F476791
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 711 | 378 | 664 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0003464|Ga0451577_0003464_8684_9250 |
| Length | 169 |
| Sequence | MNPARKRRLWFVLAVLAAGAAATALVTMALQRNVAYLYTPAEVLRGDAGARVVAGDAVFRLGGMVEAGSFQRDEGSMEARFRVTDGDAQLPVRYTGILPDLFREKQAVVATGRMQDGVFVAEQVLAKHDETYVPKEVADKMGLAHRKHGVVMPANGQQQAPSAAPSKGY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 2 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 3 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 4 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 5 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 6 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 7 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 8 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 9 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 10 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 11 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 12 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 13 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 14 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 15 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 16 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 17 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 18 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 19 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 20 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 21 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 22 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 23 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 24 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 25 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 26 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 27 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 28 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 29 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 30 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 31 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 32 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 33 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 34 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 35 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 36 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 37 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 38 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 39 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 40 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 41 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 42 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 43 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 44 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 45 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 46 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 47 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 48 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 49 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 50 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 51 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 55 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 56 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 57 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 58 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 59 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 60 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 61 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 62 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 64 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 69 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 71 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 90 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 95 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 99 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 103 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 104 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 105 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 106 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 107 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 108 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 109 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 110 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 111 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 112 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 113 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 114 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 115 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 116 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 117 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 118 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 119 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 120 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 134 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 135 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 136 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 137 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 138 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 149 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 154 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 155 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 219 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 220 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 221 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 222 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 223 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 224 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 225 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 229 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 230 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 231 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 232 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 235 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 236 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 237 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 238 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 240 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 241 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 242 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 243 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 244 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 245 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 248 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 250 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 251 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 257 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 258 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 259 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 263 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 264 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 265 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 266 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 267 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 268 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 269 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 270 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 271 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 272 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 273 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 274 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 275 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 276 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 277 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 278 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 279 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 280 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 281 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 282 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 283 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 310 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 311 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 312 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 313 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 314 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 315 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 318 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 319 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 320 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 321 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 322 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 323 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 324 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 325 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 328 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 329 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 330 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 331 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 332 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 333 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 334 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 335 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 349 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 350 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 351 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 352 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 356 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 360 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 370 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 371 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 372 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 373 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 374 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 375 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 376 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 377 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 378 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.11 |
| Metatranscriptomes | 0.28 |
| Isolates | 6.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.14 |
| Bulb | 0 |
| Endosphere | 13.92 |
| Nodule | 0.14 |
| Rhizoplane | 3.94 |
| Rhizosphere | 66.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25150J39212_1036061 | 3300002774 | Bacteria | 658 |
| 2 | JGI25151J46595_10000041 | 3300003187 | Bacteria | 174472 |
| 3 | JGI25151J46595_10022201 | 3300003187 | Bacteria | 2639 |
| 4 | rootH2_10011881 | 3300003320 | Bacteria | 4523 |
| 5 | rootH1_10259244 | 3300003323 | Bacteria | 2884 |
| 6 | Ga0055526_1000071 | 3300003771 | Bacteria | 96766 |
| 7 | Ga0055526_1002377 | 3300003771 | Bacteria | 12752 |
| 8 | Ga0055526_1029797 | 3300003771 | Bacteria | 1609 |
| 9 | Ga0055537_1000164 | 3300003773 | Bacteria | 49285 |
| 10 | Ga0055537_1000203 | 3300003773 | Bacteria | 44421 |
| 11 | Ga0055524_1000041 | 3300003775 | Bacteria | 156728 |
| 12 | Ga0055524_1025173 | 3300003775 | Bacteria | 1869 |
| 13 | Ga0055524_1029812 | 3300003775 | Bacteria | 1603 |
| 14 | Ga0055536_1000367 | 3300003781 | Bacteria | 33548 |
| 15 | Ga0055536_1000709 | 3300003781 | Bacteria | 22354 |
| 16 | Ga0055536_1001874 | 3300003781 | Bacteria | 12248 |
| 17 | Ga0055536_1046680 | 3300003781 | Bacteria | 982 |
| 18 | Ga0055534_1000026 | 3300003784 | Bacteria | 130908 |
| 19 | Ga0055534_1000040 | 3300003784 | Bacteria | 104019 |
| 20 | Ga0055534_1045248 | 3300003784 | Bacteria | 637 |
| 21 | Ga0055534_1049363 | 3300003784 | Bacteria | 601 |
| 22 | Ga0055528_1000017 | 3300003790 | Bacteria | 156728 |
| 23 | Ga0055528_1000951 | 3300003790 | Bacteria | 19236 |
| 24 | Ga0055530_10000772 | 3300003791 | Bacteria | 26697 |
| 25 | Ga0055530_10000972 | 3300003791 | Bacteria | 23228 |
| 26 | Ga0055530_10007918 | 3300003791 | Bacteria | 4358 |
| 27 | Ga0055531_10001367 | 3300003794 | Bacteria | 18110 |
| 28 | Ga0055531_10010225 | 3300003794 | Bacteria | 4691 |
| 29 | Ga0055531_10010515 | 3300003794 | Bacteria | 4587 |
| 30 | Ga0058692_1000012 | 3300003856 | Bacteria | 318930 |
| 31 | Ga0065714_10071120 | 3300005288 | Bacteria | 3662 |
| 32 | Ga0065714_10112470 | 3300005288 | Bacteria | 1455 |
| 33 | Ga0065712_10014013 | 3300005290 | Bacteria | 2302 |
| 34 | Ga0065715_10057607 | 3300005293 | Bacteria | 1150 |
| 35 | Ga0065715_10269005 | 3300005293 | Bacteria | 1116 |
| 36 | Ga0065715_10521248 | 3300005293 | Bacteria | 760 |
| 37 | Ga0065707_10082671 | 3300005295 | Bacteria | 12875 |
| 38 | Ga0070658_10920019 | 3300005327 | Bacteria | 760 |
| 39 | Ga0070690_100029887 | 3300005330 | Bacteria | 3383 |
| 40 | Ga0070670_100080049 | 3300005331 | Bacteria | 2808 |
| 41 | Ga0070670_100136865 | 3300005331 | Bacteria | 2117 |
| 42 | Ga0070677_10030830 | 3300005333 | Bacteria | 2044 |
| 43 | Ga0068869_100123791 | 3300005334 | Bacteria | 1981 |
| 44 | Ga0068869_101008657 | 3300005334 | Unclassified | 725 |
| 45 | Ga0070680_100351344 | 3300005336 | Bacteria | 1254 |
| 46 | Ga0070689_100009182 | 3300005340 | Bacteria | 7001 |
| 47 | Ga0070691_10142858 | 3300005341 | Bacteria | 1221 |
| 48 | Ga0070687_100073255 | 3300005343 | Bacteria | 1845 |
| 49 | Ga0070661_100195709 | 3300005344 | Bacteria | 1543 |
| 50 | Ga0070661_100760797 | 3300005344 | Bacteria | 793 |
| 51 | Ga0070692_10514805 | 3300005345 | Bacteria | 778 |
| 52 | Ga0070668_100029849 | 3300005347 | Bacteria | 4143 |
| 53 | Ga0070668_100218595 | 3300005347 | Bacteria | 1570 |
| 54 | Ga0070669_100077494 | 3300005353 | Bacteria | 2470 |
| 55 | Ga0070669_101141301 | 3300005353 | Bacteria | 672 |
| 56 | Ga0070675_100146002 | 3300005354 | Bacteria | 2025 |
| 57 | Ga0070675_100245323 | 3300005354 | Bacteria | 1566 |
| 58 | Ga0070675_101033784 | 3300005354 | Bacteria | 755 |
| 59 | Ga0070671_100030322 | 3300005355 | Bacteria | 4463 |
| 60 | Ga0070671_100137708 | 3300005355 | Bacteria | 2059 |
| 61 | Ga0070673_100050505 | 3300005364 | Bacteria | 3252 |
| 62 | Ga0070659_100029751 | 3300005366 | Bacteria | 4222 |
| 63 | Ga0070659_100423451 | 3300005366 | Bacteria | 1126 |
| 64 | Ga0070667_100124111 | 3300005367 | Bacteria | 2249 |
| 65 | Ga0070667_100320191 | 3300005367 | Bacteria | 1399 |
| 66 | Ga0070667_101220162 | 3300005367 | Bacteria | 704 |
| 67 | Ga0070710_10483003 | 3300005437 | Bacteria | 845 |
| 68 | Ga0070701_10053061 | 3300005438 | Bacteria | 2109 |
| 69 | Ga0070705_100234524 | 3300005440 | Bacteria | 1279 |
| 70 | Ga0070663_100541147 | 3300005455 | Bacteria | 972 |
| 71 | Ga0070663_100586687 | 3300005455 | Bacteria | 936 |
| 72 | Ga0070678_100116456 | 3300005456 | Bacteria | 2100 |
| 73 | Ga0070678_100275041 | 3300005456 | Bacteria | 1422 |
| 74 | Ga0070662_100154171 | 3300005457 | Bacteria | 1792 |
| 75 | Ga0070662_100204193 | 3300005457 | Bacteria | 1569 |
| 76 | Ga0070662_101750682 | 3300005457 | Bacteria | 537 |
| 77 | Ga0070681_10152415 | 3300005458 | Bacteria | 2238 |
| 78 | Ga0068867_100163801 | 3300005459 | Bacteria | 1755 |
| 79 | Ga0070685_10015831 | 3300005466 | Bacteria | 4010 |
| 80 | Ga0070706_100002239 | 3300005467 | Bacteria | 19629 |
| 81 | Ga0070707_101752464 | 3300005468 | Bacteria | 588 |
| 82 | Ga0070684_100017714 | 3300005535 | Bacteria | 5854 |
| 83 | Ga0068853_101559225 | 3300005539 | Bacteria | 640 |
| 84 | Ga0070672_100165244 | 3300005543 | Bacteria | 1838 |
| 85 | Ga0070686_100016707 | 3300005544 | Bacteria | 4273 |
| 86 | Ga0070665_100053732 | 3300005548 | Bacteria | 4040 |
| 87 | Ga0070665_100258149 | 3300005548 | Bacteria | 1744 |
| 88 | Ga0070665_100395068 | 3300005548 | Bacteria | 1390 |
| 89 | Ga0070665_100671842 | 3300005548 | Bacteria | 1049 |
| 90 | Ga0070665_101502027 | 3300005548 | Unclassified | 682 |
| 91 | Ga0068855_101317421 | 3300005563 | Bacteria | 747 |
| 92 | Ga0070664_100170864 | 3300005564 | Bacteria | 1928 |
| 93 | Ga0070664_100414630 | 3300005564 | Bacteria | 1233 |
| 94 | Ga0070664_101033581 | 3300005564 | Bacteria | 773 |
| 95 | Ga0068854_100224376 | 3300005578 | Bacteria | 1488 |
| 96 | Ga0068854_100224836 | 3300005578 | Bacteria | 1487 |
| 97 | Ga0070702_100074035 | 3300005615 | Bacteria | 2020 |
| 98 | Ga0068852_100467619 | 3300005616 | Bacteria | 1251 |
| 99 | Ga0068859_100472301 | 3300005617 | Bacteria | 1350 |
| 100 | Ga0068864_100032876 | 3300005618 | Bacteria | 4409 |
| 101 | Ga0068864_100087927 | 3300005618 | Bacteria | 2736 |
| 102 | Ga0068861_100002878 | 3300005719 | Bacteria | 11338 |
| 103 | Ga0068861_100889453 | 3300005719 | Bacteria | 842 |
| 104 | Ga0068851_10385386 | 3300005834 | Bacteria | 822 |
| 105 | Ga0068863_100074098 | 3300005841 | Bacteria | 3220 |
| 106 | Ga0068858_101158712 | 3300005842 | Bacteria | 759 |
| 107 | Ga0068860_100129518 | 3300005843 | Bacteria | 2421 |
| 108 | Ga0068860_100207481 | 3300005843 | Bacteria | 1900 |
| 109 | Ga0068862_100001302 | 3300005844 | Bacteria | 23282 |
| 110 | Ga0068862_100109763 | 3300005844 | Bacteria | 2420 |
| 111 | Ga0068862_100976085 | 3300005844 | Bacteria | 837 |
| 112 | Ga0075365_10174988 | 3300006038 | Bacteria | 1499 |
| 113 | Ga0075363_100418426 | 3300006048 | Bacteria | 789 |
| 114 | Ga0075364_10000477 | 3300006051 | Bacteria | 20375 |
| 115 | Ga0075364_10022493 | 3300006051 | Bacteria | 3982 |
| 116 | Ga0075364_10098188 | 3300006051 | Bacteria | 1948 |
| 117 | Ga0075364_10409467 | 3300006051 | Bacteria | 925 |
| 118 | Ga0075364_10495372 | 3300006051 | Bacteria | 835 |
| 119 | Ga0075364_10723805 | 3300006051 | Bacteria | 679 |
| 120 | Ga0075369_10063746 | 3300006186 | Bacteria | 1613 |
| 121 | Ga0075369_10064872 | 3300006186 | Bacteria | 1600 |
| 122 | Ga0068871_100248988 | 3300006358 | Bacteria | 1547 |
| 123 | Ga0075428_100000597 | 3300006844 | Bacteria | 36817 |
| 124 | Ga0075428_100006416 | 3300006844 | Bacteria | 13088 |
| 125 | Ga0075428_100298074 | 3300006844 | Bacteria | 1734 |
| 126 | Ga0075428_100580795 | 3300006844 | Bacteria | 1197 |
| 127 | Ga0075428_100600536 | 3300006844 | Bacteria | 1175 |
| 128 | Ga0075430_100000758 | 3300006846 | Bacteria | 24898 |
| 129 | Ga0075430_100052497 | 3300006846 | Bacteria | 3434 |
| 130 | Ga0075430_100094238 | 3300006846 | Bacteria | 2503 |
| 131 | Ga0075430_100208039 | 3300006846 | Bacteria | 1623 |
| 132 | Ga0075430_100364533 | 3300006846 | Bacteria | 1193 |
| 133 | Ga0075430_100438644 | 3300006846 | Bacteria | 1078 |
| 134 | Ga0075431_100001382 | 3300006847 | Bacteria | 22271 |
| 135 | Ga0075431_100010406 | 3300006847 | Bacteria | 9349 |
| 136 | Ga0075431_100014174 | 3300006847 | Bacteria | 8061 |
| 137 | Ga0075431_100345654 | 3300006847 | Bacteria | 1496 |
| 138 | Ga0075431_100595856 | 3300006847 | Bacteria | 1089 |
| 139 | Ga0075429_100000507 | 3300006880 | Bacteria | 29416 |
| 140 | Ga0075429_100506012 | 3300006880 | Bacteria | 1058 |
| 141 | Ga0068865_100182098 | 3300006881 | Bacteria | 1619 |
| 142 | Ga0068865_100780070 | 3300006881 | Bacteria | 823 |
| 143 | Ga0068865_101442502 | 3300006881 | Bacteria | 615 |
| 144 | Ga0097620_100472327 | 3300006931 | Bacteria | 1350 |
| 145 | Ga0105251_10007635 | 3300009011 | Bacteria | 6622 |
| 146 | Ga0105244_10051004 | 3300009036 | Bacteria | 2110 |
| 147 | Ga0105244_10202722 | 3300009036 | Bacteria | 935 |
| 148 | Ga0111539_10011412 | 3300009094 | Bacteria | 11151 |
| 149 | Ga0111539_10039009 | 3300009094 | Bacteria | 5727 |
| 150 | Ga0111539_10089754 | 3300009094 | Bacteria | 3612 |
| 151 | Ga0111539_10188018 | 3300009094 | Bacteria | 2411 |
| 152 | Ga0105247_10055610 | 3300009101 | Bacteria | 2442 |
| 153 | Ga0114129_10014234 | 3300009147 | Bacteria | 11335 |
| 154 | Ga0114129_10014387 | 3300009147 | Bacteria | 11277 |
| 155 | Ga0114129_12057450 | 3300009147 | Bacteria | 690 |
| 156 | Ga0105243_10005221 | 3300009148 | Bacteria | 10161 |
| 157 | Ga0105242_12534422 | 3300009176 | Bacteria | 561 |
| 158 | Ga0105248_10050912 | 3300009177 | Bacteria | 4647 |
| 159 | Ga0105248_10241912 | 3300009177 | Bacteria | 2032 |
| 160 | Ga0105249_10039918 | 3300009553 | Bacteria | 4262 |
| 161 | Ga0105239_11640907 | 3300010375 | Bacteria | 744 |
| 162 | Ga0105246_10153986 | 3300011119 | Bacteria | 1743 |
| 163 | Ga0157328_1017315 | 3300012478 | Bacteria | 575 |
| 164 | Ga0157318_1016276 | 3300012482 | Bacteria | 616 |
| 165 | Ga0157345_1018744 | 3300012498 | Bacteria | 686 |
| 166 | Ga0157316_1000764 | 3300012510 | Bacteria | 1802 |
| 167 | Ga0157327_1002256 | 3300012512 | Bacteria | 1310 |
| 168 | Ga0157373_10402291 | 3300013100 | Bacteria | 981 |
| 169 | Ga0157373_10720028 | 3300013100 | Bacteria | 732 |
| 170 | Ga0157371_10000400 | 3300013102 | Bacteria | 54327 |
| 171 | Ga0157371_10007822 | 3300013102 | Bacteria | 8583 |
| 172 | Ga0157371_10007889 | 3300013102 | Bacteria | 8545 |
| 173 | Ga0157371_10066548 | 3300013102 | Bacteria | 2551 |
| 174 | Ga0157370_10006775 | 3300013104 | Bacteria | 12568 |
| 175 | Ga0157370_10081598 | 3300013104 | Bacteria | 3042 |
| 176 | Ga0157370_10777838 | 3300013104 | Bacteria | 871 |
| 177 | Ga0157374_10331601 | 3300013296 | Bacteria | 1509 |
| 178 | Ga0157378_10183228 | 3300013297 | Bacteria | 1971 |
| 179 | Ga0163162_10142154 | 3300013306 | Bacteria | 2514 |
| 180 | Ga0163162_10684904 | 3300013306 | Bacteria | 1148 |
| 181 | Ga0157372_10106641 | 3300013307 | Bacteria | 3205 |
| 182 | Ga0157372_10943780 | 3300013307 | Bacteria | 1000 |
| 183 | Ga0157375_10133542 | 3300013308 | Bacteria | 2603 |
| 184 | Ga0157375_10136415 | 3300013308 | Bacteria | 2578 |
| 185 | Ga0163163_10252071 | 3300014325 | Bacteria | 1816 |
| 186 | Ga0157380_10006431 | 3300014326 | Bacteria | 8273 |
| 187 | Ga0157380_10506959 | 3300014326 | Bacteria | 1173 |
| 188 | Ga0182008_10000123 | 3300014497 | Bacteria | 58726 |
| 189 | Ga0182008_10044303 | 3300014497 | Bacteria | 2213 |
| 190 | Ga0157377_10029771 | 3300014745 | Bacteria | 2952 |
| 191 | Ga0157377_11160391 | 3300014745 | Unclassified | 595 |
| 192 | Ga0157379_10080526 | 3300014968 | Bacteria | 2917 |
| 193 | Ga0157379_12506707 | 3300014968 | Bacteria | 516 |
| 194 | Ga0182006_1010265 | 3300015261 | Bacteria | 4170 |
| 195 | Ga0182006_1021769 | 3300015261 | Bacteria | 2670 |
| 196 | Ga0182006_1072618 | 3300015261 | Bacteria | 1272 |
| 197 | Ga0182007_10000098 | 3300015262 | Bacteria | 61202 |
| 198 | Ga0182005_1000825 | 3300015265 | Bacteria | 13935 |
| 199 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 200 | Ga0163161_10001879 | 3300017792 | Bacteria | 15327 |
| 201 | Ga0163161_10002326 | 3300017792 | Bacteria | 13623 |
| 202 | Ga0163161_10016180 | 3300017792 | Bacteria | 5206 |
| 203 | Ga0163161_10176542 | 3300017792 | Bacteria | 1636 |
| 204 | Ga0163161_11214146 | 3300017792 | Bacteria | 652 |
| 205 | Ga0207425_1007719 | 3300025245 | Bacteria | 2811 |
| 206 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 207 | Ga0209565_1000022 | 3300025263 | Bacteria | 390888 |
| 208 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 209 | Ga0209673_1000110 | 3300025273 | Bacteria | 181173 |
| 210 | Ga0209673_1006118 | 3300025273 | Bacteria | 5901 |
| 211 | Ga0209130_1008496 | 3300025284 | Bacteria | 3027 |
| 212 | Ga0209130_1012924 | 3300025284 | Bacteria | 2161 |
| 213 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 214 | Ga0209675_1000060 | 3300025291 | Bacteria | 184316 |
| 215 | Ga0209675_1030644 | 3300025291 | Bacteria | 1280 |
| 216 | Ga0209676_1000219 | 3300025292 | Bacteria | 125330 |
| 217 | Ga0209676_1000279 | 3300025292 | Bacteria | 106358 |
| 218 | Ga0209676_1000700 | 3300025292 | Bacteria | 46962 |
| 219 | Ga0209676_1000993 | 3300025292 | Bacteria | 33600 |
| 220 | Ga0209676_1006055 | 3300025292 | Bacteria | 6090 |
| 221 | Ga0209676_1006460 | 3300025292 | Bacteria | 5781 |
| 222 | Ga0209676_1008321 | 3300025292 | Bacteria | 4645 |
| 223 | Ga0209676_1011167 | 3300025292 | Bacteria | 3651 |
| 224 | Ga0209025_1000015 | 3300025294 | Bacteria | 808120 |
| 225 | Ga0209025_1002408 | 3300025294 | Bacteria | 19932 |
| 226 | Ga0209025_1003524 | 3300025294 | Bacteria | 14690 |
| 227 | Ga0209025_1034193 | 3300025294 | Bacteria | 2328 |
| 228 | Ga0209025_1044149 | 3300025294 | Bacteria | 1867 |
| 229 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 230 | Ga0209564_1000304 | 3300025295 | Bacteria | 97304 |
| 231 | Ga0209564_1004198 | 3300025295 | Bacteria | 8983 |
| 232 | Ga0209050_1000542 | 3300025298 | Bacteria | 62500 |
| 233 | Ga0209050_1000825 | 3300025298 | Bacteria | 43030 |
| 234 | Ga0209050_1004106 | 3300025298 | Bacteria | 10168 |
| 235 | Ga0209050_1013892 | 3300025298 | Bacteria | 3527 |
| 236 | Ga0209050_1038998 | 3300025298 | Bacteria | 1345 |
| 237 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 238 | Ga0209256_1000898 | 3300025299 | Bacteria | 36504 |
| 239 | Ga0209256_1003923 | 3300025299 | Bacteria | 9811 |
| 240 | Ga0209256_1003949 | 3300025299 | Bacteria | 9756 |
| 241 | Ga0209256_1010135 | 3300025299 | Bacteria | 4002 |
| 242 | Ga0209256_1023236 | 3300025299 | Bacteria | 1854 |
| 243 | Ga0207426_1087682 | 3300025302 | Bacteria | 830 |
| 244 | Ga0209051_1012723 | 3300025303 | Bacteria | 4051 |
| 245 | Ga0209257_1000570 | 3300025304 | Bacteria | 62283 |
| 246 | Ga0209257_1000615 | 3300025304 | Bacteria | 58010 |
| 247 | Ga0209257_1000726 | 3300025304 | Bacteria | 50193 |
| 248 | Ga0209257_1000933 | 3300025304 | Bacteria | 40419 |
| 249 | Ga0209257_1004313 | 3300025304 | Bacteria | 11175 |
| 250 | Ga0209257_1005417 | 3300025304 | Bacteria | 8978 |
| 251 | Ga0209257_1005942 | 3300025304 | Bacteria | 8202 |
| 252 | Ga0209257_1026720 | 3300025304 | Bacteria | 1937 |
| 253 | Ga0207713_1027375 | 3300025735 | Bacteria | 2590 |
| 254 | Ga0207710_10038373 | 3300025900 | Bacteria | 2117 |
| 255 | Ga0207688_10296678 | 3300025901 | Bacteria | 988 |
| 256 | Ga0207645_10031489 | 3300025907 | Bacteria | 3412 |
| 257 | Ga0207684_10002129 | 3300025910 | Bacteria | 20290 |
| 258 | Ga0207662_10024040 | 3300025918 | Bacteria | 3505 |
| 259 | Ga0207657_10003945 | 3300025919 | Bacteria | 15757 |
| 260 | Ga0207649_10103917 | 3300025920 | Bacteria | 1886 |
| 261 | Ga0207649_10387414 | 3300025920 | Bacteria | 1043 |
| 262 | Ga0207649_10570636 | 3300025920 | Bacteria | 868 |
| 263 | Ga0207652_10012548 | 3300025921 | Bacteria | 6849 |
| 264 | Ga0207681_11003921 | 3300025923 | Bacteria | 700 |
| 265 | Ga0207650_10294972 | 3300025925 | Bacteria | 1323 |
| 266 | Ga0207659_10240057 | 3300025926 | Bacteria | 1465 |
| 267 | Ga0207644_10014478 | 3300025931 | Bacteria | 5274 |
| 268 | Ga0207644_10545433 | 3300025931 | Bacteria | 959 |
| 269 | Ga0207706_10321394 | 3300025933 | Bacteria | 1347 |
| 270 | Ga0207709_10000898 | 3300025935 | Bacteria | 22480 |
| 271 | Ga0207670_10327294 | 3300025936 | Bacteria | 1207 |
| 272 | Ga0207704_10057176 | 3300025938 | Bacteria | 2394 |
| 273 | Ga0207691_10120615 | 3300025940 | Bacteria | 2324 |
| 274 | Ga0207711_10139960 | 3300025941 | Bacteria | 2176 |
| 275 | Ga0207689_11071378 | 3300025942 | Unclassified | 680 |
| 276 | Ga0207679_10045070 | 3300025945 | Bacteria | 3187 |
| 277 | Ga0207679_10264414 | 3300025945 | Bacteria | 1469 |
| 278 | Ga0207679_10865260 | 3300025945 | Bacteria | 826 |
| 279 | Ga0207651_10256253 | 3300025960 | Bacteria | 1434 |
| 280 | Ga0207712_10092257 | 3300025961 | Bacteria | 2232 |
| 281 | Ga0207668_10016455 | 3300025972 | Bacteria | 4616 |
| 282 | Ga0207658_10656278 | 3300025986 | Bacteria | 946 |
| 283 | Ga0207677_10147736 | 3300026023 | Bacteria | 1809 |
| 284 | Ga0207678_10488937 | 3300026067 | Bacteria | 1072 |
| 285 | Ga0207678_10546561 | 3300026067 | Bacteria | 1013 |
| 286 | Ga0207708_10080475 | 3300026075 | Bacteria | 2503 |
| 287 | Ga0207641_10276184 | 3300026088 | Bacteria | 1578 |
| 288 | Ga0207648_10121319 | 3300026089 | Bacteria | 2298 |
| 289 | Ga0207674_10276171 | 3300026116 | Bacteria | 1628 |
| 290 | Ga0207674_10667490 | 3300026116 | Bacteria | 1004 |
| 291 | Ga0207675_100000363 | 3300026118 | Bacteria | 43476 |
| 292 | Ga0207675_100016339 | 3300026118 | Bacteria | 6928 |
| 293 | Ga0207675_100917350 | 3300026118 | Bacteria | 893 |
| 294 | Ga0207683_10202175 | 3300026121 | Bacteria | 1806 |
| 295 | Ga0207683_10299071 | 3300026121 | Bacteria | 1472 |
| 296 | Ga0209973_1012321 | 3300027252 | Bacteria | 1038 |
| 297 | Ga0209371_1000007 | 3300027312 | Bacteria | 1050654 |
| 298 | Ga0209969_1002058 | 3300027360 | Bacteria | 2774 |
| 299 | Ga0209967_1016156 | 3300027364 | Bacteria | 1072 |
| 300 | Ga0209981_1005034 | 3300027378 | Bacteria | 1749 |
| 301 | Ga0209995_1019531 | 3300027471 | Bacteria | 1119 |
| 302 | Ga0209999_1002029 | 3300027543 | Bacteria | 3534 |
| 303 | Ga0209982_1000486 | 3300027552 | Bacteria | 4941 |
| 304 | Ga0209970_1003538 | 3300027614 | Bacteria | 2619 |
| 305 | Ga0209983_1031281 | 3300027665 | Bacteria | 1135 |
| 306 | Ga0209971_1000850 | 3300027682 | Bacteria | 7870 |
| 307 | Ga0209974_10005119 | 3300027876 | Bacteria | 4631 |
| 308 | Ga0207428_10030485 | 3300027907 | Bacteria | 4458 |
| 309 | Ga0207428_10032841 | 3300027907 | Bacteria | 4268 |
| 310 | Ga0268266_10179931 | 3300028379 | Bacteria | 1925 |
| 311 | Ga0268266_10219396 | 3300028379 | Bacteria | 1747 |
| 312 | Ga0268266_10309201 | 3300028379 | Bacteria | 1476 |
| 313 | Ga0268266_10331697 | 3300028379 | Bacteria | 1426 |
| 314 | Ga0268266_11244537 | 3300028379 | Unclassified | 719 |
| 315 | Ga0268265_10000243 | 3300028380 | Bacteria | 62321 |
| 316 | Ga0268265_10112416 | 3300028380 | Bacteria | 2226 |
| 317 | Ga0268265_10361488 | 3300028380 | Bacteria | 1329 |
| 318 | Ga0268264_10333330 | 3300028381 | Bacteria | 1438 |
| 319 | Ga0268264_10630754 | 3300028381 | Bacteria | 1059 |
| 320 | Ga0265318_10115957 | 3300028577 | Bacteria | 984 |
| 321 | Ga0307515_10000037 | 3300028794 | Bacteria | 331970 |
| 322 | Ga0268256_1000008 | 3300030500 | Bacteria | 1050654 |
| 323 | Ga0316177_1015236 | 3300030731 | Bacteria | 5186 |
| 324 | Ga0316176_1168218 | 3300030732 | Bacteria | 1383 |
| 325 | Ga0316182_1099026 | 3300030745 | Bacteria | 809 |
| 326 | Ga0316182_1420801 | 3300030745 | Bacteria | 1227 |
| 327 | Ga0265328_10044255 | 3300031239 | Bacteria | 1637 |
| 328 | Ga0265331_10158800 | 3300031250 | Bacteria | 1025 |
| 329 | Ga0265327_10001605 | 3300031251 | Bacteria | 27421 |
| 330 | Ga0265327_10046816 | 3300031251 | Bacteria | 2286 |
| 331 | Ga0265327_10217951 | 3300031251 | Bacteria | 859 |
| 332 | Ga0265316_10029468 | 3300031344 | Bacteria | 4512 |
| 333 | Ga0307509_10931124 | 3300031507 | Bacteria | 534 |
| 334 | Ga0307408_100099944 | 3300031548 | Bacteria | 2208 |
| 335 | Ga0307408_100261516 | 3300031548 | Bacteria | 1432 |
| 336 | Ga0307408_100646392 | 3300031548 | Bacteria | 945 |
| 337 | Ga0307408_100726709 | 3300031548 | Bacteria | 895 |
| 338 | Ga0307408_100966598 | 3300031548 | Bacteria | 783 |
| 339 | Ga0316575_10176940 | 3300031665 | Bacteria | 885 |
| 340 | Ga0316579_10018238 | 3300031691 | Bacteria | 3086 |
| 341 | Ga0265314_10018441 | 3300031711 | Bacteria | 5440 |
| 342 | Ga0307405_10160822 | 3300031731 | Bacteria | 1590 |
| 343 | Ga0307405_10493795 | 3300031731 | Bacteria | 980 |
| 344 | Ga0307405_10752975 | 3300031731 | Bacteria | 812 |
| 345 | Ga0307405_10881125 | 3300031731 | Bacteria | 756 |
| 346 | Ga0316577_10048630 | 3300031733 | Bacteria | 2368 |
| 347 | Ga0307413_10271232 | 3300031824 | Bacteria | 1270 |
| 348 | Ga0307413_10395331 | 3300031824 | Bacteria | 1081 |
| 349 | Ga0307413_10425902 | 3300031824 | Bacteria | 1047 |
| 350 | Ga0307413_10691486 | 3300031824 | Bacteria | 846 |
| 351 | Ga0307413_11252776 | 3300031824 | Bacteria | 647 |
| 352 | Ga0307406_10198670 | 3300031901 | Bacteria | 1474 |
| 353 | Ga0307406_10325756 | 3300031901 | Bacteria | 1190 |
| 354 | Ga0307406_10462040 | 3300031901 | Bacteria | 1021 |
| 355 | Ga0307406_10832393 | 3300031901 | Bacteria | 781 |
| 356 | Ga0307406_11174781 | 3300031901 | Bacteria | 665 |
| 357 | Ga0307407_10202619 | 3300031903 | Bacteria | 1331 |
| 358 | Ga0307407_10413487 | 3300031903 | Bacteria | 970 |
| 359 | Ga0307412_10000684 | 3300031911 | Bacteria | 19615 |
| 360 | Ga0307412_10116373 | 3300031911 | Bacteria | 1917 |
| 361 | Ga0307412_11920201 | 3300031911 | Bacteria | 547 |
| 362 | Ga0307409_100179830 | 3300031995 | Bacteria | 1871 |
| 363 | Ga0307409_100206880 | 3300031995 | Bacteria | 1760 |
| 364 | Ga0307409_101561820 | 3300031995 | Bacteria | 688 |
| 365 | Ga0307416_100091070 | 3300032002 | Bacteria | 2618 |
| 366 | Ga0307416_100560435 | 3300032002 | Bacteria | 1217 |
| 367 | Ga0307416_100591092 | 3300032002 | Bacteria | 1188 |
| 368 | Ga0307416_100656311 | 3300032002 | Bacteria | 1134 |
| 369 | Ga0307414_10000988 | 3300032004 | Bacteria | 14519 |
| 370 | Ga0307414_10201971 | 3300032004 | Bacteria | 1617 |
| 371 | Ga0307414_10207378 | 3300032004 | Bacteria | 1599 |
| 372 | Ga0307414_10428930 | 3300032004 | Bacteria | 1154 |
| 373 | Ga0307414_10541219 | 3300032004 | Bacteria | 1036 |
| 374 | Ga0307414_10603811 | 3300032004 | Bacteria | 984 |
| 375 | Ga0307414_10677936 | 3300032004 | Bacteria | 931 |
| 376 | Ga0307414_10732778 | 3300032004 | Bacteria | 897 |
| 377 | Ga0307414_10893419 | 3300032004 | Bacteria | 814 |
| 378 | Ga0307414_10922141 | 3300032004 | Bacteria | 801 |
| 379 | Ga0307411_10022498 | 3300032005 | Bacteria | 3712 |
| 380 | Ga0307411_10041896 | 3300032005 | Bacteria | 2917 |
| 381 | Ga0307411_11541490 | 3300032005 | Bacteria | 612 |
| 382 | Ga0307415_100050782 | 3300032126 | Bacteria | 2812 |
| 383 | Ga0307415_102087881 | 3300032126 | Bacteria | 553 |
| 384 | Ga0316585_10165660 | 3300032137 | Bacteria | 730 |
| 385 | Ga0316593_10000885 | 3300032168 | Bacteria | 6099 |
| 386 | Ga0316593_10015361 | 3300032168 | Bacteria | 2302 |
| 387 | Ga0373932_0225699 | 3300035112 | Bacteria | 675 |
| 388 | Ga0316574_0043722 | 3300035398 | Bacteria | 2769 |
| 389 | Ga0373931_0071057 | 3300035691 | Bacteria | 1900 |
| 390 | Ga0316582_0002695 | 3300036647 | Bacteria | 8423 |
| 391 | Ga0316582_0018822 | 3300036647 | Bacteria | 4028 |
| 392 | Ga0316584_0032994 | 3300036712 | Bacteria | 3833 |
| 393 | Ga0316584_0610730 | 3300036712 | Bacteria | 755 |
| 394 | Ga0395899_0061007 | 3300037312 | Bacteria | 2777 |
| 395 | Ga0395900_0022237 | 3300037418 | Bacteria | 6488 |
| 396 | Ga0395905_0002691 | 3300037471 | Bacteria | 19486 |
| 397 | Ga0395905_0018196 | 3300037471 | Bacteria | 6669 |
| 398 | Ga0395905_0046527 | 3300037471 | Bacteria | 4068 |
| 399 | Ga0395905_1225035 | 3300037471 | Bacteria | 654 |
| 400 | Ga0316581_0000879 | 3300037588 | Bacteria | 6349 |
| 401 | Ga0395901_0012789 | 3300038443 | Bacteria | 8512 |
| 402 | Ga0439436_0010180 | 3300041404 | Bacteria | 2871 |
| 403 | Ga0439436_0042363 | 3300041404 | Bacteria | 1301 |
| 404 | Ga0439436_0063338 | 3300041404 | Bacteria | 1033 |
| 405 | Ga0439439_0000653 | 3300041406 | Bacteria | 6116 |
| 406 | Ga0439439_0043187 | 3300041406 | Bacteria | 1172 |
| 407 | Ga0439447_005849 | 3300041407 | Bacteria | 4048 |
| 408 | Ga0451789_0135540 | 3300041443 | Bacteria | 962 |
| 409 | Ga0451793_1244880 | 3300041452 | Bacteria | 2166 |
| 410 | Ga0451797_0295554 | 3300041453 | Bacteria | 1101 |
| 411 | Ga0451833_0619913 | 3300041491 | Bacteria | 833 |
| 412 | Ga0451833_0792306 | 3300041491 | Bacteria | 613 |
| 413 | Ga0451837_0126293 | 3300041494 | Bacteria | 1117 |
| 414 | Ga0451837_0131705 | 3300041494 | Bacteria | 643 |
| 415 | Ga0451837_1509570 | 3300041494 | Bacteria | 691 |
| 416 | Ga0451841_1245039 | 3300041498 | Bacteria | 1121 |
| 417 | Ga0451843_1155314 | 3300041509 | Bacteria | 711 |
| 418 | Ga0451843_1650970 | 3300041509 | Bacteria | 1222 |
| 419 | Ga0451853_4088123 | 3300041512 | Bacteria | 609 |
| 420 | Ga0439445_0076328 | 3300042004 | Bacteria | 933 |
| 421 | Ga0439445_0128118 | 3300042004 | Bacteria | 731 |
| 422 | Ga0439432_074035 | 3300042006 | Bacteria | 1036 |
| 423 | Ga0439449_0069869 | 3300042007 | Bacteria | 1294 |
| 424 | Ga0439449_0311146 | 3300042007 | Bacteria | 595 |
| 425 | Ga0439452_059343 | 3300042010 | Bacteria | 860 |
| 426 | Ga0439455_0104920 | 3300042012 | Bacteria | 783 |
| 427 | Ga0439462_0024973 | 3300042015 | Bacteria | 1572 |
| 428 | Ga0439462_0136672 | 3300042015 | Bacteria | 686 |
| 429 | Ga0450911_003455 | 3300042115 | Bacteria | 2787 |
| 430 | Ga0450914_006132 | 3300042118 | Bacteria | 1044 |
| 431 | Ga0450894_071625 | 3300042131 | Bacteria | 532 |
| 432 | Ga0450905_008334 | 3300042142 | Bacteria | 1418 |
| 433 | Ga0439464_0050869 | 3300042439 | Bacteria | 1198 |
| 434 | Ga0450918_059222 | 3300042531 | Bacteria | 706 |
| 435 | Ga0450901_005720 | 3300042533 | Bacteria | 1276 |
| 436 | Ga0450901_010309 | 3300042533 | Bacteria | 968 |
| 437 | Ga0451577_0000705 | 3300042876 | Bacteria | 52191 |
| 438 | Ga0451577_0003464 | 3300042876 | Bacteria | 17556 |
| 439 | Ga0453684_0001232 | 3300044712 | Bacteria | 78122 |
| 440 | Ga0453684_0281061 | 3300044712 | Bacteria | 1898 |
| 441 | Ga0451576_0368198 | 3300045051 | Bacteria | 1505 |
| 442 | Ga0451576_0563244 | 3300045051 | Bacteria | 1197 |
| 443 | Ga0495627_062570 | 3300046453 | Bacteria | 1098 |
| 444 | Ga0495638_0001034 | 3300046460 | Bacteria | 27502 |
| 445 | Ga0495638_0091396 | 3300046460 | Bacteria | 1833 |
| 446 | Ga0495638_0299456 | 3300046460 | Bacteria | 867 |
| 447 | Ga0495638_0360764 | 3300046460 | Bacteria | 764 |
| 448 | Ga0495650_0036587 | 3300046471 | Bacteria | 2146 |
| 449 | Ga0495585_0050465 | 3300046492 | Bacteria | 2308 |
| 450 | Ga0495583_0154378 | 3300046506 | Bacteria | 950 |
| 451 | Ga0495610_0001979 | 3300046512 | Bacteria | 17496 |
| 452 | Ga0495616_0186411 | 3300046513 | Bacteria | 919 |
| 453 | Ga0495631_0012646 | 3300046518 | Bacteria | 4116 |
| 454 | Ga0495632_0061018 | 3300046519 | Bacteria | 1831 |
| 455 | Ga0495643_0002439 | 3300046522 | Bacteria | 14756 |
| 456 | Ga0495663_0002405 | 3300046525 | Bacteria | 5629 |
| 457 | Ga0495663_0004244 | 3300046525 | Bacteria | 4044 |
| 458 | Ga0495663_0004410 | 3300046525 | Bacteria | 3961 |
| 459 | Ga0495663_0042504 | 3300046525 | Bacteria | 1385 |
| 460 | Ga0495663_0100401 | 3300046525 | Bacteria | 952 |
| 461 | Ga0495642_0333752 | 3300046528 | Bacteria | 666 |
| 462 | Ga0495621_0082155 | 3300046539 | Bacteria | 1203 |
| 463 | Ga0495633_0010993 | 3300046558 | Bacteria | 4913 |
| 464 | Ga0495633_0012134 | 3300046558 | Bacteria | 4599 |
| 465 | Ga0495633_0111332 | 3300046558 | Bacteria | 1269 |
| 466 | Ga0495656_0031294 | 3300046615 | Bacteria | 2157 |
| 467 | Ga0495656_0042344 | 3300046615 | Bacteria | 1906 |
| 468 | Ga0495656_0088229 | 3300046615 | Bacteria | 1413 |
| 469 | Ga0495668_0003900 | 3300046616 | Bacteria | 10891 |
| 470 | Ga0495625_0002787 | 3300046660 | Bacteria | 18431 |
| 471 | Ga0495625_0050008 | 3300046660 | Bacteria | 3001 |
| 472 | Ga0495625_0157227 | 3300046660 | Bacteria | 1525 |
| 473 | Ga0495625_0191514 | 3300046660 | Bacteria | 1354 |
| 474 | Ga0495625_0610438 | 3300046660 | Bacteria | 654 |
| 475 | Ga0495659_0030708 | 3300046664 | Bacteria | 1872 |
| 476 | Ga0495670_0035364 | 3300046691 | Bacteria | 2490 |
| 477 | Ga0495671_0210122 | 3300046692 | Bacteria | 943 |
| 478 | Ga0495660_0175463 | 3300046810 | Bacteria | 1041 |
| 479 | Ga0495636_0021265 | 3300047318 | Bacteria | 2619 |
| 480 | Ga0495636_0141332 | 3300047318 | Bacteria | 1075 |
| 481 | Ga0495636_0400777 | 3300047318 | Bacteria | 653 |
| 482 | Ga0495672_0000456 | 3300047320 | Bacteria | 48378 |
| 483 | Ga0495672_0098723 | 3300047320 | Bacteria | 1588 |
| 484 | Ga0495672_0123812 | 3300047320 | Bacteria | 1370 |
| 485 | Ga0495685_190070 | 3300047447 | Bacteria | 660 |
| 486 | Ga0495686_0002853 | 3300047472 | Bacteria | 15571 |
| 487 | Ga0496101_0098845 | 3300048904 | Bacteria | 2181 |
| 488 | Ga0496102_1116690 | 3300048905 | Bacteria | 708 |
| 489 | Ga0496102_1241883 | 3300048905 | Bacteria | 664 |
| 490 | Ga0496103_0130276 | 3300048906 | Bacteria | 1606 |
| 491 | Ga0496104_1040665 | 3300048907 | Bacteria | 722 |
| 492 | Ga0496105_0049515 | 3300048908 | Bacteria | 3470 |
| 493 | Ga0496106_0116221 | 3300048909 | Bacteria | 2087 |
| 494 | Ga0496107_0423293 | 3300048910 | Bacteria | 990 |
| 495 | Ga0496108_0145647 | 3300048911 | Bacteria | 2042 |
| 496 | Ga0496108_0147338 | 3300048911 | Bacteria | 2030 |
| 497 | Ga0496109_0134266 | 3300048912 | Bacteria | 2311 |
| 498 | Ga0496109_0260800 | 3300048912 | Bacteria | 1632 |
| 499 | Ga0496109_0337682 | 3300048912 | Bacteria | 1423 |
| 500 | Ga0496109_0803867 | 3300048912 | Bacteria | 878 |
| 501 | Ga0496110_0156061 | 3300048913 | Bacteria | 2067 |
| 502 | Ga0496110_0548758 | 3300048913 | Bacteria | 1050 |
| 503 | Ga0496111_0310707 | 3300048914 | Bacteria | 1168 |
| 504 | Ga0496111_0623160 | 3300048914 | Bacteria | 789 |
| 505 | Ga0496111_0742876 | 3300048914 | Bacteria | 712 |
| 506 | Ga0496112_0195277 | 3300048915 | Bacteria | 1984 |
| 507 | Ga0496112_0497727 | 3300048915 | Bacteria | 1154 |
| 508 | Ga0496113_0028397 | 3300048916 | Bacteria | 4023 |
| 509 | Ga0496113_0142457 | 3300048916 | Bacteria | 1887 |
| 510 | Ga0496113_0233046 | 3300048916 | Bacteria | 1468 |
| 511 | Ga0496113_0447802 | 3300048916 | Bacteria | 1037 |
| 512 | Ga0496116_0002429 | 3300048919 | Bacteria | 19630 |
| 513 | Ga0496116_0099750 | 3300048919 | Bacteria | 1738 |
| 514 | Ga0496116_0114945 | 3300048919 | Bacteria | 1571 |
| 515 | Ga0496116_0160986 | 3300048919 | Bacteria | 1231 |
| 516 | Ga0496116_0207294 | 3300048919 | Bacteria | 1019 |
| 517 | Ga0496116_0210665 | 3300048919 | Bacteria | 1007 |
| 518 | Ga0496117_0000779 | 3300048920 | Bacteria | 50165 |
| 519 | Ga0496117_0003178 | 3300048920 | Bacteria | 19525 |
| 520 | Ga0496117_0003531 | 3300048920 | Bacteria | 18080 |
| 521 | Ga0496117_0065950 | 3300048920 | Bacteria | 2458 |
| 522 | Ga0496117_0068687 | 3300048920 | Bacteria | 2391 |
| 523 | Ga0496117_0070380 | 3300048920 | Bacteria | 2350 |
| 524 | Ga0496117_0120546 | 3300048920 | Bacteria | 1612 |
| 525 | Ga0496117_0380775 | 3300048920 | Bacteria | 718 |
| 526 | Ga0496118_0000497 | 3300048921 | Bacteria | 65119 |
| 527 | Ga0496118_0002346 | 3300048921 | Bacteria | 25662 |
| 528 | Ga0496118_0011982 | 3300048921 | Bacteria | 8379 |
| 529 | Ga0496118_0027049 | 3300048921 | Bacteria | 4864 |
| 530 | Ga0496118_0035630 | 3300048921 | Bacteria | 4037 |
| 531 | Ga0496118_0122278 | 3300048921 | Bacteria | 1693 |
| 532 | Ga0496118_0177190 | 3300048921 | Bacteria | 1293 |
| 533 | Ga0496119_0000495 | 3300048922 | Bacteria | 53700 |
| 534 | Ga0496119_0105982 | 3300048922 | Bacteria | 1569 |
| 535 | Ga0496119_0147805 | 3300048922 | Bacteria | 1262 |
| 536 | Ga0496119_0179456 | 3300048922 | Bacteria | 1111 |
| 537 | Ga0496120_0000523 | 3300048923 | Bacteria | 59431 |
| 538 | Ga0496120_0083539 | 3300048923 | Bacteria | 1723 |
| 539 | Ga0496121_0002174 | 3300048924 | Bacteria | 30706 |
| 540 | Ga0496121_0004473 | 3300048924 | Bacteria | 18776 |
| 541 | Ga0496121_0010608 | 3300048924 | Bacteria | 10353 |
| 542 | Ga0496121_0027317 | 3300048924 | Bacteria | 5342 |
| 543 | Ga0496121_0034081 | 3300048924 | Bacteria | 4589 |
| 544 | Ga0496121_0045582 | 3300048924 | Bacteria | 3765 |
| 545 | Ga0496121_0689782 | 3300048924 | Bacteria | 616 |
| 546 | Ga0496122_0013601 | 3300048925 | Bacteria | 7947 |
| 547 | Ga0496122_0096341 | 3300048925 | Bacteria | 1996 |
| 548 | Ga0496122_0141076 | 3300048925 | Bacteria | 1507 |
| 549 | Ga0496122_0157339 | 3300048925 | Bacteria | 1392 |
| 550 | Ga0496122_0178030 | 3300048925 | Bacteria | 1272 |
| 551 | Ga0496122_0426874 | 3300048925 | Bacteria | 664 |
| 552 | Ga0496123_0024124 | 3300048926 | Bacteria | 4633 |
| 553 | Ga0496123_0032144 | 3300048926 | Bacteria | 3806 |
| 554 | Ga0496123_0045601 | 3300048926 | Bacteria | 2984 |
| 555 | Ga0496123_0099571 | 3300048926 | Bacteria | 1696 |
| 556 | Ga0496123_0128384 | 3300048926 | Bacteria | 1410 |
| 557 | Ga0496123_0350232 | 3300048926 | Bacteria | 687 |
| 558 | Ga0496124_0000813 | 3300048927 | Bacteria | 50733 |
| 559 | Ga0496124_0001070 | 3300048927 | Bacteria | 43255 |
| 560 | Ga0496124_0003371 | 3300048927 | Bacteria | 19625 |
| 561 | Ga0496124_0004018 | 3300048927 | Bacteria | 17511 |
| 562 | Ga0496124_0008226 | 3300048927 | Bacteria | 10940 |
| 563 | Ga0496124_0008239 | 3300048927 | Bacteria | 10930 |
| 564 | Ga0496124_0033579 | 3300048927 | Bacteria | 4512 |
| 565 | Ga0496124_0207382 | 3300048927 | Bacteria | 1485 |
| 566 | Ga0496124_0437856 | 3300048927 | Bacteria | 895 |
| 567 | Ga0496124_0469597 | 3300048927 | Bacteria | 852 |
| 568 | Ga0496124_0784492 | 3300048927 | Bacteria | 592 |
| 569 | Ga0496125_0006055 | 3300048928 | Bacteria | 13220 |
| 570 | Ga0496125_0006971 | 3300048928 | Bacteria | 12103 |
| 571 | Ga0496125_0009073 | 3300048928 | Bacteria | 10289 |
| 572 | Ga0496125_0017297 | 3300048928 | Bacteria | 6883 |
| 573 | Ga0496125_0062589 | 3300048928 | Bacteria | 2974 |
| 574 | Ga0496125_0134088 | 3300048928 | Bacteria | 1736 |
| 575 | Ga0496125_0195132 | 3300048928 | Bacteria | 1332 |
| 576 | Ga0496125_0215471 | 3300048928 | Bacteria | 1242 |
| 577 | Ga0496126_0002959 | 3300048929 | Bacteria | 22073 |
| 578 | Ga0496126_0186456 | 3300048929 | Bacteria | 1759 |
| 579 | Ga0496126_0215042 | 3300048929 | Bacteria | 1617 |
| 580 | Ga0496126_0318806 | 3300048929 | Bacteria | 1278 |
| 581 | Ga0496126_0339193 | 3300048929 | Bacteria | 1231 |
| 582 | Ga0501290_001987 | 3300049513 | Bacteria | 2692 |
| 583 | Ga0501299_015060 | 3300049522 | Bacteria | 1354 |
| 584 | Ga0501300_049069 | 3300049523 | Bacteria | 648 |
| 585 | Ga0501031_0042123 | 3300049568 | Bacteria | 2981 |
| 586 | Ga0501031_0192323 | 3300049568 | Bacteria | 1332 |
| 587 | Ga0501031_0235015 | 3300049568 | Bacteria | 1192 |
| 588 | Ga0501032_0028005 | 3300049569 | Bacteria | 3872 |
| 589 | Ga0501032_0090781 | 3300049569 | Bacteria | 2027 |
| 590 | Ga0501033_0000816 | 3300049570 | Bacteria | 28492 |
| 591 | Ga0501033_0013979 | 3300049570 | Bacteria | 6106 |
| 592 | Ga0501033_0120224 | 3300049570 | Bacteria | 1907 |
| 593 | Ga0501033_0623625 | 3300049570 | Bacteria | 738 |
| 594 | Ga0501034_0000498 | 3300049571 | Bacteria | 63644 |
| 595 | Ga0501034_0285310 | 3300049571 | Bacteria | 1590 |
| 596 | Ga0501034_0388715 | 3300049571 | Bacteria | 1319 |
| 597 | Ga0501034_0454941 | 3300049571 | Bacteria | 1198 |
| 598 | Ga0501034_0621372 | 3300049571 | Bacteria | 984 |
| 599 | Ga0501034_1194457 | 3300049571 | Bacteria | 639 |
| 600 | Ga0501036_0128248 | 3300049572 | Bacteria | 2142 |
| 601 | Ga0501036_0538923 | 3300049572 | Bacteria | 970 |
| 602 | Ga0501037_0005330 | 3300049573 | Bacteria | 9354 |
| 603 | Ga0501037_0382410 | 3300049573 | Bacteria | 967 |
| 604 | Ga0501038_0035964 | 3300049574 | Bacteria | 4346 |
| 605 | Ga0501038_0073274 | 3300049574 | Bacteria | 2900 |
| 606 | Ga0501039_0278174 | 3300049575 | Bacteria | 1316 |
| 607 | Ga0501039_1319171 | 3300049575 | Bacteria | 556 |
| 608 | Ga0501043_0002229 | 3300049579 | Bacteria | 16513 |
| 609 | Ga0501043_0081603 | 3300049579 | Bacteria | 2541 |
| 610 | Ga0501043_0280812 | 3300049579 | Bacteria | 1276 |
| 611 | Ga0501046_0122135 | 3300049580 | Bacteria | 1981 |
| 612 | Ga0501047_0047672 | 3300049581 | Bacteria | 4139 |
| 613 | Ga0501047_0660820 | 3300049581 | Bacteria | 864 |
| 614 | Ga0501070_0126873 | 3300049586 | Bacteria | 2108 |
| 615 | Ga0501070_0184475 | 3300049586 | Bacteria | 1716 |
| 616 | Ga0501073_0084688 | 3300049589 | Bacteria | 2206 |
| 617 | Ga0501198_049821 | 3300049649 | Bacteria | 744 |
| 618 | Ga0501223_014810 | 3300049663 | Bacteria | 1546 |
| 619 | Ga0501239_006217 | 3300049672 | Bacteria | 1223 |
| 620 | Ga0501242_006260 | 3300049674 | Bacteria | 1356 |
| 621 | Ga0501246_024609 | 3300049676 | Bacteria | 644 |
| 622 | Ga0501079_0440671 | 3300049741 | Bacteria | 1023 |
| 623 | Ga0501080_0004696 | 3300049742 | Bacteria | 12187 |
| 624 | Ga0501265_002088 | 3300049762 | Bacteria | 2278 |
| 625 | Ga0501275_000587 | 3300049772 | Bacteria | 4039 |
| 626 | Ga0501035_0083713 | 3300049822 | Bacteria | 2814 |
| 627 | Ga0501035_1284667 | 3300049822 | Bacteria | 565 |
| 628 | Ga0501044_0022048 | 3300049823 | Bacteria | 6791 |
| 629 | Ga0501044_0098267 | 3300049823 | Bacteria | 2947 |
| 630 | Ga0501212_011257 | 3300049851 | Bacteria | 1286 |
| 631 | nmdc:mga00v17_119_c1 | 3300050491 | Bacteria | 46532 |
| 632 | nmdc:mga00v17_122437_c1 | 3300050491 | Bacteria | 1657 |
| 633 | nmdc:mga00v17_45394_c1 | 3300050491 | Bacteria | 2655 |
| 634 | nmdc:mga00v17_63748_c1 | 3300050491 | Bacteria | 2270 |
| 635 | nmdc:mga05p37_1261096_c1 | 3300050507 | Bacteria | 757 |
| 636 | nmdc:mga05p37_1712008_c1 | 3300050507 | Bacteria | 612 |
| 637 | nmdc:mga05p37_33789_c1 | 3300050507 | Bacteria | 6264 |
| 638 | nmdc:mga05p37_7681_c1 | 3300050507 | Bacteria | 12723 |
| 639 | nmdc:mga09592_12355_c1 | 3300050508 | Bacteria | 6955 |
| 640 | nmdc:mga09592_4208_c1 | 3300050508 | Bacteria | 11630 |
| 641 | nmdc:mga0qj67_102252_c1 | 3300050509 | Bacteria | 2311 |
| 642 | nmdc:mga0qj67_123449_c1 | 3300050509 | Bacteria | 2095 |
| 643 | nmdc:mga0qj67_169597_c1 | 3300050509 | Bacteria | 1772 |
| 644 | nmdc:mga0qj67_2648_c1 | 3300050509 | Bacteria | 12826 |
| 645 | nmdc:mga0qj67_96627_c1 | 3300050509 | Bacteria | 2378 |
| 646 | nmdc:mga06r32_1391_c1 | 3300050510 | Bacteria | 21853 |
| 647 | nmdc:mga06r32_5609_c1 | 3300050510 | Bacteria | 11288 |
| 648 | nmdc:mga06r32_8925_c1 | 3300050510 | Bacteria | 9035 |
| 649 | nmdc:mga08y16_1913_c1 | 3300050511 | Bacteria | 21225 |
| 650 | nmdc:mga08y16_49424_c1 | 3300050511 | Bacteria | 4402 |
| 651 | nmdc:mga08y16_75450_c1 | 3300050511 | Bacteria | 3515 |
| 652 | nmdc:mga0n895_1419213_c1 | 3300050512 | Bacteria | 662 |
| 653 | nmdc:mga08x19_282915_c1 | 3300050514 | Bacteria | 1149 |
| 654 | nmdc:mga0a205_207646_c1 | 3300050515 | Bacteria | 1847 |
| 655 | nmdc:mga0sz30_116217_c1 | 3300050516 | Bacteria | 1174 |
| 656 | Ga0500610_0255232 | 3300053079 | Bacteria | 805 |
| 657 | Ga0500651_0001237 | 3300053093 | Bacteria | 12706 |
| 658 | Ga0500556_0203195 | 3300053104 | Bacteria | 783 |
| 659 | Ga0500626_090727 | 3300053128 | Bacteria | 1341 |
| 660 | Ga0500568_0018456 | 3300053139 | Bacteria | 3052 |
| 661 | Ga0500589_267173 | 3300053147 | Bacteria | 620 |
| 662 | Ga0500622_0001818 | 3300053156 | Bacteria | 16211 |
| 663 | Ga0500622_0008192 | 3300053156 | Bacteria | 5869 |
| 664 | Ga0500634_0000051 | 3300053161 | Bacteria | 52447 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042004 | Ga0439445_0076328 | Ga0439445_0076328_516_920 | 119 |
| 2 | 3300050512 | nmdc:mga0n895_1419213_c1 | nmdc:mga0n895_1419213_c1_248_652 | 119 |
| 3 | 3300006846 | Ga0075430_100208039 | Ga0075430_1002080392 | 121 |
| 4 | 3300006847 | Ga0075431_100595856 | Ga0075431_1005958561 | 121 |
| 5 | 3300031548 | Ga0307408_100099944 | Ga0307408_1000999442 | 122 |
| 6 | 3300031824 | Ga0307413_10691486 | Ga0307413_106914862 | 122 |
| 7 | 3300032002 | Ga0307416_100591092 | Ga0307416_1005910923 | 122 |
| 8 | 3300048914 | Ga0496111_0742876 | Ga0496111_0742876_10_426 | 123 |
| 9 | 3300006051 | Ga0075364_10098188 | Ga0075364_100981882 | 124 |
| 10 | 3300009094 | Ga0111539_10011412 | Ga0111539_100114126 | 124 |
| 11 | 3300010375 | Ga0105239_11640907 | Ga0105239_116409072 | 124 |
| 12 | 3300011119 | Ga0105246_10153986 | Ga0105246_101539863 | 124 |
| 13 | 3300048905 | Ga0496102_1241883 | Ga0496102_1241883_147_581 | 124 |
| 14 | 3300049568 | Ga0501031_0192323 | Ga0501031_0192323_716_1204 | 124 |
| 15 | 3300049569 | Ga0501032_0090781 | Ga0501032_0090781_358_846 | 124 |
| 16 | 3300049570 | Ga0501033_0013979 | Ga0501033_0013979_864_1352 | 124 |
| 17 | 3300049571 | Ga0501034_0454941 | Ga0501034_0454941_291_779 | 124 |
| 18 | 3300049572 | Ga0501036_0538923 | Ga0501036_0538923_328_816 | 124 |
| 19 | 3300049574 | Ga0501038_0073274 | Ga0501038_0073274_487_975 | 124 |
| 20 | 3300049575 | Ga0501039_0278174 | Ga0501039_0278174_721_1188 | 124 |
| 21 | 3300049579 | Ga0501043_0081603 | Ga0501043_0081603_1196_1684 | 124 |
| 22 | 3300049581 | Ga0501047_0660820 | Ga0501047_0660820_163_630 | 124 |
| 23 | 3300049586 | Ga0501070_0126873 | Ga0501070_0126873_674_1162 | 124 |
| 24 | 3300049822 | Ga0501035_0083713 | Ga0501035_0083713_261_749 | 124 |
| 25 | 3300049823 | Ga0501044_0098267 | Ga0501044_0098267_1627_2115 | 124 |
| 26 | 3300050491 | nmdc:mga00v17_45394_c1 | nmdc:mga00v17_45394_c1_1346_1828 | 124 |
| 27 | 3300050511 | nmdc:mga08y16_49424_c1 | nmdc:mga08y16_49424_c1_2826_3260 | 124 |
| 28 | 3300003771 | Ga0055526_1000071 | Ga0055526_100007137 | 125 |
| 29 | 3300003773 | Ga0055537_1000203 | Ga0055537_100020347 | 125 |
| 30 | 3300003775 | Ga0055524_1000041 | Ga0055524_100004137 | 125 |
| 31 | 3300003784 | Ga0055534_1000040 | Ga0055534_100004076 | 125 |
| 32 | 3300003790 | Ga0055528_1000017 | Ga0055528_100001737 | 125 |
| 33 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000012022 | 125 |
| 34 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000012022 | 125 |
| 35 | 3300025291 | Ga0209675_1000001 | Ga0209675_1000001511 | 125 |
| 36 | 3300025295 | Ga0209564_1000001 | Ga0209564_1000001673 | 125 |
| 37 | 3300025299 | Ga0209256_1000002 | Ga0209256_1000002880 | 125 |
| 38 | 3300030731 | Ga0316177_1015236 | Ga0316177_10152362 | 126 |
| 39 | 3300031251 | Ga0265327_10001605 | Ga0265327_1000160520 | 126 |
| 40 | 3300005355 | Ga0070671_100030322 | Ga0070671_1000303224 | 127 |
| 41 | 3300009177 | Ga0105248_10241912 | Ga0105248_102419122 | 127 |
| 42 | 3300025931 | Ga0207644_10014478 | Ga0207644_100144782 | 127 |
| 43 | 3300028794 | Ga0307515_10000037 | Ga0307515_10000037257 | 127 |
| 44 | 3300031507 | Ga0307509_10931124 | Ga0307509_109311241 | 127 |
| 45 | 3300037312 | Ga0395899_0061007 | Ga0395899_0061007_274_741 | 127 |
| 46 | 3300037418 | Ga0395900_0022237 | Ga0395900_0022237_5356_5823 | 127 |
| 47 | 3300037471 | Ga0395905_0002691 | Ga0395905_0002691_11847_12314 | 127 |
| 48 | 3300037471 | Ga0395905_0018196 | Ga0395905_0018196_4997_5464 | 127 |
| 49 | 3300037471 | Ga0395905_0046527 | Ga0395905_0046527_3279_3752 | 127 |
| 50 | 3300038443 | Ga0395901_0012789 | Ga0395901_0012789_1872_2339 | 127 |
| 51 | 3300048911 | Ga0496108_0145647 | Ga0496108_0145647_173_640 | 127 |
| 52 | 3300048912 | Ga0496109_0260800 | Ga0496109_0260800_442_909 | 127 |
| 53 | 3300048915 | Ga0496112_0195277 | Ga0496112_0195277_1353_1820 | 127 |
| 54 | 3300048916 | Ga0496113_0028397 | Ga0496113_0028397_2461_2928 | 127 |
| 55 | 3300049851 | Ga0501212_011257 | Ga0501212_011257_351_779 | 127 |
| 56 | 3300005327 | Ga0070658_10920019 | Ga0070658_109200191 | 128 |
| 57 | 3300005336 | Ga0070680_100351344 | Ga0070680_1003513441 | 128 |
| 58 | 3300005564 | Ga0070664_100414630 | Ga0070664_1004146303 | 128 |
| 59 | 3300006881 | Ga0068865_100780070 | Ga0068865_1007800702 | 128 |
| 60 | 3300013307 | Ga0157372_10106641 | Ga0157372_101066412 | 128 |
| 61 | 3300013307 | Ga0157372_10943780 | Ga0157372_109437801 | 128 |
| 62 | 3300027378 | Ga0209981_1005034 | Ga0209981_10050341 | 128 |
| 63 | 3300027471 | Ga0209995_1019531 | Ga0209995_10195312 | 128 |
| 64 | 3300027614 | Ga0209970_1003538 | Ga0209970_10035383 | 128 |
| 65 | 3300035398 | Ga0316574_0043722 | Ga0316574_0043722_1654_2094 | 128 |
| 66 | 3300037471 | Ga0395905_1225035 | Ga0395905_1225035_173_643 | 128 |
| 67 | 3300041494 | Ga0451837_1509570 | Ga0451837_1509570_98_574 | 128 |
| 68 | 3300042531 | Ga0450918_059222 | Ga0450918_059222_13_498 | 128 |
| 69 | 3300049568 | Ga0501031_0042123 | Ga0501031_0042123_1227_1703 | 128 |
| 70 | 3300049569 | Ga0501032_0028005 | Ga0501032_0028005_1237_1713 | 128 |
| 71 | 3300049570 | Ga0501033_0120224 | Ga0501033_0120224_772_1248 | 128 |
| 72 | 3300049571 | Ga0501034_0285310 | Ga0501034_0285310_162_593 | 128 |
| 73 | 3300049571 | Ga0501034_1194457 | Ga0501034_1194457_138_614 | 128 |
| 74 | 3300049572 | Ga0501036_0128248 | Ga0501036_0128248_57_533 | 128 |
| 75 | 3300049573 | Ga0501037_0005330 | Ga0501037_0005330_8824_9300 | 128 |
| 76 | 3300049574 | Ga0501038_0035964 | Ga0501038_0035964_3546_4022 | 128 |
| 77 | 3300049579 | Ga0501043_0280812 | Ga0501043_0280812_664_1140 | 128 |
| 78 | 3300049586 | Ga0501070_0184475 | Ga0501070_0184475_993_1469 | 128 |
| 79 | 3300049589 | Ga0501073_0084688 | Ga0501073_0084688_1719_2195 | 128 |
| 80 | 3300049742 | Ga0501080_0004696 | Ga0501080_0004696_11307_11783 | 128 |
| 81 | 3300049823 | Ga0501044_0022048 | Ga0501044_0022048_2763_3239 | 128 |
| 82 | 3300005344 | Ga0070661_100195709 | Ga0070661_1001957091 | 129 |
| 83 | 3300005367 | Ga0070667_100320191 | Ga0070667_1003201912 | 129 |
| 84 | 3300005455 | Ga0070663_100541147 | Ga0070663_1005411471 | 129 |
| 85 | 3300005563 | Ga0068855_101317421 | Ga0068855_1013174211 | 129 |
| 86 | 3300009094 | Ga0111539_10039009 | Ga0111539_100390094 | 129 |
| 87 | 3300009094 | Ga0111539_10188018 | Ga0111539_101880182 | 129 |
| 88 | 3300009101 | Ga0105247_10055610 | Ga0105247_100556102 | 129 |
| 89 | 3300009147 | Ga0114129_10014387 | Ga0114129_100143875 | 129 |
| 90 | 3300009176 | Ga0105242_12534422 | Ga0105242_125344221 | 129 |
| 91 | 3300009177 | Ga0105248_10050912 | Ga0105248_100509126 | 129 |
| 92 | 3300009553 | Ga0105249_10039918 | Ga0105249_100399183 | 129 |
| 93 | 3300013102 | Ga0157371_10066548 | Ga0157371_100665482 | 129 |
| 94 | 3300013296 | Ga0157374_10331601 | Ga0157374_103316013 | 129 |
| 95 | 3300013297 | Ga0157378_10183228 | Ga0157378_101832282 | 129 |
| 96 | 3300013306 | Ga0163162_10142154 | Ga0163162_101421544 | 129 |
| 97 | 3300013308 | Ga0157375_10133542 | Ga0157375_101335424 | 129 |
| 98 | 3300013308 | Ga0157375_10136415 | Ga0157375_101364152 | 129 |
| 99 | 3300014325 | Ga0163163_10252071 | Ga0163163_102520713 | 129 |
| 100 | 3300014745 | Ga0157377_10029771 | Ga0157377_100297712 | 129 |
| 101 | 3300014745 | Ga0157377_11160391 | Ga0157377_111603912 | 129 |
| 102 | 3300014968 | Ga0157379_10080526 | Ga0157379_100805265 | 129 |
| 103 | 3300014968 | Ga0157379_12506707 | Ga0157379_125067071 | 129 |
| 104 | 3300025919 | Ga0207657_10003945 | Ga0207657_1000394510 | 129 |
| 105 | 3300025920 | Ga0207649_10387414 | Ga0207649_103874142 | 129 |
| 106 | 3300025921 | Ga0207652_10012548 | Ga0207652_100125482 | 129 |
| 107 | 3300026067 | Ga0207678_10488937 | Ga0207678_104889372 | 129 |
| 108 | 3300035112 | Ga0373932_0225699 | Ga0373932_0225699_87_521 | 129 |
| 109 | 3300042007 | Ga0439449_0311146 | Ga0439449_0311146_46_483 | 129 |
| 110 | 3300042012 | Ga0439455_0104920 | Ga0439455_0104920_338_772 | 129 |
| 111 | 3300042131 | Ga0450894_071625 | Ga0450894_071625_43_477 | 129 |
| 112 | 3300042439 | Ga0439464_0050869 | Ga0439464_0050869_200_634 | 129 |
| 113 | 3300045051 | Ga0451576_0368198 | Ga0451576_0368198_835_1269 | 129 |
| 114 | 3300046460 | Ga0495638_0091396 | Ga0495638_0091396_951_1385 | 129 |
| 115 | 3300046492 | Ga0495585_0050465 | Ga0495585_0050465_389_853 | 129 |
| 116 | 3300046506 | Ga0495583_0154378 | Ga0495583_0154378_398_865 | 129 |
| 117 | 3300046513 | Ga0495616_0186411 | Ga0495616_0186411_461_895 | 129 |
| 118 | 3300046528 | Ga0495642_0333752 | Ga0495642_0333752_154_618 | 129 |
| 119 | 3300046660 | Ga0495625_0157227 | Ga0495625_0157227_327_764 | 129 |
| 120 | 3300046660 | Ga0495625_0610438 | Ga0495625_0610438_171_605 | 129 |
| 121 | 3300047320 | Ga0495672_0098723 | Ga0495672_0098723_1056_1490 | 129 |
| 122 | 3300048909 | Ga0496106_0116221 | Ga0496106_0116221_569_1003 | 129 |
| 123 | 3300048910 | Ga0496107_0423293 | Ga0496107_0423293_542_976 | 129 |
| 124 | 3300048911 | Ga0496108_0147338 | Ga0496108_0147338_811_1245 | 129 |
| 125 | 3300048912 | Ga0496109_0803867 | Ga0496109_0803867_353_787 | 129 |
| 126 | 3300048913 | Ga0496110_0548758 | Ga0496110_0548758_145_579 | 129 |
| 127 | 3300048914 | Ga0496111_0310707 | Ga0496111_0310707_233_667 | 129 |
| 128 | 3300048915 | Ga0496112_0497727 | Ga0496112_0497727_695_1129 | 129 |
| 129 | 3300048916 | Ga0496113_0447802 | Ga0496113_0447802_528_962 | 129 |
| 130 | 3300048927 | Ga0496124_0784492 | Ga0496124_0784492_14_451 | 129 |
| 131 | 3300049522 | Ga0501299_015060 | Ga0501299_015060_634_1068 | 129 |
| 132 | 3300049571 | Ga0501034_0621372 | Ga0501034_0621372_423_899 | 129 |
| 133 | 3300049676 | Ga0501246_024609 | Ga0501246_024609_120_554 | 129 |
| 134 | 3300049741 | Ga0501079_0440671 | Ga0501079_0440671_470_946 | 129 |
| 135 | 3300050507 | nmdc:mga05p37_1261096_c1 | nmdc:mga05p37_1261096_c1_94_528 | 129 |
| 136 | 3300050507 | nmdc:mga05p37_33789_c1 | nmdc:mga05p37_33789_c1_2837_3271 | 129 |
| 137 | 3300050507 | nmdc:mga05p37_7681_c1 | nmdc:mga05p37_7681_c1_8448_8882 | 129 |
| 138 | 3300050508 | nmdc:mga09592_12355_c1 | nmdc:mga09592_12355_c1_750_1184 | 129 |
| 139 | 3300050508 | nmdc:mga09592_4208_c1 | nmdc:mga09592_4208_c1_7618_8052 | 129 |
| 140 | 3300050509 | nmdc:mga0qj67_102252_c1 | nmdc:mga0qj67_102252_c1_273_707 | 129 |
| 141 | 3300050509 | nmdc:mga0qj67_2648_c1 | nmdc:mga0qj67_2648_c1_3969_4403 | 129 |
| 142 | 3300050509 | nmdc:mga0qj67_96627_c1 | nmdc:mga0qj67_96627_c1_761_1195 | 129 |
| 143 | 3300050510 | nmdc:mga06r32_1391_c1 | nmdc:mga06r32_1391_c1_19132_19566 | 129 |
| 144 | 3300050510 | nmdc:mga06r32_5609_c1 | nmdc:mga06r32_5609_c1_9774_10208 | 129 |
| 145 | 3300050510 | nmdc:mga06r32_8925_c1 | nmdc:mga06r32_8925_c1_2448_2882 | 129 |
| 146 | 3300050511 | nmdc:mga08y16_1913_c1 | nmdc:mga08y16_1913_c1_3181_3615 | 129 |
| 147 | 3300050514 | nmdc:mga08x19_282915_c1 | nmdc:mga08x19_282915_c1_171_605 | 129 |
| 148 | 3300050515 | nmdc:mga0a205_207646_c1 | nmdc:mga0a205_207646_c1_150_584 | 129 |
| 149 | 3300053104 | Ga0500556_0203195 | Ga0500556_0203195_196_633 | 129 |
| 150 | 3300053139 | Ga0500568_0018456 | Ga0500568_0018456_188_625 | 129 |
| 151 | 3300053147 | Ga0500589_267173 | Ga0500589_267173_16_453 | 129 |
| 152 | 3300053156 | Ga0500622_0001818 | Ga0500622_0001818_13495_13932 | 129 |
| 153 | 3300053156 | Ga0500622_0008192 | Ga0500622_0008192_1273_1710 | 129 |
| 154 | iso_pu_bacteria | 2894510363 | 2894511952 | 129 |
| 155 | 3300006051 | Ga0075364_10000477 | Ga0075364_1000047711 | 130 |
| 156 | 3300031824 | Ga0307413_10395331 | Ga0307413_103953311 | 130 |
| 157 | 3300031911 | Ga0307412_11920201 | Ga0307412_119202012 | 130 |
| 158 | 3300032002 | Ga0307416_100091070 | Ga0307416_1000910702 | 130 |
| 159 | 3300032004 | Ga0307414_10428930 | Ga0307414_104289303 | 130 |
| 160 | 3300042142 | Ga0450905_008334 | Ga0450905_008334_756_1223 | 130 |
| 161 | 3300049575 | Ga0501039_1319171 | Ga0501039_1319171_10_495 | 130 |
| 162 | 3300050491 | nmdc:mga00v17_119_c1 | nmdc:mga00v17_119_c1_32610_33077 | 130 |
| 163 | 3300005331 | Ga0070670_100136865 | Ga0070670_1001368654 | 131 |
| 164 | 3300005333 | Ga0070677_10030830 | Ga0070677_100308303 | 131 |
| 165 | 3300005341 | Ga0070691_10142858 | Ga0070691_101428582 | 131 |
| 166 | 3300005347 | Ga0070668_100029849 | Ga0070668_1000298492 | 131 |
| 167 | 3300005366 | Ga0070659_100029751 | Ga0070659_1000297512 | 131 |
| 168 | 3300005456 | Ga0070678_100116456 | Ga0070678_1001164562 | 131 |
| 169 | 3300005457 | Ga0070662_100204193 | Ga0070662_1002041932 | 131 |
| 170 | 3300005458 | Ga0070681_10152415 | Ga0070681_101524154 | 131 |
| 171 | 3300005616 | Ga0068852_100467619 | Ga0068852_1004676192 | 131 |
| 172 | 3300005843 | Ga0068860_100129518 | Ga0068860_1001295184 | 131 |
| 173 | 3300005844 | Ga0068862_100001302 | Ga0068862_10000130218 | 131 |
| 174 | 3300006844 | Ga0075428_100600536 | Ga0075428_1006005362 | 131 |
| 175 | 3300006847 | Ga0075431_100345654 | Ga0075431_1003456543 | 131 |
| 176 | 3300006880 | Ga0075429_100506012 | Ga0075429_1005060123 | 131 |
| 177 | 3300025907 | Ga0207645_10031489 | Ga0207645_100314892 | 131 |
| 178 | 3300025920 | Ga0207649_10570636 | Ga0207649_105706362 | 131 |
| 179 | 3300025933 | Ga0207706_10321394 | Ga0207706_103213943 | 131 |
| 180 | 3300025945 | Ga0207679_10865260 | Ga0207679_108652602 | 131 |
| 181 | 3300025972 | Ga0207668_10016455 | Ga0207668_100164556 | 131 |
| 182 | 3300026116 | Ga0207674_10667490 | Ga0207674_106674902 | 131 |
| 183 | 3300026118 | Ga0207675_100000363 | Ga0207675_10000036340 | 131 |
| 184 | 3300027907 | Ga0207428_10032841 | Ga0207428_100328412 | 131 |
| 185 | 3300028380 | Ga0268265_10000243 | Ga0268265_1000024360 | 131 |
| 186 | 3300028381 | Ga0268264_10630754 | Ga0268264_106307543 | 131 |
| 187 | 3300049571 | Ga0501034_0000498 | Ga0501034_0000498_52465_52938 | 131 |
| 188 | 3300050509 | nmdc:mga0qj67_169597_c1 | nmdc:mga0qj67_169597_c1_567_1031 | 131 |
| 189 | 3300013306 | Ga0163162_10684904 | Ga0163162_106849041 | 132 |
| 190 | 3300030745 | Ga0316182_1420801 | Ga0316182_14208012 | 132 |
| 191 | 3300032004 | Ga0307414_10677936 | Ga0307414_106779363 | 132 |
| 192 | 3300032168 | Ga0316593_10000885 | Ga0316593_1000088511 | 132 |
| 193 | 3300036647 | Ga0316582_0018822 | Ga0316582_0018822_3241_3675 | 132 |
| 194 | 3300036712 | Ga0316584_0610730 | Ga0316584_0610730_178_612 | 132 |
| 195 | 3300042533 | Ga0450901_005720 | Ga0450901_005720_391_852 | 132 |
| 196 | 3300046660 | Ga0495625_0002787 | Ga0495625_0002787_5631_6107 | 132 |
| 197 | 3300049570 | Ga0501033_0000816 | Ga0501033_0000816_21673_22152 | 132 |
| 198 | 3300049570 | Ga0501033_0623625 | Ga0501033_0623625_228_707 | 132 |
| 199 | 3300049571 | Ga0501034_0388715 | Ga0501034_0388715_544_1023 | 132 |
| 200 | 3300049573 | Ga0501037_0382410 | Ga0501037_0382410_122_601 | 132 |
| 201 | 3300005467 | Ga0070706_100002239 | Ga0070706_1000022392 | 133 |
| 202 | 3300014326 | Ga0157380_10006431 | Ga0157380_100064319 | 133 |
| 203 | 3300025910 | Ga0207684_10002129 | Ga0207684_1000212921 | 133 |
| 204 | 3300027252 | Ga0209973_1012321 | Ga0209973_10123212 | 133 |
| 205 | 3300027360 | Ga0209969_1002058 | Ga0209969_10020582 | 133 |
| 206 | 3300027364 | Ga0209967_1016156 | Ga0209967_10161562 | 133 |
| 207 | 3300027543 | Ga0209999_1002029 | Ga0209999_10020294 | 133 |
| 208 | 3300027552 | Ga0209982_1000486 | Ga0209982_10004867 | 133 |
| 209 | 3300027665 | Ga0209983_1031281 | Ga0209983_10312812 | 133 |
| 210 | 3300027682 | Ga0209971_1000850 | Ga0209971_10008505 | 133 |
| 211 | 3300027876 | Ga0209974_10005119 | Ga0209974_100051192 | 133 |
| 212 | 3300031239 | Ga0265328_10044255 | Ga0265328_100442552 | 133 |
| 213 | 3300031250 | Ga0265331_10158800 | Ga0265331_101588002 | 133 |
| 214 | 3300031251 | Ga0265327_10046816 | Ga0265327_100468162 | 133 |
| 215 | 3300031251 | Ga0265327_10217951 | Ga0265327_102179512 | 133 |
| 216 | 3300031344 | Ga0265316_10029468 | Ga0265316_100294683 | 133 |
| 217 | 3300031711 | Ga0265314_10018441 | Ga0265314_100184414 | 133 |
| 218 | 3300042876 | Ga0451577_0000705 | Ga0451577_0000705_18582_19016 | 133 |
| 219 | 3300044712 | Ga0453684_0001232 | Ga0453684_0001232_40241_40675 | 133 |
| 220 | 3300044712 | Ga0453684_0281061 | Ga0453684_0281061_1014_1451 | 133 |
| 221 | 3300048924 | Ga0496121_0027317 | Ga0496121_0027317_1827_2315 | 133 |
| 222 | 3300049568 | Ga0501031_0235015 | Ga0501031_0235015_520_1008 | 133 |
| 223 | 3300053079 | Ga0500610_0255232 | Ga0500610_0255232_38_505 | 133 |
| 224 | iso_pu_bacteria | 2874220319 | 2874222426 | 133 |
| 225 | iso_pu_bacteria | 2919089067 | 2919090364 | 133 |
| 226 | iso_pu_bacteria | 2928496128 | 2928497751 | 133 |
| 227 | iso_pu_bacteria | 2931380184 | 2931384118 | 133 |
| 228 | 3300031665 | Ga0316575_10176940 | Ga0316575_101769402 | 134 |
| 229 | 3300032004 | Ga0307414_10207378 | Ga0307414_102073783 | 134 |
| 230 | 3300041443 | Ga0451789_0135540 | Ga0451789_0135540_166_630 | 134 |
| 231 | 3300041452 | Ga0451793_1244880 | Ga0451793_1244880_762_1226 | 134 |
| 232 | 3300041494 | Ga0451837_0131705 | Ga0451837_0131705_42_506 | 134 |
| 233 | iso_pu_bacteria | 2989392574 | 2989396039 | 134 |
| 234 | 3300006881 | Ga0068865_101442502 | Ga0068865_1014425022 | 135 |
| 235 | 3300028577 | Ga0265318_10115957 | Ga0265318_101159573 | 135 |
| 236 | 3300045051 | Ga0451576_0563244 | Ga0451576_0563244_416_865 | 135 |
| 237 | 3300005288 | Ga0065714_10112470 | Ga0065714_101124703 | 136 |
| 238 | 3300005290 | Ga0065712_10014013 | Ga0065712_100140132 | 136 |
| 239 | 3300005330 | Ga0070690_100029887 | Ga0070690_1000298872 | 136 |
| 240 | 3300005334 | Ga0068869_100123791 | Ga0068869_1001237913 | 136 |
| 241 | 3300005334 | Ga0068869_101008657 | Ga0068869_1010086572 | 136 |
| 242 | 3300005340 | Ga0070689_100009182 | Ga0070689_1000091824 | 136 |
| 243 | 3300005343 | Ga0070687_100073255 | Ga0070687_1000732554 | 136 |
| 244 | 3300005344 | Ga0070661_100760797 | Ga0070661_1007607972 | 136 |
| 245 | 3300005345 | Ga0070692_10514805 | Ga0070692_105148052 | 136 |
| 246 | 3300005347 | Ga0070668_100218595 | Ga0070668_1002185952 | 136 |
| 247 | 3300005353 | Ga0070669_100077494 | Ga0070669_1000774943 | 136 |
| 248 | 3300005354 | Ga0070675_100146002 | Ga0070675_1001460023 | 136 |
| 249 | 3300005355 | Ga0070671_100137708 | Ga0070671_1001377083 | 136 |
| 250 | 3300005364 | Ga0070673_100050505 | Ga0070673_1000505052 | 136 |
| 251 | 3300005367 | Ga0070667_100124111 | Ga0070667_1001241112 | 136 |
| 252 | 3300005438 | Ga0070701_10053061 | Ga0070701_100530612 | 136 |
| 253 | 3300005440 | Ga0070705_100234524 | Ga0070705_1002345242 | 136 |
| 254 | 3300005455 | Ga0070663_100586687 | Ga0070663_1005866871 | 136 |
| 255 | 3300005456 | Ga0070678_100275041 | Ga0070678_1002750412 | 136 |
| 256 | 3300005457 | Ga0070662_100154171 | Ga0070662_1001541713 | 136 |
| 257 | 3300005459 | Ga0068867_100163801 | Ga0068867_1001638012 | 136 |
| 258 | 3300005466 | Ga0070685_10015831 | Ga0070685_100158315 | 136 |
| 259 | 3300005468 | Ga0070707_101752464 | Ga0070707_1017524641 | 136 |
| 260 | 3300005535 | Ga0070684_100017714 | Ga0070684_1000177146 | 136 |
| 261 | 3300005543 | Ga0070672_100165244 | Ga0070672_1001652442 | 136 |
| 262 | 3300005544 | Ga0070686_100016707 | Ga0070686_1000167077 | 136 |
| 263 | 3300005548 | Ga0070665_100053732 | Ga0070665_1000537322 | 136 |
| 264 | 3300005548 | Ga0070665_100671842 | Ga0070665_1006718423 | 136 |
| 265 | 3300005548 | Ga0070665_101502027 | Ga0070665_1015020272 | 136 |
| 266 | 3300005564 | Ga0070664_100170864 | Ga0070664_1001708642 | 136 |
| 267 | 3300005564 | Ga0070664_101033581 | Ga0070664_1010335812 | 136 |
| 268 | 3300005578 | Ga0068854_100224836 | Ga0068854_1002248362 | 136 |
| 269 | 3300005615 | Ga0070702_100074035 | Ga0070702_1000740353 | 136 |
| 270 | 3300005617 | Ga0068859_100472301 | Ga0068859_1004723012 | 136 |
| 271 | 3300005618 | Ga0068864_100087927 | Ga0068864_1000879273 | 136 |
| 272 | 3300005719 | Ga0068861_100889453 | Ga0068861_1008894533 | 136 |
| 273 | 3300005834 | Ga0068851_10385386 | Ga0068851_103853861 | 136 |
| 274 | 3300005841 | Ga0068863_100074098 | Ga0068863_1000740984 | 136 |
| 275 | 3300005842 | Ga0068858_101158712 | Ga0068858_1011587123 | 136 |
| 276 | 3300005843 | Ga0068860_100207481 | Ga0068860_1002074813 | 136 |
| 277 | 3300005844 | Ga0068862_100109763 | Ga0068862_1001097634 | 136 |
| 278 | 3300006358 | Ga0068871_100248988 | Ga0068871_1002489882 | 136 |
| 279 | 3300006844 | Ga0075428_100000597 | Ga0075428_10000059746 | 136 |
| 280 | 3300006844 | Ga0075428_100006416 | Ga0075428_10000641612 | 136 |
| 281 | 3300006844 | Ga0075428_100298074 | Ga0075428_1002980743 | 136 |
| 282 | 3300006844 | Ga0075428_100580795 | Ga0075428_1005807952 | 136 |
| 283 | 3300006846 | Ga0075430_100000758 | Ga0075430_10000075810 | 136 |
| 284 | 3300006846 | Ga0075430_100052497 | Ga0075430_1000524972 | 136 |
| 285 | 3300006846 | Ga0075430_100364533 | Ga0075430_1003645332 | 136 |
| 286 | 3300006847 | Ga0075431_100001382 | Ga0075431_10000138219 | 136 |
| 287 | 3300006847 | Ga0075431_100010406 | Ga0075431_1000104066 | 136 |
| 288 | 3300006847 | Ga0075431_100014174 | Ga0075431_1000141749 | 136 |
| 289 | 3300006880 | Ga0075429_100000507 | Ga0075429_10000050716 | 136 |
| 290 | 3300006881 | Ga0068865_100182098 | Ga0068865_1001820981 | 136 |
| 291 | 3300006931 | Ga0097620_100472327 | Ga0097620_1004723272 | 136 |
| 292 | 3300009011 | Ga0105251_10007635 | Ga0105251_100076357 | 136 |
| 293 | 3300009094 | Ga0111539_10089754 | Ga0111539_100897543 | 136 |
| 294 | 3300009147 | Ga0114129_10014234 | Ga0114129_100142345 | 136 |
| 295 | 3300009147 | Ga0114129_12057450 | Ga0114129_120574502 | 136 |
| 296 | 3300017792 | Ga0163161_10176542 | Ga0163161_101765422 | 136 |
| 297 | 3300025900 | Ga0207710_10038373 | Ga0207710_100383733 | 136 |
| 298 | 3300025918 | Ga0207662_10024040 | Ga0207662_100240405 | 136 |
| 299 | 3300025920 | Ga0207649_10103917 | Ga0207649_101039172 | 136 |
| 300 | 3300025926 | Ga0207659_10240057 | Ga0207659_102400572 | 136 |
| 301 | 3300025936 | Ga0207670_10327294 | Ga0207670_103272943 | 136 |
| 302 | 3300025938 | Ga0207704_10057176 | Ga0207704_100571762 | 136 |
| 303 | 3300025940 | Ga0207691_10120615 | Ga0207691_101206153 | 136 |
| 304 | 3300025941 | Ga0207711_10139960 | Ga0207711_101399603 | 136 |
| 305 | 3300025942 | Ga0207689_11071378 | Ga0207689_110713782 | 136 |
| 306 | 3300025945 | Ga0207679_10045070 | Ga0207679_100450702 | 136 |
| 307 | 3300025960 | Ga0207651_10256253 | Ga0207651_102562532 | 136 |
| 308 | 3300025961 | Ga0207712_10092257 | Ga0207712_100922572 | 136 |
| 309 | 3300026023 | Ga0207677_10147736 | Ga0207677_101477363 | 136 |
| 310 | 3300026067 | Ga0207678_10546561 | Ga0207678_105465612 | 136 |
| 311 | 3300026075 | Ga0207708_10080475 | Ga0207708_100804752 | 136 |
| 312 | 3300026088 | Ga0207641_10276184 | Ga0207641_102761843 | 136 |
| 313 | 3300026089 | Ga0207648_10121319 | Ga0207648_101213192 | 136 |
| 314 | 3300026116 | Ga0207674_10276171 | Ga0207674_102761713 | 136 |
| 315 | 3300026121 | Ga0207683_10299071 | Ga0207683_102990712 | 136 |
| 316 | 3300027907 | Ga0207428_10030485 | Ga0207428_100304855 | 136 |
| 317 | 3300028379 | Ga0268266_10179931 | Ga0268266_101799313 | 136 |
| 318 | 3300028379 | Ga0268266_10309201 | Ga0268266_103092012 | 136 |
| 319 | 3300028379 | Ga0268266_11244537 | Ga0268266_112445371 | 136 |
| 320 | 3300028380 | Ga0268265_10112416 | Ga0268265_101124162 | 136 |
| 321 | 3300028381 | Ga0268264_10333330 | Ga0268264_103333302 | 136 |
| 322 | 3300031548 | Ga0307408_100261516 | Ga0307408_1002615162 | 136 |
| 323 | 3300031548 | Ga0307408_100966598 | Ga0307408_1009665983 | 136 |
| 324 | 3300031691 | Ga0316579_10018238 | Ga0316579_100182384 | 136 |
| 325 | 3300031731 | Ga0307405_10881125 | Ga0307405_108811252 | 136 |
| 326 | 3300031733 | Ga0316577_10048630 | Ga0316577_100486302 | 136 |
| 327 | 3300031824 | Ga0307413_10425902 | Ga0307413_104259022 | 136 |
| 328 | 3300031824 | Ga0307413_11252776 | Ga0307413_112527762 | 136 |
| 329 | 3300031901 | Ga0307406_10462040 | Ga0307406_104620402 | 136 |
| 330 | 3300031901 | Ga0307406_10832393 | Ga0307406_108323931 | 136 |
| 331 | 3300031995 | Ga0307409_101561820 | Ga0307409_1015618201 | 136 |
| 332 | 3300032002 | Ga0307416_100560435 | Ga0307416_1005604352 | 136 |
| 333 | 3300032126 | Ga0307415_102087881 | Ga0307415_1020878811 | 136 |
| 334 | 3300032137 | Ga0316585_10165660 | Ga0316585_101656602 | 136 |
| 335 | 3300032168 | Ga0316593_10015361 | Ga0316593_100153612 | 136 |
| 336 | 3300036647 | Ga0316582_0002695 | Ga0316582_0002695_5787_6242 | 136 |
| 337 | 3300036712 | Ga0316584_0032994 | Ga0316584_0032994_1025_1480 | 136 |
| 338 | 3300037588 | Ga0316581_0000879 | Ga0316581_0000879_3510_3965 | 136 |
| 339 | 3300042118 | Ga0450914_006132 | Ga0450914_006132_27_491 | 136 |
| 340 | 3300046471 | Ga0495650_0036587 | Ga0495650_0036587_933_1388 | 136 |
| 341 | 3300049580 | Ga0501046_0122135 | Ga0501046_0122135_86_544 | 136 |
| 342 | 3300049581 | Ga0501047_0047672 | Ga0501047_0047672_859_1317 | 136 |
| 343 | 3300050507 | nmdc:mga05p37_1712008_c1 | nmdc:mga05p37_1712008_c1_97_561 | 136 |
| 344 | 3300050511 | nmdc:mga08y16_75450_c1 | nmdc:mga08y16_75450_c1_2418_2882 | 136 |
| 345 | iso_pu_bacteria | 2747842501 | 2748016061 | 136 |
| 346 | 3300013100 | Ga0157373_10720028 | Ga0157373_107200282 | 137 |
| 347 | 3300013102 | Ga0157371_10007889 | Ga0157371_100078899 | 137 |
| 348 | 3300046460 | Ga0495638_0360764 | Ga0495638_0360764_185_646 | 137 |
| 349 | 3300048924 | Ga0496121_0010608 | Ga0496121_0010608_9308_9769 | 137 |
| 350 | 3300048928 | Ga0496125_0062589 | Ga0496125_0062589_2276_2761 | 137 |
| 351 | 3300005539 | Ga0068853_101559225 | Ga0068853_1015592251 | 138 |
| 352 | 3300006846 | Ga0075430_100438644 | Ga0075430_1004386442 | 138 |
| 353 | 3300032005 | Ga0307411_10041896 | Ga0307411_100418964 | 138 |
| 354 | 3300035691 | Ga0373931_0071057 | Ga0373931_0071057_1268_1732 | 138 |
| 355 | 3300041404 | Ga0439436_0063338 | Ga0439436_0063338_259_741 | 138 |
| 356 | 3300041509 | Ga0451843_1155314 | Ga0451843_1155314_148_636 | 138 |
| 357 | 3300042010 | Ga0439452_059343 | Ga0439452_059343_54_533 | 138 |
| 358 | 3300046558 | Ga0495633_0010993 | Ga0495633_0010993_657_1109 | 138 |
| 359 | 3300046692 | Ga0495671_0210122 | Ga0495671_0210122_15_467 | 138 |
| 360 | 3300005295 | Ga0065707_10082671 | Ga0065707_100826718 | 139 |
| 361 | 3300005719 | Ga0068861_100002878 | Ga0068861_10000287811 | 139 |
| 362 | 3300006846 | Ga0075430_100094238 | Ga0075430_1000942383 | 139 |
| 363 | 3300026118 | Ga0207675_100016339 | Ga0207675_1000163395 | 139 |
| 364 | 3300041453 | Ga0451797_0295554 | Ga0451797_0295554_350_838 | 139 |
| 365 | 3300041494 | Ga0451837_0126293 | Ga0451837_0126293_121_609 | 139 |
| 366 | 3300049822 | Ga0501035_1284667 | Ga0501035_1284667_10_486 | 139 |
| 367 | 3300050509 | nmdc:mga0qj67_123449_c1 | nmdc:mga0qj67_123449_c1_720_1184 | 139 |
| 368 | iso_pu_bacteria | 2894414249 | 2894415336 | 139 |
| 369 | iso_pu_bacteria | 2895498888 | 2895498919 | 139 |
| 370 | iso_pu_bacteria | 2895511927 | 2895511958 | 139 |
| 371 | iso_pu_bacteria | 2895522137 | 2895524976 | 139 |
| 372 | iso_pu_bacteria | 2895525241 | 2895527901 | 139 |
| 373 | iso_pu_bacteria | 2919513703 | 2919515933 | 139 |
| 374 | iso_pu_bacteria | 2919675420 | 2919677232 | 139 |
| 375 | 3300041491 | Ga0451833_0619913 | Ga0451833_0619913_332_793 | 140 |
| 376 | 3300041491 | Ga0451833_0792306 | Ga0451833_0792306_108_569 | 141 |
| 377 | 3300046460 | Ga0495638_0299456 | Ga0495638_0299456_34_498 | 141 |
| 378 | 3300053093 | Ga0500651_0001237 | Ga0500651_0001237_5785_6273 | 141 |
| 379 | iso_pu_bacteria | 2547132130 | 2547499614 | 141 |
| 380 | iso_pu_bacteria | 2576861471 | 2578457762 | 141 |
| 381 | iso_pu_bacteria | 2747842428 | 2747949153 | 141 |
| 382 | iso_pu_bacteria | 2765235840 | 2765579731 | 141 |
| 383 | iso_pu_bacteria | 2816332141 | 2816517811 | 141 |
| 384 | iso_pu_bacteria | 2842391507 | 2842391994 | 141 |
| 385 | iso_pu_bacteria | 2842757796 | 2842760065 | 141 |
| 386 | iso_pu_bacteria | 2852649853 | 2852650204 | 141 |
| 387 | iso_pu_bacteria | 2857442823 | 2857446131 | 141 |
| 388 | iso_pu_bacteria | 2919134579 | 2919138485 | 141 |
| 389 | iso_pu_bacteria | 2937610967 | 2937614719 | 141 |
| 390 | iso_pu_bacteria | 2939589442 | 2939590953 | 141 |
| 391 | iso_pu_bacteria | 2939622612 | 2939625554 | 141 |
| 392 | iso_pu_bacteria | 2939626828 | 2939630595 | 141 |
| 393 | iso_pu_bacteria | 2941475908 | 2941476494 | 141 |
| 394 | iso_pu_bacteria | 2961047084 | 2961049191 | 141 |
| 395 | iso_pu_bacteria | 2961064222 | 2961066111 | 141 |
| 396 | iso_pu_bacteria | 2974307012 | 2974308373 | 141 |
| 397 | iso_pu_bacteria | 2977247770 | 2977249130 | 141 |
| 398 | iso_pu_bacteria | 2984514374 | 2984516418 | 141 |
| 399 | 3300046519 | Ga0495632_0061018 | Ga0495632_0061018_177_641 | 142 |
| 400 | 3300053161 | Ga0500634_0000051 | Ga0500634_0000051_51440_51904 | 142 |
| 401 | iso_pu_bacteria | 2571042365 | 2572255128 | 142 |
| 402 | iso_pu_bacteria | 2643221559 | 2643815204 | 142 |
| 403 | iso_pu_bacteria | 2643221586 | 2643939882 | 142 |
| 404 | iso_pu_bacteria | 2643221612 | 2644076940 | 142 |
| 405 | iso_pu_bacteria | 2643221727 | 2644695254 | 142 |
| 406 | iso_pu_bacteria | 8003014200 | 8003014500 | 142 |
| 407 | 3300005457 | Ga0070662_101750682 | Ga0070662_1017506821 | 143 |
| 408 | 3300006051 | Ga0075364_10409467 | Ga0075364_104094672 | 143 |
| 409 | 3300012498 | Ga0157345_1018744 | Ga0157345_10187442 | 143 |
| 410 | 3300032004 | Ga0307414_10603811 | Ga0307414_106038112 | 143 |
| 411 | iso_pu_bacteria | 2643221573 | 2643879243 | 143 |
| 412 | iso_pu_bacteria | 2643221593 | 2643977080 | 143 |
| 413 | iso_pu_bacteria | 2643221695 | 2644529507 | 143 |
| 414 | iso_pu_bacteria | 2643221720 | 2644660543 | 143 |
| 415 | iso_pu_bacteria | 2643221728 | 2644697902 | 143 |
| 416 | iso_pu_bacteria | 2941489479 | 2941490635 | 143 |
| 417 | iso_pu_bacteria | 2995948881 | 2995951408 | 143 |
| 418 | 3300003784 | Ga0055534_1045248 | Ga0055534_10452481 | 144 |
| 419 | 3300005288 | Ga0065714_10071120 | Ga0065714_100711203 | 144 |
| 420 | 3300005293 | Ga0065715_10057607 | Ga0065715_100576072 | 144 |
| 421 | 3300005293 | Ga0065715_10269005 | Ga0065715_102690053 | 144 |
| 422 | 3300005293 | Ga0065715_10521248 | Ga0065715_105212481 | 144 |
| 423 | 3300005354 | Ga0070675_101033784 | Ga0070675_1010337841 | 144 |
| 424 | 3300015261 | Ga0182006_1021769 | Ga0182006_10217692 | 144 |
| 425 | 3300025945 | Ga0207679_10264414 | Ga0207679_102644143 | 144 |
| 426 | 3300026121 | Ga0207683_10202175 | Ga0207683_102021753 | 144 |
| 427 | 3300031901 | Ga0307406_10198670 | Ga0307406_101986703 | 144 |
| 428 | 3300031901 | Ga0307406_11174781 | Ga0307406_111747811 | 144 |
| 429 | 3300031903 | Ga0307407_10413487 | Ga0307407_104134872 | 144 |
| 430 | 3300031995 | Ga0307409_100206880 | Ga0307409_1002068802 | 144 |
| 431 | 3300032002 | Ga0307416_100656311 | Ga0307416_1006563112 | 144 |
| 432 | 3300032004 | Ga0307414_10000988 | Ga0307414_1000098813 | 144 |
| 433 | 3300032004 | Ga0307414_10893419 | Ga0307414_108934192 | 144 |
| 434 | 3300032004 | Ga0307414_10922141 | Ga0307414_109221412 | 144 |
| 435 | 3300032005 | Ga0307411_10022498 | Ga0307411_100224985 | 144 |
| 436 | 3300041404 | Ga0439436_0042363 | Ga0439436_0042363_36_515 | 144 |
| 437 | 3300041406 | Ga0439439_0043187 | Ga0439439_0043187_419_898 | 144 |
| 438 | 3300042015 | Ga0439462_0136672 | Ga0439462_0136672_177_656 | 144 |
| 439 | 3300048905 | Ga0496102_1116690 | Ga0496102_1116690_27_512 | 144 |
| 440 | 3300003320 | rootH2_10011881 | rootH2_100118812 | 145 |
| 441 | 3300003323 | rootH1_10259244 | rootH1_102592442 | 145 |
| 442 | 3300003771 | Ga0055526_1002377 | Ga0055526_10023778 | 145 |
| 443 | 3300003773 | Ga0055537_1000164 | Ga0055537_100016428 | 145 |
| 444 | 3300003781 | Ga0055536_1000367 | Ga0055536_100036717 | 145 |
| 445 | 3300003781 | Ga0055536_1000709 | Ga0055536_100070910 | 145 |
| 446 | 3300003781 | Ga0055536_1001874 | Ga0055536_10018745 | 145 |
| 447 | 3300003784 | Ga0055534_1000026 | Ga0055534_100002652 | 145 |
| 448 | 3300003790 | Ga0055528_1000951 | Ga0055528_100095115 | 145 |
| 449 | 3300003791 | Ga0055530_10000772 | Ga0055530_1000077210 | 145 |
| 450 | 3300003791 | Ga0055530_10000972 | Ga0055530_1000097210 | 145 |
| 451 | 3300003794 | Ga0055531_10001367 | Ga0055531_1000136712 | 145 |
| 452 | 3300003794 | Ga0055531_10010225 | Ga0055531_100102252 | 145 |
| 453 | 3300003794 | Ga0055531_10010515 | Ga0055531_100105156 | 145 |
| 454 | 3300003856 | Ga0058692_1000012 | Ga0058692_1000012116 | 145 |
| 455 | 3300005331 | Ga0070670_100080049 | Ga0070670_1000800492 | 145 |
| 456 | 3300005353 | Ga0070669_101141301 | Ga0070669_1011413011 | 145 |
| 457 | 3300005354 | Ga0070675_100245323 | Ga0070675_1002453232 | 145 |
| 458 | 3300005366 | Ga0070659_100423451 | Ga0070659_1004234513 | 145 |
| 459 | 3300005437 | Ga0070710_10483003 | Ga0070710_104830031 | 145 |
| 460 | 3300005548 | Ga0070665_100258149 | Ga0070665_1002581493 | 145 |
| 461 | 3300005548 | Ga0070665_100395068 | Ga0070665_1003950683 | 145 |
| 462 | 3300005578 | Ga0068854_100224376 | Ga0068854_1002243763 | 145 |
| 463 | 3300005618 | Ga0068864_100032876 | Ga0068864_1000328767 | 145 |
| 464 | 3300005844 | Ga0068862_100976085 | Ga0068862_1009760851 | 145 |
| 465 | 3300006038 | Ga0075365_10174988 | Ga0075365_101749883 | 145 |
| 466 | 3300006048 | Ga0075363_100418426 | Ga0075363_1004184261 | 145 |
| 467 | 3300006051 | Ga0075364_10022493 | Ga0075364_100224935 | 145 |
| 468 | 3300006051 | Ga0075364_10495372 | Ga0075364_104953721 | 145 |
| 469 | 3300006051 | Ga0075364_10723805 | Ga0075364_107238051 | 145 |
| 470 | 3300006186 | Ga0075369_10063746 | Ga0075369_100637463 | 145 |
| 471 | 3300006186 | Ga0075369_10064872 | Ga0075369_100648722 | 145 |
| 472 | 3300009036 | Ga0105244_10051004 | Ga0105244_100510043 | 145 |
| 473 | 3300009036 | Ga0105244_10202722 | Ga0105244_102027223 | 145 |
| 474 | 3300009148 | Ga0105243_10005221 | Ga0105243_100052219 | 145 |
| 475 | 3300012478 | Ga0157328_1017315 | Ga0157328_10173151 | 145 |
| 476 | 3300012482 | Ga0157318_1016276 | Ga0157318_10162762 | 145 |
| 477 | 3300012510 | Ga0157316_1000764 | Ga0157316_10007643 | 145 |
| 478 | 3300012512 | Ga0157327_1002256 | Ga0157327_10022562 | 145 |
| 479 | 3300013100 | Ga0157373_10402291 | Ga0157373_104022913 | 145 |
| 480 | 3300013102 | Ga0157371_10000400 | Ga0157371_1000040033 | 145 |
| 481 | 3300013102 | Ga0157371_10007822 | Ga0157371_1000782210 | 145 |
| 482 | 3300013104 | Ga0157370_10006775 | Ga0157370_100067753 | 145 |
| 483 | 3300013104 | Ga0157370_10081598 | Ga0157370_100815983 | 145 |
| 484 | 3300013104 | Ga0157370_10777838 | Ga0157370_107778382 | 145 |
| 485 | 3300014326 | Ga0157380_10506959 | Ga0157380_105069592 | 145 |
| 486 | 3300014497 | Ga0182008_10000123 | Ga0182008_1000012342 | 145 |
| 487 | 3300014497 | Ga0182008_10044303 | Ga0182008_100443032 | 145 |
| 488 | 3300015261 | Ga0182006_1010265 | Ga0182006_10102654 | 145 |
| 489 | 3300015261 | Ga0182006_1072618 | Ga0182006_10726182 | 145 |
| 490 | 3300015262 | Ga0182007_10000098 | Ga0182007_1000009833 | 145 |
| 491 | 3300015265 | Ga0182005_1000825 | Ga0182005_10008257 | 145 |
| 492 | 3300017792 | Ga0163161_10001879 | Ga0163161_100018797 | 145 |
| 493 | 3300017792 | Ga0163161_10002326 | Ga0163161_1000232613 | 145 |
| 494 | 3300017792 | Ga0163161_10016180 | Ga0163161_100161802 | 145 |
| 495 | 3300017792 | Ga0163161_11214146 | Ga0163161_112141462 | 145 |
| 496 | 3300025263 | Ga0209565_1000022 | Ga0209565_1000022151 | 145 |
| 497 | 3300025273 | Ga0209673_1000110 | Ga0209673_1000110105 | 145 |
| 498 | 3300025284 | Ga0209130_1012924 | Ga0209130_10129244 | 145 |
| 499 | 3300025291 | Ga0209675_1000060 | Ga0209675_1000060109 | 145 |
| 500 | 3300025292 | Ga0209676_1000219 | Ga0209676_100021935 | 145 |
| 501 | 3300025292 | Ga0209676_1000279 | Ga0209676_100027974 | 145 |
| 502 | 3300025292 | Ga0209676_1000993 | Ga0209676_100099312 | 145 |
| 503 | 3300025294 | Ga0209025_1003524 | Ga0209025_100352415 | 145 |
| 504 | 3300025295 | Ga0209564_1000304 | Ga0209564_100030450 | 145 |
| 505 | 3300025298 | Ga0209050_1000542 | Ga0209050_100054232 | 145 |
| 506 | 3300025298 | Ga0209050_1000825 | Ga0209050_100082523 | 145 |
| 507 | 3300025298 | Ga0209050_1038998 | Ga0209050_10389983 | 145 |
| 508 | 3300025299 | Ga0209256_1000898 | Ga0209256_100089812 | 145 |
| 509 | 3300025299 | Ga0209256_1010135 | Ga0209256_10101354 | 145 |
| 510 | 3300025304 | Ga0209257_1000726 | Ga0209257_100072611 | 145 |
| 511 | 3300025304 | Ga0209257_1000933 | Ga0209257_100093318 | 145 |
| 512 | 3300025304 | Ga0209257_1005417 | Ga0209257_10054172 | 145 |
| 513 | 3300025735 | Ga0207713_1027375 | Ga0207713_10273752 | 145 |
| 514 | 3300025901 | Ga0207688_10296678 | Ga0207688_102966782 | 145 |
| 515 | 3300025923 | Ga0207681_11003921 | Ga0207681_110039212 | 145 |
| 516 | 3300025925 | Ga0207650_10294972 | Ga0207650_102949722 | 145 |
| 517 | 3300025931 | Ga0207644_10545433 | Ga0207644_105454332 | 145 |
| 518 | 3300025935 | Ga0207709_10000898 | Ga0207709_100008986 | 145 |
| 519 | 3300026118 | Ga0207675_100917350 | Ga0207675_1009173502 | 145 |
| 520 | 3300027312 | Ga0209371_1000007 | Ga0209371_1000007273 | 145 |
| 521 | 3300028379 | Ga0268266_10219396 | Ga0268266_102193963 | 145 |
| 522 | 3300028379 | Ga0268266_10331697 | Ga0268266_103316973 | 145 |
| 523 | 3300028380 | Ga0268265_10361488 | Ga0268265_103614883 | 145 |
| 524 | 3300030500 | Ga0268256_1000008 | Ga0268256_1000008677 | 145 |
| 525 | 3300030732 | Ga0316176_1168218 | Ga0316176_11682182 | 145 |
| 526 | 3300030745 | Ga0316182_1099026 | Ga0316182_10990261 | 145 |
| 527 | 3300031911 | Ga0307412_10000684 | Ga0307412_100006849 | 145 |
| 528 | 3300032004 | Ga0307414_10201971 | Ga0307414_102019712 | 145 |
| 529 | 3300032004 | Ga0307414_10732778 | Ga0307414_107327782 | 145 |
| 530 | 3300041498 | Ga0451841_1245039 | Ga0451841_1245039_501_962 | 145 |
| 531 | 3300041509 | Ga0451843_1650970 | Ga0451843_1650970_218_679 | 145 |
| 532 | 3300041512 | Ga0451853_4088123 | Ga0451853_4088123_58_519 | 145 |
| 533 | 3300042006 | Ga0439432_074035 | Ga0439432_074035_110_571 | 145 |
| 534 | 3300042115 | Ga0450911_003455 | Ga0450911_003455_1382_1843 | 145 |
| 535 | 3300042533 | Ga0450901_010309 | Ga0450901_010309_120_581 | 145 |
| 536 | 3300046453 | Ga0495627_062570 | Ga0495627_062570_43_504 | 145 |
| 537 | 3300046460 | Ga0495638_0001034 | Ga0495638_0001034_23839_24300 | 145 |
| 538 | 3300046512 | Ga0495610_0001979 | Ga0495610_0001979_13981_14442 | 145 |
| 539 | 3300046518 | Ga0495631_0012646 | Ga0495631_0012646_2795_3256 | 145 |
| 540 | 3300046522 | Ga0495643_0002439 | Ga0495643_0002439_13690_14151 | 145 |
| 541 | 3300046525 | Ga0495663_0002405 | Ga0495663_0002405_590_1051 | 145 |
| 542 | 3300046525 | Ga0495663_0004244 | Ga0495663_0004244_669_1130 | 145 |
| 543 | 3300046525 | Ga0495663_0004410 | Ga0495663_0004410_2924_3397 | 145 |
| 544 | 3300046525 | Ga0495663_0042504 | Ga0495663_0042504_608_1069 | 145 |
| 545 | 3300046539 | Ga0495621_0082155 | Ga0495621_0082155_298_786 | 145 |
| 546 | 3300046558 | Ga0495633_0012134 | Ga0495633_0012134_2996_3457 | 145 |
| 547 | 3300046615 | Ga0495656_0031294 | Ga0495656_0031294_486_950 | 145 |
| 548 | 3300046615 | Ga0495656_0042344 | Ga0495656_0042344_771_1259 | 145 |
| 549 | 3300046615 | Ga0495656_0088229 | Ga0495656_0088229_359_847 | 145 |
| 550 | 3300046660 | Ga0495625_0050008 | Ga0495625_0050008_2059_2520 | 145 |
| 551 | 3300046660 | Ga0495625_0191514 | Ga0495625_0191514_468_929 | 145 |
| 552 | 3300046664 | Ga0495659_0030708 | Ga0495659_0030708_1004_1477 | 145 |
| 553 | 3300046691 | Ga0495670_0035364 | Ga0495670_0035364_1864_2328 | 145 |
| 554 | 3300046810 | Ga0495660_0175463 | Ga0495660_0175463_375_836 | 145 |
| 555 | 3300047318 | Ga0495636_0021265 | Ga0495636_0021265_515_988 | 145 |
| 556 | 3300047318 | Ga0495636_0400777 | Ga0495636_0400777_160_633 | 145 |
| 557 | 3300047320 | Ga0495672_0000456 | Ga0495672_0000456_13739_14200 | 145 |
| 558 | 3300047320 | Ga0495672_0123812 | Ga0495672_0123812_397_858 | 145 |
| 559 | 3300047472 | Ga0495686_0002853 | Ga0495686_0002853_592_1053 | 145 |
| 560 | 3300048904 | Ga0496101_0098845 | Ga0496101_0098845_422_910 | 145 |
| 561 | 3300048906 | Ga0496103_0130276 | Ga0496103_0130276_958_1446 | 145 |
| 562 | 3300048907 | Ga0496104_1040665 | Ga0496104_1040665_28_489 | 145 |
| 563 | 3300048908 | Ga0496105_0049515 | Ga0496105_0049515_2812_3273 | 145 |
| 564 | 3300048912 | Ga0496109_0134266 | Ga0496109_0134266_1439_1927 | 145 |
| 565 | 3300048913 | Ga0496110_0156061 | Ga0496110_0156061_940_1428 | 145 |
| 566 | 3300048914 | Ga0496111_0623160 | Ga0496111_0623160_174_635 | 145 |
| 567 | 3300048916 | Ga0496113_0142457 | Ga0496113_0142457_403_864 | 145 |
| 568 | 3300048916 | Ga0496113_0233046 | Ga0496113_0233046_550_1011 | 145 |
| 569 | 3300048919 | Ga0496116_0002429 | Ga0496116_0002429_9868_10329 | 145 |
| 570 | 3300048919 | Ga0496116_0099750 | Ga0496116_0099750_788_1249 | 145 |
| 571 | 3300048919 | Ga0496116_0114945 | Ga0496116_0114945_485_946 | 145 |
| 572 | 3300048919 | Ga0496116_0160986 | Ga0496116_0160986_433_894 | 145 |
| 573 | 3300048919 | Ga0496116_0207294 | Ga0496116_0207294_519_980 | 145 |
| 574 | 3300048919 | Ga0496116_0210665 | Ga0496116_0210665_158_619 | 145 |
| 575 | 3300048920 | Ga0496117_0000779 | Ga0496117_0000779_8909_9370 | 145 |
| 576 | 3300048920 | Ga0496117_0003178 | Ga0496117_0003178_17568_18029 | 145 |
| 577 | 3300048920 | Ga0496117_0003531 | Ga0496117_0003531_14210_14671 | 145 |
| 578 | 3300048920 | Ga0496117_0065950 | Ga0496117_0065950_1479_1940 | 145 |
| 579 | 3300048920 | Ga0496117_0068687 | Ga0496117_0068687_1541_2002 | 145 |
| 580 | 3300048920 | Ga0496117_0070380 | Ga0496117_0070380_1796_2257 | 145 |
| 581 | 3300048920 | Ga0496117_0120546 | Ga0496117_0120546_384_845 | 145 |
| 582 | 3300048920 | Ga0496117_0380775 | Ga0496117_0380775_119_580 | 145 |
| 583 | 3300048921 | Ga0496118_0000497 | Ga0496118_0000497_13645_14106 | 145 |
| 584 | 3300048921 | Ga0496118_0002346 | Ga0496118_0002346_18684_19145 | 145 |
| 585 | 3300048921 | Ga0496118_0011982 | Ga0496118_0011982_4825_5286 | 145 |
| 586 | 3300048921 | Ga0496118_0027049 | Ga0496118_0027049_1413_1874 | 145 |
| 587 | 3300048921 | Ga0496118_0035630 | Ga0496118_0035630_234_695 | 145 |
| 588 | 3300048921 | Ga0496118_0122278 | Ga0496118_0122278_609_1070 | 145 |
| 589 | 3300048921 | Ga0496118_0177190 | Ga0496118_0177190_529_990 | 145 |
| 590 | 3300048922 | Ga0496119_0000495 | Ga0496119_0000495_36472_36933 | 145 |
| 591 | 3300048922 | Ga0496119_0105982 | Ga0496119_0105982_259_720 | 145 |
| 592 | 3300048922 | Ga0496119_0147805 | Ga0496119_0147805_379_840 | 145 |
| 593 | 3300048922 | Ga0496119_0179456 | Ga0496119_0179456_305_766 | 145 |
| 594 | 3300048923 | Ga0496120_0000523 | Ga0496120_0000523_49109_49570 | 145 |
| 595 | 3300048923 | Ga0496120_0083539 | Ga0496120_0083539_917_1378 | 145 |
| 596 | 3300048924 | Ga0496121_0004473 | Ga0496121_0004473_621_1082 | 145 |
| 597 | 3300048924 | Ga0496121_0034081 | Ga0496121_0034081_2886_3347 | 145 |
| 598 | 3300048924 | Ga0496121_0045582 | Ga0496121_0045582_1949_2410 | 145 |
| 599 | 3300048924 | Ga0496121_0689782 | Ga0496121_0689782_129_590 | 145 |
| 600 | 3300048925 | Ga0496122_0013601 | Ga0496122_0013601_2742_3203 | 145 |
| 601 | 3300048925 | Ga0496122_0096341 | Ga0496122_0096341_751_1212 | 145 |
| 602 | 3300048925 | Ga0496122_0141076 | Ga0496122_0141076_509_970 | 145 |
| 603 | 3300048925 | Ga0496122_0157339 | Ga0496122_0157339_294_755 | 145 |
| 604 | 3300048925 | Ga0496122_0178030 | Ga0496122_0178030_474_935 | 145 |
| 605 | 3300048925 | Ga0496122_0426874 | Ga0496122_0426874_45_506 | 145 |
| 606 | 3300048926 | Ga0496123_0024124 | Ga0496123_0024124_3485_3946 | 145 |
| 607 | 3300048926 | Ga0496123_0032144 | Ga0496123_0032144_2742_3203 | 145 |
| 608 | 3300048926 | Ga0496123_0045601 | Ga0496123_0045601_599_1060 | 145 |
| 609 | 3300048926 | Ga0496123_0099571 | Ga0496123_0099571_341_802 | 145 |
| 610 | 3300048926 | Ga0496123_0128384 | Ga0496123_0128384_196_657 | 145 |
| 611 | 3300048926 | Ga0496123_0350232 | Ga0496123_0350232_140_601 | 145 |
| 612 | 3300048927 | Ga0496124_0000813 | Ga0496124_0000813_17437_17898 | 145 |
| 613 | 3300048927 | Ga0496124_0001070 | Ga0496124_0001070_3026_3487 | 145 |
| 614 | 3300048927 | Ga0496124_0003371 | Ga0496124_0003371_15997_16458 | 145 |
| 615 | 3300048927 | Ga0496124_0004018 | Ga0496124_0004018_16767_17228 | 145 |
| 616 | 3300048927 | Ga0496124_0008226 | Ga0496124_0008226_3420_3881 | 145 |
| 617 | 3300048927 | Ga0496124_0008239 | Ga0496124_0008239_6628_7089 | 145 |
| 618 | 3300048927 | Ga0496124_0033579 | Ga0496124_0033579_98_559 | 145 |
| 619 | 3300048927 | Ga0496124_0207382 | Ga0496124_0207382_1007_1468 | 145 |
| 620 | 3300048927 | Ga0496124_0437856 | Ga0496124_0437856_100_561 | 145 |
| 621 | 3300048927 | Ga0496124_0469597 | Ga0496124_0469597_20_481 | 145 |
| 622 | 3300048928 | Ga0496125_0006055 | Ga0496125_0006055_8511_8972 | 145 |
| 623 | 3300048928 | Ga0496125_0006971 | Ga0496125_0006971_10450_10911 | 145 |
| 624 | 3300048928 | Ga0496125_0009073 | Ga0496125_0009073_9264_9725 | 145 |
| 625 | 3300048928 | Ga0496125_0017297 | Ga0496125_0017297_6333_6794 | 145 |
| 626 | 3300048928 | Ga0496125_0134088 | Ga0496125_0134088_598_1059 | 145 |
| 627 | 3300048928 | Ga0496125_0195132 | Ga0496125_0195132_809_1270 | 145 |
| 628 | 3300048928 | Ga0496125_0215471 | Ga0496125_0215471_335_796 | 145 |
| 629 | 3300048929 | Ga0496126_0002959 | Ga0496126_0002959_9844_10305 | 145 |
| 630 | 3300048929 | Ga0496126_0186456 | Ga0496126_0186456_739_1200 | 145 |
| 631 | 3300048929 | Ga0496126_0215042 | Ga0496126_0215042_685_1146 | 145 |
| 632 | 3300048929 | Ga0496126_0318806 | Ga0496126_0318806_468_929 | 145 |
| 633 | 3300048929 | Ga0496126_0339193 | Ga0496126_0339193_218_679 | 145 |
| 634 | 3300050491 | nmdc:mga00v17_122437_c1 | nmdc:mga00v17_122437_c1_483_944 | 145 |
| 635 | 3300050491 | nmdc:mga00v17_63748_c1 | nmdc:mga00v17_63748_c1_699_1160 | 145 |
| 636 | 3300050516 | nmdc:mga0sz30_116217_c1 | nmdc:mga0sz30_116217_c1_664_1125 | 145 |
| 637 | 3300053128 | Ga0500626_090727 | Ga0500626_090727_414_875 | 145 |
| 638 | 3300003187 | JGI25151J46595_10022201 | JGI25151J46595_100222012 | 146 |
| 639 | 3300003771 | Ga0055526_1029797 | Ga0055526_10297973 | 146 |
| 640 | 3300003775 | Ga0055524_1025173 | Ga0055524_10251732 | 146 |
| 641 | 3300003775 | Ga0055524_1029812 | Ga0055524_10298123 | 146 |
| 642 | 3300003781 | Ga0055536_1046680 | Ga0055536_10466803 | 146 |
| 643 | 3300003784 | Ga0055534_1049363 | Ga0055534_10493631 | 146 |
| 644 | 3300003791 | Ga0055530_10007918 | Ga0055530_100079184 | 146 |
| 645 | 3300025273 | Ga0209673_1006118 | Ga0209673_10061186 | 146 |
| 646 | 3300025284 | Ga0209130_1008496 | Ga0209130_10084962 | 146 |
| 647 | 3300025291 | Ga0209675_1030644 | Ga0209675_10306443 | 146 |
| 648 | 3300025292 | Ga0209676_1000700 | Ga0209676_100070018 | 146 |
| 649 | 3300025292 | Ga0209676_1006055 | Ga0209676_10060554 | 146 |
| 650 | 3300025292 | Ga0209676_1006460 | Ga0209676_10064603 | 146 |
| 651 | 3300025292 | Ga0209676_1008321 | Ga0209676_10083214 | 146 |
| 652 | 3300025292 | Ga0209676_1011167 | Ga0209676_10111672 | 146 |
| 653 | 3300025294 | Ga0209025_1002408 | Ga0209025_10024087 | 146 |
| 654 | 3300025294 | Ga0209025_1034193 | Ga0209025_10341933 | 146 |
| 655 | 3300025294 | Ga0209025_1044149 | Ga0209025_10441493 | 146 |
| 656 | 3300025295 | Ga0209564_1004198 | Ga0209564_10041987 | 146 |
| 657 | 3300025298 | Ga0209050_1004106 | Ga0209050_10041063 | 146 |
| 658 | 3300025298 | Ga0209050_1013892 | Ga0209050_10138922 | 146 |
| 659 | 3300025299 | Ga0209256_1003923 | Ga0209256_10039234 | 146 |
| 660 | 3300025299 | Ga0209256_1003949 | Ga0209256_10039493 | 146 |
| 661 | 3300025299 | Ga0209256_1023236 | Ga0209256_10232363 | 146 |
| 662 | 3300025302 | Ga0207426_1087682 | Ga0207426_10876822 | 146 |
| 663 | 3300025303 | Ga0209051_1012723 | Ga0209051_10127232 | 146 |
| 664 | 3300025304 | Ga0209257_1000570 | Ga0209257_100057044 | 146 |
| 665 | 3300025304 | Ga0209257_1000615 | Ga0209257_100061511 | 146 |
| 666 | 3300025304 | Ga0209257_1004313 | Ga0209257_100431314 | 146 |
| 667 | 3300025304 | Ga0209257_1005942 | Ga0209257_10059424 | 146 |
| 668 | 3300025304 | Ga0209257_1026720 | Ga0209257_10267203 | 146 |
| 669 | 3300031548 | Ga0307408_100646392 | Ga0307408_1006463921 | 146 |
| 670 | 3300031548 | Ga0307408_100726709 | Ga0307408_1007267092 | 146 |
| 671 | 3300031731 | Ga0307405_10160822 | Ga0307405_101608222 | 146 |
| 672 | 3300031731 | Ga0307405_10493795 | Ga0307405_104937952 | 146 |
| 673 | 3300031731 | Ga0307405_10752975 | Ga0307405_107529751 | 146 |
| 674 | 3300031824 | Ga0307413_10271232 | Ga0307413_102712323 | 146 |
| 675 | 3300031901 | Ga0307406_10325756 | Ga0307406_103257562 | 146 |
| 676 | 3300031903 | Ga0307407_10202619 | Ga0307407_102026192 | 146 |
| 677 | 3300031911 | Ga0307412_10116373 | Ga0307412_101163733 | 146 |
| 678 | 3300031995 | Ga0307409_100179830 | Ga0307409_1001798303 | 146 |
| 679 | 3300032004 | Ga0307414_10541219 | Ga0307414_105412191 | 146 |
| 680 | 3300032005 | Ga0307411_11541490 | Ga0307411_115414902 | 146 |
| 681 | 3300032126 | Ga0307415_100050782 | Ga0307415_1000507823 | 146 |
| 682 | 3300041404 | Ga0439436_0010180 | Ga0439436_0010180_2256_2732 | 146 |
| 683 | 3300041406 | Ga0439439_0000653 | Ga0439439_0000653_2168_2641 | 146 |
| 684 | 3300042004 | Ga0439445_0128118 | Ga0439445_0128118_45_518 | 146 |
| 685 | 3300042007 | Ga0439449_0069869 | Ga0439449_0069869_249_722 | 146 |
| 686 | 3300042015 | Ga0439462_0024973 | Ga0439462_0024973_989_1462 | 146 |
| 687 | 3300042876 | Ga0451577_0003464 | Ga0451577_0003464_8684_9250 | 146 |
| 688 | 3300046525 | Ga0495663_0100401 | Ga0495663_0100401_143_640 | 146 |
| 689 | 3300046558 | Ga0495633_0111332 | Ga0495633_0111332_495_962 | 146 |
| 690 | 3300047318 | Ga0495636_0141332 | Ga0495636_0141332_171_668 | 146 |
| 691 | 3300047447 | Ga0495685_190070 | Ga0495685_190070_118_615 | 146 |
| 692 | 3300048912 | Ga0496109_0337682 | Ga0496109_0337682_543_1040 | 146 |
| 693 | 3300049513 | Ga0501290_001987 | Ga0501290_001987_804_1313 | 146 |
| 694 | 3300049523 | Ga0501300_049069 | Ga0501300_049069_80_589 | 146 |
| 695 | 3300049579 | Ga0501043_0002229 | Ga0501043_0002229_3836_4309 | 146 |
| 696 | 3300049649 | Ga0501198_049821 | Ga0501198_049821_77_553 | 146 |
| 697 | 3300049663 | Ga0501223_014810 | Ga0501223_014810_318_794 | 146 |
| 698 | 3300049672 | Ga0501239_006217 | Ga0501239_006217_540_1016 | 146 |
| 699 | 3300049674 | Ga0501242_006260 | Ga0501242_006260_367_843 | 146 |
| 700 | 3300049762 | Ga0501265_002088 | Ga0501265_002088_1553_2062 | 146 |
| 701 | 3300049772 | Ga0501275_000587 | Ga0501275_000587_557_1066 | 146 |
| 702 | 3300002774 | JGI25150J39212_1036061 | JGI25150J39212_10360611 | 147 |
| 703 | 3300003187 | JGI25151J46595_10000041 | JGI25151J46595_1000004195 | 147 |
| 704 | 3300005367 | Ga0070667_101220162 | Ga0070667_1012201621 | 147 |
| 705 | 3300015689 | Ga0183360_10001 | Ga0183360_100011798 | 147 |
| 706 | 3300025245 | Ga0207425_1007719 | Ga0207425_10077192 | 147 |
| 707 | 3300025294 | Ga0209025_1000015 | Ga0209025_1000015659 | 147 |
| 708 | 3300025986 | Ga0207658_10656278 | Ga0207658_106562783 | 147 |
| 709 | 3300041407 | Ga0439447_005849 | Ga0439447_005849_555_1022 | 147 |
| 710 | 3300046616 | Ga0495668_0003900 | Ga0495668_0003900_5924_6391 | 147 |
| 711 | 3300048924 | Ga0496121_0002174 | Ga0496121_0002174_23665_24132 | 147 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1j6q-assembly1.cif.gz_A | solution structure and characterization of the heme chaperone ccme | 0.8821 | 25 | 115 |
| 1sr3-assembly1.cif.gz_A | solution structure of the heme chaperone ccme of escherichia coli | 0.8304 | 25 | 124 |
| 2kct-assembly1.cif.gz_A | solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. | 0.8226 | 40 | 114 |
| 1j6q-assembly1.cif.gz_A | solution structure and characterization of the heme chaperone ccme | 0.8017 | 25 | 115 |
| 1z9f-assembly1.cif.gz_A | crystal structure of single stranded dna-binding protein (tm0604) from thermotoga maritima at 2.60 a resolution | 0.7778 | 45 | 115 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1j6qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8821 | 25 | 115 | 2.40.50.140 |
| 3f8tA02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8751 | 44 | 115 | 2.40.50.140 |
| af_A0A0R4IAS3_25_130_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8312 | 26 | 113 | 2.40.50.140 |
| 1sr3A00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8304 | 25 | 124 | 2.40.50.140 |
| 2kctA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8226 | 40 | 114 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5W4VQ91-F1-model_v4 | Cytochrome c biogenesis protein CcmE | 0.9193 | 25 | 113 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A1Q7GS37-F1-model_v4 | Cytochrome c maturation protein CcmE | 0.9174 | 25 | 119 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A367MDS7-F1-model_v4 | Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) | 0.9161 | 18 | 136 |
GO:0005886
GO:0017004 GO:0020037 GO:0022857 GO:0046872 |
| AF-A5CCV8-F1-model_v4 | Cytochrome c-type biogenesis protein | 0.9079 | 9 | 123 |
GO:0005886
GO:0017004 GO:0020037 GO:0046872 |
| AF-X5H1Z7-F1-model_v4 | CcmE family protein | 0.9034 | 25 | 122 |
GO:0005886
GO:0017004 GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar