006914 Bacteria 2308
216 Ga0075436_100106811 3300006914 Bacteria 1953
217 Ga0075436_100285853 3300006914 Bacteria 1180
218 Ga0097620_100000949 3300006931 Bacteria 29651
219 Ga0097620_100011061 3300006931 Bacteria 9076
220 Ga0097620_100024498 3300006931 Bacteria 6055
221 Ga0097620_100096924 3300006931 Bacteria 3002
222 Ga0097620_100210923 3300006931 Bacteria 2028
223 Ga0097620_100680964 3300006931 Bacteria 1120
224 Ga0099826_10089094 3300006948 Bacteria 1893
225 Ga0075435_100018356 3300007076 Bacteria 5318
226 Ga0075435_100224993 3300007076 Bacteria 1593
227 Ga0075435_100716270 3300007076 Bacteria 870
228 Ga0099794_10014358 3300007265 Bacteria 3469
229 Ga0099795_10000015 3300007788 Bacteria 64331
230 Ga0099795_10000075 3300007788 Bacteria 17387
231 Ga0105240_10123251 3300009093 Bacteria 3118
232 Ga0111539_10010862 3300009094 Bacteria 11460
233 Ga0111539_10012306 3300009094 Bacteria 10722
234 Ga0111539_10118141 3300009094 Bacteria 3108
235 Ga0111539_10399075 3300009094 Bacteria 1602
236 Ga0111539_11167520 3300009094 Bacteria 894
237 Ga0105245_10001896 3300009098 Bacteria 18996
238 Ga0105245_10006356 3300009098 Bacteria 10396
239 Ga0105245_10539227 3300009098 Bacteria 1188
240 Ga0105245_11110947 3300009098 Bacteria 837
241 Ga0105247_10089033 3300009101 Bacteria 1957
242 Ga0105247_10140548 3300009101 Bacteria 1582
243 Ga0105247_10302504 3300009101 Bacteria 1110
244 Ga0105247_10306958 3300009101 Bacteria 1103
245 Ga0114129_10032479 3300009147 Bacteria 7378
246 Ga0114129_10066916 3300009147 Bacteria 5010
247 Ga0114129_10190939 3300009147 Bacteria 2781
248 Ga0114129_11550813 3300009147 Bacteria 812
249 Ga0105241_10298613 3300009174 Bacteria 1382
250 Ga0105241_10318076 3300009174 Bacteria 1341
251 Ga0105242_10004198 3300009176 Bacteria 11229
252 Ga0105242_10228377 3300009176 Bacteria 1667
253 Ga0105242_10411292 3300009176 Bacteria 1265
254 Ga0105248_10002211 3300009177 Bacteria 21553
255 Ga0105248_10002407 3300009177 Bacteria 20777
256 Ga0105248_10003549 3300009177 Bacteria 17287
257 Ga0105248_10024742 3300009177 Bacteria 6677
258 Ga0105248_10088888 3300009177 Bacteria 3477
259 Ga0105248_11301361 3300009177 Bacteria 822
260 Ga0105238_10461206 3300009551 Bacteria 1268
261 Ga0105249_10016579 3300009553 Bacteria 6538
262 Ga0105249_10035648 3300009553 Bacteria 4511
263 Ga0105249_10095997 3300009553 Bacteria 2780
264 Ga0105249_10512266 3300009553 Bacteria 1246
265 Ga0105249_11200792 3300009553 Bacteria 829
266 Ga0099796_10000044 3300010159 Bacteria 24507
267 Ga0099796_10002250 3300010159 Bacteria 4188
268 Ga0099796_10023934 3300010159 Bacteria 1912
269 Ga0105239_10179328 3300010375 Bacteria 2370
270 Ga0105239_11568303 3300010375 Bacteria 761
271 Ga0105246_10737918 3300011119 Bacteria 867
272 Ga0157369_10189001 3300013105 Bacteria 2164
273 Ga0157374_10013613 3300013296 Bacteria 7105
274 Ga0157374_10045246 3300013296 Bacteria 4073
275 Ga0157374_10080636 3300013296 Bacteria 3087
276 Ga0157374_10945868 3300013296 Bacteria 880
277 Ga0157378_10003991 3300013297 Bacteria 13038
278 Ga0157378_10012745 3300013297 Bacteria 7359
279 Ga0163162_10056038 3300013306 Bacteria 3970
280 Ga0163162_10172493 3300013306 Bacteria 2288
281 Ga0163162_11393311 3300013306 Bacteria 798
282 Ga0163162_11552488 3300013306 Bacteria 755
283 Ga0163162_11736138 3300013306 Bacteria 713
284 Ga0157372_10606954 3300013307 Bacteria 1275
285 Ga0157375_10008687 3300013308 Bacteria 8903
286 Ga0157375_10052471 3300013308 Bacteria 4009
287 Ga0157375_10071548 3300013308 Bacteria 3482
288 Ga0157375_10219556 3300013308 Bacteria 2059
289 Ga0163163_10000118 3300014325 Bacteria 84379
290 Ga0163163_10012973 3300014325 Bacteria 7611
291 Ga0163163_10244182 3300014325 Bacteria 1846
292 Ga0157380_10044056 3300014326 Bacteria 3495
293 Ga0157380_10587789 3300014326 Bacteria 1099
294 Ga0157380_11139784 3300014326 Bacteria 821
295 Ga0157377_10007978 3300014745 Bacteria 5142
296 Ga0157377_10066758 3300014745 Bacteria 2069
297 Ga0157377_10866286 3300014745 Bacteria 672
298 Ga0157377_11279456 3300014745 Bacteria 572
299 Ga0157379_10004582 3300014968 Bacteria 11860
300 Ga0157379_10348196 3300014968 Bacteria 1356
301 Ga0157379_10725484 3300014968 Bacteria 934
302 Ga0157376_10000400 3300014969 Bacteria 28297
303 Ga0157376_10011903 3300014969 Bacteria 6433
304 Ga0157376_10020696 3300014969 Bacteria 5097
305 Ga0163161_10169842 3300017792 Bacteria 1667
306 Ga0213872_10016834 3300021361 Bacteria 3388
307 Ga0213872_10053869 3300021361 Bacteria 1824
308 Ga0213872_10076206 3300021361 Bacteria 1509
309 Ga0207697_10144180 3300025315 Bacteria 1034
310 Ga0207656_10061076 3300025321 Bacteria 1653
311 Ga0207642_10029074 3300025899 Bacteria 2285
312 Ga0207642_10104145 3300025899 Bacteria 1431
313 Ga0207688_10018733 3300025901 Bacteria 3764
314 Ga0207688_10565796 3300025901 Bacteria 715
315 Ga0207680_10018290 3300025903 Bacteria 3721
316 Ga0207680_10064240 3300025903 Bacteria 2250
317 Ga0207680_10177627 3300025903 Bacteria 1438
318 Ga0207680_10187724 3300025903 Bacteria 1401
319 Ga0207699_10335113 3300025906 Bacteria 1064
320 Ga0207645_10168452 3300025907 Bacteria 1435
321 Ga0207643_10316863 3300025908 Bacteria 973
322 Ga0207643_10360500 3300025908 Bacteria 914
323 Ga0207643_10490146 3300025908 Bacteria 785
324 Ga0207705_10061461 3300025909 Bacteria 2714
325 Ga0207684_10461319 3300025910 Bacteria 1090
326 Ga0207654_10073478 3300025911 Bacteria 2038
327 Ga0207654_10196779 3300025911 Bacteria 1325
328 Ga0207707_10027997 3300025912 Bacteria 4927
329 Ga0207707_10035257 3300025912 Bacteria 4376
330 Ga0207707_10234875 3300025912 Bacteria 1595
331 Ga0207707_11113047 3300025912 Bacteria 643
332 Ga0207671_10025884 3300025914 Bacteria 4403
333 Ga0207660_10084613 3300025917 Bacteria 2338
334 Ga0207660_10333540 3300025917 Bacteria 1213
335 Ga0207662_10009609 3300025918 Bacteria 5329
336 Ga0207662_10405553 3300025918 Bacteria 925
337 Ga0207657_10523815 3300025919 Bacteria 928
338 Ga0207649_10040772 3300025920 Bacteria 2824
339 Ga0207649_10064552 3300025920 Bacteria 2315
340 Ga0207649_10351884 3300025920 Bacteria 1090
341 Ga0207649_10497559 3300025920 Bacteria 927
342 Ga0207652_10130779 3300025921 Bacteria 2239
343 Ga0207681_10002041 3300025923 Bacteria 12952
344 Ga0207681_10012376 3300025923 Bacteria 5265
345 Ga0207681_10423423 3300025923 Bacteria 1079
346 Ga0207650_10000013 3300025925 Bacteria 409471
347 Ga0207650_10131099 3300025925 Bacteria 1961
348 Ga0207650_10167603 3300025925 Bacteria 1744
349 Ga0207659_10010114 3300025926 Bacteria 5913
350 Ga0207659_10039083 3300025926 Bacteria 3306
351 Ga0207659_10224356 3300025926 Bacteria 1512
352 Ga0207687_10296108 3300025927 Bacteria 1302
353 Ga0207687_10831231 3300025927 Bacteria 789
354 Ga0207700_10087161 3300025928 Bacteria 2455
355 Ga0207664_10020611 3300025929 Bacteria 4889
356 Ga0207664_10057026 3300025929 Bacteria 3104
357 Ga0207664_10317217 3300025929 Bacteria 1375
358 Ga0207644_10000015 3300025931 Bacteria 179880
359 Ga0207644_10020618 3300025931 Bacteria 4485
360 Ga0207644_10145980 3300025931 Bacteria 1826
361 Ga0207644_10218041 3300025931 Bacteria 1511
362 Ga0207690_10025157 3300025932 Bacteria 3734
363 Ga0207690_10393410 3300025932 Bacteria 1104
364 Ga0207706_10004055 3300025933 Bacteria 13854
365 Ga0207706_10132128 3300025933 Bacteria 2195
366 Ga0207706_10661564 3300025933 Bacteria 894
367 Ga0207709_10813517 3300025935 Bacteria 755
368 Ga0207704_10011084 3300025938 Bacteria 4424
369 Ga0207704_10073923 3300025938 Bacteria 2173
370 Ga0207665_10735341 3300025939 Bacteria 777
371 Ga0207691_10007106 3300025940 Bacteria 10808
372 Ga0207691_10036071 3300025940 Bacteria 4583
373 Ga0207711_10000103 3300025941 Bacteria 90172
374 Ga0207711_10000277 3300025941 Bacteria 55359
375 Ga0207711_10004938 3300025941 Bacteria 11327
376 Ga0207711_10011788 3300025941 Bacteria 7263
377 Ga0207711_10427228 3300025941 Bacteria 1233
378 Ga0207711_10679511 3300025941 Bacteria 960
379 Ga0207689_10000974 3300025942 Bacteria 27470
380 Ga0207689_10006698 3300025942 Bacteria 10164
381 Ga0207689_10307491 3300025942 Bacteria 1314
382 Ga0207689_11368155 3300025942 Bacteria 594
383 Ga0207661_10183543 3300025944 Bacteria 1829
384 Ga0207661_11016531 3300025944 Bacteria 763
385 Ga0207679_10005967 3300025945 Bacteria 7665
386 Ga0207679_10040593 3300025945 Bacteria 3333
387 Ga0207679_10046570 3300025945 Bacteria 3144
388 Ga0207667_10085553 3300025949 Bacteria 3264
389 Ga0207667_11238969 3300025949 Bacteria 724
390 Ga0207651_10021146 3300025960 Bacteria 3946
391 Ga0207651_10114154 3300025960 Bacteria 2034
392 Ga0207651_10140782 3300025960 Bacteria 1863
393 Ga0207651_10551560 3300025960 Bacteria 1002
394 Ga0207712_10011813 3300025961 Bacteria 5568
395 Ga0207712_10127992 3300025961 Bacteria 1931
396 Ga0207712_10420199 3300025961 Bacteria 1128
397 Ga0207668_10006950 3300025972 Bacteria 6717
398 Ga0207668_10321190 3300025972 Bacteria 1285
399 Ga0207640_10068365 3300025981 Bacteria 2380
400 Ga0207658_10000005 3300025986 Bacteria 408341
401 Ga0207658_10020040 3300025986 Bacteria 4629
402 Ga0207658_10125281 3300025986 Bacteria 2055
403 Ga0207658_10595958 3300025986 Bacteria 992
404 Ga0207677_10031535 3300026023 Bacteria 3395
405 Ga0207677_10154054 3300026023 Bacteria 1777
406 Ga0207677_10214924 3300026023 Bacteria 1538
407 Ga0207703_10005017 3300026035 Bacteria 10732
408 Ga0207703_10053560 3300026035 Bacteria 3279
409 Ga0207703_10059027 3300026035 Bacteria 3134
410 Ga0207703_10069201 3300026035 Bacteria 2910
411 Ga0207703_10475782 3300026035 Bacteria 1170
412 Ga0207639_10028853 3300026041 Bacteria 4056
413 Ga0207639_11436094 3300026041 Bacteria 647
414 Ga0207678_10225851 3300026067 Bacteria 1603
415 Ga0207708_10507421 3300026075 Bacteria 1012
416 Ga0207702_11191236 3300026078 Bacteria 756
417 Ga0207641_10022587 3300026088 Bacteria 5178
418 Ga0207641_10093434 3300026088 Bacteria 2636
419 Ga0207641_10118468 3300026088 Bacteria 2359
420 Ga0207641_10235840 3300026088 Bacteria 1702
421 Ga0207641_10272783 3300026088 Bacteria 1588
422 Ga0207641_12236201 3300026088 Bacteria 547
423 Ga0207648_10032325 3300026089 Bacteria 4620
424 Ga0207648_10188118 3300026089 Bacteria 1829
425 Ga0207648_10749717 3300026089 Bacteria 907
426 Ga0207648_10939727 3300026089 Bacteria 809
427 Ga0207676_10000010 3300026095 Bacteria 519402
428 Ga0207676_10007265 3300026095 Bacteria 7847
429 Ga0207676_10012652 3300026095 Bacteria 6052
430 Ga0207676_10328609 3300026095 Bacteria 1406
431 Ga0207674_10013468 3300026116 Bacteria 9071
432 Ga0207674_10020988 3300026116 Bacteria 7045
433 Ga0207674_10403954 3300026116 Bacteria 1320
434 Ga0207675_100003162 3300026118 Bacteria 16157
435 Ga0207675_100006059 3300026118 Bacteria 11506
436 Ga0207675_100013963 3300026118 Bacteria 7488
437 Ga0207675_100565860 3300026118 Bacteria 1137
438 Ga0207683_10003576 3300026121 Bacteria 13558
439 Ga0207683_10051793 3300026121 Bacteria 3596
440 Ga0207698_10025963 3300026142 Bacteria 4138
441 Ga0209969_1004562 3300027360 Bacteria 1938
442 Ga0209995_1001621 3300027471 Bacteria 3495
443 Ga0209179_1000010 3300027512 Bacteria 68867
444 Ga0209179_1007430 3300027512 Bacteria 1809
445 Ga0209179_1027827 3300027512 Bacteria 1142
446 Ga0209999_1001099 3300027543 Bacteria 4615
447 Ga0209282_1201044 3300027666 Bacteria 918
448 Ga0209971_1022551 3300027682 Bacteria 1500
449 Ga0209974_10001583 3300027876 Bacteria 8236
450 Ga0209974_10050958 3300027876 Bacteria 1391
451 Ga0207428_10003362 3300027907 Bacteria 15546
452 Ga0268266_10022886 3300028379 Bacteria 5318
453 Ga0268266_10023031 3300028379 Bacteria 5301
454 Ga0268266_10110772 3300028379 Bacteria 2432
455 Ga0268266_10330724 3300028379 Bacteria 1428
456 Ga0268266_10406896 3300028379 Bacteria 1287
457 Ga0268265_10001515 3300028380 Bacteria 19408
458 Ga0268265_10005465 3300028380 Bacteria 8683
459 Ga0268265_10035383 3300028380 Bacteria 3649
460 Ga0268265_10065120 3300028380 Bacteria 2811
461 Ga0268265_10395545 3300028380 Bacteria 1276
462 Ga0268265_10819584 3300028380 Bacteria 908
463 Ga0268264_10000036 3300028381 Bacteria 392994
464 Ga0268264_10018203 3300028381 Bacteria 5746
465 Ga0268264_10041471 3300028381 Bacteria 3808
466 Ga0268264_10896797 3300028381 Bacteria 890
467 Ga0268264_11782931 3300028381 Bacteria 626
468 Ga0265334_10000092 3300028573 Bacteria 64246
469 Ga0265334_10020425 3300028573 Bacteria 2711
470 Ga0265338_10005957 3300028800 Bacteria 15684
471 Ga0265339_10260709 3300031249 Bacteria 836
472 Ga0307509_10000365 3300031507 Bacteria 76187
473 Ga0307408_100063639 3300031548 Bacteria 2699
474 Ga0307408_100105824 3300031548 Bacteria 2151
475 Ga0307408_100112043 3300031548 Bacteria 2097
476 Ga0307408_100125213 3300031548 Bacteria 1997
477 Ga0265313_10000109 3300031595 Bacteria 83136
478 Ga0265313_10010261 3300031595 Bacteria 5955
479 Ga0265313_10112395 3300031595 Bacteria 1196
480 Ga0316575_10122421 3300031665 Bacteria 1064
481 Ga0316575_10372420 3300031665 Bacteria 610
482 Ga0316576_10250249 3300031727 Bacteria 1330
483 Ga0307516_10000209 3300031730 Bacteria 75193
484 Ga0307405_10180567 3300031731 Bacteria 1515
485 Ga0307405_10224512 3300031731 Bacteria 1380
486 Ga0307413_10713379 3300031824 Bacteria 834
487 Ga0307413_10720323 3300031824 Unclassified 831
488 Ga0307410_10065703 3300031852 Unclassified 2496
489 Ga0307410_10469405 3300031852 Bacteria 1030
490 Ga0307406_10016892 3300031901 Bacteria 4247
491 Ga0307406_10670790 3300031901 Bacteria 863
492 Ga0307407_10203608 3300031903 Bacteria 1328
493 Ga0307412_10126396 3300031911 Bacteria 1850
494 Ga0307412_11646992 3300031911 Bacteria 587
495 Ga0307409_100834635 3300031995 Bacteria 931
496 Ga0307416_102436284 3300032002 Bacteria 622
497 Ga0307416_103544721 3300032002 Bacteria 522
498 Ga0307414_10821446 3300032004 Bacteria 849
499 Ga0307411_10217655 3300032005 Bacteria 1479
500 Ga0307415_101112519 3300032126 Bacteria 740
501 Ga0316593_10000692 3300032168 Bacteria 6574
502 Ga0316593_10005117 3300032168 Bacteria 3430
503 Ga0316593_10039782 3300032168 Bacteria 1561
504 Ga0316592_1000870 3300033524 Bacteria 4567
505 Ga0316592_1002547 3300033524 Bacteria 3165
506 Ga0316587_1000489 3300033529 Bacteria 4022
507 Ga0316587_1050155 3300033529 Bacteria 763
508 Ga0316596_1000453 3300033541 Bacteria 6871
509 Ga0316596_1002939 3300033541 Bacteria 3694
510 Ga0373936_0031837 3300035113 Bacteria 2084
511 Ga0373939_0219622 3300035114 Bacteria 727
512 Ga0373960_0131864 3300035121 Bacteria 839
513 Ga0373942_0065859 3300035207 Bacteria 1048
514 Ga0373962_0209803 3300035242 Bacteria 662
515 Ga0316574_0261688 3300035398 Bacteria 1104
516 Ga0373931_0055499 3300035691 Bacteria 2120
517 Ga0373927_0000003 3300035695 Bacteria 480348
518 Ga0373937_0113993 3300036401 Bacteria 2516
519 Ga0373937_0619724 3300036401 Bacteria 1027
520 Ga0316582_0645729 3300036647 Bacteria 728
521 Ga0316584_0150738 3300036712 Bacteria 1731
522 Ga0316584_0163799 3300036712 Bacteria 1651
523 Ga0316584_0337425 3300036712 Bacteria 1084
524 Ga0400484_16028 3300038725 Bacteria 9868
525 Ga0400484_22999 3300038725 Bacteria 40826
526 Ga0400484_29948 3300038725 Bacteria 10111
527 Ga0400484_36650 3300038725 Bacteria 3461
528 Ga0400490_09976 3300038726 Bacteria 2238
529 Ga0400490_14517 3300038726 Bacteria 5868
530 Ga0400490_29153 3300038726 Bacteria 26709
531 Ga0400490_31423 3300038726 Bacteria 6035
532 Ga0400490_55744 3300038726 Bacteria 86921
533 Ga0400491_02682 3300038727 Bacteria 1380
534 Ga0400491_10039 3300038727 Unclassified 1294
535 Ga0400491_20315 3300038727 Bacteria 1555
536 Ga0400491_22710 3300038727 Bacteria 4330
537 Ga0400491_26238 3300038727 Bacteria 5854
538 Ga0400485_04462 3300038735 Bacteria 6670
539 Ga0400485_11431 3300038735 Bacteria 142174
540 Ga0400488_09389 3300038741 Bacteria 1707
541 Ga0400488_19449 3300038741 Bacteria 2249
542 Ga0400488_21215 3300038741 Bacteria 17200
543 Ga0400488_24107 3300038741 Bacteria 1959
544 Ga0400488_31647 3300038741 Bacteria 1041
545 Ga0400488_33004 3300038741 Bacteria 10792
546 Ga0400488_38891 3300038741 Bacteria 20773
547 Ga0400488_42663 3300038741 Bacteria 2772
548 Ga0400486_00233 3300038742 Bacteria 7497
549 Ga0400486_08527 3300038742 Bacteria 3907
550 Ga0400486_14851 3300038742 Bacteria 63108
551 Ga0400486_18012 3300038742 Bacteria 99609
552 Ga0400483_004216 3300039062 Bacteria 4538
553 Ga0400483_053442 3300039062 Unclassified 1224
554 Ga0400483_093565 3300039062 Bacteria 2573
555 Ga0400483_108094 3300039062 Bacteria 15316
556 Ga0400483_145565 3300039062 Bacteria 12981
557 Ga0400483_175714 3300039062 Bacteria 1373
558 Ga0400483_178062 3300039062 Bacteria 7395
559 Ga0400483_202890 3300039062 Bacteria 2007
560 Ga0400483_229521 3300039062 Bacteria 1270
561 Ga0400483_241642 3300039062 Bacteria 19322
562 Ga0400483_265824 3300039062 Bacteria 1032
563 Ga0400483_268051 3300039062 Bacteria 17073
564 Ga0400483_290185 3300039062 Bacteria 6932
565 Ga0400489_80563 3300039093 Bacteria 3798
566 Ga0400487_11274 3300039110 Bacteria 1629
567 Ga0400487_11908 3300039110 Bacteria 3498
568 Ga0400487_14076 3300039110 Bacteria 135338
569 Ga0400487_17975 3300039110 Bacteria 1712
570 Ga0400487_20104 3300039110 Bacteria 5320
571 Ga0400487_24806 3300039110 Bacteria 35141
572 Ga0400487_26238 3300039110 Bacteria 16964
573 Ga0400487_54961 3300039110 Bacteria 48611
574 Ga0436361_0022148 3300039447 Bacteria 4126
575 Ga0436361_0060574 3300039447 Bacteria 787
576 Ga0436361_0359769 3300039447 Bacteria 2171
577 Ga0436361_0402051 3300039447 Bacteria 2484
578 Ga0439439_0190229 3300041406 Bacteria 594
579 Ga0439461_0002613 3300041410 Bacteria 2900
580 Ga0451797_0371857 3300041453 Bacteria 1511
581 Ga0439431_0049696 3300041997 Bacteria 1085
582 Ga0439442_046765 3300042002 Bacteria 912
583 Ga0439448_0028169 3300042005 Bacteria 1773
584 Ga0439462_0120621 3300042015 Bacteria 729
585 Ga0439463_051671 3300042016 Bacteria 1049
586 Ga0450914_040850 3300042118 Bacteria 588
587 Ga0450888_031509 3300042126 Bacteria 711
588 Ga0439446_0004846 3300042156 Bacteria 3431
589 Ga0439434_0004148 3300042435 Bacteria 4231
590 Ga0439435_0000204 3300042436 Bacteria 8336
591 Ga0439464_0097903 3300042439 Bacteria 889
592 Ga0451577_0041337 3300042876 Bacteria 4138
593 Ga0451577_1015112 3300042876 Bacteria 745
594 Ga0466969_0007376 3300044656 Bacteria 5845
595 Ga0466965_0103131 3300044683 Bacteria 1460
596 Ga0466965_0136123 3300044683 Bacteria 1276
597 Ga0466961_0000300 3300044693 Bacteria 32920
598 Ga0453684_0456139 3300044712 Bacteria 1422
599 Ga0451576_0016225 3300045051 Bacteria 8227
600 Ga0451576_0047973 3300045051 Bacteria 4489
601 Ga0451576_0212501 3300045051 Bacteria 2020
602 Ga0451576_1010087 3300045051 Bacteria 872
603 Ga0495638_0001192 3300046460 Bacteria 24878
604 Ga0495638_0477398 3300046460 Bacteria 632
605 Ga0495650_0013647 3300046471 Bacteria 4283
606 Ga0495650_0208495 3300046471 Bacteria 677
607 Ga0495630_0175917 3300046517 Bacteria 1631
608 Ga0495632_0178624 3300046519 Bacteria 973
609 Ga0495642_0232722 3300046528 Bacteria 805
610 Ga0495598_0008886 3300046537 Bacteria 2353
611 Ga0495621_0344983 3300046539 Bacteria 624
612 Ga0495667_0258044 3300046559 Bacteria 1109
613 Ga0495668_0243504 3300046616 Bacteria 985
614 Ga0495625_0003539 3300046660 Bacteria 15446
615 Ga0495625_0239180 3300046660 Bacteria 1183
616 Ga0495674_0793990 3300047319 Bacteria 737
617 Ga0495672_0044208 3300047320 Bacteria 2674
618 Ga0495602_0190944 3300048088 Bacteria 1571
619 Ga0496101_0291908 3300048904 Bacteria 1276
620 Ga0496101_0615504 3300048904 Bacteria 858
621 Ga0496104_0000384 3300048907 Bacteria 38678
622 Ga0496104_0163884 3300048907 Bacteria 2132
623 Ga0496104_0385982 3300048907 Bacteria 1313
624 Ga0496104_0984103 3300048907 Bacteria 748
625 Ga0496105_0019635 3300048908 Bacteria 5452
626 Ga0496108_0005248 3300048911 Bacteria 10463
627 Ga0496108_0100879 3300048911 Bacteria 2462
628 Ga0496108_0151347 3300048911 Bacteria 2002
629 Ga0496109_0087986 3300048912 Bacteria 2870
630 Ga0496110_0000305 3300048913 Bacteria 32413
631 Ga0496110_0528532 3300048913 Bacteria 1073
632 Ga0496111_0432947 3300048914 Bacteria 971
633 Ga0496112_1338753 3300048915 Bacteria 631
634 Ga0496113_0101972 3300048916 Bacteria 2225
635 Ga0496114_0162159 3300048917 Bacteria 1945
636 Ga0496114_0170009 3300048917 Bacteria 1899
637 Ga0496114_0202928 3300048917 Bacteria 1737
638 Ga0496115_0488366 3300048918 Bacteria 991
639 Ga0496117_0232093 3300048920 Bacteria 1019
640 Ga0496121_0090713 3300048924 Bacteria 2388
641 Ga0496124_0479451 3300048927 Bacteria 840
642 Ga0496125_0435560 3300048928 Bacteria 755
643 Ga0496126_0436630 3300048929 Bacteria 1056
644 Ga0501034_0188223 3300049571 Bacteria 2027
645 Ga0501039_0488210 3300049575 Bacteria 967
646 Ga0501047_0023376 3300049581 Bacteria 5935
647 Ga0501047_0323021 3300049581 Bacteria 1383
648 Ga0501069_0018783 3300049585 Bacteria 3733
649 Ga0501071_0397557 3300049587 Bacteria 1052
650 Ga0501072_0272597 3300049588 Bacteria 1346
651 Ga0501075_0576176 3300049591 Bacteria 859
652 Ga0501077_0056905 3300049593 Bacteria 2483
653 Ga0501035_0196440 3300049822 Bacteria 1733
654 Ga0501044_0617669 3300049823 Bacteria 976
655 nmdc:mga05p37_1468177_c1 3300050507 Bacteria 681
656 nmdc:mga05p37_2025310_c1 3300050507 Bacteria 543
657 nmdc:mga05p37_484178_c1 3300050507 Bacteria 1424
658 nmdc:mga05p37_51204_c1 3300050507 Bacteria 5079
659 nmdc:mga09592_3351_c1 3300050508 Bacteria 12959
660 nmdc:mga09592_414837_c1 3300050508 Bacteria 1163
661 nmdc:mga09592_98502_c1 3300050508 Bacteria 2503
662 nmdc:mga0qj67_1124394_c1 3300050509 Bacteria 613
663 nmdc:mga0qj67_1270602_c1 3300050509 Bacteria 571
664 nmdc:mga0qj67_17344_c1 3300050509 Bacteria 5473
665 nmdc:mga0qj67_18430_c1 3300050509 Bacteria 5320
666 nmdc:mga0qj67_3821_c1 3300050509 Bacteria 10882
667 nmdc:mga0qj67_931487_c1 3300050509 Bacteria 684
668 nmdc:mga06r32_1129060_c1 3300050510 Bacteria 732
669 nmdc:mga06r32_1292502_c1 3300050510 Bacteria 674
670 nmdc:mga06r32_22643_c1 3300050510 Bacteria 5811
671 nmdc:mga06r32_23_c1 3300050510 Bacteria 93533
672 nmdc:mga06r32_3897_c1 3300050510 Bacteria 13374
673 nmdc:mga08y16_10408_c1 3300050511 Bacteria 9756
674 nmdc:mga08y16_12878_c1 3300050511 Bacteria 8796
675 nmdc:mga08y16_451948_c1 3300050511 Bacteria 1310
676 nmdc:mga08y16_820965_c1 3300050511 Bacteria 921
677 nmdc:mga0n895_316603_c1 3300050512 Bacteria 1581
678 nmdc:mga0n895_415_c1 3300050512 Bacteria 28635
679 nmdc:mga0rr50_105517_c1 3300050513 Bacteria 2222
680 nmdc:mga0rr50_1206_c1 3300050513 Bacteria 14042
681 nmdc:mga0rr50_210356_c1 3300050513 Bacteria 1602
682 nmdc:mga0rr50_395737_c1 3300050513 Bacteria 1166
683 nmdc:mga0rr50_797402_c1 3300050513 Bacteria 806
684 nmdc:mga08x19_14295_c1 3300050514 Bacteria 4814
685 nmdc:mga08x19_156983_c1 3300050514 Bacteria 1543
686 nmdc:mga08x19_265478_c1 3300050514 Bacteria 1187
687 nmdc:mga08x19_285389_c1 3300050514 Bacteria 1144
688 nmdc:mga08x19_43053_c1 3300050514 Bacteria 2880
689 nmdc:mga08x19_61092_c1 3300050514 Bacteria 2442
690 nmdc:mga08x19_625_c1 3300050514 Bacteria 22799
691 nmdc:mga0a205_380733_c1 3300050515 Bacteria 1276
692 nmdc:mga0a205_449096_c1 3300050515 Bacteria 1149
693 Ga0500643_187964 3300053087 Bacteria 554
694 Ga0500644_0233730 3300053088 Bacteria 770
695 Ga0500581_359527 3300053089 Bacteria 547
696 Ga0500646_0210523 3300053090 Bacteria 671
697 Ga0500583_0013312 3300053092 Bacteria 3178
698 Ga0500583_0083771 3300053092 Bacteria 1544
699 Ga0500651_0577865 3300053093 Bacteria 612
700 Ga0500569_013363 3300053109 Bacteria 2008
701 Ga0500617_147203 3300053124 Bacteria 936
702 Ga0500642_0095320 3300053130 Bacteria 1379
703 Ga0500568_0119260 3300053139 Bacteria 983
704 Ga0500588_0000210 3300053146 Bacteria 8184
705 Ga0500622_0001473 3300053156 Bacteria 18746
706 Ga0500622_0013289 3300053156 Bacteria 4441
707 Ga0500627_0170845 3300053158 Bacteria 980
708 Ga0500637_0319659 3300053178 Bacteria 839
709 Ga0590071_054655 3300059421 Bacteria 971
710 Ga0590071_065477 3300059421 Bacteria 892

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053087 Ga0500643_187964 Ga0500643_187964_16_438 137
2 3300042876 Ga0451577_1015112 Ga0451577_1015112_77_517 142
3 3300005329 Ga0070683_100035698 Ga0070683_1000356982 143
4 3300005331 Ga0070670_100006956 Ga0070670_1000069568 143
5 3300005336 Ga0070680_100407771 Ga0070680_1004077711 143
6 3300005338 Ga0068868_100180742 Ga0068868_1001807422 143
7 3300005355 Ga0070671_100021032 Ga0070671_1000210324 143
8 3300005364 Ga0070673_100005910 Ga0070673_1000059106 143
9 3300005435 Ga0070714_100064330 Ga0070714_1000643302 143
10 3300005456 Ga0070678_100084624 Ga0070678_1000846243 143
11 3300005458 Ga0070681_10523724 Ga0070681_105237241 143
12 3300005840 Ga0068870_10282549 Ga0068870_102825492 143
13 3300005844 Ga0068862_100953616 Ga0068862_1009536162 143
14 3300009098 Ga0105245_11110947 Ga0105245_111109472 143
15 3300009176 Ga0105242_10228377 Ga0105242_102283772 143
16 3300009177 Ga0105248_10088888 Ga0105248_100888884 143
17 3300009551 Ga0105238_10461206 Ga0105238_104612062 143
18 3300013296 Ga0157374_10045246 Ga0157374_100452464 143
19 3300013297 Ga0157378_10003991 Ga0157378_100039913 143
20 3300013306 Ga0163162_10056038 Ga0163162_100560382 143
21 3300013308 Ga0157375_10071548 Ga0157375_100715484 143
22 3300014326 Ga0157380_11139784 Ga0157380_111397842 143
23 3300014745 Ga0157377_10066758 Ga0157377_100667582 143
24 3300014969 Ga0157376_10011903 Ga0157376_100119036 143
25 3300025908 Ga0207643_10490146 Ga0207643_104901461 143
26 3300025912 Ga0207707_11113047 Ga0207707_111130472 143
27 3300025917 Ga0207660_10333540 Ga0207660_103335401 143
28 3300027360 Ga0209969_1004562 Ga0209969_10045623 143
29 3300027876 Ga0209974_10050958 Ga0209974_100509582 143
30 3300028380 Ga0268265_10035383 Ga0268265_100353832 143
31 3300031665 Ga0316575_10122421 Ga0316575_101224212 143
32 3300033529 Ga0316587_1050155 Ga0316587_10501551 143
33 3300035398 Ga0316574_0261688 Ga0316574_0261688_275_715 143
34 3300036712 Ga0316584_0337425 Ga0316584_0337425_189_626 143
35 3300038725 Ga0400484_22999 Ga0400484_22999_26173_26613 143
36 3300038725 Ga0400484_29948 Ga0400484_29948_5754_6194 143
37 3300038725 Ga0400484_36650 Ga0400484_36650_2801_3241 143
38 3300038726 Ga0400490_09976 Ga0400490_09976_194_631 143
39 3300038726 Ga0400490_29153 Ga0400490_29153_15574_16014 143
40 3300038726 Ga0400490_55744 Ga0400490_55744_64471_64911 143
41 3300038727 Ga0400491_02682 Ga0400491_02682_753_1193 143
42 3300038727 Ga0400491_10039 Ga0400491_10039_462_902 143
43 3300038727 Ga0400491_26238 Ga0400491_26238_4202_4642 143
44 3300038735 Ga0400485_04462 Ga0400485_04462_3767_4207 143
45 3300038741 Ga0400488_09389 Ga0400488_09389_575_1015 143
46 3300038741 Ga0400488_19449 Ga0400488_19449_413_853 143
47 3300038741 Ga0400488_21215 Ga0400488_21215_16634_17074 143
48 3300038741 Ga0400488_24107 Ga0400488_24107_251_691 143
49 3300038741 Ga0400488_31647 Ga0400488_31647_194_634 143
50 3300038741 Ga0400488_38891 Ga0400488_38891_8605_9045 143
51 3300038741 Ga0400488_42663 Ga0400488_42663_1536_1976 143
52 3300038742 Ga0400486_08527 Ga0400486_08527_3264_3701 143
53 3300038742 Ga0400486_14851 Ga0400486_14851_3801_4241 143
54 3300039062 Ga0400483_093565 Ga0400483_093565_412_852 143
55 3300039062 Ga0400483_108094 Ga0400483_108094_1069_1509 143
56 3300039062 Ga0400483_175714 Ga0400483_175714_386_826 143
57 3300039062 Ga0400483_202890 Ga0400483_202890_1365_1805 143
58 3300039062 Ga0400483_241642 Ga0400483_241642_14965_15405 143
59 3300039062 Ga0400483_265824 Ga0400483_265824_184_621 143
60 3300039062 Ga0400483_290185 Ga0400483_290185_4667_5107 143
61 3300039093 Ga0400489_80563 Ga0400489_80563_1957_2394 143
62 3300039110 Ga0400487_11274 Ga0400487_11274_347_787 143
63 3300039110 Ga0400487_11908 Ga0400487_11908_2882_3322 143
64 3300039110 Ga0400487_14076 Ga0400487_14076_16568_17008 143
65 3300039110 Ga0400487_17975 Ga0400487_17975_837_1277 143
66 3300039110 Ga0400487_54961 Ga0400487_54961_25090_25530 143
67 3300042015 Ga0439462_0120621 Ga0439462_0120621_173_616 143
68 3300045051 Ga0451576_0047973 Ga0451576_0047973_379_828 143
69 3300048904 Ga0496101_0291908 Ga0496101_0291908_693_1148 143
70 3300048907 Ga0496104_0385982 Ga0496104_0385982_309_764 143
71 3300048907 Ga0496104_0984103 Ga0496104_0984103_293_730 143
72 3300048911 Ga0496108_0100879 Ga0496108_0100879_310_765 143
73 3300048912 Ga0496109_0087986 Ga0496109_0087986_1146_1601 143
74 3300048917 Ga0496114_0202928 Ga0496114_0202928_722_1177 143
75 3300048920 Ga0496117_0232093 Ga0496117_0232093_35_484 143
76 3300048928 Ga0496125_0435560 Ga0496125_0435560_136_570 143
77 3300049585 Ga0501069_0018783 Ga0501069_0018783_3051_3494 143
78 3300049587 Ga0501071_0397557 Ga0501071_0397557_15_476 143
79 3300049588 Ga0501072_0272597 Ga0501072_0272597_530_973 143
80 3300050509 nmdc:mga0qj67_18430_c1 nmdc:mga0qj67_18430_c1_3433_3888 143
81 3300050513 nmdc:mga0rr50_210356_c1 nmdc:mga0rr50_210356_c1_952_1395 143
82 3300050514 nmdc:mga08x19_156983_c1 nmdc:mga08x19_156983_c1_549_992 143
83 3300053089 Ga0500581_359527 Ga0500581_359527_75_515 143
84 3300053158 Ga0500627_0170845 Ga0500627_0170845_480_923 143
85 3300005331 Ga0070670_100000015 Ga0070670_100000015155 144
86 3300005335 Ga0070666_10030935 Ga0070666_100309354 144
87 3300005353 Ga0070669_100002436 Ga0070669_1000024365 144
88 3300005355 Ga0070671_100000013 Ga0070671_100000013156 144
89 3300005365 Ga0070688_100024544 Ga0070688_1000245442 144
90 3300005367 Ga0070667_100000015 Ga0070667_10000001560 144
91 3300005466 Ga0070685_10000004 Ga0070685_1000000469 144
92 3300005467 Ga0070706_100764759 Ga0070706_1007647592 144
93 3300005548 Ga0070665_100146477 Ga0070665_1001464773 144
94 3300005617 Ga0068859_100011061 Ga0068859_1000110614 144
95 3300005618 Ga0068864_100000072 Ga0068864_10000007262 144
96 3300005841 Ga0068863_102351757 Ga0068863_1023517571 144
97 3300005842 Ga0068858_100059515 Ga0068858_1000595152 144
98 3300005843 Ga0068860_100000271 Ga0068860_10000027119 144
99 3300005844 Ga0068862_100002888 Ga0068862_1000028885 144
100 3300006931 Ga0097620_100011061 Ga0097620_1000110616 144
101 3300009101 Ga0105247_10089033 Ga0105247_100890333 144
102 3300009177 Ga0105248_10024742 Ga0105248_100247423 144
103 3300009553 Ga0105249_10095997 Ga0105249_100959973 144
104 3300014325 Ga0163163_10000118 Ga0163163_1000011860 144
105 3300021361 Ga0213872_10076206 Ga0213872_100762062 144
106 3300025903 Ga0207680_10018290 Ga0207680_100182905 144
107 3300025923 Ga0207681_10002041 Ga0207681_100020414 144
108 3300025925 Ga0207650_10000013 Ga0207650_10000013326 144
109 3300025931 Ga0207644_10000015 Ga0207644_10000015104 144
110 3300025941 Ga0207711_10000103 Ga0207711_1000010333 144
111 3300025941 Ga0207711_10000277 Ga0207711_1000027739 144
112 3300025961 Ga0207712_10127992 Ga0207712_101279923 144
113 3300025986 Ga0207658_10000005 Ga0207658_10000005327 144
114 3300026035 Ga0207703_10005017 Ga0207703_100050172 144
115 3300026088 Ga0207641_10022587 Ga0207641_100225872 144
116 3300026095 Ga0207676_10000010 Ga0207676_10000010424 144
117 3300028379 Ga0268266_10023031 Ga0268266_100230311 144
118 3300028380 Ga0268265_10001515 Ga0268265_1000151510 144
119 3300028381 Ga0268264_10000036 Ga0268264_10000036193 144
120 3300039447 Ga0436361_0359769 Ga0436361_0359769_922_1410 144
121 3300048927 Ga0496124_0479451 Ga0496124_0479451_228_668 144
122 3300048929 Ga0496126_0436630 Ga0496126_0436630_222_662 144
123 3300049575 Ga0501039_0488210 Ga0501039_0488210_447_887 144
124 3300049581 Ga0501047_0023376 Ga0501047_0023376_1796_2236 144
125 iso_pu_bacteria 2547132103 2547373956 144
126 iso_pu_bacteria 2843690924 2843692418 144
127 iso_pu_bacteria 2846033681 2846036266 144
128 iso_pu_bacteria 2846037992 2846041010 144
129 3300005331 Ga0070670_100547530 Ga0070670_1005475302 145
130 3300005334 Ga0068869_100003904 Ga0068869_1000039043 145
131 3300005335 Ga0070666_10041927 Ga0070666_100419272 145
132 3300005343 Ga0070687_100585443 Ga0070687_1005854432 145
133 3300005347 Ga0070668_100356678 Ga0070668_1003566782 145
134 3300005354 Ga0070675_100067476 Ga0070675_1000674763 145
135 3300005364 Ga0070673_100354037 Ga0070673_1003540372 145
136 3300005365 Ga0070688_101100106 Ga0070688_1011001061 145
137 3300005367 Ga0070667_100311078 Ga0070667_1003110782 145
138 3300005444 Ga0070694_100256120 Ga0070694_1002561202 145
139 3300005456 Ga0070678_100130988 Ga0070678_1001309882 145
140 3300005459 Ga0068867_100036380 Ga0068867_1000363804 145
141 3300005466 Ga0070685_10062017 Ga0070685_100620171 145
142 3300005548 Ga0070665_100094876 Ga0070665_1000948762 145
143 3300005617 Ga0068859_100210935 Ga0068859_1002109353 145
144 3300005618 Ga0068864_100143466 Ga0068864_1001434662 145
145 3300005841 Ga0068863_100207589 Ga0068863_1002075893 145
146 3300005842 Ga0068858_100276436 Ga0068858_1002764362 145
147 3300005844 Ga0068862_100748968 Ga0068862_1007489682 145
148 3300005844 Ga0068862_101270022 Ga0068862_1012700221 145
149 3300006237 Ga0097621_100578321 Ga0097621_1005783211 145
150 3300006358 Ga0068871_100029924 Ga0068871_1000299245 145
151 3300006881 Ga0068865_100359048 Ga0068865_1003590482 145
152 3300006931 Ga0097620_100210923 Ga0097620_1002109233 145
153 3300009094 Ga0111539_10399075 Ga0111539_103990752 145
154 3300009098 Ga0105245_10539227 Ga0105245_105392272 145
155 3300009101 Ga0105247_10140548 Ga0105247_101405482 145
156 3300009177 Ga0105248_10002407 Ga0105248_1000240718 145
157 3300009553 Ga0105249_11200792 Ga0105249_112007921 145
158 3300010375 Ga0105239_11568303 Ga0105239_115683031 145
159 3300013296 Ga0157374_10080636 Ga0157374_100806362 145
160 3300013306 Ga0163162_11552488 Ga0163162_115524882 145
161 3300013308 Ga0157375_10052471 Ga0157375_100524714 145
162 3300014326 Ga0157380_10587789 Ga0157380_105877892 145
163 3300014745 Ga0157377_11279456 Ga0157377_112794562 145
164 3300014968 Ga0157379_10725484 Ga0157379_107254842 145
165 3300014969 Ga0157376_10020696 Ga0157376_100206964 145
166 3300025899 Ga0207642_10029074 Ga0207642_100290743 145
167 3300025903 Ga0207680_10187724 Ga0207680_101877242 145
168 3300025908 Ga0207643_10316863 Ga0207643_103168632 145
169 3300025926 Ga0207659_10039083 Ga0207659_100390833 145
170 3300025935 Ga0207709_10813517 Ga0207709_108135172 145
171 3300025938 Ga0207704_10073923 Ga0207704_100739233 145
172 3300025941 Ga0207711_10011788 Ga0207711_100117885 145
173 3300025942 Ga0207689_10000974 Ga0207689_1000097426 145
174 3300025960 Ga0207651_10551560 Ga0207651_105515602 145
175 3300025972 Ga0207668_10321190 Ga0207668_103211902 145
176 3300025986 Ga0207658_10125281 Ga0207658_101252812 145
177 3300026023 Ga0207677_10214924 Ga0207677_102149242 145
178 3300026035 Ga0207703_10053560 Ga0207703_100535604 145
179 3300026088 Ga0207641_10118468 Ga0207641_101184683 145
180 3300026089 Ga0207648_10032325 Ga0207648_100323254 145
181 3300026095 Ga0207676_10328609 Ga0207676_103286092 145
182 3300026118 Ga0207675_100565860 Ga0207675_1005658602 145
183 3300028379 Ga0268266_10406896 Ga0268266_104068962 145
184 3300028380 Ga0268265_10819584 Ga0268265_108195841 145
185 3300028381 Ga0268264_10896797 Ga0268264_108967971 145
186 3300031665 Ga0316575_10372420 Ga0316575_103724201 145
187 3300039447 Ga0436361_0060574 Ga0436361_0060574_57_500 145
188 3300047319 Ga0495674_0793990 Ga0495674_0793990_65_505 145
189 3300050511 nmdc:mga08y16_451948_c1 nmdc:mga08y16_451948_c1_199_639 145
190 3300005327 Ga0070658_10168924 Ga0070658_101689242 146
191 3300005328 Ga0070676_10431059 Ga0070676_104310592 146
192 3300005333 Ga0070677_10110098 Ga0070677_101100982 146
193 3300005334 Ga0068869_101183805 Ga0068869_1011838052 146
194 3300005335 Ga0070666_10227926 Ga0070666_102279262 146
195 3300005338 Ga0068868_100209917 Ga0068868_1002099171 146
196 3300005344 Ga0070661_100157790 Ga0070661_1001577902 146
197 3300005353 Ga0070669_101269602 Ga0070669_1012696021 146
198 3300005354 Ga0070675_100066009 Ga0070675_1000660093 146
199 3300005354 Ga0070675_100740971 Ga0070675_1007409712 146
200 3300005355 Ga0070671_100837471 Ga0070671_1008374712 146
201 3300005365 Ga0070688_100306842 Ga0070688_1003068422 146
202 3300005366 Ga0070659_100327620 Ga0070659_1003276202 146
203 3300005367 Ga0070667_100292441 Ga0070667_1002924412 146
204 3300005435 Ga0070714_100018737 Ga0070714_1000187375 146
205 3300005435 Ga0070714_100061413 Ga0070714_1000614132 146
206 3300005440 Ga0070705_100269645 Ga0070705_1002696452 146
207 3300005440 Ga0070705_101240372 Ga0070705_1012403721 146
208 3300005440 Ga0070705_101762899 Ga0070705_1017628991 146
209 3300005444 Ga0070694_100005376 Ga0070694_1000053763 146
210 3300005457 Ga0070662_100161987 Ga0070662_1001619872 146
211 3300005458 Ga0070681_10004922 Ga0070681_100049229 146
212 3300005458 Ga0070681_10763045 Ga0070681_107630452 146
213 3300005459 Ga0068867_101797744 Ga0068867_1017977441 146
214 3300005467 Ga0070706_100287774 Ga0070706_1002877742 146
215 3300005518 Ga0070699_100023690 Ga0070699_1000236906 146
216 3300005535 Ga0070684_100227634 Ga0070684_1002276342 146
217 3300005536 Ga0070697_100008352 Ga0070697_1000083527 146
218 3300005536 Ga0070697_100452979 Ga0070697_1004529792 146
219 3300005536 Ga0070697_100500031 Ga0070697_1005000312 146
220 3300005539 Ga0068853_100008688 Ga0068853_1000086887 146
221 3300005539 Ga0068853_100794052 Ga0068853_1007940522 146
222 3300005545 Ga0070695_100004111 Ga0070695_1000041115 146
223 3300005545 Ga0070695_100778115 Ga0070695_1007781152 146
224 3300005546 Ga0070696_100007424 Ga0070696_1000074244 146
225 3300005546 Ga0070696_100124509 Ga0070696_1001245092 146
226 3300005547 Ga0070693_101049589 Ga0070693_1010495891 146
227 3300005549 Ga0070704_100130014 Ga0070704_1001300142 146
228 3300005563 Ga0068855_100201866 Ga0068855_1002018662 146
229 3300005564 Ga0070664_100022229 Ga0070664_1000222295 146
230 3300005577 Ga0068857_100029896 Ga0068857_1000298962 146
231 3300005578 Ga0068854_100010299 Ga0068854_1000102993 146
232 3300005614 Ga0068856_100526522 Ga0068856_1005265222 146
233 3300005614 Ga0068856_100688698 Ga0068856_1006886982 146
234 3300005615 Ga0070702_100122629 Ga0070702_1001226293 146
235 3300005615 Ga0070702_100189440 Ga0070702_1001894401 146
236 3300005615 Ga0070702_100374531 Ga0070702_1003745312 146
237 3300005616 Ga0068852_100005797 Ga0068852_1000057977 146
238 3300005617 Ga0068859_100024498 Ga0068859_1000244982 146
239 3300005618 Ga0068864_100247521 Ga0068864_1002475212 146
240 3300005718 Ga0068866_10108657 Ga0068866_101086572 146
241 3300005834 Ga0068851_10090016 Ga0068851_100900162 146
242 3300005842 Ga0068858_100347079 Ga0068858_1003470792 146
243 3300005842 Ga0068858_100584181 Ga0068858_1005841812 146
244 3300005844 Ga0068862_100056332 Ga0068862_1000563322 146
245 3300005985 Ga0081539_10001441 Ga0081539_100014417 146
246 3300006058 Ga0075432_10299323 Ga0075432_102993232 146
247 3300006173 Ga0070716_100250656 Ga0070716_1002506562 146
248 3300006173 Ga0070716_100734426 Ga0070716_1007344262 146
249 3300006237 Ga0097621_100003683 Ga0097621_1000036834 146
250 3300006358 Ga0068871_100289780 Ga0068871_1002897802 146
251 3300006844 Ga0075428_100010558 Ga0075428_1000105582 146
252 3300006844 Ga0075428_100699555 Ga0075428_1006995551 146
253 3300006846 Ga0075430_100289900 Ga0075430_1002899002 146
254 3300006847 Ga0075431_101009158 Ga0075431_1010091582 146
255 3300006852 Ga0075433_10463383 Ga0075433_104633832 146
256 3300006871 Ga0075434_100000004 Ga0075434_10000000463 146
257 3300006871 Ga0075434_100321078 Ga0075434_1003210782 146
258 3300006914 Ga0075436_100005388 Ga0075436_1000053887 146
259 3300006914 Ga0075436_100005406 Ga0075436_1000054067 146
260 3300006914 Ga0075436_100021279 Ga0075436_1000212792 146
261 3300006914 Ga0075436_100077166 Ga0075436_1000771663 146
262 3300006914 Ga0075436_100106811 Ga0075436_1001068112 146
263 3300006914 Ga0075436_100285853 Ga0075436_1002858532 146
264 3300006931 Ga0097620_100024498 Ga0097620_1000244982 146
265 3300007076 Ga0075435_100018356 Ga0075435_1000183566 146
266 3300007076 Ga0075435_100224993 Ga0075435_1002249933 146
267 3300007076 Ga0075435_100716270 Ga0075435_1007162702 146
268 3300009094 Ga0111539_11167520 Ga0111539_111675202 146
269 3300009098 Ga0105245_10006356 Ga0105245_100063567 146
270 3300009147 Ga0114129_10190939 Ga0114129_101909392 146
271 3300009147 Ga0114129_11550813 Ga0114129_115508132 146
272 3300009176 Ga0105242_10004198 Ga0105242_100041983 146
273 3300009177 Ga0105248_11301361 Ga0105248_113013612 146
274 3300014968 Ga0157379_10348196 Ga0157379_103481962 146
275 3300025315 Ga0207697_10144180 Ga0207697_101441802 146
276 3300025321 Ga0207656_10061076 Ga0207656_100610762 146
277 3300025903 Ga0207680_10064240 Ga0207680_100642403 146
278 3300025906 Ga0207699_10335113 Ga0207699_103351132 146
279 3300025909 Ga0207705_10061461 Ga0207705_100614614 146
280 3300025911 Ga0207654_10073478 Ga0207654_100734782 146
281 3300025912 Ga0207707_10035257 Ga0207707_100352573 146
282 3300025912 Ga0207707_10234875 Ga0207707_102348752 146
283 3300025914 Ga0207671_10025884 Ga0207671_100258843 146
284 3300025918 Ga0207662_10405553 Ga0207662_104055532 146
285 3300025920 Ga0207649_10040772 Ga0207649_100407723 146
286 3300025923 Ga0207681_10423423 Ga0207681_104234232 146
287 3300025926 Ga0207659_10224356 Ga0207659_102243562 146
288 3300025927 Ga0207687_10831231 Ga0207687_108312312 146
289 3300025929 Ga0207664_10020611 Ga0207664_100206115 146
290 3300025929 Ga0207664_10057026 Ga0207664_100570262 146
291 3300025929 Ga0207664_10317217 Ga0207664_103172172 146
292 3300025931 Ga0207644_10020618 Ga0207644_100206184 146
293 3300025932 Ga0207690_10393410 Ga0207690_103934102 146
294 3300025933 Ga0207706_10132128 Ga0207706_101321282 146
295 3300025939 Ga0207665_10735341 Ga0207665_107353412 146
296 3300025940 Ga0207691_10007106 Ga0207691_100071064 146
297 3300025941 Ga0207711_10427228 Ga0207711_104272282 146
298 3300025942 Ga0207689_11368155 Ga0207689_113681552 146
299 3300025944 Ga0207661_10183543 Ga0207661_101835432 146
300 3300025945 Ga0207679_10005967 Ga0207679_100059675 146
301 3300025949 Ga0207667_10085553 Ga0207667_100855533 146
302 3300025960 Ga0207651_10140782 Ga0207651_101407823 146
303 3300025981 Ga0207640_10068365 Ga0207640_100683653 146
304 3300026023 Ga0207677_10031535 Ga0207677_100315352 146
305 3300026035 Ga0207703_10475782 Ga0207703_104757822 146
306 3300026041 Ga0207639_10028853 Ga0207639_100288532 146
307 3300026041 Ga0207639_11436094 Ga0207639_114360942 146
308 3300026078 Ga0207702_11191236 Ga0207702_111912361 146
309 3300026088 Ga0207641_10272783 Ga0207641_102727832 146
310 3300026089 Ga0207648_10749717 Ga0207648_107497172 146
311 3300026116 Ga0207674_10020988 Ga0207674_100209882 146
312 3300026121 Ga0207683_10003576 Ga0207683_1000357613 146
313 3300026142 Ga0207698_10025963 Ga0207698_100259633 146
314 3300027471 Ga0209995_1001621 Ga0209995_10016212 146
315 3300027543 Ga0209999_1001099 Ga0209999_10010994 146
316 3300027682 Ga0209971_1022551 Ga0209971_10225512 146
317 3300027876 Ga0209974_10001583 Ga0209974_100015835 146
318 3300028380 Ga0268265_10065120 Ga0268265_100651202 146
319 3300028573 Ga0265334_10020425 Ga0265334_100204254 146
320 3300028800 Ga0265338_10005957 Ga0265338_100059574 146
321 3300031595 Ga0265313_10010261 Ga0265313_100102613 146
322 3300032002 Ga0307416_103544721 Ga0307416_1035447211 146
323 3300035114 Ga0373939_0219622 Ga0373939_0219622_73_531 146
324 3300035242 Ga0373962_0209803 Ga0373962_0209803_194_646 146
325 3300041406 Ga0439439_0190229 Ga0439439_0190229_75_524 146
326 3300041410 Ga0439461_0002613 Ga0439461_0002613_486_938 146
327 3300041997 Ga0439431_0049696 Ga0439431_0049696_280_732 146
328 3300042156 Ga0439446_0004846 Ga0439446_0004846_92_544 146
329 3300042435 Ga0439434_0004148 Ga0439434_0004148_483_935 146
330 3300042436 Ga0439435_0000204 Ga0439435_0000204_883_1335 146
331 3300045051 Ga0451576_1010087 Ga0451576_1010087_364_816 146
332 3300046528 Ga0495642_0232722 Ga0495642_0232722_162_614 146
333 3300046537 Ga0495598_0008886 Ga0495598_0008886_1641_2105 146
334 3300046539 Ga0495621_0344983 Ga0495621_0344983_108_572 146
335 3300049593 Ga0501077_0056905 Ga0501077_0056905_1230_1679 146
336 3300050507 nmdc:mga05p37_1468177_c1 nmdc:mga05p37_1468177_c1_97_549 146
337 3300050509 nmdc:mga0qj67_1270602_c1 nmdc:mga0qj67_1270602_c1_86_544 146
338 3300050510 nmdc:mga06r32_1292502_c1 nmdc:mga06r32_1292502_c1_146_604 146
339 3300050511 nmdc:mga08y16_820965_c1 nmdc:mga08y16_820965_c1_369_860 146
340 3300050512 nmdc:mga0n895_415_c1 nmdc:mga0n895_415_c1_8919_9371 146
341 3300050513 nmdc:mga0rr50_105517_c1 nmdc:mga0rr50_105517_c1_1630_2082 146
342 3300050513 nmdc:mga0rr50_1206_c1 nmdc:mga0rr50_1206_c1_4502_4954 146
343 3300050513 nmdc:mga0rr50_395737_c1 nmdc:mga0rr50_395737_c1_507_959 146
344 3300050513 nmdc:mga0rr50_797402_c1 nmdc:mga0rr50_797402_c1_94_546 146
345 3300050514 nmdc:mga08x19_14295_c1 nmdc:mga08x19_14295_c1_556_1008 146
346 3300050514 nmdc:mga08x19_265478_c1 nmdc:mga08x19_265478_c1_612_1064 146
347 3300050514 nmdc:mga08x19_285389_c1 nmdc:mga08x19_285389_c1_624_1076 146
348 3300050514 nmdc:mga08x19_43053_c1 nmdc:mga08x19_43053_c1_2283_2735 146
349 3300050514 nmdc:mga08x19_61092_c1 nmdc:mga08x19_61092_c1_621_1073 146
350 3300050514 nmdc:mga08x19_625_c1 nmdc:mga08x19_625_c1_18661_19113 146
351 3300050515 nmdc:mga0a205_449096_c1 nmdc:mga0a205_449096_c1_659_1111 146
352 3300059421 Ga0590071_054655 Ga0590071_054655_264_716 146
353 3300059421 Ga0590071_065477 Ga0590071_065477_282_734 146
354 3300005327 Ga0070658_10241175 Ga0070658_102411752 147
355 3300005335 Ga0070666_10000912 Ga0070666_1000091214 147
356 3300005338 Ga0068868_100007318 Ga0068868_1000073182 147
357 3300005344 Ga0070661_100567428 Ga0070661_1005674282 147
358 3300005355 Ga0070671_100193271 Ga0070671_1001932713 147
359 3300005364 Ga0070673_100097039 Ga0070673_1000970392 147
360 3300005367 Ga0070667_100003903 Ga0070667_1000039035 147
361 3300005459 Ga0068867_101081861 Ga0068867_1010818612 147
362 3300005466 Ga0070685_10710997 Ga0070685_107109971 147
363 3300005548 Ga0070665_100010167 Ga0070665_1000101675 147
364 3300005617 Ga0068859_100096921 Ga0068859_1000969213 147
365 3300005618 Ga0068864_100017395 Ga0068864_1000173954 147
366 3300005718 Ga0068866_10120592 Ga0068866_101205922 147
367 3300005841 Ga0068863_100229975 Ga0068863_1002299752 147
368 3300005842 Ga0068858_100006370 Ga0068858_1000063705 147
369 3300005843 Ga0068860_100019058 Ga0068860_1000190586 147
370 3300006175 Ga0070712_100108706 Ga0070712_1001087062 147
371 3300006237 Ga0097621_100056300 Ga0097621_1000563002 147
372 3300006358 Ga0068871_100024415 Ga0068871_1000244152 147
373 3300006881 Ga0068865_100017384 Ga0068865_1000173845 147
374 3300006931 Ga0097620_100096924 Ga0097620_1000969243 147
375 3300009098 Ga0105245_10001896 Ga0105245_1000189617 147
376 3300009101 Ga0105247_10302504 Ga0105247_103025042 147
377 3300009176 Ga0105242_10411292 Ga0105242_104112922 147
378 3300009177 Ga0105248_10003549 Ga0105248_1000354911 147
379 3300013296 Ga0157374_10013613 Ga0157374_100136133 147
380 3300013297 Ga0157378_10012745 Ga0157378_100127454 147
381 3300013306 Ga0163162_10172493 Ga0163162_101724932 147
382 3300014325 Ga0163163_10244182 Ga0163163_102441823 147
383 3300014968 Ga0157379_10004582 Ga0157379_100045825 147
384 3300014969 Ga0157376_10000400 Ga0157376_1000040022 147
385 3300017792 Ga0163161_10169842 Ga0163161_101698422 147
386 3300021361 Ga0213872_10016834 Ga0213872_100168344 147
387 3300021361 Ga0213872_10053869 Ga0213872_100538692 147
388 3300025899 Ga0207642_10104145 Ga0207642_101041451 147
389 3300025920 Ga0207649_10497559 Ga0207649_104975592 147
390 3300025927 Ga0207687_10296108 Ga0207687_102961082 147
391 3300025931 Ga0207644_10218041 Ga0207644_102180412 147
392 3300025941 Ga0207711_10004938 Ga0207711_100049385 147
393 3300025960 Ga0207651_10114154 Ga0207651_101141542 147
394 3300025986 Ga0207658_10020040 Ga0207658_100200404 147
395 3300026023 Ga0207677_10154054 Ga0207677_101540543 147
396 3300026035 Ga0207703_10069201 Ga0207703_100692013 147
397 3300026088 Ga0207641_10235840 Ga0207641_102358402 147
398 3300026089 Ga0207648_10939727 Ga0207648_109397272 147
399 3300026095 Ga0207676_10012652 Ga0207676_100126523 147
400 3300028379 Ga0268266_10022886 Ga0268266_100228864 147
401 3300028381 Ga0268264_10018203 Ga0268264_100182035 147
402 3300028573 Ga0265334_10000092 Ga0265334_1000009226 147
403 3300031595 Ga0265313_10000109 Ga0265313_1000010924 147
404 3300035695 Ga0373927_0000003 Ga0373927_0000003_41290_41745 147
405 3300036401 Ga0373937_0113993 Ga0373937_0113993_1708_2163 147
406 3300036401 Ga0373937_0619724 Ga0373937_0619724_72_527 147
407 3300039447 Ga0436361_0022148 Ga0436361_0022148_1268_1720 147
408 3300039447 Ga0436361_0402051 Ga0436361_0402051_175_627 147
409 3300044656 Ga0466969_0007376 Ga0466969_0007376_854_1303 147
410 3300044683 Ga0466965_0136123 Ga0466965_0136123_214_663 147
411 3300044693 Ga0466961_0000300 Ga0466961_0000300_19026_19475 147
412 3300046517 Ga0495630_0175917 Ga0495630_0175917_198_653 147
413 3300046559 Ga0495667_0258044 Ga0495667_0258044_109_564 147
414 3300048088 Ga0495602_0190944 Ga0495602_0190944_994_1449 147
415 3300048904 Ga0496101_0615504 Ga0496101_0615504_117_608 147
416 3300048907 Ga0496104_0000384 Ga0496104_0000384_36533_37024 147
417 3300048908 Ga0496105_0019635 Ga0496105_0019635_2420_2911 147
418 3300048911 Ga0496108_0005248 Ga0496108_0005248_4225_4716 147
419 3300048913 Ga0496110_0000305 Ga0496110_0000305_2696_3187 147
420 3300048914 Ga0496111_0432947 Ga0496111_0432947_366_857 147
421 3300048915 Ga0496112_1338753 Ga0496112_1338753_19_510 147
422 3300048917 Ga0496114_0170009 Ga0496114_0170009_764_1255 147
423 3300048918 Ga0496115_0488366 Ga0496115_0488366_469_960 147
424 3300053092 Ga0500583_0013312 Ga0500583_0013312_814_1263 147
425 3300053178 Ga0500637_0319659 Ga0500637_0319659_333_782 147
426 3300031903 Ga0307407_10203608 Ga0307407_102036082 148
427 3300038741 Ga0400488_33004 Ga0400488_33004_10276_10737 148
428 3300038742 Ga0400486_00233 Ga0400486_00233_473_934 148
429 3300039062 Ga0400483_053442 Ga0400483_053442_663_1124 148
430 3300053090 Ga0500646_0210523 Ga0500646_0210523_99_587 148
431 3300053092 Ga0500583_0083771 Ga0500583_0083771_547_1035 148
432 3300053124 Ga0500617_147203 Ga0500617_147203_79_567 148
433 3300053146 Ga0500588_0000210 Ga0500588_0000210_3694_4182 148
434 iso_pu_bacteria 2998344455 2998347214 148
435 3300005288 Ga0065714_10222308 Ga0065714_102223082 149
436 3300005290 Ga0065712_10089595 Ga0065712_100895952 149
437 3300005293 Ga0065715_10095987 Ga0065715_100959874 149
438 3300005295 Ga0065707_10088639 Ga0065707_100886394 149
439 3300005329 Ga0070683_100650461 Ga0070683_1006504612 149
440 3300005330 Ga0070690_100027547 Ga0070690_1000275472 149
441 3300005331 Ga0070670_100047907 Ga0070670_1000479072 149
442 3300005334 Ga0068869_100027255 Ga0068869_1000272554 149
443 3300005334 Ga0068869_100329772 Ga0068869_1003297722 149
444 3300005335 Ga0070666_10250811 Ga0070666_102508112 149
445 3300005338 Ga0068868_101234355 Ga0068868_1012343552 149
446 3300005340 Ga0070689_100004887 Ga0070689_1000048875 149
447 3300005343 Ga0070687_100043515 Ga0070687_1000435153 149
448 3300005344 Ga0070661_100018471 Ga0070661_1000184712 149
449 3300005345 Ga0070692_10538689 Ga0070692_105386892 149
450 3300005347 Ga0070668_100002261 Ga0070668_10000226112 149
451 3300005353 Ga0070669_100037306 Ga0070669_1000373064 149
452 3300005354 Ga0070675_100335136 Ga0070675_1003351362 149
453 3300005355 Ga0070671_100067376 Ga0070671_1000673763 149
454 3300005364 Ga0070673_100010204 Ga0070673_1000102045 149
455 3300005365 Ga0070688_100004864 Ga0070688_1000048643 149
456 3300005367 Ga0070667_100038246 Ga0070667_1000382462 149
457 3300005434 Ga0070709_10103513 Ga0070709_101035133 149
458 3300005436 Ga0070713_100510789 Ga0070713_1005107892 149
459 3300005438 Ga0070701_10105706 Ga0070701_101057062 149
460 3300005441 Ga0070700_100338743 Ga0070700_1003387432 149
461 3300005444 Ga0070694_100302523 Ga0070694_1003025232 149
462 3300005455 Ga0070663_100714354 Ga0070663_1007143542 149
463 3300005456 Ga0070678_100052998 Ga0070678_1000529984 149
464 3300005457 Ga0070662_100158230 Ga0070662_1001582302 149
465 3300005458 Ga0070681_10236206 Ga0070681_102362063 149
466 3300005459 Ga0068867_100349977 Ga0068867_1003499772 149
467 3300005466 Ga0070685_10037569 Ga0070685_100375694 149
468 3300005471 Ga0070698_100547873 Ga0070698_1005478732 149
469 3300005535 Ga0070684_100007830 Ga0070684_1000078305 149
470 3300005543 Ga0070672_100037746 Ga0070672_1000377462 149
471 3300005544 Ga0070686_100002369 Ga0070686_1000023697 149
472 3300005545 Ga0070695_100634886 Ga0070695_1006348862 149
473 3300005546 Ga0070696_100078172 Ga0070696_1000781722 149
474 3300005547 Ga0070693_100589755 Ga0070693_1005897552 149
475 3300005548 Ga0070665_100088154 Ga0070665_1000881543 149
476 3300005563 Ga0068855_100845492 Ga0068855_1008454922 149
477 3300005564 Ga0070664_100004310 Ga0070664_1000043105 149
478 3300005577 Ga0068857_100034238 Ga0068857_1000342382 149
479 3300005615 Ga0070702_100018484 Ga0070702_1000184842 149
480 3300005617 Ga0068859_100000949 Ga0068859_1000009494 149
481 3300005617 Ga0068859_100680978 Ga0068859_1006809782 149
482 3300005618 Ga0068864_100006463 Ga0068864_1000064634 149
483 3300005719 Ga0068861_100012581 Ga0068861_1000125815 149
484 3300005719 Ga0068861_100066058 Ga0068861_1000660584 149
485 3300005834 Ga0068851_11025946 Ga0068851_110259461 149
486 3300005841 Ga0068863_100004762 Ga0068863_1000047625 149
487 3300005842 Ga0068858_100022887 Ga0068858_1000228873 149
488 3300005843 Ga0068860_100059220 Ga0068860_1000592202 149
489 3300005844 Ga0068862_100001400 Ga0068862_10000140011 149
490 3300005844 Ga0068862_100002538 Ga0068862_10000253810 149
491 3300005844 Ga0068862_100199701 Ga0068862_1001997013 149
492 3300005844 Ga0068862_100751655 Ga0068862_1007516552 149
493 3300006237 Ga0097621_100220104 Ga0097621_1002201042 149
494 3300006844 Ga0075428_100005586 Ga0075428_10000558612 149
495 3300006844 Ga0075428_100015259 Ga0075428_1000152595 149
496 3300006844 Ga0075428_100697375 Ga0075428_1006973752 149
497 3300006846 Ga0075430_100004165 Ga0075430_1000041651 149
498 3300006846 Ga0075430_100011047 Ga0075430_1000110475 149
499 3300006846 Ga0075430_101260008 Ga0075430_1012600081 149
500 3300006847 Ga0075431_100000318 Ga0075431_10000031812 149
501 3300006847 Ga0075431_100005721 Ga0075431_10000572111 149
502 3300006847 Ga0075431_100265923 Ga0075431_1002659233 149
503 3300006847 Ga0075431_100747149 Ga0075431_1007471492 149
504 3300006847 Ga0075431_100936976 Ga0075431_1009369762 149
505 3300006852 Ga0075433_10570026 Ga0075433_105700262 149
506 3300006880 Ga0075429_100001918 Ga0075429_1000019185 149
507 3300006880 Ga0075429_100046537 Ga0075429_1000465374 149
508 3300006880 Ga0075429_101232132 Ga0075429_1012321321 149
509 3300006931 Ga0097620_100000949 Ga0097620_10000094929 149
510 3300006931 Ga0097620_100680964 Ga0097620_1006809642 149
511 3300006948 Ga0099826_10089094 Ga0099826_100890942 149
512 3300007265 Ga0099794_10014358 Ga0099794_100143583 149
513 3300007788 Ga0099795_10000015 Ga0099795_100000152 149
514 3300007788 Ga0099795_10000075 Ga0099795_100000755 149
515 3300009093 Ga0105240_10123251 Ga0105240_101232513 149
516 3300009094 Ga0111539_10010862 Ga0111539_100108626 149
517 3300009094 Ga0111539_10012306 Ga0111539_100123065 149
518 3300009094 Ga0111539_10118141 Ga0111539_101181413 149
519 3300009101 Ga0105247_10306958 Ga0105247_103069581 149
520 3300009147 Ga0114129_10032479 Ga0114129_100324795 149
521 3300009147 Ga0114129_10066916 Ga0114129_100669164 149
522 3300009174 Ga0105241_10298613 Ga0105241_102986132 149
523 3300009174 Ga0105241_10318076 Ga0105241_103180762 149
524 3300009177 Ga0105248_10002211 Ga0105248_100022115 149
525 3300009553 Ga0105249_10016579 Ga0105249_100165794 149
526 3300009553 Ga0105249_10035648 Ga0105249_100356484 149
527 3300009553 Ga0105249_10512266 Ga0105249_105122662 149
528 3300010159 Ga0099796_10000044 Ga0099796_1000004420 149
529 3300010159 Ga0099796_10002250 Ga0099796_100022504 149
530 3300010159 Ga0099796_10023934 Ga0099796_100239342 149
531 3300010375 Ga0105239_10179328 Ga0105239_101793282 149
532 3300011119 Ga0105246_10737918 Ga0105246_107379182 149
533 3300013105 Ga0157369_10189001 Ga0157369_101890013 149
534 3300013296 Ga0157374_10945868 Ga0157374_109458682 149
535 3300013306 Ga0163162_11393311 Ga0163162_113933111 149
536 3300013306 Ga0163162_11736138 Ga0163162_117361381 149
537 3300013307 Ga0157372_10606954 Ga0157372_106069542 149
538 3300013308 Ga0157375_10008687 Ga0157375_100086872 149
539 3300013308 Ga0157375_10219556 Ga0157375_102195562 149
540 3300014325 Ga0163163_10012973 Ga0163163_100129734 149
541 3300014326 Ga0157380_10044056 Ga0157380_100440564 149
542 3300014745 Ga0157377_10007978 Ga0157377_100079782 149
543 3300014745 Ga0157377_10866286 Ga0157377_108662861 149
544 3300025901 Ga0207688_10018733 Ga0207688_100187332 149
545 3300025901 Ga0207688_10565796 Ga0207688_105657962 149
546 3300025903 Ga0207680_10177627 Ga0207680_101776271 149
547 3300025907 Ga0207645_10168452 Ga0207645_101684522 149
548 3300025908 Ga0207643_10360500 Ga0207643_103605002 149
549 3300025910 Ga0207684_10461319 Ga0207684_104613192 149
550 3300025911 Ga0207654_10196779 Ga0207654_101967792 149
551 3300025912 Ga0207707_10027997 Ga0207707_100279974 149
552 3300025917 Ga0207660_10084613 Ga0207660_100846132 149
553 3300025918 Ga0207662_10009609 Ga0207662_100096093 149
554 3300025919 Ga0207657_10523815 Ga0207657_105238152 149
555 3300025920 Ga0207649_10064552 Ga0207649_100645522 149
556 3300025920 Ga0207649_10351884 Ga0207649_103518842 149
557 3300025921 Ga0207652_10130779 Ga0207652_101307793 149
558 3300025923 Ga0207681_10012376 Ga0207681_100123764 149
559 3300025925 Ga0207650_10131099 Ga0207650_101310991 149
560 3300025925 Ga0207650_10167603 Ga0207650_101676032 149
561 3300025926 Ga0207659_10010114 Ga0207659_100101142 149
562 3300025928 Ga0207700_10087161 Ga0207700_100871612 149
563 3300025931 Ga0207644_10145980 Ga0207644_101459801 149
564 3300025932 Ga0207690_10025157 Ga0207690_100251574 149
565 3300025933 Ga0207706_10004055 Ga0207706_1000405511 149
566 3300025933 Ga0207706_10661564 Ga0207706_106615642 149
567 3300025938 Ga0207704_10011084 Ga0207704_100110844 149
568 3300025940 Ga0207691_10036071 Ga0207691_100360714 149
569 3300025941 Ga0207711_10679511 Ga0207711_106795112 149
570 3300025942 Ga0207689_10006698 Ga0207689_100066983 149
571 3300025942 Ga0207689_10307491 Ga0207689_103074912 149
572 3300025944 Ga0207661_11016531 Ga0207661_110165312 149
573 3300025945 Ga0207679_10040593 Ga0207679_100405932 149
574 3300025945 Ga0207679_10046570 Ga0207679_100465702 149
575 3300025949 Ga0207667_11238969 Ga0207667_112389692 149
576 3300025960 Ga0207651_10021146 Ga0207651_100211464 149
577 3300025961 Ga0207712_10011813 Ga0207712_100118134 149
578 3300025961 Ga0207712_10420199 Ga0207712_104201992 149
579 3300025972 Ga0207668_10006950 Ga0207668_100069505 149
580 3300025986 Ga0207658_10595958 Ga0207658_105959582 149
581 3300026035 Ga0207703_10059027 Ga0207703_100590274 149
582 3300026067 Ga0207678_10225851 Ga0207678_102258512 149
583 3300026075 Ga0207708_10507421 Ga0207708_105074212 149
584 3300026088 Ga0207641_10093434 Ga0207641_100934344 149
585 3300026088 Ga0207641_12236201 Ga0207641_122362011 149
586 3300026089 Ga0207648_10188118 Ga0207648_101881183 149
587 3300026095 Ga0207676_10007265 Ga0207676_100072656 149
588 3300026116 Ga0207674_10013468 Ga0207674_100134685 149
589 3300026116 Ga0207674_10403954 Ga0207674_104039542 149
590 3300026118 Ga0207675_100003162 Ga0207675_10000316211 149
591 3300026118 Ga0207675_100006059 Ga0207675_1000060597 149
592 3300026118 Ga0207675_100013963 Ga0207675_1000139635 149
593 3300026121 Ga0207683_10051793 Ga0207683_100517934 149
594 3300027512 Ga0209179_1000010 Ga0209179_100001061 149
595 3300027512 Ga0209179_1007430 Ga0209179_10074302 149
596 3300027512 Ga0209179_1027827 Ga0209179_10278272 149
597 3300027666 Ga0209282_1201044 Ga0209282_12010442 149
598 3300027907 Ga0207428_10003362 Ga0207428_1000336210 149
599 3300028379 Ga0268266_10110772 Ga0268266_101107723 149
600 3300028379 Ga0268266_10330724 Ga0268266_103307242 149
601 3300028380 Ga0268265_10005465 Ga0268265_100054652 149
602 3300028380 Ga0268265_10395545 Ga0268265_103955452 149
603 3300028381 Ga0268264_10041471 Ga0268264_100414715 149
604 3300028381 Ga0268264_11782931 Ga0268264_117829312 149
605 3300031249 Ga0265339_10260709 Ga0265339_102607091 149
606 3300031507 Ga0307509_10000365 Ga0307509_100003652 149
607 3300031548 Ga0307408_100063639 Ga0307408_1000636392 149
608 3300031548 Ga0307408_100105824 Ga0307408_1001058242 149
609 3300031548 Ga0307408_100112043 Ga0307408_1001120431 149
610 3300031548 Ga0307408_100125213 Ga0307408_1001252132 149
611 3300031595 Ga0265313_10112395 Ga0265313_101123952 149
612 3300031727 Ga0316576_10250249 Ga0316576_102502492 149
613 3300031730 Ga0307516_10000209 Ga0307516_1000020949 149
614 3300031731 Ga0307405_10180567 Ga0307405_101805672 149
615 3300031731 Ga0307405_10224512 Ga0307405_102245122 149
616 3300031824 Ga0307413_10713379 Ga0307413_107133792 149
617 3300031824 Ga0307413_10720323 Ga0307413_107203232 149
618 3300031852 Ga0307410_10065703 Ga0307410_100657033 149
619 3300031852 Ga0307410_10469405 Ga0307410_104694052 149
620 3300031901 Ga0307406_10016892 Ga0307406_100168922 149
621 3300031901 Ga0307406_10670790 Ga0307406_106707902 149
622 3300031911 Ga0307412_10126396 Ga0307412_101263962 149
623 3300031911 Ga0307412_11646992 Ga0307412_116469921 149
624 3300031995 Ga0307409_100834635 Ga0307409_1008346352 149
625 3300032002 Ga0307416_102436284 Ga0307416_1024362842 149
626 3300032004 Ga0307414_10821446 Ga0307414_108214461 149
627 3300032005 Ga0307411_10217655 Ga0307411_102176552 149
628 3300032126 Ga0307415_101112519 Ga0307415_1011125191 149
629 3300032168 Ga0316593_10000692 Ga0316593_100006924 149
630 3300032168 Ga0316593_10005117 Ga0316593_100051174 149
631 3300032168 Ga0316593_10039782 Ga0316593_100397822 149
632 3300033524 Ga0316592_1000870 Ga0316592_10008704 149
633 3300033524 Ga0316592_1002547 Ga0316592_10025473 149
634 3300033529 Ga0316587_1000489 Ga0316587_10004895 149
635 3300033541 Ga0316596_1000453 Ga0316596_10004534 149
636 3300033541 Ga0316596_1002939 Ga0316596_10029393 149
637 3300035113 Ga0373936_0031837 Ga0373936_0031837_142_603 149
638 3300035121 Ga0373960_0131864 Ga0373960_0131864_82_531 149
639 3300035207 Ga0373942_0065859 Ga0373942_0065859_285_734 149
640 3300035691 Ga0373931_0055499 Ga0373931_0055499_551_1000 149
641 3300036647 Ga0316582_0645729 Ga0316582_0645729_97_570 149
642 3300036712 Ga0316584_0150738 Ga0316584_0150738_1226_1699 149
643 3300036712 Ga0316584_0163799 Ga0316584_0163799_1145_1618 149
644 3300038725 Ga0400484_16028 Ga0400484_16028_5993_6484 149
645 3300038726 Ga0400490_14517 Ga0400490_14517_923_1414 149
646 3300038726 Ga0400490_31423 Ga0400490_31423_5308_5781 149
647 3300038727 Ga0400491_20315 Ga0400491_20315_696_1169 149
648 3300038727 Ga0400491_22710 Ga0400491_22710_2985_3476 149
649 3300038735 Ga0400485_11431 Ga0400485_11431_97712_98185 149
650 3300038742 Ga0400486_18012 Ga0400486_18012_44031_44504 149
651 3300039062 Ga0400483_004216 Ga0400483_004216_221_685 149
652 3300039062 Ga0400483_145565 Ga0400483_145565_3769_4248 149
653 3300039062 Ga0400483_178062 Ga0400483_178062_5242_5706 149
654 3300039062 Ga0400483_229521 Ga0400483_229521_421_885 149
655 3300039062 Ga0400483_268051 Ga0400483_268051_15527_16006 149
656 3300039110 Ga0400487_20104 Ga0400487_20104_4712_5179 149
657 3300039110 Ga0400487_24806 Ga0400487_24806_29620_30087 149
658 3300039110 Ga0400487_26238 Ga0400487_26238_9904_10377 149
659 3300041453 Ga0451797_0371857 Ga0451797_0371857_919_1392 149
660 3300042002 Ga0439442_046765 Ga0439442_046765_74_526 149
661 3300042005 Ga0439448_0028169 Ga0439448_0028169_743_1195 149
662 3300042016 Ga0439463_051671 Ga0439463_051671_463_915 149
663 3300042118 Ga0450914_040850 Ga0450914_040850_113_565 149
664 3300042126 Ga0450888_031509 Ga0450888_031509_235_687 149
665 3300042439 Ga0439464_0097903 Ga0439464_0097903_273_725 149
666 3300042876 Ga0451577_0041337 Ga0451577_0041337_1756_2217 149
667 3300044683 Ga0466965_0103131 Ga0466965_0103131_925_1428 149
668 3300044712 Ga0453684_0456139 Ga0453684_0456139_579_1040 149
669 3300045051 Ga0451576_0016225 Ga0451576_0016225_5039_5488 149
670 3300045051 Ga0451576_0212501 Ga0451576_0212501_274_723 149
671 3300046460 Ga0495638_0001192 Ga0495638_0001192_5633_6142 149
672 3300046460 Ga0495638_0477398 Ga0495638_0477398_132_617 149
673 3300046471 Ga0495650_0013647 Ga0495650_0013647_1280_1798 149
674 3300046471 Ga0495650_0208495 Ga0495650_0208495_121_645 149
675 3300046519 Ga0495632_0178624 Ga0495632_0178624_112_591 149
676 3300046616 Ga0495668_0243504 Ga0495668_0243504_179_700 149
677 3300046660 Ga0495625_0003539 Ga0495625_0003539_13508_14017 149
678 3300046660 Ga0495625_0239180 Ga0495625_0239180_303_782 149
679 3300047320 Ga0495672_0044208 Ga0495672_0044208_1273_1767 149
680 3300048907 Ga0496104_0163884 Ga0496104_0163884_259_708 149
681 3300048911 Ga0496108_0151347 Ga0496108_0151347_200_649 149
682 3300048913 Ga0496110_0528532 Ga0496110_0528532_534_1016 149
683 3300048916 Ga0496113_0101972 Ga0496113_0101972_379_828 149
684 3300048917 Ga0496114_0162159 Ga0496114_0162159_585_1067 149
685 3300048924 Ga0496121_0090713 Ga0496121_0090713_1756_2265 149
686 3300049571 Ga0501034_0188223 Ga0501034_0188223_535_1017 149
687 3300049581 Ga0501047_0323021 Ga0501047_0323021_317_805 149
688 3300049591 Ga0501075_0576176 Ga0501075_0576176_71_526 149
689 3300049822 Ga0501035_0196440 Ga0501035_0196440_643_1122 149
690 3300049823 Ga0501044_0617669 Ga0501044_0617669_13_501 149
691 3300050507 nmdc:mga05p37_2025310_c1 nmdc:mga05p37_2025310_c1_44_517 149
692 3300050507 nmdc:mga05p37_484178_c1 nmdc:mga05p37_484178_c1_149_601 149
693 3300050507 nmdc:mga05p37_51204_c1 nmdc:mga05p37_51204_c1_1718_2167 149
694 3300050508 nmdc:mga09592_3351_c1 nmdc:mga09592_3351_c1_11816_12265 149
695 3300050508 nmdc:mga09592_414837_c1 nmdc:mga09592_414837_c1_57_530 149
696 3300050508 nmdc:mga09592_98502_c1 nmdc:mga09592_98502_c1_1025_1477 149
697 3300050509 nmdc:mga0qj67_1124394_c1 nmdc:mga0qj67_1124394_c1_63_521 149
698 3300050509 nmdc:mga0qj67_17344_c1 nmdc:mga0qj67_17344_c1_870_1319 149
699 3300050509 nmdc:mga0qj67_3821_c1 nmdc:mga0qj67_3821_c1_6946_7398 149
700 3300050509 nmdc:mga0qj67_931487_c1 nmdc:mga0qj67_931487_c1_171_656 149
701 3300050510 nmdc:mga06r32_1129060_c1 nmdc:mga06r32_1129060_c1_24_473 149
702 3300050510 nmdc:mga06r32_22643_c1 nmdc:mga06r32_22643_c1_3278_3727 149
703 3300050510 nmdc:mga06r32_23_c1 nmdc:mga06r32_23_c1_12005_12454 149
704 3300050510 nmdc:mga06r32_3897_c1 nmdc:mga06r32_3897_c1_7878_8330 149
705 3300050511 nmdc:mga08y16_10408_c1 nmdc:mga08y16_10408_c1_138_590 149
706 3300050511 nmdc:mga08y16_12878_c1 nmdc:mga08y16_12878_c1_3624_4073 149
707 3300050512 nmdc:mga0n895_316603_c1 nmdc:mga0n895_316603_c1_1035_1484 149
708 3300050515 nmdc:mga0a205_380733_c1 nmdc:mga0a205_380733_c1_398_850 149
709 3300053088 Ga0500644_0233730 Ga0500644_0233730_250_756 149
710 3300053093 Ga0500651_0577865 Ga0500651_0577865_65_541 149
711 3300053109 Ga0500569_013363 Ga0500569_013363_385_843 149
712 3300053130 Ga0500642_0095320 Ga0500642_0095320_151_672 149
713 3300053139 Ga0500568_0119260 Ga0500568_0119260_277_774 149
714 3300053156 Ga0500622_0001473 Ga0500622_0001473_17935_18432 149
715 3300053156 Ga0500622_0013289 Ga0500622_0013289_2370_2867 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

34

160

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h4g-assembly1.cif.gz_B crystal structure of (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase from burkholderia thailandensis e264 0.9485 7 144
5buw-assembly1.cif.gz_A crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from yersinia pestis 0.944 6 148
4h4g-assembly1.cif.gz_A crystal structure of (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase from burkholderia thailandensis e264 0.9422 7 149
4h4g-assembly1.cif.gz_I crystal structure of (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase from burkholderia thailandensis e264 0.9403 5 148
5buy-assembly1.cif.gz_F crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from francisella tularensis 0.9389 5 146
ID Description Score Start End Superfamily
4h4gA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9422 7 149 3.10.129.10
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9389 5 146 3.10.129.10
4h4gA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9355 7 149 3.10.129.10
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9255 5 146 3.10.129.10
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9249 7 145 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A534II55-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) 0.9608 1 141 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A7S1MYI3-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ 0.9585 23 134 GO:0016829
AF-A0A317CP42-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9581 5 149 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A6N6THU7-F1-model_v4 Multifunctional fusion protein [Includes: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase); UDP-3-O-acylglucosamine N-acyltransferase (EC 2.3.1.191)] 0.9577 4 146 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0016410
GO:0019171
AF-A0A1J5SG54-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.59) 0.957 5 146 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171

Feature Viewer

pLDDT pTM Quality
90.29 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map