F476791

General Info

Members Datasets Scaffolds Average Seq Length
711 378 664 150

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0003464|Ga0451577_0003464_8684_9250
Length 169
Sequence MNPARKRRLWFVLAVLAAGAAATALVTMALQRNVAYLYTPAEVLRGDAGARVVAGDAVFRLGGMVEAGSFQRDEGSMEARFRVTDGDAQLPVRYTGILPDLFREKQAVVATGRMQDGVFVAEQVLAKHDETYVPKEVADKMGLAHRKHGVVMPANGQQQAPSAAPSKGY

Samples

Sample ID Description Type Environment
1 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221559 Lysobacter sp. Root559 Isolate Unclassified
5 2643221573 Lysobacter sp. Root604 Isolate Unclassified
6 2643221586 Lysobacter sp. Root667 Isolate Unclassified
7 2643221593 Lysobacter sp. Root690 Isolate Unclassified
8 2643221612 Lysobacter sp. Root76 Isolate Unclassified
9 2643221695 Lysobacter sp. Root494 Isolate Unclassified
10 2643221720 Lysobacter sp. Root916 Isolate Unclassified
11 2643221727 Lysobacter sp. Root96 Isolate Unclassified
12 2643221728 Lysobacter sp. Root983 Isolate Unclassified
13 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
14 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
15 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
16 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
17 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
18 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
19 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
20 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
21 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
22 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
23 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
24 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
25 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
26 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
27 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
28 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
29 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
30 2919513703 Luteimonas sp. 3794 Isolate Unclassified
31 2919675420 Luteimonas terrae 4099 Isolate Unclassified
32 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
33 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
34 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
35 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
36 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
37 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
38 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
39 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
40 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
41 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
42 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
43 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
44 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
45 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
46 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
47 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
48 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
49 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
50 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
53 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
54 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
55 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
56 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
57 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
58 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
59 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
60 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
61 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
62 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
63 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
64 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
65 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
66 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
67 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
68 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
69 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
70 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
71 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
72 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
73 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
74 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
75 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
76 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
77 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
78 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
79 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
80 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
83 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
84 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
85 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
86 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
87 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
88 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
89 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
90 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
91 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
92 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
93 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
94 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
95 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
96 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
97 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
104 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
105 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
106 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
107 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
108 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
109 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
110 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
111 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
117 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
134 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
135 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
136 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
137 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
149 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
152 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
153 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
154 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
157 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
219 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
220 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
221 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
222 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
223 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
224 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
225 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
226 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
229 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
230 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
231 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
232 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
233 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
234 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
235 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
236 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
237 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
238 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
239 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
240 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
241 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
242 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
243 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
244 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
245 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
247 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
250 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
251 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
257 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
258 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
259 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
260 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
261 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
262 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
263 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
264 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
265 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
266 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
267 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
268 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
269 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
270 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
271 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
272 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
273 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
274 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
275 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
276 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
277 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
278 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
279 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
280 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
281 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
282 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
283 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
284 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
285 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
286 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
287 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
288 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
289 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
290 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
291 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
292 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
293 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
294 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
295 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
296 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
299 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
300 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
301 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
302 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
303 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
304 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
305 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
306 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
307 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
308 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
325 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
333 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
334 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
335 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
347 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
348 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
349 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
350 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
351 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
352 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
356 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
360 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
370 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
371 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
372 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
373 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
374 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
375 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
376 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
377 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
378 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.11
Metatranscriptomes 0.28
Isolates 6.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 13.92
Nodule 0.14
Rhizoplane 3.94
Rhizosphere 66.24
Stem 0
Stem Tuber 0
Unclassified 15.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1036061 3300002774 Bacteria 658
2 JGI25151J46595_10000041 3300003187 Bacteria 174472
3 JGI25151J46595_10022201 3300003187 Bacteria 2639
4 rootH2_10011881 3300003320 Bacteria 4523
5 rootH1_10259244 3300003323 Bacteria 2884
6 Ga0055526_1000071 3300003771 Bacteria 96766
7 Ga0055526_1002377 3300003771 Bacteria 12752
8 Ga0055526_1029797 3300003771 Bacteria 1609
9 Ga0055537_1000164 3300003773 Bacteria 49285
10 Ga0055537_1000203 3300003773 Bacteria 44421
11 Ga0055524_1000041 3300003775 Bacteria 156728
12 Ga0055524_1025173 3300003775 Bacteria 1869
13 Ga0055524_1029812 3300003775 Bacteria 1603
14 Ga0055536_1000367 3300003781 Bacteria 33548
15 Ga0055536_1000709 3300003781 Bacteria 22354
16 Ga0055536_1001874 3300003781 Bacteria 12248
17 Ga0055536_1046680 3300003781 Bacteria 982
18 Ga0055534_1000026 3300003784 Bacteria 130908
19 Ga0055534_1000040 3300003784 Bacteria 104019
20 Ga0055534_1045248 3300003784 Bacteria 637
21 Ga0055534_1049363 3300003784 Bacteria 601
22 Ga0055528_1000017 3300003790 Bacteria 156728
23 Ga0055528_1000951 3300003790 Bacteria 19236
24 Ga0055530_10000772 3300003791 Bacteria 26697
25 Ga0055530_10000972 3300003791 Bacteria 23228
26 Ga0055530_10007918 3300003791 Bacteria 4358
27 Ga0055531_10001367 3300003794 Bacteria 18110
28 Ga0055531_10010225 3300003794 Bacteria 4691
29 Ga0055531_10010515 3300003794 Bacteria 4587
30 Ga0058692_1000012 3300003856 Bacteria 318930
31 Ga0065714_10071120 3300005288 Bacteria 3662
32 Ga0065714_10112470 3300005288 Bacteria 1455
33 Ga0065712_10014013 3300005290 Bacteria 2302
34 Ga0065715_10057607 3300005293 Bacteria 1150
35 Ga0065715_10269005 3300005293 Bacteria 1116
36 Ga0065715_10521248 3300005293 Bacteria 760
37 Ga0065707_10082671 3300005295 Bacteria 12875
38 Ga0070658_10920019 3300005327 Bacteria 760
39 Ga0070690_100029887 3300005330 Bacteria 3383
40 Ga0070670_100080049 3300005331 Bacteria 2808
41 Ga0070670_100136865 3300005331 Bacteria 2117
42 Ga0070677_10030830 3300005333 Bacteria 2044
43 Ga0068869_100123791 3300005334 Bacteria 1981
44 Ga0068869_101008657 3300005334 Unclassified 725
45 Ga0070680_100351344 3300005336 Bacteria 1254
46 Ga0070689_100009182 3300005340 Bacteria 7001
47 Ga0070691_10142858 3300005341 Bacteria 1221
48 Ga0070687_100073255 3300005343 Bacteria 1845
49 Ga0070661_100195709 3300005344 Bacteria 1543
50 Ga0070661_100760797 3300005344 Bacteria 793
51 Ga0070692_10514805 3300005345 Bacteria 778
52 Ga0070668_100029849 3300005347 Bacteria 4143
53 Ga0070668_100218595 3300005347 Bacteria 1570
54 Ga0070669_100077494 3300005353 Bacteria 2470
55 Ga0070669_101141301 3300005353 Bacteria 672
56 Ga0070675_100146002 3300005354 Bacteria 2025
57 Ga0070675_100245323 3300005354 Bacteria 1566
58 Ga0070675_101033784 3300005354 Bacteria 755
59 Ga0070671_100030322 3300005355 Bacteria 4463
60 Ga0070671_100137708 3300005355 Bacteria 2059
61 Ga0070673_100050505 3300005364 Bacteria 3252
62 Ga0070659_100029751 3300005366 Bacteria 4222
63 Ga0070659_100423451 3300005366 Bacteria 1126
64 Ga0070667_100124111 3300005367 Bacteria 2249
65 Ga0070667_100320191 3300005367 Bacteria 1399
66 Ga0070667_101220162 3300005367 Bacteria 704
67 Ga0070710_10483003 3300005437 Bacteria 845
68 Ga0070701_10053061 3300005438 Bacteria 2109
69 Ga0070705_100234524 3300005440 Bacteria 1279
70 Ga0070663_100541147 3300005455 Bacteria 972
71 Ga0070663_100586687 3300005455 Bacteria 936
72 Ga0070678_100116456 3300005456 Bacteria 2100
73 Ga0070678_100275041 3300005456 Bacteria 1422
74 Ga0070662_100154171 3300005457 Bacteria 1792
75 Ga0070662_100204193 3300005457 Bacteria 1569
76 Ga0070662_101750682 3300005457 Bacteria 537
77 Ga0070681_10152415 3300005458 Bacteria 2238
78 Ga0068867_100163801 3300005459 Bacteria 1755
79 Ga0070685_10015831 3300005466 Bacteria 4010
80 Ga0070706_100002239 3300005467 Bacteria 19629
81 Ga0070707_101752464 3300005468 Bacteria 588
82 Ga0070684_100017714 3300005535 Bacteria 5854
83 Ga0068853_101559225 3300005539 Bacteria 640
84 Ga0070672_100165244 3300005543 Bacteria 1838
85 Ga0070686_100016707 3300005544 Bacteria 4273
86 Ga0070665_100053732 3300005548 Bacteria 4040
87 Ga0070665_100258149 3300005548 Bacteria 1744
88 Ga0070665_100395068 3300005548 Bacteria 1390
89 Ga0070665_100671842 3300005548 Bacteria 1049
90 Ga0070665_101502027 3300005548 Unclassified 682
91 Ga0068855_101317421 3300005563 Bacteria 747
92 Ga0070664_100170864 3300005564 Bacteria 1928
93 Ga0070664_100414630 3300005564 Bacteria 1233
94 Ga0070664_101033581 3300005564 Bacteria 773
95 Ga0068854_100224376 3300005578 Bacteria 1488
96 Ga0068854_100224836 3300005578 Bacteria 1487
97 Ga0070702_100074035 3300005615 Bacteria 2020
98 Ga0068852_100467619 3300005616 Bacteria 1251
99 Ga0068859_100472301 3300005617 Bacteria 1350
100 Ga0068864_100032876 3300005618 Bacteria 4409
101 Ga0068864_100087927 3300005618 Bacteria 2736
102 Ga0068861_100002878 3300005719 Bacteria 11338
103 Ga0068861_100889453 3300005719 Bacteria 842
104 Ga0068851_10385386 3300005834 Bacteria 822
105 Ga0068863_100074098 3300005841 Bacteria 3220
106 Ga0068858_101158712 3300005842 Bacteria 759
107 Ga0068860_100129518 3300005843 Bacteria 2421
108 Ga0068860_100207481 3300005843 Bacteria 1900
109 Ga0068862_100001302 3300005844 Bacteria 23282
110 Ga0068862_100109763 3300005844 Bacteria 2420
111 Ga0068862_100976085 3300005844 Bacteria 837
112 Ga0075365_10174988 3300006038 Bacteria 1499
113 Ga0075363_100418426 3300006048 Bacteria 789
114 Ga0075364_10000477 3300006051 Bacteria 20375
115 Ga0075364_10022493 3300006051 Bacteria 3982
116 Ga0075364_10098188 3300006051 Bacteria 1948
117 Ga0075364_10409467 3300006051 Bacteria 925
118 Ga0075364_10495372 3300006051 Bacteria 835
119 Ga0075364_10723805 3300006051 Bacteria 679
120 Ga0075369_10063746 3300006186 Bacteria 1613
121 Ga0075369_10064872 3300006186 Bacteria 1600
122 Ga0068871_100248988 3300006358 Bacteria 1547
123 Ga0075428_100000597 3300006844 Bacteria 36817
124 Ga0075428_100006416 3300006844 Bacteria 13088
125 Ga0075428_100298074 3300006844 Bacteria 1734
126 Ga0075428_100580795 3300006844 Bacteria 1197
127 Ga0075428_100600536 3300006844 Bacteria 1175
128 Ga0075430_100000758 3300006846 Bacteria 24898
129 Ga0075430_100052497 3300006846 Bacteria 3434
130 Ga0075430_100094238 3300006846 Bacteria 2503
131 Ga0075430_100208039 3300006846 Bacteria 1623
132 Ga0075430_100364533 3300006846 Bacteria 1193
133 Ga0075430_100438644 3300006846 Bacteria 1078
134 Ga0075431_100001382 3300006847 Bacteria 22271
135 Ga0075431_100010406 3300006847 Bacteria 9349
136 Ga0075431_100014174 3300006847 Bacteria 8061
137 Ga0075431_100345654 3300006847 Bacteria 1496
138 Ga0075431_100595856 3300006847 Bacteria 1089
139 Ga0075429_100000507 3300006880 Bacteria 29416
140 Ga0075429_100506012 3300006880 Bacteria 1058
141 Ga0068865_100182098 3300006881 Bacteria 1619
142 Ga0068865_100780070 3300006881 Bacteria 823
143 Ga0068865_101442502 3300006881 Bacteria 615
144 Ga0097620_100472327 3300006931 Bacteria 1350
145 Ga0105251_10007635 3300009011 Bacteria 6622
146 Ga0105244_10051004 3300009036 Bacteria 2110
147 Ga0105244_10202722 3300009036 Bacteria 935
148 Ga0111539_10011412 3300009094 Bacteria 11151
149 Ga0111539_10039009 3300009094 Bacteria 5727
150 Ga0111539_10089754 3300009094 Bacteria 3612
151 Ga0111539_10188018 3300009094 Bacteria 2411
152 Ga0105247_10055610 3300009101 Bacteria 2442
153 Ga0114129_10014234 3300009147 Bacteria 11335
154 Ga0114129_10014387 3300009147 Bacteria 11277
155 Ga0114129_12057450 3300009147 Bacteria 690
156 Ga0105243_10005221 3300009148 Bacteria 10161
157 Ga0105242_12534422 3300009176 Bacteria 561
158 Ga0105248_10050912 3300009177 Bacteria 4647
159 Ga0105248_10241912 3300009177 Bacteria 2032
160 Ga0105249_10039918 3300009553 Bacteria 4262
161 Ga0105239_11640907 3300010375 Bacteria 744
162 Ga0105246_10153986 3300011119 Bacteria 1743
163 Ga0157328_1017315 3300012478 Bacteria 575
164 Ga0157318_1016276 3300012482 Bacteria 616
165 Ga0157345_1018744 3300012498 Bacteria 686
166 Ga0157316_1000764 3300012510 Bacteria 1802
167 Ga0157327_1002256 3300012512 Bacteria 1310
168 Ga0157373_10402291 3300013100 Bacteria 981
169 Ga0157373_10720028 3300013100 Bacteria 732
170 Ga0157371_10000400 3300013102 Bacteria 54327
171 Ga0157371_10007822 3300013102 Bacteria 8583
172 Ga0157371_10007889 3300013102 Bacteria 8545
173 Ga0157371_10066548 3300013102 Bacteria 2551
174 Ga0157370_10006775 3300013104 Bacteria 12568
175 Ga0157370_10081598 3300013104 Bacteria 3042
176 Ga0157370_10777838 3300013104 Bacteria 871
177 Ga0157374_10331601 3300013296 Bacteria 1509
178 Ga0157378_10183228 3300013297 Bacteria 1971
179 Ga0163162_10142154 3300013306 Bacteria 2514
180 Ga0163162_10684904 3300013306 Bacteria 1148
181 Ga0157372_10106641 3300013307 Bacteria 3205
182 Ga0157372_10943780 3300013307 Bacteria 1000
183 Ga0157375_10133542 3300013308 Bacteria 2603
184 Ga0157375_10136415 3300013308 Bacteria 2578
185 Ga0163163_10252071 3300014325 Bacteria 1816
186 Ga0157380_10006431 3300014326 Bacteria 8273
187 Ga0157380_10506959 3300014326 Bacteria 1173
188 Ga0182008_10000123 3300014497 Bacteria 58726
189 Ga0182008_10044303 3300014497 Bacteria 2213
190 Ga0157377_10029771 3300014745 Bacteria 2952
191 Ga0157377_11160391 3300014745 Unclassified 595
192 Ga0157379_10080526 3300014968 Bacteria 2917
193 Ga0157379_12506707 3300014968 Bacteria 516
194 Ga0182006_1010265 3300015261 Bacteria 4170
195 Ga0182006_1021769 3300015261 Bacteria 2670
196 Ga0182006_1072618 3300015261 Bacteria 1272
197 Ga0182007_10000098 3300015262 Bacteria 61202
198 Ga0182005_1000825 3300015265 Bacteria 13935
199 Ga0183360_10001 3300015689 Bacteria 3943671
200 Ga0163161_10001879 3300017792 Bacteria 15327
201 Ga0163161_10002326 3300017792 Bacteria 13623
202 Ga0163161_10016180 3300017792 Bacteria 5206
203 Ga0163161_10176542 3300017792 Bacteria 1636
204 Ga0163161_11214146 3300017792 Bacteria 652
205 Ga0207425_1007719 3300025245 Bacteria 2811
206 Ga0209565_1000001 3300025263 Bacteria 2950419
207 Ga0209565_1000022 3300025263 Bacteria 390888
208 Ga0209673_1000001 3300025273 Bacteria 3176258
209 Ga0209673_1000110 3300025273 Bacteria 181173
210 Ga0209673_1006118 3300025273 Bacteria 5901
211 Ga0209130_1008496 3300025284 Bacteria 3027
212 Ga0209130_1012924 3300025284 Bacteria 2161
213 Ga0209675_1000001 3300025291 Bacteria 2950293
214 Ga0209675_1000060 3300025291 Bacteria 184316
215 Ga0209675_1030644 3300025291 Bacteria 1280
216 Ga0209676_1000219 3300025292 Bacteria 125330
217 Ga0209676_1000279 3300025292 Bacteria 106358
218 Ga0209676_1000700 3300025292 Bacteria 46962
219 Ga0209676_1000993 3300025292 Bacteria 33600
220 Ga0209676_1006055 3300025292 Bacteria 6090
221 Ga0209676_1006460 3300025292 Bacteria 5781
222 Ga0209676_1008321 3300025292 Bacteria 4645
223 Ga0209676_1011167 3300025292 Bacteria 3651
224 Ga0209025_1000015 3300025294 Bacteria 808120
225 Ga0209025_1002408 3300025294 Bacteria 19932
226 Ga0209025_1003524 3300025294 Bacteria 14690
227 Ga0209025_1034193 3300025294 Bacteria 2328
228 Ga0209025_1044149 3300025294 Bacteria 1867
229 Ga0209564_1000001 3300025295 Bacteria 3176258
230 Ga0209564_1000304 3300025295 Bacteria 97304
231 Ga0209564_1004198 3300025295 Bacteria 8983
232 Ga0209050_1000542 3300025298 Bacteria 62500
233 Ga0209050_1000825 3300025298 Bacteria 43030
234 Ga0209050_1004106 3300025298 Bacteria 10168
235 Ga0209050_1013892 3300025298 Bacteria 3527
236 Ga0209050_1038998 3300025298 Bacteria 1345
237 Ga0209256_1000002 3300025299 Bacteria 1906740
238 Ga0209256_1000898 3300025299 Bacteria 36504
239 Ga0209256_1003923 3300025299 Bacteria 9811
240 Ga0209256_1003949 3300025299 Bacteria 9756
241 Ga0209256_1010135 3300025299 Bacteria 4002
242 Ga0209256_1023236 3300025299 Bacteria 1854
243 Ga0207426_1087682 3300025302 Bacteria 830
244 Ga0209051_1012723 3300025303 Bacteria 4051
245 Ga0209257_1000570 3300025304 Bacteria 62283
246 Ga0209257_1000615 3300025304 Bacteria 58010
247 Ga0209257_1000726 3300025304 Bacteria 50193
248 Ga0209257_1000933 3300025304 Bacteria 40419
249 Ga0209257_1004313 3300025304 Bacteria 11175
250 Ga0209257_1005417 3300025304 Bacteria 8978
251 Ga0209257_1005942 3300025304 Bacteria 8202
252 Ga0209257_1026720 3300025304 Bacteria 1937
253 Ga0207713_1027375 3300025735 Bacteria 2590
254 Ga0207710_10038373 3300025900 Bacteria 2117
255 Ga0207688_10296678 3300025901 Bacteria 988
256 Ga0207645_10031489 3300025907 Bacteria 3412
257 Ga0207684_10002129 3300025910 Bacteria 20290
258 Ga0207662_10024040 3300025918 Bacteria 3505
259 Ga0207657_10003945 3300025919 Bacteria 15757
260 Ga0207649_10103917 3300025920 Bacteria 1886
261 Ga0207649_10387414 3300025920 Bacteria 1043
262 Ga0207649_10570636 3300025920 Bacteria 868
263 Ga0207652_10012548 3300025921 Bacteria 6849
264 Ga0207681_11003921 3300025923 Bacteria 700
265 Ga0207650_10294972 3300025925 Bacteria 1323
266 Ga0207659_10240057 3300025926 Bacteria 1465
267 Ga0207644_10014478 3300025931 Bacteria 5274
268 Ga0207644_10545433 3300025931 Bacteria 959
269 Ga0207706_10321394 3300025933 Bacteria 1347
270 Ga0207709_10000898 3300025935 Bacteria 22480
271 Ga0207670_10327294 3300025936 Bacteria 1207
272 Ga0207704_10057176 3300025938 Bacteria 2394
273 Ga0207691_10120615 3300025940 Bacteria 2324
274 Ga0207711_10139960 3300025941 Bacteria 2176
275 Ga0207689_11071378 3300025942 Unclassified 680
276 Ga0207679_10045070 3300025945 Bacteria 3187
277 Ga0207679_10264414 3300025945 Bacteria 1469
278 Ga0207679_10865260 3300025945 Bacteria 826
279 Ga0207651_10256253 3300025960 Bacteria 1434
280 Ga0207712_10092257 3300025961 Bacteria 2232
281 Ga0207668_10016455 3300025972 Bacteria 4616
282 Ga0207658_10656278 3300025986 Bacteria 946
283 Ga0207677_10147736 3300026023 Bacteria 1809
284 Ga0207678_10488937 3300026067 Bacteria 1072
285 Ga0207678_10546561 3300026067 Bacteria 1013
286 Ga0207708_10080475 3300026075 Bacteria 2503
287 Ga0207641_10276184 3300026088 Bacteria 1578
288 Ga0207648_10121319 3300026089 Bacteria 2298
289 Ga0207674_10276171 3300026116 Bacteria 1628
290 Ga0207674_10667490 3300026116 Bacteria 1004
291 Ga0207675_100000363 3300026118 Bacteria 43476
292 Ga0207675_100016339 3300026118 Bacteria 6928
293 Ga0207675_100917350 3300026118 Bacteria 893
294 Ga0207683_10202175 3300026121 Bacteria 1806
295 Ga0207683_10299071 3300026121 Bacteria 1472
296 Ga0209973_1012321 3300027252 Bacteria 1038
297 Ga0209371_1000007 3300027312 Bacteria 1050654
298 Ga0209969_1002058 3300027360 Bacteria 2774
299 Ga0209967_1016156 3300027364 Bacteria 1072
300 Ga0209981_1005034 3300027378 Bacteria 1749
301 Ga0209995_1019531 3300027471 Bacteria 1119
302 Ga0209999_1002029 3300027543 Bacteria 3534
303 Ga0209982_1000486 3300027552 Bacteria 4941
304 Ga0209970_1003538 3300027614 Bacteria 2619
305 Ga0209983_1031281 3300027665 Bacteria 1135
306 Ga0209971_1000850 3300027682 Bacteria 7870
307 Ga0209974_10005119 3300027876 Bacteria 4631
308 Ga0207428_10030485 3300027907 Bacteria 4458
309 Ga0207428_10032841 3300027907 Bacteria 4268
310 Ga0268266_10179931 3300028379 Bacteria 1925
311 Ga0268266_10219396 3300028379 Bacteria 1747
312 Ga0268266_10309201 3300028379 Bacteria 1476
313 Ga0268266_10331697 3300028379 Bacteria 1426
314 Ga0268266_11244537 3300028379 Unclassified 719
315 Ga0268265_10000243 3300028380 Bacteria 62321
316 Ga0268265_10112416 3300028380 Bacteria 2226
317 Ga0268265_10361488 3300028380 Bacteria 1329
318 Ga0268264_10333330 3300028381 Bacteria 1438
319 Ga0268264_10630754 3300028381 Bacteria 1059
320 Ga0265318_10115957 3300028577 Bacteria 984
321 Ga0307515_10000037 3300028794 Bacteria 331970
322 Ga0268256_1000008 3300030500 Bacteria 1050654
323 Ga0316177_1015236 3300030731 Bacteria 5186
324 Ga0316176_1168218 3300030732 Bacteria 1383
325 Ga0316182_1099026 3300030745 Bacteria 809
326 Ga0316182_1420801 3300030745 Bacteria 1227
327 Ga0265328_10044255 3300031239 Bacteria 1637
328 Ga0265331_10158800 3300031250 Bacteria 1025
329 Ga0265327_10001605 3300031251 Bacteria 27421
330 Ga0265327_10046816 3300031251 Bacteria 2286
331 Ga0265327_10217951 3300031251 Bacteria 859
332 Ga0265316_10029468 3300031344 Bacteria 4512
333 Ga0307509_10931124 3300031507 Bacteria 534
334 Ga0307408_100099944 3300031548 Bacteria 2208
335 Ga0307408_100261516 3300031548 Bacteria 1432
336 Ga0307408_100646392 3300031548 Bacteria 945
337 Ga0307408_100726709 3300031548 Bacteria 895
338 Ga0307408_100966598 3300031548 Bacteria 783
339 Ga0316575_10176940 3300031665 Bacteria 885
340 Ga0316579_10018238 3300031691 Bacteria 3086
341 Ga0265314_10018441 3300031711 Bacteria 5440
342 Ga0307405_10160822 3300031731 Bacteria 1590
343 Ga0307405_10493795 3300031731 Bacteria 980
344 Ga0307405_10752975 3300031731 Bacteria 812
345 Ga0307405_10881125 3300031731 Bacteria 756
346 Ga0316577_10048630 3300031733 Bacteria 2368
347 Ga0307413_10271232 3300031824 Bacteria 1270
348 Ga0307413_10395331 3300031824 Bacteria 1081
349 Ga0307413_10425902 3300031824 Bacteria 1047
350 Ga0307413_10691486 3300031824 Bacteria 846
351 Ga0307413_11252776 3300031824 Bacteria 647
352 Ga0307406_10198670 3300031901 Bacteria 1474
353 Ga0307406_10325756 3300031901 Bacteria 1190
354 Ga0307406_10462040 3300031901 Bacteria 1021
355 Ga0307406_10832393 3300031901 Bacteria 781
356 Ga0307406_11174781 3300031901 Bacteria 665
357 Ga0307407_10202619 3300031903 Bacteria 1331
358 Ga0307407_10413487 3300031903 Bacteria 970
359 Ga0307412_10000684 3300031911 Bacteria 19615
360 Ga0307412_10116373 3300031911 Bacteria 1917
361 Ga0307412_11920201 3300031911 Bacteria 547
362 Ga0307409_100179830 3300031995 Bacteria 1871
363 Ga0307409_100206880 3300031995 Bacteria 1760
364 Ga0307409_101561820 3300031995 Bacteria 688
365 Ga0307416_100091070 3300032002 Bacteria 2618
366 Ga0307416_100560435 3300032002 Bacteria 1217
367 Ga0307416_100591092 3300032002 Bacteria 1188
368 Ga0307416_100656311 3300032002 Bacteria 1134
369 Ga0307414_10000988 3300032004 Bacteria 14519
370 Ga0307414_10201971 3300032004 Bacteria 1617
371 Ga0307414_10207378 3300032004 Bacteria 1599
372 Ga0307414_10428930 3300032004 Bacteria 1154
373 Ga0307414_10541219 3300032004 Bacteria 1036
374 Ga0307414_10603811 3300032004 Bacteria 984
375 Ga0307414_10677936 3300032004 Bacteria 931
376 Ga0307414_10732778 3300032004 Bacteria 897
377 Ga0307414_10893419 3300032004 Bacteria 814
378 Ga0307414_10922141 3300032004 Bacteria 801
379 Ga0307411_10022498 3300032005 Bacteria 3712
380 Ga0307411_10041896 3300032005 Bacteria 2917
381 Ga0307411_11541490 3300032005 Bacteria 612
382 Ga0307415_100050782 3300032126 Bacteria 2812
383 Ga0307415_102087881 3300032126 Bacteria 553
384 Ga0316585_10165660 3300032137 Bacteria 730
385 Ga0316593_10000885 3300032168 Bacteria 6099
386 Ga0316593_10015361 3300032168 Bacteria 2302
387 Ga0373932_0225699 3300035112 Bacteria 675
388 Ga0316574_0043722 3300035398 Bacteria 2769
389 Ga0373931_0071057 3300035691 Bacteria 1900
390 Ga0316582_0002695 3300036647 Bacteria 8423
391 Ga0316582_0018822 3300036647 Bacteria 4028
392 Ga0316584_0032994 3300036712 Bacteria 3833
393 Ga0316584_0610730 3300036712 Bacteria 755
394 Ga0395899_0061007 3300037312 Bacteria 2777
395 Ga0395900_0022237 3300037418 Bacteria 6488
396 Ga0395905_0002691 3300037471 Bacteria 19486
397 Ga0395905_0018196 3300037471 Bacteria 6669
398 Ga0395905_0046527 3300037471 Bacteria 4068
399 Ga0395905_1225035 3300037471 Bacteria 654
400 Ga0316581_0000879 3300037588 Bacteria 6349
401 Ga0395901_0012789 3300038443 Bacteria 8512
402 Ga0439436_0010180 3300041404 Bacteria 2871
403 Ga0439436_0042363 3300041404 Bacteria 1301
404 Ga0439436_0063338 3300041404 Bacteria 1033
405 Ga0439439_0000653 3300041406 Bacteria 6116
406 Ga0439439_0043187 3300041406 Bacteria 1172
407 Ga0439447_005849 3300041407 Bacteria 4048
408 Ga0451789_0135540 3300041443 Bacteria 962
409 Ga0451793_1244880 3300041452 Bacteria 2166
410 Ga0451797_0295554 3300041453 Bacteria 1101
411 Ga0451833_0619913 3300041491 Bacteria 833
412 Ga0451833_0792306 3300041491 Bacteria 613
413 Ga0451837_0126293 3300041494 Bacteria 1117
414 Ga0451837_0131705 3300041494 Bacteria 643
415 Ga0451837_1509570 3300041494 Bacteria 691
416 Ga0451841_1245039 3300041498 Bacteria 1121
417 Ga0451843_1155314 3300041509 Bacteria 711
418 Ga0451843_1650970 3300041509 Bacteria 1222
419 Ga0451853_4088123 3300041512 Bacteria 609
420 Ga0439445_0076328 3300042004 Bacteria 933
421 Ga0439445_0128118 3300042004 Bacteria 731
422 Ga0439432_074035 3300042006 Bacteria 1036
423 Ga0439449_0069869 3300042007 Bacteria 1294
424 Ga0439449_0311146 3300042007 Bacteria 595
425 Ga0439452_059343 3300042010 Bacteria 860
426 Ga0439455_0104920 3300042012 Bacteria 783
427 Ga0439462_0024973 3300042015 Bacteria 1572
428 Ga0439462_0136672 3300042015 Bacteria 686
429 Ga0450911_003455 3300042115 Bacteria 2787
430 Ga0450914_006132 3300042118 Bacteria 1044
431 Ga0450894_071625 3300042131 Bacteria 532
432 Ga0450905_008334 3300042142 Bacteria 1418
433 Ga0439464_0050869 3300042439 Bacteria 1198
434 Ga0450918_059222 3300042531 Bacteria 706
435 Ga0450901_005720 3300042533 Bacteria 1276
436 Ga0450901_010309 3300042533 Bacteria 968
437 Ga0451577_0000705 3300042876 Bacteria 52191
438 Ga0451577_0003464 3300042876 Bacteria 17556
439 Ga0453684_0001232 3300044712 Bacteria 78122
440 Ga0453684_0281061 3300044712 Bacteria 1898
441 Ga0451576_0368198 3300045051 Bacteria 1505
442 Ga0451576_0563244 3300045051 Bacteria 1197
443 Ga0495627_062570 3300046453 Bacteria 1098
444 Ga0495638_0001034 3300046460 Bacteria 27502
445 Ga0495638_0091396 3300046460 Bacteria 1833
446 Ga0495638_0299456 3300046460 Bacteria 867
447 Ga0495638_0360764 3300046460 Bacteria 764
448 Ga0495650_0036587 3300046471 Bacteria 2146
449 Ga0495585_0050465 3300046492 Bacteria 2308
450 Ga0495583_0154378 3300046506 Bacteria 950
451 Ga0495610_0001979 3300046512 Bacteria 17496
452 Ga0495616_0186411 3300046513 Bacteria 919
453 Ga0495631_0012646 3300046518 Bacteria 4116
454 Ga0495632_0061018 3300046519 Bacteria 1831
455 Ga0495643_0002439 3300046522 Bacteria 14756
456 Ga0495663_0002405 3300046525 Bacteria 5629
457 Ga0495663_0004244 3300046525 Bacteria 4044
458 Ga0495663_0004410 3300046525 Bacteria 3961
459 Ga0495663_0042504 3300046525 Bacteria 1385
460 Ga0495663_0100401 3300046525 Bacteria 952
461 Ga0495642_0333752 3300046528 Bacteria 666
462 Ga0495621_0082155 3300046539 Bacteria 1203
463 Ga0495633_0010993 3300046558 Bacteria 4913
464 Ga0495633_0012134 3300046558 Bacteria 4599
465 Ga0495633_0111332 3300046558 Bacteria 1269
466 Ga0495656_0031294 3300046615 Bacteria 2157
467 Ga0495656_0042344 3300046615 Bacteria 1906
468 Ga0495656_0088229 3300046615 Bacteria 1413
469 Ga0495668_0003900 3300046616 Bacteria 10891
470 Ga0495625_0002787 3300046660 Bacteria 18431
471 Ga0495625_0050008 3300046660 Bacteria 3001
472 Ga0495625_0157227 3300046660 Bacteria 1525
473 Ga0495625_0191514 3300046660 Bacteria 1354
474 Ga0495625_0610438 3300046660 Bacteria 654
475 Ga0495659_0030708 3300046664 Bacteria 1872
476 Ga0495670_0035364 3300046691 Bacteria 2490
477 Ga0495671_0210122 3300046692 Bacteria 943
478 Ga0495660_0175463 3300046810 Bacteria 1041
479 Ga0495636_0021265 3300047318 Bacteria 2619
480 Ga0495636_0141332 3300047318 Bacteria 1075
481 Ga0495636_0400777 3300047318 Bacteria 653
482 Ga0495672_0000456 3300047320 Bacteria 48378
483 Ga0495672_0098723 3300047320 Bacteria 1588
484 Ga0495672_0123812 3300047320 Bacteria 1370
485 Ga0495685_190070 3300047447 Bacteria 660
486 Ga0495686_0002853 3300047472 Bacteria 15571
487 Ga0496101_0098845 3300048904 Bacteria 2181
488 Ga0496102_1116690 3300048905 Bacteria 708
489 Ga0496102_1241883 3300048905 Bacteria 664
490 Ga0496103_0130276 3300048906 Bacteria 1606
491 Ga0496104_1040665 3300048907 Bacteria 722
492 Ga0496105_0049515 3300048908 Bacteria 3470
493 Ga0496106_0116221 3300048909 Bacteria 2087
494 Ga0496107_0423293 3300048910 Bacteria 990
495 Ga0496108_0145647 3300048911 Bacteria 2042
496 Ga0496108_0147338 3300048911 Bacteria 2030
497 Ga0496109_0134266 3300048912 Bacteria 2311
498 Ga0496109_0260800 3300048912 Bacteria 1632
499 Ga0496109_0337682 3300048912 Bacteria 1423
500 Ga0496109_0803867 3300048912 Bacteria 878
501 Ga0496110_0156061 3300048913 Bacteria 2067
502 Ga0496110_0548758 3300048913 Bacteria 1050
503 Ga0496111_0310707 3300048914 Bacteria 1168
504 Ga0496111_0623160 3300048914 Bacteria 789
505 Ga0496111_0742876 3300048914 Bacteria 712
506 Ga0496112_0195277 3300048915 Bacteria 1984
507 Ga0496112_0497727 3300048915 Bacteria 1154
508 Ga0496113_0028397 3300048916 Bacteria 4023
509 Ga0496113_0142457 3300048916 Bacteria 1887
510 Ga0496113_0233046 3300048916 Bacteria 1468
511 Ga0496113_0447802 3300048916 Bacteria 1037
512 Ga0496116_0002429 3300048919 Bacteria 19630
513 Ga0496116_0099750 3300048919 Bacteria 1738
514 Ga0496116_0114945 3300048919 Bacteria 1571
515 Ga0496116_0160986 3300048919 Bacteria 1231
516 Ga0496116_0207294 3300048919 Bacteria 1019
517 Ga0496116_0210665 3300048919 Bacteria 1007
518 Ga0496117_0000779 3300048920 Bacteria 50165
519 Ga0496117_0003178 3300048920 Bacteria 19525
520 Ga0496117_0003531 3300048920 Bacteria 18080
521 Ga0496117_0065950 3300048920 Bacteria 2458
522 Ga0496117_0068687 3300048920 Bacteria 2391
523 Ga0496117_0070380 3300048920 Bacteria 2350
524 Ga0496117_0120546 3300048920 Bacteria 1612
525 Ga0496117_0380775 3300048920 Bacteria 718
526 Ga0496118_0000497 3300048921 Bacteria 65119
527 Ga0496118_0002346 3300048921 Bacteria 25662
528 Ga0496118_0011982 3300048921 Bacteria 8379
529 Ga0496118_0027049 3300048921 Bacteria 4864
530 Ga0496118_0035630 3300048921 Bacteria 4037
531 Ga0496118_0122278 3300048921 Bacteria 1693
532 Ga0496118_0177190 3300048921 Bacteria 1293
533 Ga0496119_0000495 3300048922 Bacteria 53700
534 Ga0496119_0105982 3300048922 Bacteria 1569
535 Ga0496119_0147805 3300048922 Bacteria 1262
536 Ga0496119_0179456 3300048922 Bacteria 1111
537 Ga0496120_0000523 3300048923 Bacteria 59431
538 Ga0496120_0083539 3300048923 Bacteria 1723
539 Ga0496121_0002174 3300048924 Bacteria 30706
540 Ga0496121_0004473 3300048924 Bacteria 18776
541 Ga0496121_0010608 3300048924 Bacteria 10353
542 Ga0496121_0027317 3300048924 Bacteria 5342
543 Ga0496121_0034081 3300048924 Bacteria 4589
544 Ga0496121_0045582 3300048924 Bacteria 3765
545 Ga0496121_0689782 3300048924 Bacteria 616
546 Ga0496122_0013601 3300048925 Bacteria 7947
547 Ga0496122_0096341 3300048925 Bacteria 1996
548 Ga0496122_0141076 3300048925 Bacteria 1507
549 Ga0496122_0157339 3300048925 Bacteria 1392
550 Ga0496122_0178030 3300048925 Bacteria 1272
551 Ga0496122_0426874 3300048925 Bacteria 664
552 Ga0496123_0024124 3300048926 Bacteria 4633
553 Ga0496123_0032144 3300048926 Bacteria 3806
554 Ga0496123_0045601 3300048926 Bacteria 2984
555 Ga0496123_0099571 3300048926 Bacteria 1696
556 Ga0496123_0128384 3300048926 Bacteria 1410
557 Ga0496123_0350232 3300048926 Bacteria 687
558 Ga0496124_0000813 3300048927 Bacteria 50733
559 Ga0496124_0001070 3300048927 Bacteria 43255
560 Ga0496124_0003371 3300048927 Bacteria 19625
561 Ga0496124_0004018 3300048927 Bacteria 17511
562 Ga0496124_0008226 3300048927 Bacteria 10940
563 Ga0496124_0008239 3300048927 Bacteria 10930
564 Ga0496124_0033579 3300048927 Bacteria 4512
565 Ga0496124_0207382 3300048927 Bacteria 1485
566 Ga0496124_0437856 3300048927 Bacteria 895
567 Ga0496124_0469597 3300048927 Bacteria 852
568 Ga0496124_0784492 3300048927 Bacteria 592
569 Ga0496125_0006055 3300048928 Bacteria 13220
570 Ga0496125_0006971 3300048928 Bacteria 12103
571 Ga0496125_0009073 3300048928 Bacteria 10289
572 Ga0496125_0017297 3300048928 Bacteria 6883
573 Ga0496125_0062589 3300048928 Bacteria 2974
574 Ga0496125_0134088 3300048928 Bacteria 1736
575 Ga0496125_0195132 3300048928 Bacteria 1332
576 Ga0496125_0215471 3300048928 Bacteria 1242
577 Ga0496126_0002959 3300048929 Bacteria 22073
578 Ga0496126_0186456 3300048929 Bacteria 1759
579 Ga0496126_0215042 3300048929 Bacteria 1617
580 Ga0496126_0318806 3300048929 Bacteria 1278
581 Ga0496126_0339193 3300048929 Bacteria 1231
582 Ga0501290_001987 3300049513 Bacteria 2692
583 Ga0501299_015060 3300049522 Bacteria 1354
584 Ga0501300_049069 3300049523 Bacteria 648
585 Ga0501031_0042123 3300049568 Bacteria 2981
586 Ga0501031_0192323 3300049568 Bacteria 1332
587 Ga0501031_0235015 3300049568 Bacteria 1192
588 Ga0501032_0028005 3300049569 Bacteria 3872
589 Ga0501032_0090781 3300049569 Bacteria 2027
590 Ga0501033_0000816 3300049570 Bacteria 28492
591 Ga0501033_0013979 3300049570 Bacteria 6106
592 Ga0501033_0120224 3300049570 Bacteria 1907
593 Ga0501033_0623625 3300049570 Bacteria 738
594 Ga0501034_0000498 3300049571 Bacteria 63644
595 Ga0501034_0285310 3300049571 Bacteria 1590
596 Ga0501034_0388715 3300049571 Bacteria 1319
597 Ga0501034_0454941 3300049571 Bacteria 1198
598 Ga0501034_0621372 3300049571 Bacteria 984
599 Ga0501034_1194457 3300049571 Bacteria 639
600 Ga0501036_0128248 3300049572 Bacteria 2142
601 Ga0501036_0538923 3300049572 Bacteria 970
602 Ga0501037_0005330 3300049573 Bacteria 9354
603 Ga0501037_0382410 3300049573 Bacteria 967
604 Ga0501038_0035964 3300049574 Bacteria 4346
605 Ga0501038_0073274 3300049574 Bacteria 2900
606 Ga0501039_0278174 3300049575 Bacteria 1316
607 Ga0501039_1319171 3300049575 Bacteria 556
608 Ga0501043_0002229 3300049579 Bacteria 16513
609 Ga0501043_0081603 3300049579 Bacteria 2541
610 Ga0501043_0280812 3300049579 Bacteria 1276
611 Ga0501046_0122135 3300049580 Bacteria 1981
612 Ga0501047_0047672 3300049581 Bacteria 4139
613 Ga0501047_0660820 3300049581 Bacteria 864
614 Ga0501070_0126873 3300049586 Bacteria 2108
615 Ga0501070_0184475 3300049586 Bacteria 1716
616 Ga0501073_0084688 3300049589 Bacteria 2206
617 Ga0501198_049821 3300049649 Bacteria 744
618 Ga0501223_014810 3300049663 Bacteria 1546
619 Ga0501239_006217 3300049672 Bacteria 1223
620 Ga0501242_006260 3300049674 Bacteria 1356
621 Ga0501246_024609 3300049676 Bacteria 644
622 Ga0501079_0440671 3300049741 Bacteria 1023
623 Ga0501080_0004696 3300049742 Bacteria 12187
624 Ga0501265_002088 3300049762 Bacteria 2278
625 Ga0501275_000587 3300049772 Bacteria 4039
626 Ga0501035_0083713 3300049822 Bacteria 2814
627 Ga0501035_1284667 3300049822 Bacteria 565
628 Ga0501044_0022048 3300049823 Bacteria 6791
629 Ga0501044_0098267 3300049823 Bacteria 2947
630 Ga0501212_011257 3300049851 Bacteria 1286
631 nmdc:mga00v17_119_c1 3300050491 Bacteria 46532
632 nmdc:mga00v17_122437_c1 3300050491 Bacteria 1657
633 nmdc:mga00v17_45394_c1 3300050491 Bacteria 2655
634 nmdc:mga00v17_63748_c1 3300050491 Bacteria 2270
635 nmdc:mga05p37_1261096_c1 3300050507 Bacteria 757
636 nmdc:mga05p37_1712008_c1 3300050507 Bacteria 612
637 nmdc:mga05p37_33789_c1 3300050507 Bacteria 6264
638 nmdc:mga05p37_7681_c1 3300050507 Bacteria 12723
639 nmdc:mga09592_12355_c1 3300050508 Bacteria 6955
640 nmdc:mga09592_4208_c1 3300050508 Bacteria 11630
641 nmdc:mga0qj67_102252_c1 3300050509 Bacteria 2311
642 nmdc:mga0qj67_123449_c1 3300050509 Bacteria 2095
643 nmdc:mga0qj67_169597_c1 3300050509 Bacteria 1772
644 nmdc:mga0qj67_2648_c1 3300050509 Bacteria 12826
645 nmdc:mga0qj67_96627_c1 3300050509 Bacteria 2378
646 nmdc:mga06r32_1391_c1 3300050510 Bacteria 21853
647 nmdc:mga06r32_5609_c1 3300050510 Bacteria 11288
648 nmdc:mga06r32_8925_c1 3300050510 Bacteria 9035
649 nmdc:mga08y16_1913_c1 3300050511 Bacteria 21225
650 nmdc:mga08y16_49424_c1 3300050511 Bacteria 4402
651 nmdc:mga08y16_75450_c1 3300050511 Bacteria 3515
652 nmdc:mga0n895_1419213_c1 3300050512 Bacteria 662
653 nmdc:mga08x19_282915_c1 3300050514 Bacteria 1149
654 nmdc:mga0a205_207646_c1 3300050515 Bacteria 1847
655 nmdc:mga0sz30_116217_c1 3300050516 Bacteria 1174
656 Ga0500610_0255232 3300053079 Bacteria 805
657 Ga0500651_0001237 3300053093 Bacteria 12706
658 Ga0500556_0203195 3300053104 Bacteria 783
659 Ga0500626_090727 3300053128 Bacteria 1341
660 Ga0500568_0018456 3300053139 Bacteria 3052
661 Ga0500589_267173 3300053147 Bacteria 620
662 Ga0500622_0001818 3300053156 Bacteria 16211
663 Ga0500622_0008192 3300053156 Bacteria 5869
664 Ga0500634_0000051 3300053161 Bacteria 52447

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042004 Ga0439445_0076328 Ga0439445_0076328_516_920 119
2 3300050512 nmdc:mga0n895_1419213_c1 nmdc:mga0n895_1419213_c1_248_652 119
3 3300006846 Ga0075430_100208039 Ga0075430_1002080392 121
4 3300006847 Ga0075431_100595856 Ga0075431_1005958561 121
5 3300031548 Ga0307408_100099944 Ga0307408_1000999442 122
6 3300031824 Ga0307413_10691486 Ga0307413_106914862 122
7 3300032002 Ga0307416_100591092 Ga0307416_1005910923 122
8 3300048914 Ga0496111_0742876 Ga0496111_0742876_10_426 123
9 3300006051 Ga0075364_10098188 Ga0075364_100981882 124
10 3300009094 Ga0111539_10011412 Ga0111539_100114126 124
11 3300010375 Ga0105239_11640907 Ga0105239_116409072 124
12 3300011119 Ga0105246_10153986 Ga0105246_101539863 124
13 3300048905 Ga0496102_1241883 Ga0496102_1241883_147_581 124
14 3300049568 Ga0501031_0192323 Ga0501031_0192323_716_1204 124
15 3300049569 Ga0501032_0090781 Ga0501032_0090781_358_846 124
16 3300049570 Ga0501033_0013979 Ga0501033_0013979_864_1352 124
17 3300049571 Ga0501034_0454941 Ga0501034_0454941_291_779 124
18 3300049572 Ga0501036_0538923 Ga0501036_0538923_328_816 124
19 3300049574 Ga0501038_0073274 Ga0501038_0073274_487_975 124
20 3300049575 Ga0501039_0278174 Ga0501039_0278174_721_1188 124
21 3300049579 Ga0501043_0081603 Ga0501043_0081603_1196_1684 124
22 3300049581 Ga0501047_0660820 Ga0501047_0660820_163_630 124
23 3300049586 Ga0501070_0126873 Ga0501070_0126873_674_1162 124
24 3300049822 Ga0501035_0083713 Ga0501035_0083713_261_749 124
25 3300049823 Ga0501044_0098267 Ga0501044_0098267_1627_2115 124
26 3300050491 nmdc:mga00v17_45394_c1 nmdc:mga00v17_45394_c1_1346_1828 124
27 3300050511 nmdc:mga08y16_49424_c1 nmdc:mga08y16_49424_c1_2826_3260 124
28 3300003771 Ga0055526_1000071 Ga0055526_100007137 125
29 3300003773 Ga0055537_1000203 Ga0055537_100020347 125
30 3300003775 Ga0055524_1000041 Ga0055524_100004137 125
31 3300003784 Ga0055534_1000040 Ga0055534_100004076 125
32 3300003790 Ga0055528_1000017 Ga0055528_100001737 125
33 3300025263 Ga0209565_1000001 Ga0209565_10000012022 125
34 3300025273 Ga0209673_1000001 Ga0209673_10000012022 125
35 3300025291 Ga0209675_1000001 Ga0209675_1000001511 125
36 3300025295 Ga0209564_1000001 Ga0209564_1000001673 125
37 3300025299 Ga0209256_1000002 Ga0209256_1000002880 125
38 3300030731 Ga0316177_1015236 Ga0316177_10152362 126
39 3300031251 Ga0265327_10001605 Ga0265327_1000160520 126
40 3300005355 Ga0070671_100030322 Ga0070671_1000303224 127
41 3300009177 Ga0105248_10241912 Ga0105248_102419122 127
42 3300025931 Ga0207644_10014478 Ga0207644_100144782 127
43 3300028794 Ga0307515_10000037 Ga0307515_10000037257 127
44 3300031507 Ga0307509_10931124 Ga0307509_109311241 127
45 3300037312 Ga0395899_0061007 Ga0395899_0061007_274_741 127
46 3300037418 Ga0395900_0022237 Ga0395900_0022237_5356_5823 127
47 3300037471 Ga0395905_0002691 Ga0395905_0002691_11847_12314 127
48 3300037471 Ga0395905_0018196 Ga0395905_0018196_4997_5464 127
49 3300037471 Ga0395905_0046527 Ga0395905_0046527_3279_3752 127
50 3300038443 Ga0395901_0012789 Ga0395901_0012789_1872_2339 127
51 3300048911 Ga0496108_0145647 Ga0496108_0145647_173_640 127
52 3300048912 Ga0496109_0260800 Ga0496109_0260800_442_909 127
53 3300048915 Ga0496112_0195277 Ga0496112_0195277_1353_1820 127
54 3300048916 Ga0496113_0028397 Ga0496113_0028397_2461_2928 127
55 3300049851 Ga0501212_011257 Ga0501212_011257_351_779 127
56 3300005327 Ga0070658_10920019 Ga0070658_109200191 128
57 3300005336 Ga0070680_100351344 Ga0070680_1003513441 128
58 3300005564 Ga0070664_100414630 Ga0070664_1004146303 128
59 3300006881 Ga0068865_100780070 Ga0068865_1007800702 128
60 3300013307 Ga0157372_10106641 Ga0157372_101066412 128
61 3300013307 Ga0157372_10943780 Ga0157372_109437801 128
62 3300027378 Ga0209981_1005034 Ga0209981_10050341 128
63 3300027471 Ga0209995_1019531 Ga0209995_10195312 128
64 3300027614 Ga0209970_1003538 Ga0209970_10035383 128
65 3300035398 Ga0316574_0043722 Ga0316574_0043722_1654_2094 128
66 3300037471 Ga0395905_1225035 Ga0395905_1225035_173_643 128
67 3300041494 Ga0451837_1509570 Ga0451837_1509570_98_574 128
68 3300042531 Ga0450918_059222 Ga0450918_059222_13_498 128
69 3300049568 Ga0501031_0042123 Ga0501031_0042123_1227_1703 128
70 3300049569 Ga0501032_0028005 Ga0501032_0028005_1237_1713 128
71 3300049570 Ga0501033_0120224 Ga0501033_0120224_772_1248 128
72 3300049571 Ga0501034_0285310 Ga0501034_0285310_162_593 128
73 3300049571 Ga0501034_1194457 Ga0501034_1194457_138_614 128
74 3300049572 Ga0501036_0128248 Ga0501036_0128248_57_533 128
75 3300049573 Ga0501037_0005330 Ga0501037_0005330_8824_9300 128
76 3300049574 Ga0501038_0035964 Ga0501038_0035964_3546_4022 128
77 3300049579 Ga0501043_0280812 Ga0501043_0280812_664_1140 128
78 3300049586 Ga0501070_0184475 Ga0501070_0184475_993_1469 128
79 3300049589 Ga0501073_0084688 Ga0501073_0084688_1719_2195 128
80 3300049742 Ga0501080_0004696 Ga0501080_0004696_11307_11783 128
81 3300049823 Ga0501044_0022048 Ga0501044_0022048_2763_3239 128
82 3300005344 Ga0070661_100195709 Ga0070661_1001957091 129
83 3300005367 Ga0070667_100320191 Ga0070667_1003201912 129
84 3300005455 Ga0070663_100541147 Ga0070663_1005411471 129
85 3300005563 Ga0068855_101317421 Ga0068855_1013174211 129
86 3300009094 Ga0111539_10039009 Ga0111539_100390094 129
87 3300009094 Ga0111539_10188018 Ga0111539_101880182 129
88 3300009101 Ga0105247_10055610 Ga0105247_100556102 129
89 3300009147 Ga0114129_10014387 Ga0114129_100143875 129
90 3300009176 Ga0105242_12534422 Ga0105242_125344221 129
91 3300009177 Ga0105248_10050912 Ga0105248_100509126 129
92 3300009553 Ga0105249_10039918 Ga0105249_100399183 129
93 3300013102 Ga0157371_10066548 Ga0157371_100665482 129
94 3300013296 Ga0157374_10331601 Ga0157374_103316013 129
95 3300013297 Ga0157378_10183228 Ga0157378_101832282 129
96 3300013306 Ga0163162_10142154 Ga0163162_101421544 129
97 3300013308 Ga0157375_10133542 Ga0157375_101335424 129
98 3300013308 Ga0157375_10136415 Ga0157375_101364152 129
99 3300014325 Ga0163163_10252071 Ga0163163_102520713 129
100 3300014745 Ga0157377_10029771 Ga0157377_100297712 129
101 3300014745 Ga0157377_11160391 Ga0157377_111603912 129
102 3300014968 Ga0157379_10080526 Ga0157379_100805265 129
103 3300014968 Ga0157379_12506707 Ga0157379_125067071 129
104 3300025919 Ga0207657_10003945 Ga0207657_1000394510 129
105 3300025920 Ga0207649_10387414 Ga0207649_103874142 129
106 3300025921 Ga0207652_10012548 Ga0207652_100125482 129
107 3300026067 Ga0207678_10488937 Ga0207678_104889372 129
108 3300035112 Ga0373932_0225699 Ga0373932_0225699_87_521 129
109 3300042007 Ga0439449_0311146 Ga0439449_0311146_46_483 129
110 3300042012 Ga0439455_0104920 Ga0439455_0104920_338_772 129
111 3300042131 Ga0450894_071625 Ga0450894_071625_43_477 129
112 3300042439 Ga0439464_0050869 Ga0439464_0050869_200_634 129
113 3300045051 Ga0451576_0368198 Ga0451576_0368198_835_1269 129
114 3300046460 Ga0495638_0091396 Ga0495638_0091396_951_1385 129
115 3300046492 Ga0495585_0050465 Ga0495585_0050465_389_853 129
116 3300046506 Ga0495583_0154378 Ga0495583_0154378_398_865 129
117 3300046513 Ga0495616_0186411 Ga0495616_0186411_461_895 129
118 3300046528 Ga0495642_0333752 Ga0495642_0333752_154_618 129
119 3300046660 Ga0495625_0157227 Ga0495625_0157227_327_764 129
120 3300046660 Ga0495625_0610438 Ga0495625_0610438_171_605 129
121 3300047320 Ga0495672_0098723 Ga0495672_0098723_1056_1490 129
122 3300048909 Ga0496106_0116221 Ga0496106_0116221_569_1003 129
123 3300048910 Ga0496107_0423293 Ga0496107_0423293_542_976 129
124 3300048911 Ga0496108_0147338 Ga0496108_0147338_811_1245 129
125 3300048912 Ga0496109_0803867 Ga0496109_0803867_353_787 129
126 3300048913 Ga0496110_0548758 Ga0496110_0548758_145_579 129
127 3300048914 Ga0496111_0310707 Ga0496111_0310707_233_667 129
128 3300048915 Ga0496112_0497727 Ga0496112_0497727_695_1129 129
129 3300048916 Ga0496113_0447802 Ga0496113_0447802_528_962 129
130 3300048927 Ga0496124_0784492 Ga0496124_0784492_14_451 129
131 3300049522 Ga0501299_015060 Ga0501299_015060_634_1068 129
132 3300049571 Ga0501034_0621372 Ga0501034_0621372_423_899 129
133 3300049676 Ga0501246_024609 Ga0501246_024609_120_554 129
134 3300049741 Ga0501079_0440671 Ga0501079_0440671_470_946 129
135 3300050507 nmdc:mga05p37_1261096_c1 nmdc:mga05p37_1261096_c1_94_528 129
136 3300050507 nmdc:mga05p37_33789_c1 nmdc:mga05p37_33789_c1_2837_3271 129
137 3300050507 nmdc:mga05p37_7681_c1 nmdc:mga05p37_7681_c1_8448_8882 129
138 3300050508 nmdc:mga09592_12355_c1 nmdc:mga09592_12355_c1_750_1184 129
139 3300050508 nmdc:mga09592_4208_c1 nmdc:mga09592_4208_c1_7618_8052 129
140 3300050509 nmdc:mga0qj67_102252_c1 nmdc:mga0qj67_102252_c1_273_707 129
141 3300050509 nmdc:mga0qj67_2648_c1 nmdc:mga0qj67_2648_c1_3969_4403 129
142 3300050509 nmdc:mga0qj67_96627_c1 nmdc:mga0qj67_96627_c1_761_1195 129
143 3300050510 nmdc:mga06r32_1391_c1 nmdc:mga06r32_1391_c1_19132_19566 129
144 3300050510 nmdc:mga06r32_5609_c1 nmdc:mga06r32_5609_c1_9774_10208 129
145 3300050510 nmdc:mga06r32_8925_c1 nmdc:mga06r32_8925_c1_2448_2882 129
146 3300050511 nmdc:mga08y16_1913_c1 nmdc:mga08y16_1913_c1_3181_3615 129
147 3300050514 nmdc:mga08x19_282915_c1 nmdc:mga08x19_282915_c1_171_605 129
148 3300050515 nmdc:mga0a205_207646_c1 nmdc:mga0a205_207646_c1_150_584 129
149 3300053104 Ga0500556_0203195 Ga0500556_0203195_196_633 129
150 3300053139 Ga0500568_0018456 Ga0500568_0018456_188_625 129
151 3300053147 Ga0500589_267173 Ga0500589_267173_16_453 129
152 3300053156 Ga0500622_0001818 Ga0500622_0001818_13495_13932 129
153 3300053156 Ga0500622_0008192 Ga0500622_0008192_1273_1710 129
154 iso_pu_bacteria 2894510363 2894511952 129
155 3300006051 Ga0075364_10000477 Ga0075364_1000047711 130
156 3300031824 Ga0307413_10395331 Ga0307413_103953311 130
157 3300031911 Ga0307412_11920201 Ga0307412_119202012 130
158 3300032002 Ga0307416_100091070 Ga0307416_1000910702 130
159 3300032004 Ga0307414_10428930 Ga0307414_104289303 130
160 3300042142 Ga0450905_008334 Ga0450905_008334_756_1223 130
161 3300049575 Ga0501039_1319171 Ga0501039_1319171_10_495 130
162 3300050491 nmdc:mga00v17_119_c1 nmdc:mga00v17_119_c1_32610_33077 130
163 3300005331 Ga0070670_100136865 Ga0070670_1001368654 131
164 3300005333 Ga0070677_10030830 Ga0070677_100308303 131
165 3300005341 Ga0070691_10142858 Ga0070691_101428582 131
166 3300005347 Ga0070668_100029849 Ga0070668_1000298492 131
167 3300005366 Ga0070659_100029751 Ga0070659_1000297512 131
168 3300005456 Ga0070678_100116456 Ga0070678_1001164562 131
169 3300005457 Ga0070662_100204193 Ga0070662_1002041932 131
170 3300005458 Ga0070681_10152415 Ga0070681_101524154 131
171 3300005616 Ga0068852_100467619 Ga0068852_1004676192 131
172 3300005843 Ga0068860_100129518 Ga0068860_1001295184 131
173 3300005844 Ga0068862_100001302 Ga0068862_10000130218 131
174 3300006844 Ga0075428_100600536 Ga0075428_1006005362 131
175 3300006847 Ga0075431_100345654 Ga0075431_1003456543 131
176 3300006880 Ga0075429_100506012 Ga0075429_1005060123 131
177 3300025907 Ga0207645_10031489 Ga0207645_100314892 131
178 3300025920 Ga0207649_10570636 Ga0207649_105706362 131
179 3300025933 Ga0207706_10321394 Ga0207706_103213943 131
180 3300025945 Ga0207679_10865260 Ga0207679_108652602 131
181 3300025972 Ga0207668_10016455 Ga0207668_100164556 131
182 3300026116 Ga0207674_10667490 Ga0207674_106674902 131
183 3300026118 Ga0207675_100000363 Ga0207675_10000036340 131
184 3300027907 Ga0207428_10032841 Ga0207428_100328412 131
185 3300028380 Ga0268265_10000243 Ga0268265_1000024360 131
186 3300028381 Ga0268264_10630754 Ga0268264_106307543 131
187 3300049571 Ga0501034_0000498 Ga0501034_0000498_52465_52938 131
188 3300050509 nmdc:mga0qj67_169597_c1 nmdc:mga0qj67_169597_c1_567_1031 131
189 3300013306 Ga0163162_10684904 Ga0163162_106849041 132
190 3300030745 Ga0316182_1420801 Ga0316182_14208012 132
191 3300032004 Ga0307414_10677936 Ga0307414_106779363 132
192 3300032168 Ga0316593_10000885 Ga0316593_1000088511 132
193 3300036647 Ga0316582_0018822 Ga0316582_0018822_3241_3675 132
194 3300036712 Ga0316584_0610730 Ga0316584_0610730_178_612 132
195 3300042533 Ga0450901_005720 Ga0450901_005720_391_852 132
196 3300046660 Ga0495625_0002787 Ga0495625_0002787_5631_6107 132
197 3300049570 Ga0501033_0000816 Ga0501033_0000816_21673_22152 132
198 3300049570 Ga0501033_0623625 Ga0501033_0623625_228_707 132
199 3300049571 Ga0501034_0388715 Ga0501034_0388715_544_1023 132
200 3300049573 Ga0501037_0382410 Ga0501037_0382410_122_601 132
201 3300005467 Ga0070706_100002239 Ga0070706_1000022392 133
202 3300014326 Ga0157380_10006431 Ga0157380_100064319 133
203 3300025910 Ga0207684_10002129 Ga0207684_1000212921 133
204 3300027252 Ga0209973_1012321 Ga0209973_10123212 133
205 3300027360 Ga0209969_1002058 Ga0209969_10020582 133
206 3300027364 Ga0209967_1016156 Ga0209967_10161562 133
207 3300027543 Ga0209999_1002029 Ga0209999_10020294 133
208 3300027552 Ga0209982_1000486 Ga0209982_10004867 133
209 3300027665 Ga0209983_1031281 Ga0209983_10312812 133
210 3300027682 Ga0209971_1000850 Ga0209971_10008505 133
211 3300027876 Ga0209974_10005119 Ga0209974_100051192 133
212 3300031239 Ga0265328_10044255 Ga0265328_100442552 133
213 3300031250 Ga0265331_10158800 Ga0265331_101588002 133
214 3300031251 Ga0265327_10046816 Ga0265327_100468162 133
215 3300031251 Ga0265327_10217951 Ga0265327_102179512 133
216 3300031344 Ga0265316_10029468 Ga0265316_100294683 133
217 3300031711 Ga0265314_10018441 Ga0265314_100184414 133
218 3300042876 Ga0451577_0000705 Ga0451577_0000705_18582_19016 133
219 3300044712 Ga0453684_0001232 Ga0453684_0001232_40241_40675 133
220 3300044712 Ga0453684_0281061 Ga0453684_0281061_1014_1451 133
221 3300048924 Ga0496121_0027317 Ga0496121_0027317_1827_2315 133
222 3300049568 Ga0501031_0235015 Ga0501031_0235015_520_1008 133
223 3300053079 Ga0500610_0255232 Ga0500610_0255232_38_505 133
224 iso_pu_bacteria 2874220319 2874222426 133
225 iso_pu_bacteria 2919089067 2919090364 133
226 iso_pu_bacteria 2928496128 2928497751 133
227 iso_pu_bacteria 2931380184 2931384118 133
228 3300031665 Ga0316575_10176940 Ga0316575_101769402 134
229 3300032004 Ga0307414_10207378 Ga0307414_102073783 134
230 3300041443 Ga0451789_0135540 Ga0451789_0135540_166_630 134
231 3300041452 Ga0451793_1244880 Ga0451793_1244880_762_1226 134
232 3300041494 Ga0451837_0131705 Ga0451837_0131705_42_506 134
233 iso_pu_bacteria 2989392574 2989396039 134
234 3300006881 Ga0068865_101442502 Ga0068865_1014425022 135
235 3300028577 Ga0265318_10115957 Ga0265318_101159573 135
236 3300045051 Ga0451576_0563244 Ga0451576_0563244_416_865 135
237 3300005288 Ga0065714_10112470 Ga0065714_101124703 136
238 3300005290 Ga0065712_10014013 Ga0065712_100140132 136
239 3300005330 Ga0070690_100029887 Ga0070690_1000298872 136
240 3300005334 Ga0068869_100123791 Ga0068869_1001237913 136
241 3300005334 Ga0068869_101008657 Ga0068869_1010086572 136
242 3300005340 Ga0070689_100009182 Ga0070689_1000091824 136
243 3300005343 Ga0070687_100073255 Ga0070687_1000732554 136
244 3300005344 Ga0070661_100760797 Ga0070661_1007607972 136
245 3300005345 Ga0070692_10514805 Ga0070692_105148052 136
246 3300005347 Ga0070668_100218595 Ga0070668_1002185952 136
247 3300005353 Ga0070669_100077494 Ga0070669_1000774943 136
248 3300005354 Ga0070675_100146002 Ga0070675_1001460023 136
249 3300005355 Ga0070671_100137708 Ga0070671_1001377083 136
250 3300005364 Ga0070673_100050505 Ga0070673_1000505052 136
251 3300005367 Ga0070667_100124111 Ga0070667_1001241112 136
252 3300005438 Ga0070701_10053061 Ga0070701_100530612 136
253 3300005440 Ga0070705_100234524 Ga0070705_1002345242 136
254 3300005455 Ga0070663_100586687 Ga0070663_1005866871 136
255 3300005456 Ga0070678_100275041 Ga0070678_1002750412 136
256 3300005457 Ga0070662_100154171 Ga0070662_1001541713 136
257 3300005459 Ga0068867_100163801 Ga0068867_1001638012 136
258 3300005466 Ga0070685_10015831 Ga0070685_100158315 136
259 3300005468 Ga0070707_101752464 Ga0070707_1017524641 136
260 3300005535 Ga0070684_100017714 Ga0070684_1000177146 136
261 3300005543 Ga0070672_100165244 Ga0070672_1001652442 136
262 3300005544 Ga0070686_100016707 Ga0070686_1000167077 136
263 3300005548 Ga0070665_100053732 Ga0070665_1000537322 136
264 3300005548 Ga0070665_100671842 Ga0070665_1006718423 136
265 3300005548 Ga0070665_101502027 Ga0070665_1015020272 136
266 3300005564 Ga0070664_100170864 Ga0070664_1001708642 136
267 3300005564 Ga0070664_101033581 Ga0070664_1010335812 136
268 3300005578 Ga0068854_100224836 Ga0068854_1002248362 136
269 3300005615 Ga0070702_100074035 Ga0070702_1000740353 136
270 3300005617 Ga0068859_100472301 Ga0068859_1004723012 136
271 3300005618 Ga0068864_100087927 Ga0068864_1000879273 136
272 3300005719 Ga0068861_100889453 Ga0068861_1008894533 136
273 3300005834 Ga0068851_10385386 Ga0068851_103853861 136
274 3300005841 Ga0068863_100074098 Ga0068863_1000740984 136
275 3300005842 Ga0068858_101158712 Ga0068858_1011587123 136
276 3300005843 Ga0068860_100207481 Ga0068860_1002074813 136
277 3300005844 Ga0068862_100109763 Ga0068862_1001097634 136
278 3300006358 Ga0068871_100248988 Ga0068871_1002489882 136
279 3300006844 Ga0075428_100000597 Ga0075428_10000059746 136
280 3300006844 Ga0075428_100006416 Ga0075428_10000641612 136
281 3300006844 Ga0075428_100298074 Ga0075428_1002980743 136
282 3300006844 Ga0075428_100580795 Ga0075428_1005807952 136
283 3300006846 Ga0075430_100000758 Ga0075430_10000075810 136
284 3300006846 Ga0075430_100052497 Ga0075430_1000524972 136
285 3300006846 Ga0075430_100364533 Ga0075430_1003645332 136
286 3300006847 Ga0075431_100001382 Ga0075431_10000138219 136
287 3300006847 Ga0075431_100010406 Ga0075431_1000104066 136
288 3300006847 Ga0075431_100014174 Ga0075431_1000141749 136
289 3300006880 Ga0075429_100000507 Ga0075429_10000050716 136
290 3300006881 Ga0068865_100182098 Ga0068865_1001820981 136
291 3300006931 Ga0097620_100472327 Ga0097620_1004723272 136
292 3300009011 Ga0105251_10007635 Ga0105251_100076357 136
293 3300009094 Ga0111539_10089754 Ga0111539_100897543 136
294 3300009147 Ga0114129_10014234 Ga0114129_100142345 136
295 3300009147 Ga0114129_12057450 Ga0114129_120574502 136
296 3300017792 Ga0163161_10176542 Ga0163161_101765422 136
297 3300025900 Ga0207710_10038373 Ga0207710_100383733 136
298 3300025918 Ga0207662_10024040 Ga0207662_100240405 136
299 3300025920 Ga0207649_10103917 Ga0207649_101039172 136
300 3300025926 Ga0207659_10240057 Ga0207659_102400572 136
301 3300025936 Ga0207670_10327294 Ga0207670_103272943 136
302 3300025938 Ga0207704_10057176 Ga0207704_100571762 136
303 3300025940 Ga0207691_10120615 Ga0207691_101206153 136
304 3300025941 Ga0207711_10139960 Ga0207711_101399603 136
305 3300025942 Ga0207689_11071378 Ga0207689_110713782 136
306 3300025945 Ga0207679_10045070 Ga0207679_100450702 136
307 3300025960 Ga0207651_10256253 Ga0207651_102562532 136
308 3300025961 Ga0207712_10092257 Ga0207712_100922572 136
309 3300026023 Ga0207677_10147736 Ga0207677_101477363 136
310 3300026067 Ga0207678_10546561 Ga0207678_105465612 136
311 3300026075 Ga0207708_10080475 Ga0207708_100804752 136
312 3300026088 Ga0207641_10276184 Ga0207641_102761843 136
313 3300026089 Ga0207648_10121319 Ga0207648_101213192 136
314 3300026116 Ga0207674_10276171 Ga0207674_102761713 136
315 3300026121 Ga0207683_10299071 Ga0207683_102990712 136
316 3300027907 Ga0207428_10030485 Ga0207428_100304855 136
317 3300028379 Ga0268266_10179931 Ga0268266_101799313 136
318 3300028379 Ga0268266_10309201 Ga0268266_103092012 136
319 3300028379 Ga0268266_11244537 Ga0268266_112445371 136
320 3300028380 Ga0268265_10112416 Ga0268265_101124162 136
321 3300028381 Ga0268264_10333330 Ga0268264_103333302 136
322 3300031548 Ga0307408_100261516 Ga0307408_1002615162 136
323 3300031548 Ga0307408_100966598 Ga0307408_1009665983 136
324 3300031691 Ga0316579_10018238 Ga0316579_100182384 136
325 3300031731 Ga0307405_10881125 Ga0307405_108811252 136
326 3300031733 Ga0316577_10048630 Ga0316577_100486302 136
327 3300031824 Ga0307413_10425902 Ga0307413_104259022 136
328 3300031824 Ga0307413_11252776 Ga0307413_112527762 136
329 3300031901 Ga0307406_10462040 Ga0307406_104620402 136
330 3300031901 Ga0307406_10832393 Ga0307406_108323931 136
331 3300031995 Ga0307409_101561820 Ga0307409_1015618201 136
332 3300032002 Ga0307416_100560435 Ga0307416_1005604352 136
333 3300032126 Ga0307415_102087881 Ga0307415_1020878811 136
334 3300032137 Ga0316585_10165660 Ga0316585_101656602 136
335 3300032168 Ga0316593_10015361 Ga0316593_100153612 136
336 3300036647 Ga0316582_0002695 Ga0316582_0002695_5787_6242 136
337 3300036712 Ga0316584_0032994 Ga0316584_0032994_1025_1480 136
338 3300037588 Ga0316581_0000879 Ga0316581_0000879_3510_3965 136
339 3300042118 Ga0450914_006132 Ga0450914_006132_27_491 136
340 3300046471 Ga0495650_0036587 Ga0495650_0036587_933_1388 136
341 3300049580 Ga0501046_0122135 Ga0501046_0122135_86_544 136
342 3300049581 Ga0501047_0047672 Ga0501047_0047672_859_1317 136
343 3300050507 nmdc:mga05p37_1712008_c1 nmdc:mga05p37_1712008_c1_97_561 136
344 3300050511 nmdc:mga08y16_75450_c1 nmdc:mga08y16_75450_c1_2418_2882 136
345 iso_pu_bacteria 2747842501 2748016061 136
346 3300013100 Ga0157373_10720028 Ga0157373_107200282 137
347 3300013102 Ga0157371_10007889 Ga0157371_100078899 137
348 3300046460 Ga0495638_0360764 Ga0495638_0360764_185_646 137
349 3300048924 Ga0496121_0010608 Ga0496121_0010608_9308_9769 137
350 3300048928 Ga0496125_0062589 Ga0496125_0062589_2276_2761 137
351 3300005539 Ga0068853_101559225 Ga0068853_1015592251 138
352 3300006846 Ga0075430_100438644 Ga0075430_1004386442 138
353 3300032005 Ga0307411_10041896 Ga0307411_100418964 138
354 3300035691 Ga0373931_0071057 Ga0373931_0071057_1268_1732 138
355 3300041404 Ga0439436_0063338 Ga0439436_0063338_259_741 138
356 3300041509 Ga0451843_1155314 Ga0451843_1155314_148_636 138
357 3300042010 Ga0439452_059343 Ga0439452_059343_54_533 138
358 3300046558 Ga0495633_0010993 Ga0495633_0010993_657_1109 138
359 3300046692 Ga0495671_0210122 Ga0495671_0210122_15_467 138
360 3300005295 Ga0065707_10082671 Ga0065707_100826718 139
361 3300005719 Ga0068861_100002878 Ga0068861_10000287811 139
362 3300006846 Ga0075430_100094238 Ga0075430_1000942383 139
363 3300026118 Ga0207675_100016339 Ga0207675_1000163395 139
364 3300041453 Ga0451797_0295554 Ga0451797_0295554_350_838 139
365 3300041494 Ga0451837_0126293 Ga0451837_0126293_121_609 139
366 3300049822 Ga0501035_1284667 Ga0501035_1284667_10_486 139
367 3300050509 nmdc:mga0qj67_123449_c1 nmdc:mga0qj67_123449_c1_720_1184 139
368 iso_pu_bacteria 2894414249 2894415336 139
369 iso_pu_bacteria 2895498888 2895498919 139
370 iso_pu_bacteria 2895511927 2895511958 139
371 iso_pu_bacteria 2895522137 2895524976 139
372 iso_pu_bacteria 2895525241 2895527901 139
373 iso_pu_bacteria 2919513703 2919515933 139
374 iso_pu_bacteria 2919675420 2919677232 139
375 3300041491 Ga0451833_0619913 Ga0451833_0619913_332_793 140
376 3300041491 Ga0451833_0792306 Ga0451833_0792306_108_569 141
377 3300046460 Ga0495638_0299456 Ga0495638_0299456_34_498 141
378 3300053093 Ga0500651_0001237 Ga0500651_0001237_5785_6273 141
379 iso_pu_bacteria 2547132130 2547499614 141
380 iso_pu_bacteria 2576861471 2578457762 141
381 iso_pu_bacteria 2747842428 2747949153 141
382 iso_pu_bacteria 2765235840 2765579731 141
383 iso_pu_bacteria 2816332141 2816517811 141
384 iso_pu_bacteria 2842391507 2842391994 141
385 iso_pu_bacteria 2842757796 2842760065 141
386 iso_pu_bacteria 2852649853 2852650204 141
387 iso_pu_bacteria 2857442823 2857446131 141
388 iso_pu_bacteria 2919134579 2919138485 141
389 iso_pu_bacteria 2937610967 2937614719 141
390 iso_pu_bacteria 2939589442 2939590953 141
391 iso_pu_bacteria 2939622612 2939625554 141
392 iso_pu_bacteria 2939626828 2939630595 141
393 iso_pu_bacteria 2941475908 2941476494 141
394 iso_pu_bacteria 2961047084 2961049191 141
395 iso_pu_bacteria 2961064222 2961066111 141
396 iso_pu_bacteria 2974307012 2974308373 141
397 iso_pu_bacteria 2977247770 2977249130 141
398 iso_pu_bacteria 2984514374 2984516418 141
399 3300046519 Ga0495632_0061018 Ga0495632_0061018_177_641 142
400 3300053161 Ga0500634_0000051 Ga0500634_0000051_51440_51904 142
401 iso_pu_bacteria 2571042365 2572255128 142
402 iso_pu_bacteria 2643221559 2643815204 142
403 iso_pu_bacteria 2643221586 2643939882 142
404 iso_pu_bacteria 2643221612 2644076940 142
405 iso_pu_bacteria 2643221727 2644695254 142
406 iso_pu_bacteria 8003014200 8003014500 142
407 3300005457 Ga0070662_101750682 Ga0070662_1017506821 143
408 3300006051 Ga0075364_10409467 Ga0075364_104094672 143
409 3300012498 Ga0157345_1018744 Ga0157345_10187442 143
410 3300032004 Ga0307414_10603811 Ga0307414_106038112 143
411 iso_pu_bacteria 2643221573 2643879243 143
412 iso_pu_bacteria 2643221593 2643977080 143
413 iso_pu_bacteria 2643221695 2644529507 143
414 iso_pu_bacteria 2643221720 2644660543 143
415 iso_pu_bacteria 2643221728 2644697902 143
416 iso_pu_bacteria 2941489479 2941490635 143
417 iso_pu_bacteria 2995948881 2995951408 143
418 3300003784 Ga0055534_1045248 Ga0055534_10452481 144
419 3300005288 Ga0065714_10071120 Ga0065714_100711203 144
420 3300005293 Ga0065715_10057607 Ga0065715_100576072 144
421 3300005293 Ga0065715_10269005 Ga0065715_102690053 144
422 3300005293 Ga0065715_10521248 Ga0065715_105212481 144
423 3300005354 Ga0070675_101033784 Ga0070675_1010337841 144
424 3300015261 Ga0182006_1021769 Ga0182006_10217692 144
425 3300025945 Ga0207679_10264414 Ga0207679_102644143 144
426 3300026121 Ga0207683_10202175 Ga0207683_102021753 144
427 3300031901 Ga0307406_10198670 Ga0307406_101986703 144
428 3300031901 Ga0307406_11174781 Ga0307406_111747811 144
429 3300031903 Ga0307407_10413487 Ga0307407_104134872 144
430 3300031995 Ga0307409_100206880 Ga0307409_1002068802 144
431 3300032002 Ga0307416_100656311 Ga0307416_1006563112 144
432 3300032004 Ga0307414_10000988 Ga0307414_1000098813 144
433 3300032004 Ga0307414_10893419 Ga0307414_108934192 144
434 3300032004 Ga0307414_10922141 Ga0307414_109221412 144
435 3300032005 Ga0307411_10022498 Ga0307411_100224985 144
436 3300041404 Ga0439436_0042363 Ga0439436_0042363_36_515 144
437 3300041406 Ga0439439_0043187 Ga0439439_0043187_419_898 144
438 3300042015 Ga0439462_0136672 Ga0439462_0136672_177_656 144
439 3300048905 Ga0496102_1116690 Ga0496102_1116690_27_512 144
440 3300003320 rootH2_10011881 rootH2_100118812 145
441 3300003323 rootH1_10259244 rootH1_102592442 145
442 3300003771 Ga0055526_1002377 Ga0055526_10023778 145
443 3300003773 Ga0055537_1000164 Ga0055537_100016428 145
444 3300003781 Ga0055536_1000367 Ga0055536_100036717 145
445 3300003781 Ga0055536_1000709 Ga0055536_100070910 145
446 3300003781 Ga0055536_1001874 Ga0055536_10018745 145
447 3300003784 Ga0055534_1000026 Ga0055534_100002652 145
448 3300003790 Ga0055528_1000951 Ga0055528_100095115 145
449 3300003791 Ga0055530_10000772 Ga0055530_1000077210 145
450 3300003791 Ga0055530_10000972 Ga0055530_1000097210 145
451 3300003794 Ga0055531_10001367 Ga0055531_1000136712 145
452 3300003794 Ga0055531_10010225 Ga0055531_100102252 145
453 3300003794 Ga0055531_10010515 Ga0055531_100105156 145
454 3300003856 Ga0058692_1000012 Ga0058692_1000012116 145
455 3300005331 Ga0070670_100080049 Ga0070670_1000800492 145
456 3300005353 Ga0070669_101141301 Ga0070669_1011413011 145
457 3300005354 Ga0070675_100245323 Ga0070675_1002453232 145
458 3300005366 Ga0070659_100423451 Ga0070659_1004234513 145
459 3300005437 Ga0070710_10483003 Ga0070710_104830031 145
460 3300005548 Ga0070665_100258149 Ga0070665_1002581493 145
461 3300005548 Ga0070665_100395068 Ga0070665_1003950683 145
462 3300005578 Ga0068854_100224376 Ga0068854_1002243763 145
463 3300005618 Ga0068864_100032876 Ga0068864_1000328767 145
464 3300005844 Ga0068862_100976085 Ga0068862_1009760851 145
465 3300006038 Ga0075365_10174988 Ga0075365_101749883 145
466 3300006048 Ga0075363_100418426 Ga0075363_1004184261 145
467 3300006051 Ga0075364_10022493 Ga0075364_100224935 145
468 3300006051 Ga0075364_10495372 Ga0075364_104953721 145
469 3300006051 Ga0075364_10723805 Ga0075364_107238051 145
470 3300006186 Ga0075369_10063746 Ga0075369_100637463 145
471 3300006186 Ga0075369_10064872 Ga0075369_100648722 145
472 3300009036 Ga0105244_10051004 Ga0105244_100510043 145
473 3300009036 Ga0105244_10202722 Ga0105244_102027223 145
474 3300009148 Ga0105243_10005221 Ga0105243_100052219 145
475 3300012478 Ga0157328_1017315 Ga0157328_10173151 145
476 3300012482 Ga0157318_1016276 Ga0157318_10162762 145
477 3300012510 Ga0157316_1000764 Ga0157316_10007643 145
478 3300012512 Ga0157327_1002256 Ga0157327_10022562 145
479 3300013100 Ga0157373_10402291 Ga0157373_104022913 145
480 3300013102 Ga0157371_10000400 Ga0157371_1000040033 145
481 3300013102 Ga0157371_10007822 Ga0157371_1000782210 145
482 3300013104 Ga0157370_10006775 Ga0157370_100067753 145
483 3300013104 Ga0157370_10081598 Ga0157370_100815983 145
484 3300013104 Ga0157370_10777838 Ga0157370_107778382 145
485 3300014326 Ga0157380_10506959 Ga0157380_105069592 145
486 3300014497 Ga0182008_10000123 Ga0182008_1000012342 145
487 3300014497 Ga0182008_10044303 Ga0182008_100443032 145
488 3300015261 Ga0182006_1010265 Ga0182006_10102654 145
489 3300015261 Ga0182006_1072618 Ga0182006_10726182 145
490 3300015262 Ga0182007_10000098 Ga0182007_1000009833 145
491 3300015265 Ga0182005_1000825 Ga0182005_10008257 145
492 3300017792 Ga0163161_10001879 Ga0163161_100018797 145
493 3300017792 Ga0163161_10002326 Ga0163161_1000232613 145
494 3300017792 Ga0163161_10016180 Ga0163161_100161802 145
495 3300017792 Ga0163161_11214146 Ga0163161_112141462 145
496 3300025263 Ga0209565_1000022 Ga0209565_1000022151 145
497 3300025273 Ga0209673_1000110 Ga0209673_1000110105 145
498 3300025284 Ga0209130_1012924 Ga0209130_10129244 145
499 3300025291 Ga0209675_1000060 Ga0209675_1000060109 145
500 3300025292 Ga0209676_1000219 Ga0209676_100021935 145
501 3300025292 Ga0209676_1000279 Ga0209676_100027974 145
502 3300025292 Ga0209676_1000993 Ga0209676_100099312 145
503 3300025294 Ga0209025_1003524 Ga0209025_100352415 145
504 3300025295 Ga0209564_1000304 Ga0209564_100030450 145
505 3300025298 Ga0209050_1000542 Ga0209050_100054232 145
506 3300025298 Ga0209050_1000825 Ga0209050_100082523 145
507 3300025298 Ga0209050_1038998 Ga0209050_10389983 145
508 3300025299 Ga0209256_1000898 Ga0209256_100089812 145
509 3300025299 Ga0209256_1010135 Ga0209256_10101354 145
510 3300025304 Ga0209257_1000726 Ga0209257_100072611 145
511 3300025304 Ga0209257_1000933 Ga0209257_100093318 145
512 3300025304 Ga0209257_1005417 Ga0209257_10054172 145
513 3300025735 Ga0207713_1027375 Ga0207713_10273752 145
514 3300025901 Ga0207688_10296678 Ga0207688_102966782 145
515 3300025923 Ga0207681_11003921 Ga0207681_110039212 145
516 3300025925 Ga0207650_10294972 Ga0207650_102949722 145
517 3300025931 Ga0207644_10545433 Ga0207644_105454332 145
518 3300025935 Ga0207709_10000898 Ga0207709_100008986 145
519 3300026118 Ga0207675_100917350 Ga0207675_1009173502 145
520 3300027312 Ga0209371_1000007 Ga0209371_1000007273 145
521 3300028379 Ga0268266_10219396 Ga0268266_102193963 145
522 3300028379 Ga0268266_10331697 Ga0268266_103316973 145
523 3300028380 Ga0268265_10361488 Ga0268265_103614883 145
524 3300030500 Ga0268256_1000008 Ga0268256_1000008677 145
525 3300030732 Ga0316176_1168218 Ga0316176_11682182 145
526 3300030745 Ga0316182_1099026 Ga0316182_10990261 145
527 3300031911 Ga0307412_10000684 Ga0307412_100006849 145
528 3300032004 Ga0307414_10201971 Ga0307414_102019712 145
529 3300032004 Ga0307414_10732778 Ga0307414_107327782 145
530 3300041498 Ga0451841_1245039 Ga0451841_1245039_501_962 145
531 3300041509 Ga0451843_1650970 Ga0451843_1650970_218_679 145
532 3300041512 Ga0451853_4088123 Ga0451853_4088123_58_519 145
533 3300042006 Ga0439432_074035 Ga0439432_074035_110_571 145
534 3300042115 Ga0450911_003455 Ga0450911_003455_1382_1843 145
535 3300042533 Ga0450901_010309 Ga0450901_010309_120_581 145
536 3300046453 Ga0495627_062570 Ga0495627_062570_43_504 145
537 3300046460 Ga0495638_0001034 Ga0495638_0001034_23839_24300 145
538 3300046512 Ga0495610_0001979 Ga0495610_0001979_13981_14442 145
539 3300046518 Ga0495631_0012646 Ga0495631_0012646_2795_3256 145
540 3300046522 Ga0495643_0002439 Ga0495643_0002439_13690_14151 145
541 3300046525 Ga0495663_0002405 Ga0495663_0002405_590_1051 145
542 3300046525 Ga0495663_0004244 Ga0495663_0004244_669_1130 145
543 3300046525 Ga0495663_0004410 Ga0495663_0004410_2924_3397 145
544 3300046525 Ga0495663_0042504 Ga0495663_0042504_608_1069 145
545 3300046539 Ga0495621_0082155 Ga0495621_0082155_298_786 145
546 3300046558 Ga0495633_0012134 Ga0495633_0012134_2996_3457 145
547 3300046615 Ga0495656_0031294 Ga0495656_0031294_486_950 145
548 3300046615 Ga0495656_0042344 Ga0495656_0042344_771_1259 145
549 3300046615 Ga0495656_0088229 Ga0495656_0088229_359_847 145
550 3300046660 Ga0495625_0050008 Ga0495625_0050008_2059_2520 145
551 3300046660 Ga0495625_0191514 Ga0495625_0191514_468_929 145
552 3300046664 Ga0495659_0030708 Ga0495659_0030708_1004_1477 145
553 3300046691 Ga0495670_0035364 Ga0495670_0035364_1864_2328 145
554 3300046810 Ga0495660_0175463 Ga0495660_0175463_375_836 145
555 3300047318 Ga0495636_0021265 Ga0495636_0021265_515_988 145
556 3300047318 Ga0495636_0400777 Ga0495636_0400777_160_633 145
557 3300047320 Ga0495672_0000456 Ga0495672_0000456_13739_14200 145
558 3300047320 Ga0495672_0123812 Ga0495672_0123812_397_858 145
559 3300047472 Ga0495686_0002853 Ga0495686_0002853_592_1053 145
560 3300048904 Ga0496101_0098845 Ga0496101_0098845_422_910 145
561 3300048906 Ga0496103_0130276 Ga0496103_0130276_958_1446 145
562 3300048907 Ga0496104_1040665 Ga0496104_1040665_28_489 145
563 3300048908 Ga0496105_0049515 Ga0496105_0049515_2812_3273 145
564 3300048912 Ga0496109_0134266 Ga0496109_0134266_1439_1927 145
565 3300048913 Ga0496110_0156061 Ga0496110_0156061_940_1428 145
566 3300048914 Ga0496111_0623160 Ga0496111_0623160_174_635 145
567 3300048916 Ga0496113_0142457 Ga0496113_0142457_403_864 145
568 3300048916 Ga0496113_0233046 Ga0496113_0233046_550_1011 145
569 3300048919 Ga0496116_0002429 Ga0496116_0002429_9868_10329 145
570 3300048919 Ga0496116_0099750 Ga0496116_0099750_788_1249 145
571 3300048919 Ga0496116_0114945 Ga0496116_0114945_485_946 145
572 3300048919 Ga0496116_0160986 Ga0496116_0160986_433_894 145
573 3300048919 Ga0496116_0207294 Ga0496116_0207294_519_980 145
574 3300048919 Ga0496116_0210665 Ga0496116_0210665_158_619 145
575 3300048920 Ga0496117_0000779 Ga0496117_0000779_8909_9370 145
576 3300048920 Ga0496117_0003178 Ga0496117_0003178_17568_18029 145
577 3300048920 Ga0496117_0003531 Ga0496117_0003531_14210_14671 145
578 3300048920 Ga0496117_0065950 Ga0496117_0065950_1479_1940 145
579 3300048920 Ga0496117_0068687 Ga0496117_0068687_1541_2002 145
580 3300048920 Ga0496117_0070380 Ga0496117_0070380_1796_2257 145
581 3300048920 Ga0496117_0120546 Ga0496117_0120546_384_845 145
582 3300048920 Ga0496117_0380775 Ga0496117_0380775_119_580 145
583 3300048921 Ga0496118_0000497 Ga0496118_0000497_13645_14106 145
584 3300048921 Ga0496118_0002346 Ga0496118_0002346_18684_19145 145
585 3300048921 Ga0496118_0011982 Ga0496118_0011982_4825_5286 145
586 3300048921 Ga0496118_0027049 Ga0496118_0027049_1413_1874 145
587 3300048921 Ga0496118_0035630 Ga0496118_0035630_234_695 145
588 3300048921 Ga0496118_0122278 Ga0496118_0122278_609_1070 145
589 3300048921 Ga0496118_0177190 Ga0496118_0177190_529_990 145
590 3300048922 Ga0496119_0000495 Ga0496119_0000495_36472_36933 145
591 3300048922 Ga0496119_0105982 Ga0496119_0105982_259_720 145
592 3300048922 Ga0496119_0147805 Ga0496119_0147805_379_840 145
593 3300048922 Ga0496119_0179456 Ga0496119_0179456_305_766 145
594 3300048923 Ga0496120_0000523 Ga0496120_0000523_49109_49570 145
595 3300048923 Ga0496120_0083539 Ga0496120_0083539_917_1378 145
596 3300048924 Ga0496121_0004473 Ga0496121_0004473_621_1082 145
597 3300048924 Ga0496121_0034081 Ga0496121_0034081_2886_3347 145
598 3300048924 Ga0496121_0045582 Ga0496121_0045582_1949_2410 145
599 3300048924 Ga0496121_0689782 Ga0496121_0689782_129_590 145
600 3300048925 Ga0496122_0013601 Ga0496122_0013601_2742_3203 145
601 3300048925 Ga0496122_0096341 Ga0496122_0096341_751_1212 145
602 3300048925 Ga0496122_0141076 Ga0496122_0141076_509_970 145
603 3300048925 Ga0496122_0157339 Ga0496122_0157339_294_755 145
604 3300048925 Ga0496122_0178030 Ga0496122_0178030_474_935 145
605 3300048925 Ga0496122_0426874 Ga0496122_0426874_45_506 145
606 3300048926 Ga0496123_0024124 Ga0496123_0024124_3485_3946 145
607 3300048926 Ga0496123_0032144 Ga0496123_0032144_2742_3203 145
608 3300048926 Ga0496123_0045601 Ga0496123_0045601_599_1060 145
609 3300048926 Ga0496123_0099571 Ga0496123_0099571_341_802 145
610 3300048926 Ga0496123_0128384 Ga0496123_0128384_196_657 145
611 3300048926 Ga0496123_0350232 Ga0496123_0350232_140_601 145
612 3300048927 Ga0496124_0000813 Ga0496124_0000813_17437_17898 145
613 3300048927 Ga0496124_0001070 Ga0496124_0001070_3026_3487 145
614 3300048927 Ga0496124_0003371 Ga0496124_0003371_15997_16458 145
615 3300048927 Ga0496124_0004018 Ga0496124_0004018_16767_17228 145
616 3300048927 Ga0496124_0008226 Ga0496124_0008226_3420_3881 145
617 3300048927 Ga0496124_0008239 Ga0496124_0008239_6628_7089 145
618 3300048927 Ga0496124_0033579 Ga0496124_0033579_98_559 145
619 3300048927 Ga0496124_0207382 Ga0496124_0207382_1007_1468 145
620 3300048927 Ga0496124_0437856 Ga0496124_0437856_100_561 145
621 3300048927 Ga0496124_0469597 Ga0496124_0469597_20_481 145
622 3300048928 Ga0496125_0006055 Ga0496125_0006055_8511_8972 145
623 3300048928 Ga0496125_0006971 Ga0496125_0006971_10450_10911 145
624 3300048928 Ga0496125_0009073 Ga0496125_0009073_9264_9725 145
625 3300048928 Ga0496125_0017297 Ga0496125_0017297_6333_6794 145
626 3300048928 Ga0496125_0134088 Ga0496125_0134088_598_1059 145
627 3300048928 Ga0496125_0195132 Ga0496125_0195132_809_1270 145
628 3300048928 Ga0496125_0215471 Ga0496125_0215471_335_796 145
629 3300048929 Ga0496126_0002959 Ga0496126_0002959_9844_10305 145
630 3300048929 Ga0496126_0186456 Ga0496126_0186456_739_1200 145
631 3300048929 Ga0496126_0215042 Ga0496126_0215042_685_1146 145
632 3300048929 Ga0496126_0318806 Ga0496126_0318806_468_929 145
633 3300048929 Ga0496126_0339193 Ga0496126_0339193_218_679 145
634 3300050491 nmdc:mga00v17_122437_c1 nmdc:mga00v17_122437_c1_483_944 145
635 3300050491 nmdc:mga00v17_63748_c1 nmdc:mga00v17_63748_c1_699_1160 145
636 3300050516 nmdc:mga0sz30_116217_c1 nmdc:mga0sz30_116217_c1_664_1125 145
637 3300053128 Ga0500626_090727 Ga0500626_090727_414_875 145
638 3300003187 JGI25151J46595_10022201 JGI25151J46595_100222012 146
639 3300003771 Ga0055526_1029797 Ga0055526_10297973 146
640 3300003775 Ga0055524_1025173 Ga0055524_10251732 146
641 3300003775 Ga0055524_1029812 Ga0055524_10298123 146
642 3300003781 Ga0055536_1046680 Ga0055536_10466803 146
643 3300003784 Ga0055534_1049363 Ga0055534_10493631 146
644 3300003791 Ga0055530_10007918 Ga0055530_100079184 146
645 3300025273 Ga0209673_1006118 Ga0209673_10061186 146
646 3300025284 Ga0209130_1008496 Ga0209130_10084962 146
647 3300025291 Ga0209675_1030644 Ga0209675_10306443 146
648 3300025292 Ga0209676_1000700 Ga0209676_100070018 146
649 3300025292 Ga0209676_1006055 Ga0209676_10060554 146
650 3300025292 Ga0209676_1006460 Ga0209676_10064603 146
651 3300025292 Ga0209676_1008321 Ga0209676_10083214 146
652 3300025292 Ga0209676_1011167 Ga0209676_10111672 146
653 3300025294 Ga0209025_1002408 Ga0209025_10024087 146
654 3300025294 Ga0209025_1034193 Ga0209025_10341933 146
655 3300025294 Ga0209025_1044149 Ga0209025_10441493 146
656 3300025295 Ga0209564_1004198 Ga0209564_10041987 146
657 3300025298 Ga0209050_1004106 Ga0209050_10041063 146
658 3300025298 Ga0209050_1013892 Ga0209050_10138922 146
659 3300025299 Ga0209256_1003923 Ga0209256_10039234 146
660 3300025299 Ga0209256_1003949 Ga0209256_10039493 146
661 3300025299 Ga0209256_1023236 Ga0209256_10232363 146
662 3300025302 Ga0207426_1087682 Ga0207426_10876822 146
663 3300025303 Ga0209051_1012723 Ga0209051_10127232 146
664 3300025304 Ga0209257_1000570 Ga0209257_100057044 146
665 3300025304 Ga0209257_1000615 Ga0209257_100061511 146
666 3300025304 Ga0209257_1004313 Ga0209257_100431314 146
667 3300025304 Ga0209257_1005942 Ga0209257_10059424 146
668 3300025304 Ga0209257_1026720 Ga0209257_10267203 146
669 3300031548 Ga0307408_100646392 Ga0307408_1006463921 146
670 3300031548 Ga0307408_100726709 Ga0307408_1007267092 146
671 3300031731 Ga0307405_10160822 Ga0307405_101608222 146
672 3300031731 Ga0307405_10493795 Ga0307405_104937952 146
673 3300031731 Ga0307405_10752975 Ga0307405_107529751 146
674 3300031824 Ga0307413_10271232 Ga0307413_102712323 146
675 3300031901 Ga0307406_10325756 Ga0307406_103257562 146
676 3300031903 Ga0307407_10202619 Ga0307407_102026192 146
677 3300031911 Ga0307412_10116373 Ga0307412_101163733 146
678 3300031995 Ga0307409_100179830 Ga0307409_1001798303 146
679 3300032004 Ga0307414_10541219 Ga0307414_105412191 146
680 3300032005 Ga0307411_11541490 Ga0307411_115414902 146
681 3300032126 Ga0307415_100050782 Ga0307415_1000507823 146
682 3300041404 Ga0439436_0010180 Ga0439436_0010180_2256_2732 146
683 3300041406 Ga0439439_0000653 Ga0439439_0000653_2168_2641 146
684 3300042004 Ga0439445_0128118 Ga0439445_0128118_45_518 146
685 3300042007 Ga0439449_0069869 Ga0439449_0069869_249_722 146
686 3300042015 Ga0439462_0024973 Ga0439462_0024973_989_1462 146
687 3300042876 Ga0451577_0003464 Ga0451577_0003464_8684_9250 146
688 3300046525 Ga0495663_0100401 Ga0495663_0100401_143_640 146
689 3300046558 Ga0495633_0111332 Ga0495633_0111332_495_962 146
690 3300047318 Ga0495636_0141332 Ga0495636_0141332_171_668 146
691 3300047447 Ga0495685_190070 Ga0495685_190070_118_615 146
692 3300048912 Ga0496109_0337682 Ga0496109_0337682_543_1040 146
693 3300049513 Ga0501290_001987 Ga0501290_001987_804_1313 146
694 3300049523 Ga0501300_049069 Ga0501300_049069_80_589 146
695 3300049579 Ga0501043_0002229 Ga0501043_0002229_3836_4309 146
696 3300049649 Ga0501198_049821 Ga0501198_049821_77_553 146
697 3300049663 Ga0501223_014810 Ga0501223_014810_318_794 146
698 3300049672 Ga0501239_006217 Ga0501239_006217_540_1016 146
699 3300049674 Ga0501242_006260 Ga0501242_006260_367_843 146
700 3300049762 Ga0501265_002088 Ga0501265_002088_1553_2062 146
701 3300049772 Ga0501275_000587 Ga0501275_000587_557_1066 146
702 3300002774 JGI25150J39212_1036061 JGI25150J39212_10360611 147
703 3300003187 JGI25151J46595_10000041 JGI25151J46595_1000004195 147
704 3300005367 Ga0070667_101220162 Ga0070667_1012201621 147
705 3300015689 Ga0183360_10001 Ga0183360_100011798 147
706 3300025245 Ga0207425_1007719 Ga0207425_10077192 147
707 3300025294 Ga0209025_1000015 Ga0209025_1000015659 147
708 3300025986 Ga0207658_10656278 Ga0207658_106562783 147
709 3300041407 Ga0439447_005849 Ga0439447_005849_555_1022 147
710 3300046616 Ga0495668_0003900 Ga0495668_0003900_5924_6391 147
711 3300048924 Ga0496121_0002174 Ga0496121_0002174_23665_24132 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

4

135

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.8821 25 115
1sr3-assembly1.cif.gz_A solution structure of the heme chaperone ccme of escherichia coli 0.8304 25 124
2kct-assembly1.cif.gz_A solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. 0.8226 40 114
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.8017 25 115
1z9f-assembly1.cif.gz_A crystal structure of single stranded dna-binding protein (tm0604) from thermotoga maritima at 2.60 a resolution 0.7778 45 115
ID Description Score Start End Superfamily
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8821 25 115 2.40.50.140
3f8tA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8751 44 115 2.40.50.140
af_A0A0R4IAS3_25_130_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8312 26 113 2.40.50.140
1sr3A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8304 25 124 2.40.50.140
2kctA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8226 40 114 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A5W4VQ91-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.9193 25 113 GO:0005886
GO:0017004
GO:0020037
AF-A0A1Q7GS37-F1-model_v4 Cytochrome c maturation protein CcmE 0.9174 25 119 GO:0005886
GO:0017004
GO:0020037
AF-A0A367MDS7-F1-model_v4 Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) 0.9161 18 136 GO:0005886
GO:0017004
GO:0020037
GO:0022857
GO:0046872
AF-A5CCV8-F1-model_v4 Cytochrome c-type biogenesis protein 0.9079 9 123 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-X5H1Z7-F1-model_v4 CcmE family protein 0.9034 25 122 GO:0005886
GO:0017004
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
84.81 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map