F476662
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 709 | 365 | 709 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0588497|Ga0373937_0588497_300_851 |
| Length | 152 |
| Sequence | MRPTADSPHGYLHVGAEAAPMVERLREFFKTFLLIELLKGMAVTGRYLFARKITVQYPEEHTPQSARFRGLHALRRYPNGEERCIACKLCEAVCPALAITIESEQREDETRILEYHGEKRSDLHYTKEMLLAVGDRYEAEIARDRASDAAYR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 11 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 204 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 205 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 207 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 208 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 209 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 211 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 212 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 216 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 219 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 233 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 234 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 235 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 237 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 238 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 240 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 244 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 245 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 246 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 247 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 250 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 251 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 252 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 253 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 254 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 255 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 258 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 259 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 260 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 261 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 262 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 299 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 300 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 305 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 306 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 307 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 308 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 309 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 310 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 311 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 312 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 313 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 337 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 338 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 339 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 341 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 343 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 344 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 348 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 349 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 350 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 351 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 352 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 354 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 355 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 356 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 357 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 359 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 360 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 361 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.45 |
| Metatranscriptomes | 1.55 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.12 |
| Nodule | 0.28 |
| Rhizoplane | 2.96 |
| Rhizosphere | 80.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000051 | 3300002704 | Bacteria | 76772 |
| 2 | JGI25156J39149_1000155 | 3300002705 | Bacteria | 50271 |
| 3 | JGI25156J39149_1000196 | 3300002705 | Bacteria | 42272 |
| 4 | JGI25154J39366_1000170 | 3300002738 | Bacteria | 50275 |
| 5 | JGI25154J39366_1000471 | 3300002738 | Bacteria | 21074 |
| 6 | JGI25154J39366_1000527 | 3300002738 | Bacteria | 19218 |
| 7 | JGI25157J39369_1000091 | 3300002741 | Bacteria | 76837 |
| 8 | JGI25150J39212_1012396 | 3300002774 | Bacteria | 1511 |
| 9 | JGI25159J45721_1000317 | 3300002987 | Bacteria | 22524 |
| 10 | JGI25159J45721_1000910 | 3300002987 | Bacteria | 12859 |
| 11 | JGI25151J46595_10015102 | 3300003187 | Bacteria | 3420 |
| 12 | JGI25151J46595_10016827 | 3300003187 | Bacteria | 3190 |
| 13 | JGI25151J46595_10043790 | 3300003187 | Bacteria | 1597 |
| 14 | JGI25153J46596_10093638 | 3300003215 | Bacteria | 720 |
| 15 | JGI25160J50197_1000067 | 3300003354 | Bacteria | 113436 |
| 16 | JGI25160J50197_1047532 | 3300003354 | Bacteria | 933 |
| 17 | JGI25161J50226_1000035 | 3300003374 | Bacteria | 133666 |
| 18 | Ga0007417J51691_1031991 | 3300003544 | Bacteria | 9194 |
| 19 | Ga0007409J51694_1013012 | 3300003575 | Bacteria | 10513 |
| 20 | Ga0007416J51690_1021228 | 3300003577 | Bacteria | 10458 |
| 21 | Ga0055529_1000080 | 3300003763 | Bacteria | 148614 |
| 22 | Ga0055526_1002909 | 3300003771 | Bacteria | 11254 |
| 23 | Ga0055537_1001588 | 3300003773 | Bacteria | 8587 |
| 24 | Ga0055537_1002902 | 3300003773 | Bacteria | 5475 |
| 25 | Ga0055524_1000006 | 3300003775 | Bacteria | 324702 |
| 26 | Ga0055536_1000020 | 3300003781 | Bacteria | 199649 |
| 27 | Ga0055534_1007801 | 3300003784 | Bacteria | 2498 |
| 28 | Ga0055528_1001140 | 3300003790 | Bacteria | 17289 |
| 29 | Ga0055528_1001336 | 3300003790 | Bacteria | 15343 |
| 30 | Ga0055530_10000154 | 3300003791 | Bacteria | 61878 |
| 31 | Ga0055530_10016037 | 3300003791 | Bacteria | 2413 |
| 32 | Ga0055540_1000005 | 3300003792 | Bacteria | 378126 |
| 33 | Ga0055543_1001037 | 3300004625 | Bacteria | 12358 |
| 34 | Ga0065165_1054762 | 3300005262 | Bacteria | 1116 |
| 35 | Ga0065165_1092771 | 3300005262 | Bacteria | 766 |
| 36 | Ga0065165_1120598 | 3300005262 | Bacteria | 636 |
| 37 | Ga0065165_1128678 | 3300005262 | Bacteria | 607 |
| 38 | Ga0065714_10372924 | 3300005288 | Bacteria | 614 |
| 39 | Ga0065715_10104050 | 3300005293 | Bacteria | 2989 |
| 40 | Ga0065715_10329917 | 3300005293 | Bacteria | 986 |
| 41 | Ga0065715_10794821 | 3300005293 | Bacteria | 612 |
| 42 | Ga0070658_10049961 | 3300005327 | Bacteria | 3389 |
| 43 | Ga0070658_10055388 | 3300005327 | Bacteria | 3222 |
| 44 | Ga0070658_10388004 | 3300005327 | Bacteria | 1199 |
| 45 | Ga0070676_10001342 | 3300005328 | Bacteria | 12362 |
| 46 | Ga0070676_10088682 | 3300005328 | Bacteria | 1890 |
| 47 | Ga0070683_100212333 | 3300005329 | Bacteria | 1839 |
| 48 | Ga0070690_100030238 | 3300005330 | Bacteria | 3364 |
| 49 | Ga0070670_100048959 | 3300005331 | Bacteria | 3636 |
| 50 | Ga0070670_100289798 | 3300005331 | Bacteria | 1430 |
| 51 | Ga0070670_100816162 | 3300005331 | Bacteria | 843 |
| 52 | Ga0068869_100001218 | 3300005334 | Bacteria | 15146 |
| 53 | Ga0070666_10000716 | 3300005335 | Bacteria | 20098 |
| 54 | Ga0070680_100277986 | 3300005336 | Bacteria | 1418 |
| 55 | Ga0070680_100670820 | 3300005336 | Bacteria | 891 |
| 56 | Ga0070682_100188682 | 3300005337 | Bacteria | 1446 |
| 57 | Ga0070660_100010228 | 3300005339 | Bacteria | 6620 |
| 58 | Ga0070660_100306191 | 3300005339 | Bacteria | 1303 |
| 59 | Ga0070660_101289680 | 3300005339 | Bacteria | 620 |
| 60 | Ga0070689_100571971 | 3300005340 | Bacteria | 976 |
| 61 | Ga0070687_100371360 | 3300005343 | Bacteria | 929 |
| 62 | Ga0070661_100009048 | 3300005344 | Bacteria | 6889 |
| 63 | Ga0070661_100010951 | 3300005344 | Bacteria | 6320 |
| 64 | Ga0070661_100019060 | 3300005344 | Bacteria | 4885 |
| 65 | Ga0070661_100028133 | 3300005344 | Bacteria | 4054 |
| 66 | Ga0070661_100305622 | 3300005344 | Bacteria | 1239 |
| 67 | Ga0070668_100003744 | 3300005347 | Bacteria | 11220 |
| 68 | Ga0070668_100028135 | 3300005347 | Bacteria | 4267 |
| 69 | Ga0070668_100037342 | 3300005347 | Bacteria | 3709 |
| 70 | Ga0070668_100061958 | 3300005347 | Bacteria | 2898 |
| 71 | Ga0070668_100515703 | 3300005347 | Bacteria | 1037 |
| 72 | Ga0070669_100011574 | 3300005353 | Bacteria | 6261 |
| 73 | Ga0070669_100269932 | 3300005353 | Bacteria | 1360 |
| 74 | Ga0070675_100016873 | 3300005354 | Bacteria | 5799 |
| 75 | Ga0070675_100041450 | 3300005354 | Bacteria | 3760 |
| 76 | Ga0070675_100084369 | 3300005354 | Bacteria | 2653 |
| 77 | Ga0070675_100203039 | 3300005354 | Bacteria | 1721 |
| 78 | Ga0070675_100400776 | 3300005354 | Bacteria | 1224 |
| 79 | Ga0070675_100577173 | 3300005354 | Bacteria | 1019 |
| 80 | Ga0070671_100036793 | 3300005355 | Bacteria | 4059 |
| 81 | Ga0070671_100312844 | 3300005355 | Bacteria | 1338 |
| 82 | Ga0070673_100009031 | 3300005364 | Bacteria | 6673 |
| 83 | Ga0070673_100052589 | 3300005364 | Bacteria | 3196 |
| 84 | Ga0070673_101534131 | 3300005364 | Bacteria | 629 |
| 85 | Ga0070659_100033099 | 3300005366 | Bacteria | 4013 |
| 86 | Ga0070659_100089359 | 3300005366 | Bacteria | 2468 |
| 87 | Ga0070659_101390418 | 3300005366 | Bacteria | 624 |
| 88 | Ga0070667_100075986 | 3300005367 | Bacteria | 2868 |
| 89 | Ga0070667_100275458 | 3300005367 | Bacteria | 1510 |
| 90 | Ga0070667_101135996 | 3300005367 | Bacteria | 731 |
| 91 | Ga0070714_100171797 | 3300005435 | Bacteria | 1967 |
| 92 | Ga0070714_100224887 | 3300005435 | Bacteria | 1726 |
| 93 | Ga0070714_100244300 | 3300005435 | Bacteria | 1658 |
| 94 | Ga0070713_100000033 | 3300005436 | Bacteria | 86758 |
| 95 | Ga0070700_100563925 | 3300005441 | Bacteria | 887 |
| 96 | Ga0070708_100355772 | 3300005445 | Bacteria | 1380 |
| 97 | Ga0070663_100006826 | 3300005455 | Bacteria | 6904 |
| 98 | Ga0070663_100032502 | 3300005455 | Bacteria | 3597 |
| 99 | Ga0070663_100333121 | 3300005455 | Bacteria | 1224 |
| 100 | Ga0070663_100628885 | 3300005455 | Bacteria | 906 |
| 101 | Ga0070663_100690630 | 3300005455 | Bacteria | 867 |
| 102 | Ga0070663_101388483 | 3300005455 | Bacteria | 622 |
| 103 | Ga0070678_100030374 | 3300005456 | Bacteria | 3714 |
| 104 | Ga0070678_100139053 | 3300005456 | Bacteria | 1940 |
| 105 | Ga0070662_100001307 | 3300005457 | Bacteria | 15307 |
| 106 | Ga0070662_100330755 | 3300005457 | Bacteria | 1245 |
| 107 | Ga0070681_10022328 | 3300005458 | Bacteria | 6354 |
| 108 | Ga0070681_10371602 | 3300005458 | Bacteria | 1340 |
| 109 | Ga0070681_10450812 | 3300005458 | Bacteria | 1199 |
| 110 | Ga0070681_10514909 | 3300005458 | Bacteria | 1110 |
| 111 | Ga0068867_100000669 | 3300005459 | Bacteria | 22732 |
| 112 | Ga0068867_100101746 | 3300005459 | Bacteria | 2195 |
| 113 | Ga0068867_100197805 | 3300005459 | Bacteria | 1607 |
| 114 | Ga0068867_100205089 | 3300005459 | Bacteria | 1580 |
| 115 | Ga0070706_100242027 | 3300005467 | Bacteria | 1685 |
| 116 | Ga0070679_100035613 | 3300005530 | Bacteria | 4939 |
| 117 | Ga0070679_100059722 | 3300005530 | Bacteria | 3800 |
| 118 | Ga0070679_101156924 | 3300005530 | Bacteria | 719 |
| 119 | Ga0070684_100001976 | 3300005535 | Bacteria | 15071 |
| 120 | Ga0070684_100115845 | 3300005535 | Bacteria | 2407 |
| 121 | Ga0068853_100014825 | 3300005539 | Bacteria | 6399 |
| 122 | Ga0068853_100026172 | 3300005539 | Bacteria | 4898 |
| 123 | Ga0068853_100050746 | 3300005539 | Bacteria | 3570 |
| 124 | Ga0068853_101193537 | 3300005539 | Bacteria | 735 |
| 125 | Ga0070672_100000521 | 3300005543 | Bacteria | 22450 |
| 126 | Ga0070672_100025883 | 3300005543 | Bacteria | 4358 |
| 127 | Ga0070672_100719780 | 3300005543 | Bacteria | 875 |
| 128 | Ga0070695_100315811 | 3300005545 | Bacteria | 1160 |
| 129 | Ga0070696_100018750 | 3300005546 | Bacteria | 4680 |
| 130 | Ga0070665_100004881 | 3300005548 | Bacteria | 13927 |
| 131 | Ga0070665_100045852 | 3300005548 | Bacteria | 4390 |
| 132 | Ga0070665_100067776 | 3300005548 | Bacteria | 3578 |
| 133 | Ga0068855_100001489 | 3300005563 | Bacteria | 29301 |
| 134 | Ga0068855_100127359 | 3300005563 | Bacteria | 2910 |
| 135 | Ga0070664_100062550 | 3300005564 | Bacteria | 3173 |
| 136 | Ga0070664_100068301 | 3300005564 | Bacteria | 3038 |
| 137 | Ga0070664_100073941 | 3300005564 | Bacteria | 2924 |
| 138 | Ga0070664_100182683 | 3300005564 | Bacteria | 1865 |
| 139 | Ga0068857_100083605 | 3300005577 | Bacteria | 2852 |
| 140 | Ga0068857_100176712 | 3300005577 | Bacteria | 1942 |
| 141 | Ga0068854_100014738 | 3300005578 | Bacteria | 5160 |
| 142 | Ga0068854_100097843 | 3300005578 | Bacteria | 2194 |
| 143 | Ga0068854_100140020 | 3300005578 | Bacteria | 1856 |
| 144 | Ga0068856_100001071 | 3300005614 | Bacteria | 28975 |
| 145 | Ga0068856_100119425 | 3300005614 | Bacteria | 2637 |
| 146 | Ga0068856_100213613 | 3300005614 | Bacteria | 1944 |
| 147 | Ga0068856_100481112 | 3300005614 | Bacteria | 1263 |
| 148 | Ga0070702_100164891 | 3300005615 | Bacteria | 1436 |
| 149 | Ga0070702_100741403 | 3300005615 | Bacteria | 753 |
| 150 | Ga0068852_100013125 | 3300005616 | Bacteria | 6330 |
| 151 | Ga0068852_100150988 | 3300005616 | Bacteria | 2160 |
| 152 | Ga0068859_100046678 | 3300005617 | Bacteria | 4350 |
| 153 | Ga0068859_100217762 | 3300005617 | Bacteria | 1997 |
| 154 | Ga0068864_100037394 | 3300005618 | Bacteria | 4142 |
| 155 | Ga0068864_100258956 | 3300005618 | Bacteria | 1618 |
| 156 | Ga0068861_100119862 | 3300005719 | Bacteria | 2121 |
| 157 | Ga0068861_100158341 | 3300005719 | Bacteria | 1865 |
| 158 | Ga0068861_100240492 | 3300005719 | Bacteria | 1539 |
| 159 | Ga0068851_10003430 | 3300005834 | Bacteria | 7053 |
| 160 | Ga0068851_10007770 | 3300005834 | Bacteria | 4932 |
| 161 | Ga0068851_10045007 | 3300005834 | Bacteria | 2230 |
| 162 | Ga0068870_10635525 | 3300005840 | Bacteria | 729 |
| 163 | Ga0068863_100070031 | 3300005841 | Bacteria | 3317 |
| 164 | Ga0068863_100107206 | 3300005841 | Bacteria | 2658 |
| 165 | Ga0068863_100174846 | 3300005841 | Bacteria | 2060 |
| 166 | Ga0068863_100226395 | 3300005841 | Bacteria | 1803 |
| 167 | Ga0068863_100590479 | 3300005841 | Bacteria | 1099 |
| 168 | Ga0068858_100011950 | 3300005842 | Bacteria | 8182 |
| 169 | Ga0068860_100001951 | 3300005843 | Bacteria | 21825 |
| 170 | Ga0068860_100015231 | 3300005843 | Bacteria | 7512 |
| 171 | Ga0068860_100038331 | 3300005843 | Bacteria | 4584 |
| 172 | Ga0068860_100348988 | 3300005843 | Bacteria | 1456 |
| 173 | Ga0068860_101103828 | 3300005843 | Bacteria | 813 |
| 174 | Ga0068862_100015315 | 3300005844 | Bacteria | 6367 |
| 175 | Ga0068862_100034893 | 3300005844 | Bacteria | 4258 |
| 176 | Ga0068862_100655855 | 3300005844 | Bacteria | 1013 |
| 177 | Ga0068862_101384102 | 3300005844 | Bacteria | 706 |
| 178 | Ga0070717_10054394 | 3300006028 | Bacteria | 3301 |
| 179 | Ga0075363_100559376 | 3300006048 | Bacteria | 683 |
| 180 | Ga0075364_10335894 | 3300006051 | Bacteria | 1029 |
| 181 | Ga0075432_10013675 | 3300006058 | Bacteria | 2758 |
| 182 | Ga0070712_100229400 | 3300006175 | Bacteria | 1474 |
| 183 | Ga0075362_10029314 | 3300006177 | Bacteria | 2371 |
| 184 | Ga0075369_10016462 | 3300006186 | Bacteria | 2984 |
| 185 | Ga0075366_10000047 | 3300006195 | Bacteria | 43345 |
| 186 | Ga0075366_10041485 | 3300006195 | Bacteria | 2725 |
| 187 | Ga0075366_10050146 | 3300006195 | Bacteria | 2478 |
| 188 | Ga0075366_10101600 | 3300006195 | Bacteria | 1726 |
| 189 | Ga0097621_100003273 | 3300006237 | Bacteria | 11139 |
| 190 | Ga0097621_100491450 | 3300006237 | Bacteria | 1111 |
| 191 | Ga0097621_100799915 | 3300006237 | Bacteria | 874 |
| 192 | Ga0097621_100808942 | 3300006237 | Bacteria | 869 |
| 193 | Ga0068871_100016262 | 3300006358 | Bacteria | 5597 |
| 194 | Ga0068871_100513976 | 3300006358 | Bacteria | 1081 |
| 195 | Ga0068871_100579435 | 3300006358 | Bacteria | 1019 |
| 196 | Ga0075434_100486687 | 3300006871 | Bacteria | 1255 |
| 197 | Ga0075429_100633405 | 3300006880 | Bacteria | 937 |
| 198 | Ga0075436_100207511 | 3300006914 | Bacteria | 1388 |
| 199 | Ga0097620_100046682 | 3300006931 | Bacteria | 4350 |
| 200 | Ga0097620_100217763 | 3300006931 | Bacteria | 1997 |
| 201 | Ga0079104_1007537 | 3300006946 | Bacteria | 3922 |
| 202 | Ga0105240_10243610 | 3300009093 | Bacteria | 2083 |
| 203 | Ga0105240_10268473 | 3300009093 | Bacteria | 1965 |
| 204 | Ga0111539_10016757 | 3300009094 | Bacteria | 9082 |
| 205 | Ga0111539_10067447 | 3300009094 | Bacteria | 4225 |
| 206 | Ga0111539_10264223 | 3300009094 | Bacteria | 2003 |
| 207 | Ga0111539_10458083 | 3300009094 | Bacteria | 1485 |
| 208 | Ga0105245_10255336 | 3300009098 | Bacteria | 1704 |
| 209 | Ga0105243_10428772 | 3300009148 | Bacteria | 1235 |
| 210 | Ga0105241_10108797 | 3300009174 | Bacteria | 2216 |
| 211 | Ga0105241_10758448 | 3300009174 | Bacteria | 890 |
| 212 | Ga0105248_10007274 | 3300009177 | Bacteria | 12143 |
| 213 | Ga0105248_10683479 | 3300009177 | Bacteria | 1158 |
| 214 | Ga0105248_10986077 | 3300009177 | Bacteria | 952 |
| 215 | Ga0105237_10144530 | 3300009545 | Bacteria | 2373 |
| 216 | Ga0105237_10491591 | 3300009545 | Bacteria | 1233 |
| 217 | Ga0105237_11097989 | 3300009545 | Bacteria | 802 |
| 218 | Ga0105249_10233053 | 3300009553 | Bacteria | 1816 |
| 219 | Ga0105249_10260886 | 3300009553 | Bacteria | 1722 |
| 220 | Ga0105239_10068982 | 3300010375 | Bacteria | 3885 |
| 221 | Ga0105239_10448588 | 3300010375 | Bacteria | 1463 |
| 222 | Ga0105239_12013156 | 3300010375 | Bacteria | 670 |
| 223 | Ga0105246_10229650 | 3300011119 | Bacteria | 1460 |
| 224 | Ga0105246_10479914 | 3300011119 | Bacteria | 1051 |
| 225 | Ga0157373_10025194 | 3300013100 | Bacteria | 4305 |
| 226 | Ga0157373_10052383 | 3300013100 | Bacteria | 2904 |
| 227 | Ga0157371_10000681 | 3300013102 | Bacteria | 40170 |
| 228 | Ga0157371_10234383 | 3300013102 | Bacteria | 1320 |
| 229 | Ga0157370_10075209 | 3300013104 | Bacteria | 3185 |
| 230 | Ga0157370_10138987 | 3300013104 | Bacteria | 2263 |
| 231 | Ga0157370_10183411 | 3300013104 | Bacteria | 1944 |
| 232 | Ga0157370_10653302 | 3300013104 | Bacteria | 961 |
| 233 | Ga0157369_10374158 | 3300013105 | Bacteria | 1479 |
| 234 | Ga0157369_10549255 | 3300013105 | Bacteria | 1194 |
| 235 | Ga0157374_10045513 | 3300013296 | Bacteria | 4061 |
| 236 | Ga0157374_10663917 | 3300013296 | Bacteria | 1055 |
| 237 | Ga0157378_10121654 | 3300013297 | Bacteria | 2406 |
| 238 | Ga0157378_10129638 | 3300013297 | Bacteria | 2333 |
| 239 | Ga0157378_10136183 | 3300013297 | Bacteria | 2277 |
| 240 | Ga0157378_10327245 | 3300013297 | Bacteria | 1490 |
| 241 | Ga0157378_10618284 | 3300013297 | Bacteria | 1096 |
| 242 | Ga0163162_10068551 | 3300013306 | Bacteria | 3599 |
| 243 | Ga0163162_10082034 | 3300013306 | Bacteria | 3296 |
| 244 | Ga0157372_10019800 | 3300013307 | Bacteria | 7252 |
| 245 | Ga0157372_10067990 | 3300013307 | Bacteria | 4005 |
| 246 | Ga0157372_10078030 | 3300013307 | Bacteria | 3741 |
| 247 | Ga0157372_10146322 | 3300013307 | Bacteria | 2725 |
| 248 | Ga0157372_10338631 | 3300013307 | Bacteria | 1752 |
| 249 | Ga0157375_10089299 | 3300013308 | Bacteria | 3138 |
| 250 | Ga0157375_10294734 | 3300013308 | Bacteria | 1785 |
| 251 | Ga0157375_10410852 | 3300013308 | Bacteria | 1520 |
| 252 | Ga0157375_10416265 | 3300013308 | Bacteria | 1510 |
| 253 | Ga0157375_11752086 | 3300013308 | Bacteria | 736 |
| 254 | Ga0157380_10140540 | 3300014326 | Bacteria | 2074 |
| 255 | Ga0157380_10284412 | 3300014326 | Bacteria | 1515 |
| 256 | Ga0157379_10014702 | 3300014968 | Bacteria | 6866 |
| 257 | Ga0157376_10017423 | 3300014969 | Bacteria | 5479 |
| 258 | Ga0157376_10065502 | 3300014969 | Bacteria | 3068 |
| 259 | Ga0157376_10163922 | 3300014969 | Bacteria | 2017 |
| 260 | Ga0182006_1000026 | 3300015261 | Bacteria | 253543 |
| 261 | Ga0182007_10033033 | 3300015262 | Bacteria | 1755 |
| 262 | Ga0182005_1000007 | 3300015265 | Bacteria | 490994 |
| 263 | Ga0163161_10045173 | 3300017792 | Bacteria | 3176 |
| 264 | Ga0163161_10690677 | 3300017792 | Bacteria | 849 |
| 265 | Ga0206356_10947281 | 3300020070 | Bacteria | 1852 |
| 266 | Ga0209435_100062 | 3300025206 | Bacteria | 77288 |
| 267 | Ga0209436_112151 | 3300025208 | Bacteria | 1475 |
| 268 | Ga0209437_103551 | 3300025233 | Bacteria | 2806 |
| 269 | Ga0209437_111870 | 3300025233 | Bacteria | 1288 |
| 270 | Ga0207425_1000143 | 3300025245 | Bacteria | 62334 |
| 271 | Ga0207425_1001034 | 3300025245 | Bacteria | 12970 |
| 272 | Ga0207425_1003980 | 3300025245 | Bacteria | 4546 |
| 273 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 274 | Ga0209646_1000010 | 3300025246 | Bacteria | 573803 |
| 275 | Ga0209026_1000224 | 3300025250 | Bacteria | 77298 |
| 276 | Ga0209759_1000013 | 3300025256 | Bacteria | 399300 |
| 277 | Ga0209129_1038406 | 3300025258 | Bacteria | 767 |
| 278 | Ga0209565_1002095 | 3300025263 | Bacteria | 7622 |
| 279 | Ga0207666_1034174 | 3300025271 | Bacteria | 785 |
| 280 | Ga0209455_1000037 | 3300025272 | Bacteria | 464097 |
| 281 | Ga0209673_1000043 | 3300025273 | Bacteria | 291503 |
| 282 | Ga0209130_1000241 | 3300025284 | Bacteria | 70093 |
| 283 | Ga0209130_1000741 | 3300025284 | Bacteria | 28625 |
| 284 | Ga0209675_1001094 | 3300025291 | Bacteria | 16654 |
| 285 | Ga0209675_1001429 | 3300025291 | Bacteria | 13803 |
| 286 | Ga0209675_1051093 | 3300025291 | Bacteria | 853 |
| 287 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 288 | Ga0209676_1000066 | 3300025292 | Bacteria | 317897 |
| 289 | Ga0209676_1004056 | 3300025292 | Bacteria | 8425 |
| 290 | Ga0209025_1001845 | 3300025294 | Bacteria | 24883 |
| 291 | Ga0209025_1002489 | 3300025294 | Bacteria | 19371 |
| 292 | Ga0209025_1003025 | 3300025294 | Bacteria | 16602 |
| 293 | Ga0209025_1006292 | 3300025294 | Bacteria | 9279 |
| 294 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 295 | Ga0209564_1000033 | 3300025295 | Bacteria | 446200 |
| 296 | Ga0209564_1000285 | 3300025295 | Bacteria | 102585 |
| 297 | Ga0209564_1000877 | 3300025295 | Bacteria | 40004 |
| 298 | Ga0209564_1012207 | 3300025295 | Bacteria | 3764 |
| 299 | Ga0209758_1001766 | 3300025297 | Bacteria | 23985 |
| 300 | Ga0209758_1028562 | 3300025297 | Bacteria | 2355 |
| 301 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 302 | Ga0209050_1010854 | 3300025298 | Bacteria | 4418 |
| 303 | Ga0209050_1020223 | 3300025298 | Bacteria | 2486 |
| 304 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 305 | Ga0209256_1011350 | 3300025299 | Bacteria | 3574 |
| 306 | Ga0207426_1000247 | 3300025302 | Bacteria | 119659 |
| 307 | Ga0207426_1004487 | 3300025302 | Bacteria | 6769 |
| 308 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 309 | Ga0209257_1000020 | 3300025304 | Bacteria | 773356 |
| 310 | Ga0209257_1008893 | 3300025304 | Bacteria | 5537 |
| 311 | Ga0207656_10020275 | 3300025321 | Bacteria | 2641 |
| 312 | Ga0207656_10034153 | 3300025321 | Bacteria | 2122 |
| 313 | Ga0207655_1010587 | 3300025728 | Bacteria | 5578 |
| 314 | Ga0207653_10094797 | 3300025885 | Bacteria | 1050 |
| 315 | Ga0207688_10069795 | 3300025901 | Bacteria | 1992 |
| 316 | Ga0207680_10078818 | 3300025903 | Bacteria | 2064 |
| 317 | Ga0207680_10097346 | 3300025903 | Bacteria | 1884 |
| 318 | Ga0207645_10001626 | 3300025907 | Bacteria | 18332 |
| 319 | Ga0207705_10045438 | 3300025909 | Bacteria | 3156 |
| 320 | Ga0207705_10109443 | 3300025909 | Bacteria | 2040 |
| 321 | Ga0207705_10886852 | 3300025909 | Bacteria | 691 |
| 322 | Ga0207684_10575384 | 3300025910 | Bacteria | 963 |
| 323 | Ga0207654_10152225 | 3300025911 | Bacteria | 1486 |
| 324 | Ga0207707_10002203 | 3300025912 | Bacteria | 17655 |
| 325 | Ga0207707_10077641 | 3300025912 | Bacteria | 2899 |
| 326 | Ga0207707_10090993 | 3300025912 | Bacteria | 2666 |
| 327 | Ga0207695_10172205 | 3300025913 | Bacteria | 2090 |
| 328 | Ga0207671_10241137 | 3300025914 | Bacteria | 1420 |
| 329 | Ga0207671_10415996 | 3300025914 | Bacteria | 1069 |
| 330 | Ga0207693_10264395 | 3300025915 | Bacteria | 1348 |
| 331 | Ga0207660_10043785 | 3300025917 | Bacteria | 3146 |
| 332 | Ga0207660_10404292 | 3300025917 | Bacteria | 1100 |
| 333 | Ga0207657_10000371 | 3300025919 | Bacteria | 47425 |
| 334 | Ga0207657_10001198 | 3300025919 | Bacteria | 27571 |
| 335 | Ga0207657_10280122 | 3300025919 | Bacteria | 1324 |
| 336 | Ga0207649_10025257 | 3300025920 | Bacteria | 3462 |
| 337 | Ga0207649_10027706 | 3300025920 | Bacteria | 3329 |
| 338 | Ga0207649_10078253 | 3300025920 | Bacteria | 2133 |
| 339 | Ga0207649_10144550 | 3300025920 | Bacteria | 1631 |
| 340 | Ga0207652_10066192 | 3300025921 | Bacteria | 3131 |
| 341 | Ga0207681_10025230 | 3300025923 | Bacteria | 3821 |
| 342 | Ga0207681_10228713 | 3300025923 | Bacteria | 1442 |
| 343 | Ga0207694_10008827 | 3300025924 | Bacteria | 7604 |
| 344 | Ga0207694_10259762 | 3300025924 | Bacteria | 1422 |
| 345 | Ga0207650_10031328 | 3300025925 | Bacteria | 3839 |
| 346 | Ga0207650_10047703 | 3300025925 | Bacteria | 3157 |
| 347 | Ga0207650_10119221 | 3300025925 | Bacteria | 2052 |
| 348 | Ga0207650_10637739 | 3300025925 | Bacteria | 898 |
| 349 | Ga0207659_10017403 | 3300025926 | Bacteria | 4696 |
| 350 | Ga0207659_10038080 | 3300025926 | Bacteria | 3342 |
| 351 | Ga0207659_10362039 | 3300025926 | Bacteria | 1206 |
| 352 | Ga0207659_10659837 | 3300025926 | Bacteria | 894 |
| 353 | Ga0207687_10218812 | 3300025927 | Bacteria | 1498 |
| 354 | Ga0207700_10000099 | 3300025928 | Bacteria | 53179 |
| 355 | Ga0207664_10007399 | 3300025929 | Bacteria | 7613 |
| 356 | Ga0207664_10215663 | 3300025929 | Bacteria | 1662 |
| 357 | Ga0207644_10118251 | 3300025931 | Bacteria | 2014 |
| 358 | Ga0207690_10040293 | 3300025932 | Bacteria | 3053 |
| 359 | Ga0207690_10594290 | 3300025932 | Bacteria | 903 |
| 360 | Ga0207706_10000179 | 3300025933 | Bacteria | 70768 |
| 361 | Ga0207706_10140078 | 3300025933 | Bacteria | 2128 |
| 362 | Ga0207706_10216825 | 3300025933 | Bacteria | 1677 |
| 363 | Ga0207706_10580012 | 3300025933 | Bacteria | 964 |
| 364 | Ga0207686_10079245 | 3300025934 | Bacteria | 2138 |
| 365 | Ga0207669_10038059 | 3300025937 | Bacteria | 2766 |
| 366 | Ga0207691_10000041 | 3300025940 | Bacteria | 106275 |
| 367 | Ga0207691_10124826 | 3300025940 | Bacteria | 2278 |
| 368 | Ga0207711_10054932 | 3300025941 | Bacteria | 3418 |
| 369 | Ga0207711_10400165 | 3300025941 | Bacteria | 1276 |
| 370 | Ga0207689_10053519 | 3300025942 | Bacteria | 3326 |
| 371 | Ga0207689_10284864 | 3300025942 | Bacteria | 1368 |
| 372 | Ga0207661_10643872 | 3300025944 | Bacteria | 974 |
| 373 | Ga0207679_10115434 | 3300025945 | Bacteria | 2127 |
| 374 | Ga0207679_10441467 | 3300025945 | Bacteria | 1152 |
| 375 | Ga0207679_10453106 | 3300025945 | Bacteria | 1138 |
| 376 | Ga0207679_10569974 | 3300025945 | Bacteria | 1017 |
| 377 | Ga0207667_10007667 | 3300025949 | Bacteria | 12923 |
| 378 | Ga0207667_10093363 | 3300025949 | Bacteria | 3107 |
| 379 | Ga0207667_10310679 | 3300025949 | Bacteria | 1610 |
| 380 | Ga0207651_10468064 | 3300025960 | Bacteria | 1084 |
| 381 | Ga0207712_10534231 | 3300025961 | Bacteria | 1007 |
| 382 | Ga0207668_10045971 | 3300025972 | Bacteria | 2980 |
| 383 | Ga0207668_10185991 | 3300025972 | Bacteria | 1642 |
| 384 | Ga0207668_10643379 | 3300025972 | Bacteria | 927 |
| 385 | Ga0207640_10024147 | 3300025981 | Bacteria | 3663 |
| 386 | Ga0207640_10045512 | 3300025981 | Bacteria | 2818 |
| 387 | Ga0207658_10078480 | 3300025986 | Bacteria | 2523 |
| 388 | Ga0207658_10316637 | 3300025986 | Bacteria | 1349 |
| 389 | Ga0207677_10009713 | 3300026023 | Bacteria | 5420 |
| 390 | Ga0207703_10040546 | 3300026035 | Bacteria | 3726 |
| 391 | Ga0207703_11679105 | 3300026035 | Bacteria | 611 |
| 392 | Ga0207639_10026255 | 3300026041 | Bacteria | 4232 |
| 393 | Ga0207639_10079529 | 3300026041 | Bacteria | 2591 |
| 394 | Ga0207639_10145699 | 3300026041 | Bacteria | 1978 |
| 395 | Ga0207639_10170133 | 3300026041 | Bacteria | 1844 |
| 396 | Ga0207678_10021176 | 3300026067 | Bacteria | 5699 |
| 397 | Ga0207678_10050423 | 3300026067 | Bacteria | 3596 |
| 398 | Ga0207678_10121481 | 3300026067 | Bacteria | 2229 |
| 399 | Ga0207678_10766079 | 3300026067 | Bacteria | 851 |
| 400 | Ga0207678_10786309 | 3300026067 | Bacteria | 840 |
| 401 | Ga0207702_10000997 | 3300026078 | Bacteria | 29032 |
| 402 | Ga0207702_10173702 | 3300026078 | Bacteria | 1978 |
| 403 | Ga0207641_10181869 | 3300026088 | Bacteria | 1926 |
| 404 | Ga0207641_10377625 | 3300026088 | Bacteria | 1356 |
| 405 | Ga0207648_10025927 | 3300026089 | Bacteria | 5215 |
| 406 | Ga0207648_10025971 | 3300026089 | Bacteria | 5209 |
| 407 | Ga0207648_10162793 | 3300026089 | Bacteria | 1971 |
| 408 | Ga0207648_10592460 | 3300026089 | Bacteria | 1021 |
| 409 | Ga0207676_10120265 | 3300026095 | Bacteria | 2213 |
| 410 | Ga0207676_10187229 | 3300026095 | Bacteria | 1818 |
| 411 | Ga0207674_10001773 | 3300026116 | Bacteria | 27553 |
| 412 | Ga0207674_10163647 | 3300026116 | Bacteria | 2179 |
| 413 | Ga0207675_100183941 | 3300026118 | Bacteria | 2002 |
| 414 | Ga0207675_100377039 | 3300026118 | Bacteria | 1394 |
| 415 | Ga0207683_10000011 | 3300026121 | Bacteria | 140261 |
| 416 | Ga0207683_10095896 | 3300026121 | Bacteria | 2645 |
| 417 | Ga0207698_10007538 | 3300026142 | Bacteria | 6819 |
| 418 | Ga0207698_11148708 | 3300026142 | Bacteria | 790 |
| 419 | Ga0209281_1012000 | 3300027111 | Bacteria | 1920 |
| 420 | Ga0209969_1004991 | 3300027360 | Bacteria | 1857 |
| 421 | Ga0209974_10053467 | 3300027876 | Bacteria | 1360 |
| 422 | Ga0207428_10007629 | 3300027907 | Bacteria | 9851 |
| 423 | Ga0207428_10050071 | 3300027907 | Bacteria | 3343 |
| 424 | Ga0268266_10069497 | 3300028379 | Bacteria | 3051 |
| 425 | Ga0268264_10023348 | 3300028381 | Bacteria | 5046 |
| 426 | Ga0265323_10063812 | 3300028653 | Bacteria | 1275 |
| 427 | Ga0307515_10235834 | 3300028794 | Bacteria | 1611 |
| 428 | Ga0265324_10000006 | 3300029957 | Bacteria | 267048 |
| 429 | Ga0265324_10000180 | 3300029957 | Bacteria | 48263 |
| 430 | Ga0265324_10016237 | 3300029957 | Bacteria | 2723 |
| 431 | Ga0316177_1082218 | 3300030731 | Bacteria | 1313 |
| 432 | Ga0316181_1149069 | 3300030744 | Bacteria | 1681 |
| 433 | Ga0316182_1388674 | 3300030745 | Bacteria | 1705 |
| 434 | Ga0265330_10102575 | 3300031235 | Bacteria | 1224 |
| 435 | Ga0265328_10000001 | 3300031239 | Bacteria | 371500 |
| 436 | Ga0265325_10000110 | 3300031241 | Bacteria | 56687 |
| 437 | Ga0265325_10023232 | 3300031241 | Bacteria | 3389 |
| 438 | Ga0265331_10005458 | 3300031250 | Bacteria | 7674 |
| 439 | Ga0265331_10008224 | 3300031250 | Bacteria | 5950 |
| 440 | Ga0265331_10024729 | 3300031250 | Bacteria | 3036 |
| 441 | Ga0265331_10051752 | 3300031250 | Bacteria | 1965 |
| 442 | Ga0265331_10257198 | 3300031250 | Bacteria | 783 |
| 443 | Ga0265327_10000588 | 3300031251 | Bacteria | 61029 |
| 444 | Ga0265327_10045923 | 3300031251 | Bacteria | 2317 |
| 445 | Ga0265316_10038264 | 3300031344 | Bacteria | 3866 |
| 446 | Ga0265316_10069121 | 3300031344 | Bacteria | 2726 |
| 447 | Ga0265316_10119684 | 3300031344 | Bacteria | 1989 |
| 448 | Ga0265316_10288588 | 3300031344 | Bacteria | 1197 |
| 449 | Ga0307513_10000054 | 3300031456 | Bacteria | 148887 |
| 450 | Ga0307509_10000006 | 3300031507 | Bacteria | 421538 |
| 451 | Ga0307408_100049572 | 3300031548 | Bacteria | 3016 |
| 452 | Ga0307408_100133369 | 3300031548 | Bacteria | 1940 |
| 453 | Ga0307408_100254986 | 3300031548 | Bacteria | 1449 |
| 454 | Ga0307408_100774566 | 3300031548 | Bacteria | 869 |
| 455 | Ga0316575_10000032 | 3300031665 | Bacteria | 33845 |
| 456 | Ga0265314_10000397 | 3300031711 | Bacteria | 59137 |
| 457 | Ga0265314_10001258 | 3300031711 | Bacteria | 28871 |
| 458 | Ga0265314_10009646 | 3300031711 | Bacteria | 8130 |
| 459 | Ga0265314_10016544 | 3300031711 | Bacteria | 5819 |
| 460 | Ga0265342_10012278 | 3300031712 | Bacteria | 5808 |
| 461 | Ga0316576_10607811 | 3300031727 | Bacteria | 798 |
| 462 | Ga0307516_10399959 | 3300031730 | Bacteria | 1033 |
| 463 | Ga0307405_10003332 | 3300031731 | Bacteria | 7357 |
| 464 | Ga0307413_10002017 | 3300031824 | Bacteria | 8074 |
| 465 | Ga0307413_10472582 | 3300031824 | Bacteria | 1000 |
| 466 | Ga0307410_10202752 | 3300031852 | Bacteria | 1515 |
| 467 | Ga0307406_10172291 | 3300031901 | Bacteria | 1567 |
| 468 | Ga0307412_10053323 | 3300031911 | Bacteria | 2680 |
| 469 | Ga0307412_10410005 | 3300031911 | Bacteria | 1106 |
| 470 | Ga0307412_11013948 | 3300031911 | Bacteria | 734 |
| 471 | Ga0307412_11594645 | 3300031911 | Bacteria | 596 |
| 472 | Ga0307409_100258470 | 3300031995 | Bacteria | 1596 |
| 473 | Ga0307416_100035982 | 3300032002 | Bacteria | 3790 |
| 474 | Ga0307416_100501394 | 3300032002 | Bacteria | 1278 |
| 475 | Ga0307414_10030059 | 3300032004 | Bacteria | 3544 |
| 476 | Ga0307411_10018632 | 3300032005 | Bacteria | 3988 |
| 477 | Ga0307415_100025599 | 3300032126 | Bacteria | 3706 |
| 478 | Ga0316583_10021856 | 3300032133 | Bacteria | 2293 |
| 479 | Ga0316583_10082050 | 3300032133 | Bacteria | 1126 |
| 480 | Ga0373926_0072586 | 3300035083 | Bacteria | 1266 |
| 481 | Ga0373928_0029931 | 3300035084 | Bacteria | 1200 |
| 482 | Ga0373928_0178783 | 3300035084 | Bacteria | 602 |
| 483 | Ga0373939_0003438 | 3300035114 | Bacteria | 3714 |
| 484 | Ga0373960_0357809 | 3300035121 | Bacteria | 555 |
| 485 | Ga0373937_0588497 | 3300036401 | Bacteria | 1056 |
| 486 | Ga0316584_0055797 | 3300036712 | Bacteria | 2958 |
| 487 | Ga0395899_0001965 | 3300037312 | Bacteria | 16903 |
| 488 | Ga0395899_0551156 | 3300037312 | Bacteria | 741 |
| 489 | Ga0395900_0014339 | 3300037418 | Bacteria | 8092 |
| 490 | Ga0395900_0024345 | 3300037418 | Bacteria | 6199 |
| 491 | Ga0395898_0009746 | 3300037466 | Bacteria | 10067 |
| 492 | Ga0395898_0114968 | 3300037466 | Bacteria | 2578 |
| 493 | Ga0395905_0013281 | 3300037471 | Bacteria | 7899 |
| 494 | Ga0395905_0013691 | 3300037471 | Bacteria | 7769 |
| 495 | Ga0395905_0019556 | 3300037471 | Bacteria | 6418 |
| 496 | Ga0395905_0037345 | 3300037471 | Bacteria | 4561 |
| 497 | Ga0395905_0067029 | 3300037471 | Bacteria | 3361 |
| 498 | Ga0395905_0138870 | 3300037471 | Bacteria | 2286 |
| 499 | Ga0395905_0198815 | 3300037471 | Bacteria | 1879 |
| 500 | Ga0395905_0552492 | 3300037471 | Bacteria | 1053 |
| 501 | Ga0395905_0842224 | 3300037471 | Bacteria | 820 |
| 502 | Ga0395901_0027151 | 3300038443 | Bacteria | 5880 |
| 503 | Ga0395901_0048355 | 3300038443 | Bacteria | 4417 |
| 504 | Ga0395901_0156195 | 3300038443 | Bacteria | 2396 |
| 505 | Ga0395901_0351426 | 3300038443 | Bacteria | 1521 |
| 506 | Ga0395901_0476816 | 3300038443 | Bacteria | 1273 |
| 507 | Ga0400490_47983 | 3300038726 | Bacteria | 10023 |
| 508 | Ga0436361_0344944 | 3300039447 | Bacteria | 4344 |
| 509 | Ga0436361_1195038 | 3300039447 | Bacteria | 1308 |
| 510 | Ga0451791_1835022 | 3300041451 | Bacteria | 776 |
| 511 | Ga0451795_1551090 | 3300041456 | Bacteria | 754 |
| 512 | Ga0451804_0427897 | 3300041463 | Bacteria | 848 |
| 513 | Ga0451577_0000080 | 3300042876 | Bacteria | 218034 |
| 514 | Ga0451577_0093859 | 3300042876 | Bacteria | 2680 |
| 515 | Ga0451577_0305633 | 3300042876 | Bacteria | 1441 |
| 516 | Ga0466969_0010029 | 3300044656 | Bacteria | 5022 |
| 517 | Ga0466972_0112731 | 3300044658 | Bacteria | 1284 |
| 518 | Ga0453683_0000049 | 3300044673 | Bacteria | 206697 |
| 519 | Ga0466965_0052930 | 3300044683 | Bacteria | 2017 |
| 520 | Ga0466966_0019611 | 3300044684 | Bacteria | 4449 |
| 521 | Ga0453684_0000237 | 3300044712 | Bacteria | 236999 |
| 522 | Ga0453684_0000286 | 3300044712 | Bacteria | 218034 |
| 523 | Ga0453684_0003300 | 3300044712 | Bacteria | 36795 |
| 524 | Ga0453684_0006085 | 3300044712 | Bacteria | 23282 |
| 525 | Ga0453684_0086624 | 3300044712 | Bacteria | 3886 |
| 526 | Ga0453684_0366082 | 3300044712 | Bacteria | 1622 |
| 527 | Ga0453684_1317235 | 3300044712 | Bacteria | 753 |
| 528 | Ga0453684_1522500 | 3300044712 | Bacteria | 689 |
| 529 | Ga0466970_0022377 | 3300044765 | Bacteria | 3299 |
| 530 | Ga0466970_0180016 | 3300044765 | Bacteria | 1173 |
| 531 | Ga0466960_0041746 | 3300044901 | Bacteria | 2174 |
| 532 | Ga0466960_0331552 | 3300044901 | Bacteria | 864 |
| 533 | Ga0466959_0056630 | 3300045049 | Bacteria | 2860 |
| 534 | Ga0466959_0084193 | 3300045049 | Bacteria | 2289 |
| 535 | Ga0451576_0000034 | 3300045051 | Bacteria | 390778 |
| 536 | Ga0451576_0000102 | 3300045051 | Bacteria | 218034 |
| 537 | Ga0451576_0376837 | 3300045051 | Bacteria | 1487 |
| 538 | Ga0451576_1279952 | 3300045051 | Bacteria | 765 |
| 539 | Ga0451576_1431499 | 3300045051 | Bacteria | 719 |
| 540 | Ga0466958_0437195 | 3300045836 | Bacteria | 847 |
| 541 | Ga0495617_000037 | 3300046452 | Bacteria | 134553 |
| 542 | Ga0495627_000008 | 3300046453 | Bacteria | 572150 |
| 543 | Ga0495590_0000089 | 3300046457 | Bacteria | 57394 |
| 544 | Ga0495638_0000329 | 3300046460 | Bacteria | 60063 |
| 545 | Ga0495638_0130847 | 3300046460 | Bacteria | 1474 |
| 546 | Ga0495653_0000038 | 3300046463 | Bacteria | 120385 |
| 547 | Ga0495650_0003518 | 3300046471 | Bacteria | 11346 |
| 548 | Ga0495650_0004834 | 3300046471 | Bacteria | 9017 |
| 549 | Ga0495650_0005997 | 3300046471 | Bacteria | 7691 |
| 550 | Ga0495650_0010456 | 3300046471 | Bacteria | 5176 |
| 551 | Ga0495650_0016142 | 3300046471 | Bacteria | 3795 |
| 552 | Ga0495605_0002030 | 3300046474 | Bacteria | 12766 |
| 553 | Ga0495585_0012995 | 3300046492 | Bacteria | 4887 |
| 554 | Ga0495607_0012687 | 3300046501 | Bacteria | 5550 |
| 555 | Ga0495607_0032811 | 3300046501 | Bacteria | 3165 |
| 556 | Ga0495583_0000464 | 3300046506 | Bacteria | 59972 |
| 557 | Ga0495606_0000011 | 3300046507 | Bacteria | 296816 |
| 558 | Ga0495606_0000064 | 3300046507 | Bacteria | 183631 |
| 559 | Ga0495606_0008212 | 3300046507 | Bacteria | 9127 |
| 560 | Ga0495606_0015425 | 3300046507 | Bacteria | 5885 |
| 561 | Ga0495606_0015437 | 3300046507 | Bacteria | 5883 |
| 562 | Ga0495606_0024643 | 3300046507 | Bacteria | 4329 |
| 563 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 564 | Ga0495610_0020763 | 3300046512 | Bacteria | 3636 |
| 565 | Ga0495610_0030292 | 3300046512 | Bacteria | 2837 |
| 566 | Ga0495637_0164188 | 3300046520 | Bacteria | 831 |
| 567 | Ga0495643_0006906 | 3300046522 | Bacteria | 7391 |
| 568 | Ga0495643_0028163 | 3300046522 | Bacteria | 3152 |
| 569 | Ga0495648_0000001 | 3300046524 | Bacteria | 696872 |
| 570 | Ga0495648_0033549 | 3300046524 | Bacteria | 3350 |
| 571 | Ga0495648_0065957 | 3300046524 | Bacteria | 2124 |
| 572 | Ga0495648_0107235 | 3300046524 | Bacteria | 1527 |
| 573 | Ga0495642_0007721 | 3300046528 | Bacteria | 4122 |
| 574 | Ga0495654_0038980 | 3300046530 | Bacteria | 2373 |
| 575 | Ga0495609_0019147 | 3300046538 | Bacteria | 3169 |
| 576 | Ga0495597_0005062 | 3300046542 | Bacteria | 7049 |
| 577 | Ga0495622_0000068 | 3300046557 | Bacteria | 90633 |
| 578 | Ga0495622_0006132 | 3300046557 | Bacteria | 5585 |
| 579 | Ga0495633_0007375 | 3300046558 | Bacteria | 6335 |
| 580 | Ga0495633_0008653 | 3300046558 | Bacteria | 5714 |
| 581 | Ga0495633_0246580 | 3300046558 | Bacteria | 815 |
| 582 | Ga0495668_0001239 | 3300046616 | Bacteria | 25630 |
| 583 | Ga0495668_0012767 | 3300046616 | Bacteria | 4974 |
| 584 | Ga0495668_0019170 | 3300046616 | Bacteria | 3947 |
| 585 | Ga0495668_0143062 | 3300046616 | Bacteria | 1309 |
| 586 | Ga0495625_0005736 | 3300046660 | Bacteria | 11222 |
| 587 | Ga0495625_0008141 | 3300046660 | Bacteria | 8981 |
| 588 | Ga0495625_0019712 | 3300046660 | Bacteria | 5222 |
| 589 | Ga0495625_0033686 | 3300046660 | Bacteria | 3784 |
| 590 | Ga0495661_0002158 | 3300046665 | Bacteria | 15383 |
| 591 | Ga0495661_0037675 | 3300046665 | Bacteria | 3017 |
| 592 | Ga0495588_0335158 | 3300046674 | Bacteria | 795 |
| 593 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 594 | Ga0495660_0011707 | 3300046810 | Bacteria | 5089 |
| 595 | Ga0495660_0019417 | 3300046810 | Bacteria | 3902 |
| 596 | Ga0495660_0041115 | 3300046810 | Bacteria | 2561 |
| 597 | Ga0495636_0068742 | 3300047318 | Bacteria | 1508 |
| 598 | Ga0495672_0000302 | 3300047320 | Bacteria | 66589 |
| 599 | Ga0495687_008955 | 3300047443 | Bacteria | 5661 |
| 600 | Ga0495687_029278 | 3300047443 | Bacteria | 2551 |
| 601 | Ga0495679_009967 | 3300047446 | Bacteria | 3763 |
| 602 | Ga0495673_0000097 | 3300047469 | Bacteria | 182247 |
| 603 | Ga0495673_0000100 | 3300047469 | Bacteria | 173962 |
| 604 | Ga0495686_0018201 | 3300047472 | Bacteria | 4719 |
| 605 | Ga0495686_0028559 | 3300047472 | Bacteria | 3632 |
| 606 | Ga0496101_0074089 | 3300048904 | Bacteria | 2503 |
| 607 | Ga0496101_0580009 | 3300048904 | Bacteria | 887 |
| 608 | Ga0496102_0001475 | 3300048905 | Bacteria | 20760 |
| 609 | Ga0496102_0266769 | 3300048905 | Bacteria | 1614 |
| 610 | Ga0496104_0431437 | 3300048907 | Bacteria | 1230 |
| 611 | Ga0496106_0002475 | 3300048909 | Bacteria | 13763 |
| 612 | Ga0496107_0112465 | 3300048910 | Bacteria | 2002 |
| 613 | Ga0496107_0691015 | 3300048910 | Bacteria | 751 |
| 614 | Ga0496108_0013970 | 3300048911 | Bacteria | 6550 |
| 615 | Ga0496108_0510383 | 3300048911 | Bacteria | 1050 |
| 616 | Ga0496109_0089029 | 3300048912 | Bacteria | 2853 |
| 617 | Ga0496110_0070547 | 3300048913 | Bacteria | 3096 |
| 618 | Ga0496110_0271182 | 3300048913 | Bacteria | 1545 |
| 619 | Ga0496111_0053765 | 3300048914 | Bacteria | 2910 |
| 620 | Ga0496111_0274884 | 3300048914 | Bacteria | 1250 |
| 621 | Ga0496114_0012788 | 3300048917 | Bacteria | 6719 |
| 622 | Ga0496114_0013659 | 3300048917 | Bacteria | 6510 |
| 623 | Ga0496115_0484993 | 3300048918 | Bacteria | 995 |
| 624 | Ga0496116_0148072 | 3300048919 | Bacteria | 1309 |
| 625 | Ga0496119_0392834 | 3300048922 | Bacteria | 663 |
| 626 | Ga0496120_0476488 | 3300048923 | Bacteria | 539 |
| 627 | Ga0496122_0147189 | 3300048925 | Bacteria | 1461 |
| 628 | Ga0496123_0013346 | 3300048926 | Bacteria | 6906 |
| 629 | Ga0496125_0133305 | 3300048928 | Bacteria | 1744 |
| 630 | Ga0496126_0014001 | 3300048929 | Bacteria | 8128 |
| 631 | Ga0496126_0143238 | 3300048929 | Bacteria | 2055 |
| 632 | Ga0501310_007907 | 3300049130 | Bacteria | 1145 |
| 633 | Ga0495678_000128 | 3300049459 | Bacteria | 89099 |
| 634 | Ga0495678_022689 | 3300049459 | Bacteria | 2740 |
| 635 | Ga0495678_042991 | 3300049459 | Bacteria | 1797 |
| 636 | Ga0501311_001467 | 3300049527 | Bacteria | 2058 |
| 637 | Ga0501315_049047 | 3300049531 | Bacteria | 659 |
| 638 | Ga0501322_019171 | 3300049538 | Bacteria | 590 |
| 639 | Ga0501031_0027721 | 3300049568 | Bacteria | 3693 |
| 640 | Ga0501032_0010188 | 3300049569 | Bacteria | 6784 |
| 641 | Ga0501033_0040060 | 3300049570 | Bacteria | 3498 |
| 642 | Ga0501034_0005376 | 3300049571 | Bacteria | 14011 |
| 643 | Ga0501034_0126349 | 3300049571 | Bacteria | 2542 |
| 644 | Ga0501034_1413026 | 3300049571 | Bacteria | 571 |
| 645 | Ga0501036_0058733 | 3300049572 | Bacteria | 3259 |
| 646 | Ga0501036_0117448 | 3300049572 | Bacteria | 2247 |
| 647 | Ga0501037_0001887 | 3300049573 | Bacteria | 15235 |
| 648 | Ga0501037_0004664 | 3300049573 | Bacteria | 9957 |
| 649 | Ga0501037_0033043 | 3300049573 | Bacteria | 3822 |
| 650 | Ga0501038_0003864 | 3300049574 | Bacteria | 13921 |
| 651 | Ga0501038_0020288 | 3300049574 | Bacteria | 5978 |
| 652 | Ga0501038_0030062 | 3300049574 | Bacteria | 4810 |
| 653 | Ga0501039_0003351 | 3300049575 | Bacteria | 11972 |
| 654 | Ga0501039_0129507 | 3300049575 | Bacteria | 1980 |
| 655 | Ga0501039_0157378 | 3300049575 | Bacteria | 1785 |
| 656 | Ga0501042_1263259 | 3300049578 | Bacteria | 538 |
| 657 | Ga0501043_0007959 | 3300049579 | Bacteria | 8372 |
| 658 | Ga0501043_0340272 | 3300049579 | Bacteria | 1141 |
| 659 | Ga0501046_0409791 | 3300049580 | Bacteria | 978 |
| 660 | Ga0501047_0034967 | 3300049581 | Bacteria | 4852 |
| 661 | Ga0501047_0226504 | 3300049581 | Bacteria | 1724 |
| 662 | Ga0501068_0181508 | 3300049584 | Bacteria | 1331 |
| 663 | Ga0501070_0024315 | 3300049586 | Bacteria | 5081 |
| 664 | Ga0501070_0032902 | 3300049586 | Bacteria | 4337 |
| 665 | Ga0501072_0178723 | 3300049588 | Bacteria | 1693 |
| 666 | Ga0501073_0061269 | 3300049589 | Bacteria | 2626 |
| 667 | Ga0501073_0253991 | 3300049589 | Bacteria | 1213 |
| 668 | Ga0501074_0004026 | 3300049590 | Bacteria | 10482 |
| 669 | Ga0501074_0016929 | 3300049590 | Bacteria | 5289 |
| 670 | Ga0501075_0044860 | 3300049591 | Bacteria | 3317 |
| 671 | Ga0501209_000841 | 3300049656 | Bacteria | 3981 |
| 672 | Ga0501257_073175 | 3300049686 | Bacteria | 878 |
| 673 | Ga0501225_0110563 | 3300049705 | Bacteria | 810 |
| 674 | Ga0501080_0004472 | 3300049742 | Bacteria | 12445 |
| 675 | Ga0501080_0057515 | 3300049742 | Bacteria | 3620 |
| 676 | Ga0501080_0676748 | 3300049742 | Bacteria | 911 |
| 677 | Ga0501280_000570 | 3300049776 | Bacteria | 8565 |
| 678 | Ga0501044_0015304 | 3300049823 | Bacteria | 8262 |
| 679 | nmdc:mga03683_124487_c1 | 3300050489 | Bacteria | 1149 |
| 680 | nmdc:mga03683_145006_c1 | 3300050489 | Bacteria | 1069 |
| 681 | nmdc:mga0k408_1337_c1 | 3300050493 | Bacteria | 13338 |
| 682 | nmdc:mga0k408_21809_c1 | 3300050493 | Bacteria | 3602 |
| 683 | nmdc:mga0k408_44254_c1 | 3300050493 | Bacteria | 2566 |
| 684 | nmdc:mga09592_598217_c1 | 3300050508 | Bacteria | 945 |
| 685 | nmdc:mga08y16_15466_c1 | 3300050511 | Bacteria | 8025 |
| 686 | nmdc:mga08y16_184336_c1 | 3300050511 | Bacteria | 2166 |
| 687 | nmdc:mga08y16_195903_c1 | 3300050511 | Bacteria | 2094 |
| 688 | nmdc:mga08y16_27850_c1 | 3300050511 | Bacteria | 5956 |
| 689 | nmdc:mga08y16_775554_c1 | 3300050511 | Bacteria | 953 |
| 690 | nmdc:mga0n895_145007_c1 | 3300050512 | Bacteria | 2403 |
| 691 | nmdc:mga0sz30_22870_c1 | 3300050516 | Bacteria | 2539 |
| 692 | Ga0500641_0014809 | 3300053096 | Bacteria | 2882 |
| 693 | Ga0500650_0074263 | 3300053098 | Bacteria | 1590 |
| 694 | Ga0500593_006380 | 3300053117 | Bacteria | 4716 |
| 695 | Ga0500607_194762 | 3300053121 | Bacteria | 880 |
| 696 | Ga0500618_001153 | 3300053125 | Bacteria | 12820 |
| 697 | Ga0500628_017355 | 3300053129 | Bacteria | 1405 |
| 698 | Ga0500586_003447 | 3300053145 | Bacteria | 3740 |
| 699 | Ga0500604_0033057 | 3300053151 | Bacteria | 1528 |
| 700 | Ga0500622_0000002 | 3300053156 | Bacteria | 646442 |
| 701 | Ga0500627_0255996 | 3300053158 | Bacteria | 774 |
| 702 | Ga0500645_001223 | 3300053730 | Bacteria | 13536 |
| 703 | Ga0500587_027065 | 3300053739 | Bacteria | 772 |
| 704 | Ga0500661_045973 | 3300055283 | Bacteria | 776 |
| 705 | Ga0587068_036369 | 3300059641 | Bacteria | 876 |
| 706 | Ga0587076_015332 | 3300059645 | Bacteria | 1193 |
| 707 | Ga0587111_0036871 | 3300060346 | Bacteria | 1025 |
| 708 | Ga0501082_0041092 | 3300060353 | Bacteria | 3987 |
| 709 | Ga0530510_0675589 | 3300061734 | Bacteria | 787 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031250 | Ga0265331_10024729 | Ga0265331_100247292 | 109 |
| 2 | 3300035084 | Ga0373928_0178783 | Ga0373928_0178783_23_478 | 109 |
| 3 | 3300049705 | Ga0501225_0110563 | Ga0501225_0110563_286_741 | 110 |
| 4 | 3300036712 | Ga0316584_0055797 | Ga0316584_0055797_1090_1578 | 117 |
| 5 | 3300044712 | Ga0453684_0000237 | Ga0453684_0000237_160813_161301 | 117 |
| 6 | 3300044712 | Ga0453684_0366082 | Ga0453684_0366082_763_1251 | 117 |
| 7 | 3300005455 | Ga0070663_101388483 | Ga0070663_1013884831 | 118 |
| 8 | 3300005615 | Ga0070702_100741403 | Ga0070702_1007414031 | 118 |
| 9 | 3300009094 | Ga0111539_10067447 | Ga0111539_100674472 | 118 |
| 10 | 3300009098 | Ga0105245_10255336 | Ga0105245_102553362 | 118 |
| 11 | 3300011119 | Ga0105246_10229650 | Ga0105246_102296501 | 118 |
| 12 | 3300013297 | Ga0157378_10618284 | Ga0157378_106182842 | 118 |
| 13 | 3300014969 | Ga0157376_10017423 | Ga0157376_100174232 | 118 |
| 14 | 3300025933 | Ga0207706_10140078 | Ga0207706_101400783 | 118 |
| 15 | 3300027907 | Ga0207428_10007629 | Ga0207428_100076298 | 118 |
| 16 | 3300031507 | Ga0307509_10000006 | Ga0307509_10000006321 | 118 |
| 17 | 3300035121 | Ga0373960_0357809 | Ga0373960_0357809_33_536 | 118 |
| 18 | 3300037471 | Ga0395905_0552492 | Ga0395905_0552492_166_654 | 118 |
| 19 | 3300037471 | Ga0395905_0842224 | Ga0395905_0842224_101_589 | 118 |
| 20 | 3300042876 | Ga0451577_0305633 | Ga0451577_0305633_200_688 | 118 |
| 21 | 3300044765 | Ga0466970_0022377 | Ga0466970_0022377_1306_1794 | 118 |
| 22 | 3300045049 | Ga0466959_0084193 | Ga0466959_0084193_1096_1584 | 118 |
| 23 | 3300046452 | Ga0495617_000037 | Ga0495617_000037_3445_3933 | 118 |
| 24 | 3300046463 | Ga0495653_0000038 | Ga0495653_0000038_117884_118372 | 118 |
| 25 | 3300046471 | Ga0495650_0003518 | Ga0495650_0003518_3175_3663 | 118 |
| 26 | 3300046492 | Ga0495585_0012995 | Ga0495585_0012995_1572_2060 | 118 |
| 27 | 3300046507 | Ga0495606_0015437 | Ga0495606_0015437_2010_2498 | 118 |
| 28 | 3300046512 | Ga0495610_0000003 | Ga0495610_0000003_419601_420089 | 118 |
| 29 | 3300046524 | Ga0495648_0033549 | Ga0495648_0033549_192_680 | 118 |
| 30 | 3300046524 | Ga0495648_0107235 | Ga0495648_0107235_179_667 | 118 |
| 31 | 3300046530 | Ga0495654_0038980 | Ga0495654_0038980_1805_2293 | 118 |
| 32 | 3300046542 | Ga0495597_0005062 | Ga0495597_0005062_3230_3718 | 118 |
| 33 | 3300046558 | Ga0495633_0246580 | Ga0495633_0246580_222_710 | 118 |
| 34 | 3300046616 | Ga0495668_0019170 | Ga0495668_0019170_3404_3892 | 118 |
| 35 | 3300046616 | Ga0495668_0143062 | Ga0495668_0143062_687_1175 | 118 |
| 36 | 3300046665 | Ga0495661_0002158 | Ga0495661_0002158_7361_7849 | 118 |
| 37 | 3300046665 | Ga0495661_0037675 | Ga0495661_0037675_692_1180 | 118 |
| 38 | 3300046692 | Ga0495671_0000001 | Ga0495671_0000001_256090_256578 | 118 |
| 39 | 3300046810 | Ga0495660_0041115 | Ga0495660_0041115_1553_2041 | 118 |
| 40 | 3300047318 | Ga0495636_0068742 | Ga0495636_0068742_975_1463 | 118 |
| 41 | 3300047443 | Ga0495687_029278 | Ga0495687_029278_288_776 | 118 |
| 42 | 3300047446 | Ga0495679_009967 | Ga0495679_009967_2158_2646 | 118 |
| 43 | 3300047469 | Ga0495673_0000100 | Ga0495673_0000100_170045_170533 | 118 |
| 44 | 3300048904 | Ga0496101_0580009 | Ga0496101_0580009_78_566 | 118 |
| 45 | 3300048911 | Ga0496108_0013970 | Ga0496108_0013970_315_803 | 118 |
| 46 | 3300048912 | Ga0496109_0089029 | Ga0496109_0089029_1614_2102 | 118 |
| 47 | 3300048913 | Ga0496110_0070547 | Ga0496110_0070547_2048_2536 | 118 |
| 48 | 3300048917 | Ga0496114_0012788 | Ga0496114_0012788_5740_6228 | 118 |
| 49 | 3300048919 | Ga0496116_0148072 | Ga0496116_0148072_775_1263 | 118 |
| 50 | 3300048922 | Ga0496119_0392834 | Ga0496119_0392834_28_516 | 118 |
| 51 | 3300048923 | Ga0496120_0476488 | Ga0496120_0476488_16_504 | 118 |
| 52 | 3300048925 | Ga0496122_0147189 | Ga0496122_0147189_248_736 | 118 |
| 53 | 3300048926 | Ga0496123_0013346 | Ga0496123_0013346_4444_4932 | 118 |
| 54 | 3300048929 | Ga0496126_0014001 | Ga0496126_0014001_5851_6339 | 118 |
| 55 | 3300050511 | nmdc:mga08y16_27850_c1 | nmdc:mga08y16_27850_c1_5172_5660 | 118 |
| 56 | 3300053125 | Ga0500618_001153 | Ga0500618_001153_10895_11383 | 118 |
| 57 | 3300059641 | Ga0587068_036369 | Ga0587068_036369_165_653 | 118 |
| 58 | 3300059645 | Ga0587076_015332 | Ga0587076_015332_161_649 | 118 |
| 59 | 3300060346 | Ga0587111_0036871 | Ga0587111_0036871_71_559 | 118 |
| 60 | 3300061734 | Ga0530510_0675589 | Ga0530510_0675589_114_602 | 118 |
| 61 | 3300002738 | JGI25154J39366_1000471 | JGI25154J39366_100047110 | 119 |
| 62 | 3300003187 | JGI25151J46595_10015102 | JGI25151J46595_100151023 | 119 |
| 63 | 3300003187 | JGI25151J46595_10043790 | JGI25151J46595_100437903 | 119 |
| 64 | 3300003763 | Ga0055529_1000080 | Ga0055529_100008031 | 119 |
| 65 | 3300003771 | Ga0055526_1002909 | Ga0055526_10029098 | 119 |
| 66 | 3300003781 | Ga0055536_1000020 | Ga0055536_100002028 | 119 |
| 67 | 3300003784 | Ga0055534_1007801 | Ga0055534_10078014 | 119 |
| 68 | 3300005366 | Ga0070659_101390418 | Ga0070659_1013904181 | 119 |
| 69 | 3300006028 | Ga0070717_10054394 | Ga0070717_100543944 | 119 |
| 70 | 3300006358 | Ga0068871_100513976 | Ga0068871_1005139762 | 119 |
| 71 | 3300006946 | Ga0079104_1007537 | Ga0079104_10075373 | 119 |
| 72 | 3300009545 | Ga0105237_10491591 | Ga0105237_104915912 | 119 |
| 73 | 3300010375 | Ga0105239_10448588 | Ga0105239_104485883 | 119 |
| 74 | 3300013297 | Ga0157378_10121654 | Ga0157378_101216544 | 119 |
| 75 | 3300013308 | Ga0157375_10089299 | Ga0157375_100892994 | 119 |
| 76 | 3300014969 | Ga0157376_10065502 | Ga0157376_100655024 | 119 |
| 77 | 3300015261 | Ga0182006_1000026 | Ga0182006_100002681 | 119 |
| 78 | 3300015262 | Ga0182007_10033033 | Ga0182007_100330332 | 119 |
| 79 | 3300015265 | Ga0182005_1000007 | Ga0182005_1000007298 | 119 |
| 80 | 3300017792 | Ga0163161_10045173 | Ga0163161_100451734 | 119 |
| 81 | 3300025233 | Ga0209437_103551 | Ga0209437_1035512 | 119 |
| 82 | 3300025233 | Ga0209437_111870 | Ga0209437_1118702 | 119 |
| 83 | 3300025245 | Ga0207425_1000143 | Ga0207425_100014349 | 119 |
| 84 | 3300025246 | Ga0209646_1000010 | Ga0209646_1000010225 | 119 |
| 85 | 3300025272 | Ga0209455_1000037 | Ga0209455_1000037116 | 119 |
| 86 | 3300025291 | Ga0209675_1001094 | Ga0209675_100109414 | 119 |
| 87 | 3300025292 | Ga0209676_1000066 | Ga0209676_100006643 | 119 |
| 88 | 3300025294 | Ga0209025_1001845 | Ga0209025_100184518 | 119 |
| 89 | 3300025294 | Ga0209025_1006292 | Ga0209025_10062928 | 119 |
| 90 | 3300025295 | Ga0209564_1000009 | Ga0209564_1000009354 | 119 |
| 91 | 3300025295 | Ga0209564_1000033 | Ga0209564_1000033265 | 119 |
| 92 | 3300025297 | Ga0209758_1001766 | Ga0209758_100176619 | 119 |
| 93 | 3300025728 | Ga0207655_1010587 | Ga0207655_10105873 | 119 |
| 94 | 3300025885 | Ga0207653_10094797 | Ga0207653_100947971 | 119 |
| 95 | 3300025914 | Ga0207671_10415996 | Ga0207671_104159962 | 119 |
| 96 | 3300025915 | Ga0207693_10264395 | Ga0207693_102643952 | 119 |
| 97 | 3300025949 | Ga0207667_10310679 | Ga0207667_103106792 | 119 |
| 98 | 3300027111 | Ga0209281_1012000 | Ga0209281_10120004 | 119 |
| 99 | 3300028653 | Ga0265323_10063812 | Ga0265323_100638122 | 119 |
| 100 | 3300030731 | Ga0316177_1082218 | Ga0316177_10822182 | 119 |
| 101 | 3300030744 | Ga0316181_1149069 | Ga0316181_11490692 | 119 |
| 102 | 3300030745 | Ga0316182_1388674 | Ga0316182_13886742 | 119 |
| 103 | 3300031711 | Ga0265314_10016544 | Ga0265314_100165446 | 119 |
| 104 | 3300032004 | Ga0307414_10030059 | Ga0307414_100300594 | 119 |
| 105 | 3300035114 | Ga0373939_0003438 | Ga0373939_0003438_2823_3311 | 119 |
| 106 | 3300038443 | Ga0395901_0156195 | Ga0395901_0156195_584_1072 | 119 |
| 107 | 3300039447 | Ga0436361_0344944 | Ga0436361_0344944_1352_1840 | 119 |
| 108 | 3300039447 | Ga0436361_1195038 | Ga0436361_1195038_107_595 | 119 |
| 109 | 3300042876 | Ga0451577_0093859 | Ga0451577_0093859_724_1212 | 119 |
| 110 | 3300044712 | Ga0453684_0006085 | Ga0453684_0006085_11297_11785 | 119 |
| 111 | 3300044712 | Ga0453684_1522500 | Ga0453684_1522500_167_652 | 119 |
| 112 | 3300044901 | Ga0466960_0331552 | Ga0466960_0331552_133_621 | 119 |
| 113 | 3300046453 | Ga0495627_000008 | Ga0495627_000008_515610_516098 | 119 |
| 114 | 3300046457 | Ga0495590_0000089 | Ga0495590_0000089_1885_2373 | 119 |
| 115 | 3300046460 | Ga0495638_0000329 | Ga0495638_0000329_1933_2421 | 119 |
| 116 | 3300046460 | Ga0495638_0130847 | Ga0495638_0130847_522_1010 | 119 |
| 117 | 3300046471 | Ga0495650_0004834 | Ga0495650_0004834_1035_1523 | 119 |
| 118 | 3300046471 | Ga0495650_0005997 | Ga0495650_0005997_1002_1490 | 119 |
| 119 | 3300046471 | Ga0495650_0010456 | Ga0495650_0010456_1937_2425 | 119 |
| 120 | 3300046471 | Ga0495650_0016142 | Ga0495650_0016142_296_784 | 119 |
| 121 | 3300046474 | Ga0495605_0002030 | Ga0495605_0002030_4287_4775 | 119 |
| 122 | 3300046501 | Ga0495607_0012687 | Ga0495607_0012687_1869_2357 | 119 |
| 123 | 3300046501 | Ga0495607_0032811 | Ga0495607_0032811_2569_3057 | 119 |
| 124 | 3300046506 | Ga0495583_0000464 | Ga0495583_0000464_57508_57996 | 119 |
| 125 | 3300046507 | Ga0495606_0000011 | Ga0495606_0000011_26569_27057 | 119 |
| 126 | 3300046507 | Ga0495606_0000064 | Ga0495606_0000064_179758_180246 | 119 |
| 127 | 3300046507 | Ga0495606_0008212 | Ga0495606_0008212_385_873 | 119 |
| 128 | 3300046507 | Ga0495606_0015425 | Ga0495606_0015425_1919_2407 | 119 |
| 129 | 3300046507 | Ga0495606_0024643 | Ga0495606_0024643_3208_3696 | 119 |
| 130 | 3300046512 | Ga0495610_0020763 | Ga0495610_0020763_1247_1735 | 119 |
| 131 | 3300046512 | Ga0495610_0030292 | Ga0495610_0030292_2193_2681 | 119 |
| 132 | 3300046520 | Ga0495637_0164188 | Ga0495637_0164188_56_544 | 119 |
| 133 | 3300046522 | Ga0495643_0006906 | Ga0495643_0006906_3383_3871 | 119 |
| 134 | 3300046522 | Ga0495643_0028163 | Ga0495643_0028163_2602_3090 | 119 |
| 135 | 3300046524 | Ga0495648_0000001 | Ga0495648_0000001_6701_7189 | 119 |
| 136 | 3300046524 | Ga0495648_0065957 | Ga0495648_0065957_1567_2055 | 119 |
| 137 | 3300046528 | Ga0495642_0007721 | Ga0495642_0007721_817_1305 | 119 |
| 138 | 3300046538 | Ga0495609_0019147 | Ga0495609_0019147_736_1224 | 119 |
| 139 | 3300046557 | Ga0495622_0000068 | Ga0495622_0000068_83903_84391 | 119 |
| 140 | 3300046557 | Ga0495622_0006132 | Ga0495622_0006132_1846_2334 | 119 |
| 141 | 3300046558 | Ga0495633_0007375 | Ga0495633_0007375_1495_1983 | 119 |
| 142 | 3300046558 | Ga0495633_0008653 | Ga0495633_0008653_3344_3832 | 119 |
| 143 | 3300046616 | Ga0495668_0001239 | Ga0495668_0001239_21395_21883 | 119 |
| 144 | 3300046616 | Ga0495668_0012767 | Ga0495668_0012767_2825_3313 | 119 |
| 145 | 3300046660 | Ga0495625_0005736 | Ga0495625_0005736_7548_8036 | 119 |
| 146 | 3300046660 | Ga0495625_0008141 | Ga0495625_0008141_1884_2372 | 119 |
| 147 | 3300046660 | Ga0495625_0019712 | Ga0495625_0019712_3275_3763 | 119 |
| 148 | 3300046660 | Ga0495625_0033686 | Ga0495625_0033686_1580_2068 | 119 |
| 149 | 3300046674 | Ga0495588_0335158 | Ga0495588_0335158_242_730 | 119 |
| 150 | 3300046810 | Ga0495660_0011707 | Ga0495660_0011707_1838_2326 | 119 |
| 151 | 3300046810 | Ga0495660_0019417 | Ga0495660_0019417_1637_2125 | 119 |
| 152 | 3300047320 | Ga0495672_0000302 | Ga0495672_0000302_1900_2388 | 119 |
| 153 | 3300047443 | Ga0495687_008955 | Ga0495687_008955_1296_1784 | 119 |
| 154 | 3300047469 | Ga0495673_0000097 | Ga0495673_0000097_3422_3910 | 119 |
| 155 | 3300047472 | Ga0495686_0018201 | Ga0495686_0018201_423_911 | 119 |
| 156 | 3300047472 | Ga0495686_0028559 | Ga0495686_0028559_152_640 | 119 |
| 157 | 3300048907 | Ga0496104_0431437 | Ga0496104_0431437_306_794 | 119 |
| 158 | 3300048910 | Ga0496107_0112465 | Ga0496107_0112465_1304_1792 | 119 |
| 159 | 3300048911 | Ga0496108_0510383 | Ga0496108_0510383_261_749 | 119 |
| 160 | 3300048914 | Ga0496111_0053765 | Ga0496111_0053765_1480_1968 | 119 |
| 161 | 3300048917 | Ga0496114_0013659 | Ga0496114_0013659_4750_5238 | 119 |
| 162 | 3300048928 | Ga0496125_0133305 | Ga0496125_0133305_505_993 | 119 |
| 163 | 3300049130 | Ga0501310_007907 | Ga0501310_007907_131_619 | 119 |
| 164 | 3300049459 | Ga0495678_000128 | Ga0495678_000128_28641_29129 | 119 |
| 165 | 3300049459 | Ga0495678_022689 | Ga0495678_022689_704_1192 | 119 |
| 166 | 3300049459 | Ga0495678_042991 | Ga0495678_042991_158_646 | 119 |
| 167 | 3300049527 | Ga0501311_001467 | Ga0501311_001467_170_658 | 119 |
| 168 | 3300049531 | Ga0501315_049047 | Ga0501315_049047_126_614 | 119 |
| 169 | 3300049538 | Ga0501322_019171 | Ga0501322_019171_46_534 | 119 |
| 170 | 3300049571 | Ga0501034_1413026 | Ga0501034_1413026_31_543 | 119 |
| 171 | 3300049686 | Ga0501257_073175 | Ga0501257_073175_60_548 | 119 |
| 172 | 3300053121 | Ga0500607_194762 | Ga0500607_194762_96_584 | 119 |
| 173 | 3300053145 | Ga0500586_003447 | Ga0500586_003447_518_1006 | 119 |
| 174 | 3300003544 | Ga0007417J51691_1031991 | Ga0007417J51691_103199110 | 120 |
| 175 | 3300003575 | Ga0007409J51694_1013012 | Ga0007409J51694_101301211 | 120 |
| 176 | 3300003577 | Ga0007416J51690_1021228 | Ga0007416J51690_102122811 | 120 |
| 177 | 3300005293 | Ga0065715_10794821 | Ga0065715_107948211 | 120 |
| 178 | 3300005339 | Ga0070660_101289680 | Ga0070660_1012896801 | 120 |
| 179 | 3300005343 | Ga0070687_100371360 | Ga0070687_1003713601 | 120 |
| 180 | 3300005344 | Ga0070661_100028133 | Ga0070661_1000281334 | 120 |
| 181 | 3300005344 | Ga0070661_100305622 | Ga0070661_1003056222 | 120 |
| 182 | 3300005435 | Ga0070714_100224887 | Ga0070714_1002248871 | 120 |
| 183 | 3300005441 | Ga0070700_100563925 | Ga0070700_1005639252 | 120 |
| 184 | 3300005458 | Ga0070681_10022328 | Ga0070681_100223284 | 120 |
| 185 | 3300005458 | Ga0070681_10450812 | Ga0070681_104508121 | 120 |
| 186 | 3300005458 | Ga0070681_10514909 | Ga0070681_105149091 | 120 |
| 187 | 3300005459 | Ga0068867_100205089 | Ga0068867_1002050891 | 120 |
| 188 | 3300005530 | Ga0070679_100035613 | Ga0070679_1000356135 | 120 |
| 189 | 3300005530 | Ga0070679_101156924 | Ga0070679_1011569242 | 120 |
| 190 | 3300005545 | Ga0070695_100315811 | Ga0070695_1003158112 | 120 |
| 191 | 3300005546 | Ga0070696_100018750 | Ga0070696_1000187505 | 120 |
| 192 | 3300005564 | Ga0070664_100073941 | Ga0070664_1000739414 | 120 |
| 193 | 3300005578 | Ga0068854_100140020 | Ga0068854_1001400202 | 120 |
| 194 | 3300005614 | Ga0068856_100119425 | Ga0068856_1001194252 | 120 |
| 195 | 3300005614 | Ga0068856_100481112 | Ga0068856_1004811121 | 120 |
| 196 | 3300005719 | Ga0068861_100158341 | Ga0068861_1001583414 | 120 |
| 197 | 3300005840 | Ga0068870_10635525 | Ga0068870_106355252 | 120 |
| 198 | 3300005843 | Ga0068860_101103828 | Ga0068860_1011038282 | 120 |
| 199 | 3300005844 | Ga0068862_100655855 | Ga0068862_1006558552 | 120 |
| 200 | 3300006195 | Ga0075366_10000047 | Ga0075366_1000004730 | 120 |
| 201 | 3300009093 | Ga0105240_10243610 | Ga0105240_102436101 | 120 |
| 202 | 3300009094 | Ga0111539_10016757 | Ga0111539_100167576 | 120 |
| 203 | 3300009148 | Ga0105243_10428772 | Ga0105243_104287721 | 120 |
| 204 | 3300009174 | Ga0105241_10758448 | Ga0105241_107584482 | 120 |
| 205 | 3300010375 | Ga0105239_12013156 | Ga0105239_120131561 | 120 |
| 206 | 3300013104 | Ga0157370_10138987 | Ga0157370_101389872 | 120 |
| 207 | 3300013297 | Ga0157378_10327245 | Ga0157378_103272452 | 120 |
| 208 | 3300013307 | Ga0157372_10078030 | Ga0157372_100780304 | 120 |
| 209 | 3300013308 | Ga0157375_10416265 | Ga0157375_104162652 | 120 |
| 210 | 3300025912 | Ga0207707_10090993 | Ga0207707_100909932 | 120 |
| 211 | 3300025913 | Ga0207695_10172205 | Ga0207695_101722051 | 120 |
| 212 | 3300025920 | Ga0207649_10025257 | Ga0207649_100252572 | 120 |
| 213 | 3300025921 | Ga0207652_10066192 | Ga0207652_100661924 | 120 |
| 214 | 3300025929 | Ga0207664_10215663 | Ga0207664_102156633 | 120 |
| 215 | 3300025933 | Ga0207706_10580012 | Ga0207706_105800121 | 120 |
| 216 | 3300025945 | Ga0207679_10441467 | Ga0207679_104414672 | 120 |
| 217 | 3300026078 | Ga0207702_10173702 | Ga0207702_101737022 | 120 |
| 218 | 3300026089 | Ga0207648_10592460 | Ga0207648_105924602 | 120 |
| 219 | 3300027360 | Ga0209969_1004991 | Ga0209969_10049912 | 120 |
| 220 | 3300027876 | Ga0209974_10053467 | Ga0209974_100534672 | 120 |
| 221 | 3300027907 | Ga0207428_10050071 | Ga0207428_100500713 | 120 |
| 222 | 3300029957 | Ga0265324_10000006 | Ga0265324_10000006123 | 120 |
| 223 | 3300029957 | Ga0265324_10000180 | Ga0265324_1000018032 | 120 |
| 224 | 3300029957 | Ga0265324_10016237 | Ga0265324_100162374 | 120 |
| 225 | 3300031241 | Ga0265325_10000110 | Ga0265325_1000011012 | 120 |
| 226 | 3300031241 | Ga0265325_10023232 | Ga0265325_100232322 | 120 |
| 227 | 3300031250 | Ga0265331_10051752 | Ga0265331_100517523 | 120 |
| 228 | 3300031250 | Ga0265331_10257198 | Ga0265331_102571981 | 120 |
| 229 | 3300031344 | Ga0265316_10038264 | Ga0265316_100382643 | 120 |
| 230 | 3300031344 | Ga0265316_10069121 | Ga0265316_100691212 | 120 |
| 231 | 3300031344 | Ga0265316_10119684 | Ga0265316_101196844 | 120 |
| 232 | 3300031344 | Ga0265316_10288588 | Ga0265316_102885882 | 120 |
| 233 | 3300031548 | Ga0307408_100774566 | Ga0307408_1007745662 | 120 |
| 234 | 3300031665 | Ga0316575_10000032 | Ga0316575_1000003223 | 120 |
| 235 | 3300031711 | Ga0265314_10000397 | Ga0265314_1000039748 | 120 |
| 236 | 3300031711 | Ga0265314_10009646 | Ga0265314_100096464 | 120 |
| 237 | 3300031727 | Ga0316576_10607811 | Ga0316576_106078112 | 120 |
| 238 | 3300032133 | Ga0316583_10021856 | Ga0316583_100218563 | 120 |
| 239 | 3300032133 | Ga0316583_10082050 | Ga0316583_100820502 | 120 |
| 240 | 3300035083 | Ga0373926_0072586 | Ga0373926_0072586_106_594 | 120 |
| 241 | 3300035084 | Ga0373928_0029931 | Ga0373928_0029931_232_720 | 120 |
| 242 | 3300037471 | Ga0395905_0067029 | Ga0395905_0067029_1028_1516 | 120 |
| 243 | 3300041451 | Ga0451791_1835022 | Ga0451791_1835022_72_560 | 120 |
| 244 | 3300042876 | Ga0451577_0000080 | Ga0451577_0000080_141131_141619 | 120 |
| 245 | 3300044673 | Ga0453683_0000049 | Ga0453683_0000049_141131_141619 | 120 |
| 246 | 3300044712 | Ga0453684_0000286 | Ga0453684_0000286_76416_76904 | 120 |
| 247 | 3300044712 | Ga0453684_0003300 | Ga0453684_0003300_16851_17339 | 120 |
| 248 | 3300044712 | Ga0453684_0086624 | Ga0453684_0086624_2681_3169 | 120 |
| 249 | 3300045051 | Ga0451576_0000034 | Ga0451576_0000034_245265_245753 | 120 |
| 250 | 3300045051 | Ga0451576_0000102 | Ga0451576_0000102_141131_141619 | 120 |
| 251 | 3300045051 | Ga0451576_0376837 | Ga0451576_0376837_391_879 | 120 |
| 252 | 3300045051 | Ga0451576_1279952 | Ga0451576_1279952_23_511 | 120 |
| 253 | 3300045051 | Ga0451576_1431499 | Ga0451576_1431499_148_648 | 120 |
| 254 | 3300048910 | Ga0496107_0691015 | Ga0496107_0691015_235_723 | 120 |
| 255 | 3300048913 | Ga0496110_0271182 | Ga0496110_0271182_955_1443 | 120 |
| 256 | 3300048914 | Ga0496111_0274884 | Ga0496111_0274884_594_1082 | 120 |
| 257 | 3300048929 | Ga0496126_0143238 | Ga0496126_0143238_1019_1510 | 120 |
| 258 | 3300049568 | Ga0501031_0027721 | Ga0501031_0027721_2850_3338 | 120 |
| 259 | 3300049569 | Ga0501032_0010188 | Ga0501032_0010188_4854_5342 | 120 |
| 260 | 3300049570 | Ga0501033_0040060 | Ga0501033_0040060_889_1377 | 120 |
| 261 | 3300049571 | Ga0501034_0005376 | Ga0501034_0005376_9893_10381 | 120 |
| 262 | 3300049571 | Ga0501034_0126349 | Ga0501034_0126349_889_1377 | 120 |
| 263 | 3300049572 | Ga0501036_0058733 | Ga0501036_0058733_1384_1872 | 120 |
| 264 | 3300049572 | Ga0501036_0117448 | Ga0501036_0117448_227_715 | 120 |
| 265 | 3300049573 | Ga0501037_0001887 | Ga0501037_0001887_336_824 | 120 |
| 266 | 3300049573 | Ga0501037_0004664 | Ga0501037_0004664_3768_4256 | 120 |
| 267 | 3300049573 | Ga0501037_0033043 | Ga0501037_0033043_1883_2371 | 120 |
| 268 | 3300049574 | Ga0501038_0003864 | Ga0501038_0003864_3640_4128 | 120 |
| 269 | 3300049574 | Ga0501038_0020288 | Ga0501038_0020288_277_765 | 120 |
| 270 | 3300049574 | Ga0501038_0030062 | Ga0501038_0030062_2212_2700 | 120 |
| 271 | 3300049575 | Ga0501039_0003351 | Ga0501039_0003351_4015_4503 | 120 |
| 272 | 3300049575 | Ga0501039_0129507 | Ga0501039_0129507_62_550 | 120 |
| 273 | 3300049575 | Ga0501039_0157378 | Ga0501039_0157378_657_1145 | 120 |
| 274 | 3300049578 | Ga0501042_1263259 | Ga0501042_1263259_11_499 | 120 |
| 275 | 3300049579 | Ga0501043_0007959 | Ga0501043_0007959_2076_2564 | 120 |
| 276 | 3300049579 | Ga0501043_0340272 | Ga0501043_0340272_272_784 | 120 |
| 277 | 3300049580 | Ga0501046_0409791 | Ga0501046_0409791_198_686 | 120 |
| 278 | 3300049581 | Ga0501047_0034967 | Ga0501047_0034967_597_1085 | 120 |
| 279 | 3300049581 | Ga0501047_0226504 | Ga0501047_0226504_780_1268 | 120 |
| 280 | 3300049584 | Ga0501068_0181508 | Ga0501068_0181508_55_543 | 120 |
| 281 | 3300049586 | Ga0501070_0024315 | Ga0501070_0024315_3561_4049 | 120 |
| 282 | 3300049586 | Ga0501070_0032902 | Ga0501070_0032902_1669_2157 | 120 |
| 283 | 3300049588 | Ga0501072_0178723 | Ga0501072_0178723_300_788 | 120 |
| 284 | 3300049589 | Ga0501073_0061269 | Ga0501073_0061269_597_1085 | 120 |
| 285 | 3300049589 | Ga0501073_0253991 | Ga0501073_0253991_25_513 | 120 |
| 286 | 3300049590 | Ga0501074_0004026 | Ga0501074_0004026_6310_6798 | 120 |
| 287 | 3300049590 | Ga0501074_0016929 | Ga0501074_0016929_3190_3678 | 120 |
| 288 | 3300049591 | Ga0501075_0044860 | Ga0501075_0044860_1730_2218 | 120 |
| 289 | 3300049656 | Ga0501209_000841 | Ga0501209_000841_1516_2007 | 120 |
| 290 | 3300049742 | Ga0501080_0004472 | Ga0501080_0004472_3939_4427 | 120 |
| 291 | 3300049742 | Ga0501080_0057515 | Ga0501080_0057515_1884_2372 | 120 |
| 292 | 3300049742 | Ga0501080_0676748 | Ga0501080_0676748_31_543 | 120 |
| 293 | 3300049776 | Ga0501280_000570 | Ga0501280_000570_3954_4442 | 120 |
| 294 | 3300049823 | Ga0501044_0015304 | Ga0501044_0015304_170_658 | 120 |
| 295 | 3300050493 | nmdc:mga0k408_1337_c1 | nmdc:mga0k408_1337_c1_10956_11444 | 120 |
| 296 | 3300050511 | nmdc:mga08y16_15466_c1 | nmdc:mga08y16_15466_c1_4794_5282 | 120 |
| 297 | 3300060353 | Ga0501082_0041092 | Ga0501082_0041092_3376_3864 | 120 |
| 298 | 3300005293 | Ga0065715_10104050 | Ga0065715_101040503 | 121 |
| 299 | 3300005293 | Ga0065715_10329917 | Ga0065715_103299171 | 121 |
| 300 | 3300005327 | Ga0070658_10049961 | Ga0070658_100499614 | 121 |
| 301 | 3300005327 | Ga0070658_10055388 | Ga0070658_100553883 | 121 |
| 302 | 3300005327 | Ga0070658_10388004 | Ga0070658_103880041 | 121 |
| 303 | 3300005328 | Ga0070676_10001342 | Ga0070676_100013427 | 121 |
| 304 | 3300005328 | Ga0070676_10088682 | Ga0070676_100886823 | 121 |
| 305 | 3300005329 | Ga0070683_100212333 | Ga0070683_1002123332 | 121 |
| 306 | 3300005330 | Ga0070690_100030238 | Ga0070690_1000302382 | 121 |
| 307 | 3300005331 | Ga0070670_100048959 | Ga0070670_1000489592 | 121 |
| 308 | 3300005331 | Ga0070670_100289798 | Ga0070670_1002897982 | 121 |
| 309 | 3300005331 | Ga0070670_100816162 | Ga0070670_1008161622 | 121 |
| 310 | 3300005334 | Ga0068869_100001218 | Ga0068869_1000012187 | 121 |
| 311 | 3300005335 | Ga0070666_10000716 | Ga0070666_1000071615 | 121 |
| 312 | 3300005336 | Ga0070680_100277986 | Ga0070680_1002779861 | 121 |
| 313 | 3300005339 | Ga0070660_100010228 | Ga0070660_1000102284 | 121 |
| 314 | 3300005339 | Ga0070660_100306191 | Ga0070660_1003061912 | 121 |
| 315 | 3300005340 | Ga0070689_100571971 | Ga0070689_1005719712 | 121 |
| 316 | 3300005344 | Ga0070661_100010951 | Ga0070661_1000109513 | 121 |
| 317 | 3300005344 | Ga0070661_100019060 | Ga0070661_1000190603 | 121 |
| 318 | 3300005347 | Ga0070668_100003744 | Ga0070668_1000037443 | 121 |
| 319 | 3300005347 | Ga0070668_100028135 | Ga0070668_1000281352 | 121 |
| 320 | 3300005347 | Ga0070668_100037342 | Ga0070668_1000373424 | 121 |
| 321 | 3300005347 | Ga0070668_100061958 | Ga0070668_1000619583 | 121 |
| 322 | 3300005353 | Ga0070669_100011574 | Ga0070669_1000115743 | 121 |
| 323 | 3300005353 | Ga0070669_100269932 | Ga0070669_1002699322 | 121 |
| 324 | 3300005354 | Ga0070675_100016873 | Ga0070675_1000168733 | 121 |
| 325 | 3300005354 | Ga0070675_100041450 | Ga0070675_1000414503 | 121 |
| 326 | 3300005354 | Ga0070675_100084369 | Ga0070675_1000843691 | 121 |
| 327 | 3300005354 | Ga0070675_100203039 | Ga0070675_1002030392 | 121 |
| 328 | 3300005354 | Ga0070675_100400776 | Ga0070675_1004007762 | 121 |
| 329 | 3300005355 | Ga0070671_100036793 | Ga0070671_1000367933 | 121 |
| 330 | 3300005355 | Ga0070671_100312844 | Ga0070671_1003128442 | 121 |
| 331 | 3300005364 | Ga0070673_100052589 | Ga0070673_1000525892 | 121 |
| 332 | 3300005364 | Ga0070673_101534131 | Ga0070673_1015341311 | 121 |
| 333 | 3300005366 | Ga0070659_100033099 | Ga0070659_1000330993 | 121 |
| 334 | 3300005366 | Ga0070659_100089359 | Ga0070659_1000893594 | 121 |
| 335 | 3300005367 | Ga0070667_100075986 | Ga0070667_1000759863 | 121 |
| 336 | 3300005367 | Ga0070667_100275458 | Ga0070667_1002754581 | 121 |
| 337 | 3300005367 | Ga0070667_101135996 | Ga0070667_1011359961 | 121 |
| 338 | 3300005435 | Ga0070714_100171797 | Ga0070714_1001717971 | 121 |
| 339 | 3300005435 | Ga0070714_100244300 | Ga0070714_1002443002 | 121 |
| 340 | 3300005436 | Ga0070713_100000033 | Ga0070713_10000003347 | 121 |
| 341 | 3300005445 | Ga0070708_100355772 | Ga0070708_1003557722 | 121 |
| 342 | 3300005455 | Ga0070663_100333121 | Ga0070663_1003331212 | 121 |
| 343 | 3300005455 | Ga0070663_100628885 | Ga0070663_1006288851 | 121 |
| 344 | 3300005455 | Ga0070663_100690630 | Ga0070663_1006906302 | 121 |
| 345 | 3300005456 | Ga0070678_100030374 | Ga0070678_1000303743 | 121 |
| 346 | 3300005456 | Ga0070678_100139053 | Ga0070678_1001390532 | 121 |
| 347 | 3300005457 | Ga0070662_100330755 | Ga0070662_1003307552 | 121 |
| 348 | 3300005458 | Ga0070681_10371602 | Ga0070681_103716022 | 121 |
| 349 | 3300005459 | Ga0068867_100000669 | Ga0068867_10000066910 | 121 |
| 350 | 3300005459 | Ga0068867_100101746 | Ga0068867_1001017464 | 121 |
| 351 | 3300005459 | Ga0068867_100197805 | Ga0068867_1001978053 | 121 |
| 352 | 3300005530 | Ga0070679_100059722 | Ga0070679_1000597223 | 121 |
| 353 | 3300005535 | Ga0070684_100001976 | Ga0070684_1000019764 | 121 |
| 354 | 3300005535 | Ga0070684_100115845 | Ga0070684_1001158451 | 121 |
| 355 | 3300005539 | Ga0068853_100026172 | Ga0068853_1000261724 | 121 |
| 356 | 3300005539 | Ga0068853_100050746 | Ga0068853_1000507462 | 121 |
| 357 | 3300005539 | Ga0068853_101193537 | Ga0068853_1011935371 | 121 |
| 358 | 3300005543 | Ga0070672_100000521 | Ga0070672_1000005213 | 121 |
| 359 | 3300005543 | Ga0070672_100025883 | Ga0070672_1000258834 | 121 |
| 360 | 3300005543 | Ga0070672_100719780 | Ga0070672_1007197802 | 121 |
| 361 | 3300005548 | Ga0070665_100004881 | Ga0070665_10000488113 | 121 |
| 362 | 3300005548 | Ga0070665_100045852 | Ga0070665_1000458523 | 121 |
| 363 | 3300005564 | Ga0070664_100062550 | Ga0070664_1000625503 | 121 |
| 364 | 3300005577 | Ga0068857_100083605 | Ga0068857_1000836053 | 121 |
| 365 | 3300005577 | Ga0068857_100176712 | Ga0068857_1001767122 | 121 |
| 366 | 3300005578 | Ga0068854_100014738 | Ga0068854_1000147381 | 121 |
| 367 | 3300005578 | Ga0068854_100097843 | Ga0068854_1000978432 | 121 |
| 368 | 3300005614 | Ga0068856_100213613 | Ga0068856_1002136131 | 121 |
| 369 | 3300005615 | Ga0070702_100164891 | Ga0070702_1001648912 | 121 |
| 370 | 3300005616 | Ga0068852_100013125 | Ga0068852_1000131253 | 121 |
| 371 | 3300005616 | Ga0068852_100150988 | Ga0068852_1001509883 | 121 |
| 372 | 3300005617 | Ga0068859_100046678 | Ga0068859_1000466784 | 121 |
| 373 | 3300005617 | Ga0068859_100217762 | Ga0068859_1002177622 | 121 |
| 374 | 3300005618 | Ga0068864_100037394 | Ga0068864_1000373944 | 121 |
| 375 | 3300005618 | Ga0068864_100258956 | Ga0068864_1002589562 | 121 |
| 376 | 3300005719 | Ga0068861_100119862 | Ga0068861_1001198623 | 121 |
| 377 | 3300005719 | Ga0068861_100240492 | Ga0068861_1002404923 | 121 |
| 378 | 3300005834 | Ga0068851_10003430 | Ga0068851_100034303 | 121 |
| 379 | 3300005834 | Ga0068851_10007770 | Ga0068851_100077703 | 121 |
| 380 | 3300005834 | Ga0068851_10045007 | Ga0068851_100450072 | 121 |
| 381 | 3300005841 | Ga0068863_100070031 | Ga0068863_1000700313 | 121 |
| 382 | 3300005841 | Ga0068863_100107206 | Ga0068863_1001072062 | 121 |
| 383 | 3300005841 | Ga0068863_100174846 | Ga0068863_1001748464 | 121 |
| 384 | 3300005841 | Ga0068863_100226395 | Ga0068863_1002263952 | 121 |
| 385 | 3300005841 | Ga0068863_100590479 | Ga0068863_1005904791 | 121 |
| 386 | 3300005842 | Ga0068858_100011950 | Ga0068858_1000119508 | 121 |
| 387 | 3300005843 | Ga0068860_100001951 | Ga0068860_1000019515 | 121 |
| 388 | 3300005843 | Ga0068860_100015231 | Ga0068860_1000152312 | 121 |
| 389 | 3300005843 | Ga0068860_100038331 | Ga0068860_1000383313 | 121 |
| 390 | 3300005844 | Ga0068862_100015315 | Ga0068862_1000153152 | 121 |
| 391 | 3300005844 | Ga0068862_100034893 | Ga0068862_1000348934 | 121 |
| 392 | 3300005844 | Ga0068862_101384102 | Ga0068862_1013841022 | 121 |
| 393 | 3300006048 | Ga0075363_100559376 | Ga0075363_1005593762 | 121 |
| 394 | 3300006175 | Ga0070712_100229400 | Ga0070712_1002294002 | 121 |
| 395 | 3300006195 | Ga0075366_10101600 | Ga0075366_101016002 | 121 |
| 396 | 3300006237 | Ga0097621_100003273 | Ga0097621_1000032733 | 121 |
| 397 | 3300006237 | Ga0097621_100491450 | Ga0097621_1004914501 | 121 |
| 398 | 3300006237 | Ga0097621_100808942 | Ga0097621_1008089422 | 121 |
| 399 | 3300006358 | Ga0068871_100016262 | Ga0068871_1000162624 | 121 |
| 400 | 3300006914 | Ga0075436_100207511 | Ga0075436_1002075111 | 121 |
| 401 | 3300006931 | Ga0097620_100046682 | Ga0097620_1000466823 | 121 |
| 402 | 3300006931 | Ga0097620_100217763 | Ga0097620_1002177632 | 121 |
| 403 | 3300009093 | Ga0105240_10268473 | Ga0105240_102684732 | 121 |
| 404 | 3300009094 | Ga0111539_10264223 | Ga0111539_102642232 | 121 |
| 405 | 3300009094 | Ga0111539_10458083 | Ga0111539_104580832 | 121 |
| 406 | 3300009174 | Ga0105241_10108797 | Ga0105241_101087971 | 121 |
| 407 | 3300009177 | Ga0105248_10007274 | Ga0105248_1000727410 | 121 |
| 408 | 3300009177 | Ga0105248_10986077 | Ga0105248_109860772 | 121 |
| 409 | 3300009545 | Ga0105237_10144530 | Ga0105237_101445304 | 121 |
| 410 | 3300009553 | Ga0105249_10233053 | Ga0105249_102330533 | 121 |
| 411 | 3300009553 | Ga0105249_10260886 | Ga0105249_102608862 | 121 |
| 412 | 3300010375 | Ga0105239_10068982 | Ga0105239_100689823 | 121 |
| 413 | 3300011119 | Ga0105246_10479914 | Ga0105246_104799141 | 121 |
| 414 | 3300013100 | Ga0157373_10052383 | Ga0157373_100523833 | 121 |
| 415 | 3300013102 | Ga0157371_10234383 | Ga0157371_102343832 | 121 |
| 416 | 3300013104 | Ga0157370_10075209 | Ga0157370_100752092 | 121 |
| 417 | 3300013104 | Ga0157370_10183411 | Ga0157370_101834113 | 121 |
| 418 | 3300013104 | Ga0157370_10653302 | Ga0157370_106533021 | 121 |
| 419 | 3300013105 | Ga0157369_10374158 | Ga0157369_103741582 | 121 |
| 420 | 3300013105 | Ga0157369_10549255 | Ga0157369_105492552 | 121 |
| 421 | 3300013296 | Ga0157374_10045513 | Ga0157374_100455134 | 121 |
| 422 | 3300013297 | Ga0157378_10129638 | Ga0157378_101296383 | 121 |
| 423 | 3300013297 | Ga0157378_10136183 | Ga0157378_101361832 | 121 |
| 424 | 3300013306 | Ga0163162_10082034 | Ga0163162_100820343 | 121 |
| 425 | 3300013307 | Ga0157372_10067990 | Ga0157372_100679904 | 121 |
| 426 | 3300013307 | Ga0157372_10146322 | Ga0157372_101463222 | 121 |
| 427 | 3300013307 | Ga0157372_10338631 | Ga0157372_103386312 | 121 |
| 428 | 3300013308 | Ga0157375_10294734 | Ga0157375_102947342 | 121 |
| 429 | 3300013308 | Ga0157375_11752086 | Ga0157375_117520862 | 121 |
| 430 | 3300014326 | Ga0157380_10140540 | Ga0157380_101405402 | 121 |
| 431 | 3300014326 | Ga0157380_10284412 | Ga0157380_102844122 | 121 |
| 432 | 3300014968 | Ga0157379_10014702 | Ga0157379_100147025 | 121 |
| 433 | 3300014969 | Ga0157376_10163922 | Ga0157376_101639223 | 121 |
| 434 | 3300017792 | Ga0163161_10690677 | Ga0163161_106906772 | 121 |
| 435 | 3300020070 | Ga0206356_10947281 | Ga0206356_109472813 | 121 |
| 436 | 3300025271 | Ga0207666_1034174 | Ga0207666_10341742 | 121 |
| 437 | 3300025321 | Ga0207656_10020275 | Ga0207656_100202752 | 121 |
| 438 | 3300025321 | Ga0207656_10034153 | Ga0207656_100341533 | 121 |
| 439 | 3300025901 | Ga0207688_10069795 | Ga0207688_100697952 | 121 |
| 440 | 3300025903 | Ga0207680_10078818 | Ga0207680_100788181 | 121 |
| 441 | 3300025903 | Ga0207680_10097346 | Ga0207680_100973462 | 121 |
| 442 | 3300025907 | Ga0207645_10001626 | Ga0207645_1000162611 | 121 |
| 443 | 3300025909 | Ga0207705_10045438 | Ga0207705_100454382 | 121 |
| 444 | 3300025909 | Ga0207705_10109443 | Ga0207705_101094433 | 121 |
| 445 | 3300025909 | Ga0207705_10886852 | Ga0207705_108868521 | 121 |
| 446 | 3300025911 | Ga0207654_10152225 | Ga0207654_101522252 | 121 |
| 447 | 3300025912 | Ga0207707_10002203 | Ga0207707_100022031 | 121 |
| 448 | 3300025914 | Ga0207671_10241137 | Ga0207671_102411372 | 121 |
| 449 | 3300025917 | Ga0207660_10043785 | Ga0207660_100437853 | 121 |
| 450 | 3300025919 | Ga0207657_10001198 | Ga0207657_100011981 | 121 |
| 451 | 3300025920 | Ga0207649_10027706 | Ga0207649_100277063 | 121 |
| 452 | 3300025920 | Ga0207649_10078253 | Ga0207649_100782531 | 121 |
| 453 | 3300025923 | Ga0207681_10025230 | Ga0207681_100252303 | 121 |
| 454 | 3300025923 | Ga0207681_10228713 | Ga0207681_102287132 | 121 |
| 455 | 3300025924 | Ga0207694_10008827 | Ga0207694_100088277 | 121 |
| 456 | 3300025924 | Ga0207694_10259762 | Ga0207694_102597623 | 121 |
| 457 | 3300025925 | Ga0207650_10031328 | Ga0207650_100313283 | 121 |
| 458 | 3300025925 | Ga0207650_10047703 | Ga0207650_100477032 | 121 |
| 459 | 3300025925 | Ga0207650_10119221 | Ga0207650_101192214 | 121 |
| 460 | 3300025925 | Ga0207650_10637739 | Ga0207650_106377392 | 121 |
| 461 | 3300025926 | Ga0207659_10017403 | Ga0207659_100174034 | 121 |
| 462 | 3300025926 | Ga0207659_10038080 | Ga0207659_100380802 | 121 |
| 463 | 3300025926 | Ga0207659_10659837 | Ga0207659_106598372 | 121 |
| 464 | 3300025928 | Ga0207700_10000099 | Ga0207700_1000009946 | 121 |
| 465 | 3300025929 | Ga0207664_10007399 | Ga0207664_100073993 | 121 |
| 466 | 3300025931 | Ga0207644_10118251 | Ga0207644_101182512 | 121 |
| 467 | 3300025932 | Ga0207690_10040293 | Ga0207690_100402933 | 121 |
| 468 | 3300025932 | Ga0207690_10594290 | Ga0207690_105942902 | 121 |
| 469 | 3300025933 | Ga0207706_10216825 | Ga0207706_102168252 | 121 |
| 470 | 3300025937 | Ga0207669_10038059 | Ga0207669_100380594 | 121 |
| 471 | 3300025940 | Ga0207691_10000041 | Ga0207691_1000004132 | 121 |
| 472 | 3300025940 | Ga0207691_10124826 | Ga0207691_101248263 | 121 |
| 473 | 3300025941 | Ga0207711_10054932 | Ga0207711_100549322 | 121 |
| 474 | 3300025942 | Ga0207689_10053519 | Ga0207689_100535194 | 121 |
| 475 | 3300025944 | Ga0207661_10643872 | Ga0207661_106438721 | 121 |
| 476 | 3300025945 | Ga0207679_10115434 | Ga0207679_101154344 | 121 |
| 477 | 3300025945 | Ga0207679_10453106 | Ga0207679_104531062 | 121 |
| 478 | 3300025949 | Ga0207667_10007667 | Ga0207667_1000766714 | 121 |
| 479 | 3300025960 | Ga0207651_10468064 | Ga0207651_104680642 | 121 |
| 480 | 3300025961 | Ga0207712_10534231 | Ga0207712_105342311 | 121 |
| 481 | 3300025972 | Ga0207668_10045971 | Ga0207668_100459712 | 121 |
| 482 | 3300025972 | Ga0207668_10185991 | Ga0207668_101859912 | 121 |
| 483 | 3300025972 | Ga0207668_10643379 | Ga0207668_106433792 | 121 |
| 484 | 3300025981 | Ga0207640_10045512 | Ga0207640_100455122 | 121 |
| 485 | 3300025986 | Ga0207658_10078480 | Ga0207658_100784803 | 121 |
| 486 | 3300025986 | Ga0207658_10316637 | Ga0207658_103166371 | 121 |
| 487 | 3300026023 | Ga0207677_10009713 | Ga0207677_100097136 | 121 |
| 488 | 3300026035 | Ga0207703_10040546 | Ga0207703_100405461 | 121 |
| 489 | 3300026035 | Ga0207703_11679105 | Ga0207703_116791051 | 121 |
| 490 | 3300026041 | Ga0207639_10026255 | Ga0207639_100262553 | 121 |
| 491 | 3300026041 | Ga0207639_10079529 | Ga0207639_100795291 | 121 |
| 492 | 3300026041 | Ga0207639_10145699 | Ga0207639_101456992 | 121 |
| 493 | 3300026067 | Ga0207678_10021176 | Ga0207678_100211763 | 121 |
| 494 | 3300026067 | Ga0207678_10050423 | Ga0207678_100504234 | 121 |
| 495 | 3300026067 | Ga0207678_10121481 | Ga0207678_101214812 | 121 |
| 496 | 3300026067 | Ga0207678_10766079 | Ga0207678_107660792 | 121 |
| 497 | 3300026067 | Ga0207678_10786309 | Ga0207678_107863092 | 121 |
| 498 | 3300026088 | Ga0207641_10181869 | Ga0207641_101818692 | 121 |
| 499 | 3300026088 | Ga0207641_10377625 | Ga0207641_103776252 | 121 |
| 500 | 3300026089 | Ga0207648_10025927 | Ga0207648_100259274 | 121 |
| 501 | 3300026089 | Ga0207648_10025971 | Ga0207648_100259713 | 121 |
| 502 | 3300026089 | Ga0207648_10162793 | Ga0207648_101627933 | 121 |
| 503 | 3300026095 | Ga0207676_10120265 | Ga0207676_101202654 | 121 |
| 504 | 3300026095 | Ga0207676_10187229 | Ga0207676_101872293 | 121 |
| 505 | 3300026116 | Ga0207674_10001773 | Ga0207674_100017731 | 121 |
| 506 | 3300026116 | Ga0207674_10163647 | Ga0207674_101636473 | 121 |
| 507 | 3300026118 | Ga0207675_100183941 | Ga0207675_1001839412 | 121 |
| 508 | 3300026121 | Ga0207683_10000011 | Ga0207683_1000001185 | 121 |
| 509 | 3300026121 | Ga0207683_10095896 | Ga0207683_100958962 | 121 |
| 510 | 3300026142 | Ga0207698_10007538 | Ga0207698_100075384 | 121 |
| 511 | 3300026142 | Ga0207698_11148708 | Ga0207698_111487082 | 121 |
| 512 | 3300028379 | Ga0268266_10069497 | Ga0268266_100694974 | 121 |
| 513 | 3300028381 | Ga0268264_10023348 | Ga0268264_100233482 | 121 |
| 514 | 3300028794 | Ga0307515_10235834 | Ga0307515_102358342 | 121 |
| 515 | 3300031239 | Ga0265328_10000001 | Ga0265328_10000001100 | 121 |
| 516 | 3300031548 | Ga0307408_100254986 | Ga0307408_1002549861 | 121 |
| 517 | 3300031730 | Ga0307516_10399959 | Ga0307516_103999592 | 121 |
| 518 | 3300031911 | Ga0307412_10410005 | Ga0307412_104100052 | 121 |
| 519 | 3300031911 | Ga0307412_11013948 | Ga0307412_110139482 | 121 |
| 520 | 3300031911 | Ga0307412_11594645 | Ga0307412_115946451 | 121 |
| 521 | 3300032002 | Ga0307416_100501394 | Ga0307416_1005013942 | 121 |
| 522 | 3300038726 | Ga0400490_47983 | Ga0400490_47983_2779_3270 | 121 |
| 523 | 3300041463 | Ga0451804_0427897 | Ga0451804_0427897_121_612 | 121 |
| 524 | 3300044712 | Ga0453684_1317235 | Ga0453684_1317235_195_686 | 121 |
| 525 | 3300048918 | Ga0496115_0484993 | Ga0496115_0484993_226_717 | 121 |
| 526 | 3300050511 | nmdc:mga08y16_184336_c1 | nmdc:mga08y16_184336_c1_446_937 | 121 |
| 527 | 3300050511 | nmdc:mga08y16_195903_c1 | nmdc:mga08y16_195903_c1_678_1169 | 121 |
| 528 | 3300050511 | nmdc:mga08y16_775554_c1 | nmdc:mga08y16_775554_c1_167_670 | 121 |
| 529 | 3300050512 | nmdc:mga0n895_145007_c1 | nmdc:mga0n895_145007_c1_719_1210 | 121 |
| 530 | 3300053156 | Ga0500622_0000002 | Ga0500622_0000002_570893_571384 | 121 |
| 531 | 3300005336 | Ga0070680_100670820 | Ga0070680_1006708202 | 122 |
| 532 | 3300005344 | Ga0070661_100009048 | Ga0070661_1000090484 | 122 |
| 533 | 3300005347 | Ga0070668_100515703 | Ga0070668_1005157032 | 122 |
| 534 | 3300005354 | Ga0070675_100577173 | Ga0070675_1005771732 | 122 |
| 535 | 3300005364 | Ga0070673_100009031 | Ga0070673_1000090314 | 122 |
| 536 | 3300005455 | Ga0070663_100006826 | Ga0070663_1000068266 | 122 |
| 537 | 3300005457 | Ga0070662_100001307 | Ga0070662_10000130710 | 122 |
| 538 | 3300005467 | Ga0070706_100242027 | Ga0070706_1002420273 | 122 |
| 539 | 3300005539 | Ga0068853_100014825 | Ga0068853_1000148256 | 122 |
| 540 | 3300005563 | Ga0068855_100001489 | Ga0068855_10000148915 | 122 |
| 541 | 3300005564 | Ga0070664_100068301 | Ga0070664_1000683012 | 122 |
| 542 | 3300005614 | Ga0068856_100001071 | Ga0068856_1000010712 | 122 |
| 543 | 3300006880 | Ga0075429_100633405 | Ga0075429_1006334052 | 122 |
| 544 | 3300009545 | Ga0105237_11097989 | Ga0105237_110979892 | 122 |
| 545 | 3300013100 | Ga0157373_10025194 | Ga0157373_100251941 | 122 |
| 546 | 3300013102 | Ga0157371_10000681 | Ga0157371_100006813 | 122 |
| 547 | 3300013307 | Ga0157372_10019800 | Ga0157372_100198007 | 122 |
| 548 | 3300025910 | Ga0207684_10575384 | Ga0207684_105753842 | 122 |
| 549 | 3300025912 | Ga0207707_10077641 | Ga0207707_100776414 | 122 |
| 550 | 3300025917 | Ga0207660_10404292 | Ga0207660_104042922 | 122 |
| 551 | 3300025919 | Ga0207657_10000371 | Ga0207657_100003713 | 122 |
| 552 | 3300025919 | Ga0207657_10280122 | Ga0207657_102801222 | 122 |
| 553 | 3300025920 | Ga0207649_10144550 | Ga0207649_101445502 | 122 |
| 554 | 3300025926 | Ga0207659_10362039 | Ga0207659_103620392 | 122 |
| 555 | 3300025933 | Ga0207706_10000179 | Ga0207706_1000017932 | 122 |
| 556 | 3300025945 | Ga0207679_10569974 | Ga0207679_105699742 | 122 |
| 557 | 3300025949 | Ga0207667_10093363 | Ga0207667_100933633 | 122 |
| 558 | 3300025981 | Ga0207640_10024147 | Ga0207640_100241473 | 122 |
| 559 | 3300026041 | Ga0207639_10170133 | Ga0207639_101701332 | 122 |
| 560 | 3300026078 | Ga0207702_10000997 | Ga0207702_1000099724 | 122 |
| 561 | 3300031548 | Ga0307408_100133369 | Ga0307408_1001333692 | 122 |
| 562 | 3300031731 | Ga0307405_10003332 | Ga0307405_100033324 | 122 |
| 563 | 3300031824 | Ga0307413_10002017 | Ga0307413_100020175 | 122 |
| 564 | 3300031852 | Ga0307410_10202752 | Ga0307410_102027522 | 122 |
| 565 | 3300031901 | Ga0307406_10172291 | Ga0307406_101722912 | 122 |
| 566 | 3300031911 | Ga0307412_10053323 | Ga0307412_100533234 | 122 |
| 567 | 3300031995 | Ga0307409_100258470 | Ga0307409_1002584702 | 122 |
| 568 | 3300032002 | Ga0307416_100035982 | Ga0307416_1000359823 | 122 |
| 569 | 3300032005 | Ga0307411_10018632 | Ga0307411_100186325 | 122 |
| 570 | 3300032126 | Ga0307415_100025599 | Ga0307415_1000255993 | 122 |
| 571 | 3300041456 | Ga0451795_1551090 | Ga0451795_1551090_121_621 | 122 |
| 572 | 3300045836 | Ga0466958_0437195 | Ga0466958_0437195_252_764 | 122 |
| 573 | 3300048904 | Ga0496101_0074089 | Ga0496101_0074089_1841_2338 | 122 |
| 574 | 3300048905 | Ga0496102_0001475 | Ga0496102_0001475_14189_14686 | 122 |
| 575 | 3300048909 | Ga0496106_0002475 | Ga0496106_0002475_6076_6573 | 122 |
| 576 | 3300050508 | nmdc:mga09592_598217_c1 | nmdc:mga09592_598217_c1_371_868 | 122 |
| 577 | 3300002704 | JGI25155J39150_1000051 | JGI25155J39150_100005155 | 123 |
| 578 | 3300002705 | JGI25156J39149_1000155 | JGI25156J39149_10001551 | 123 |
| 579 | 3300002705 | JGI25156J39149_1000196 | JGI25156J39149_100019627 | 123 |
| 580 | 3300002738 | JGI25154J39366_1000170 | JGI25154J39366_10001701 | 123 |
| 581 | 3300002738 | JGI25154J39366_1000527 | JGI25154J39366_10005274 | 123 |
| 582 | 3300002741 | JGI25157J39369_1000091 | JGI25157J39369_100009155 | 123 |
| 583 | 3300002774 | JGI25150J39212_1012396 | JGI25150J39212_10123962 | 123 |
| 584 | 3300002987 | JGI25159J45721_1000317 | JGI25159J45721_100031724 | 123 |
| 585 | 3300002987 | JGI25159J45721_1000910 | JGI25159J45721_10009104 | 123 |
| 586 | 3300003187 | JGI25151J46595_10016827 | JGI25151J46595_100168273 | 123 |
| 587 | 3300003215 | JGI25153J46596_10093638 | JGI25153J46596_100936381 | 123 |
| 588 | 3300003354 | JGI25160J50197_1000067 | JGI25160J50197_10000676 | 123 |
| 589 | 3300003354 | JGI25160J50197_1047532 | JGI25160J50197_10475322 | 123 |
| 590 | 3300003374 | JGI25161J50226_1000035 | JGI25161J50226_100003527 | 123 |
| 591 | 3300003773 | Ga0055537_1001588 | Ga0055537_10015889 | 123 |
| 592 | 3300003773 | Ga0055537_1002902 | Ga0055537_10029022 | 123 |
| 593 | 3300003775 | Ga0055524_1000006 | Ga0055524_10000068 | 123 |
| 594 | 3300003790 | Ga0055528_1001140 | Ga0055528_10011404 | 123 |
| 595 | 3300003790 | Ga0055528_1001336 | Ga0055528_100133612 | 123 |
| 596 | 3300003791 | Ga0055530_10000154 | Ga0055530_1000015461 | 123 |
| 597 | 3300003791 | Ga0055530_10016037 | Ga0055530_100160372 | 123 |
| 598 | 3300003792 | Ga0055540_1000005 | Ga0055540_1000005304 | 123 |
| 599 | 3300004625 | Ga0055543_1001037 | Ga0055543_100103712 | 123 |
| 600 | 3300005262 | Ga0065165_1054762 | Ga0065165_10547621 | 123 |
| 601 | 3300005262 | Ga0065165_1092771 | Ga0065165_10927711 | 123 |
| 602 | 3300005262 | Ga0065165_1120598 | Ga0065165_11205981 | 123 |
| 603 | 3300005262 | Ga0065165_1128678 | Ga0065165_11286781 | 123 |
| 604 | 3300005288 | Ga0065714_10372924 | Ga0065714_103729241 | 123 |
| 605 | 3300005337 | Ga0070682_100188682 | Ga0070682_1001886822 | 123 |
| 606 | 3300005455 | Ga0070663_100032502 | Ga0070663_1000325024 | 123 |
| 607 | 3300005548 | Ga0070665_100067776 | Ga0070665_1000677764 | 123 |
| 608 | 3300005563 | Ga0068855_100127359 | Ga0068855_1001273592 | 123 |
| 609 | 3300005564 | Ga0070664_100182683 | Ga0070664_1001826832 | 123 |
| 610 | 3300005843 | Ga0068860_100348988 | Ga0068860_1003489883 | 123 |
| 611 | 3300006051 | Ga0075364_10335894 | Ga0075364_103358942 | 123 |
| 612 | 3300006058 | Ga0075432_10013675 | Ga0075432_100136753 | 123 |
| 613 | 3300006177 | Ga0075362_10029314 | Ga0075362_100293142 | 123 |
| 614 | 3300006186 | Ga0075369_10016462 | Ga0075369_100164622 | 123 |
| 615 | 3300006195 | Ga0075366_10041485 | Ga0075366_100414854 | 123 |
| 616 | 3300006195 | Ga0075366_10050146 | Ga0075366_100501463 | 123 |
| 617 | 3300006237 | Ga0097621_100799915 | Ga0097621_1007999152 | 123 |
| 618 | 3300006358 | Ga0068871_100579435 | Ga0068871_1005794352 | 123 |
| 619 | 3300006871 | Ga0075434_100486687 | Ga0075434_1004866872 | 123 |
| 620 | 3300009177 | Ga0105248_10683479 | Ga0105248_106834792 | 123 |
| 621 | 3300013296 | Ga0157374_10663917 | Ga0157374_106639172 | 123 |
| 622 | 3300013306 | Ga0163162_10068551 | Ga0163162_100685513 | 123 |
| 623 | 3300013308 | Ga0157375_10410852 | Ga0157375_104108522 | 123 |
| 624 | 3300025206 | Ga0209435_100062 | Ga0209435_10006227 | 123 |
| 625 | 3300025208 | Ga0209436_112151 | Ga0209436_1121513 | 123 |
| 626 | 3300025245 | Ga0207425_1001034 | Ga0207425_10010344 | 123 |
| 627 | 3300025245 | Ga0207425_1003980 | Ga0207425_10039803 | 123 |
| 628 | 3300025246 | Ga0209646_1000001 | Ga0209646_1000001316 | 123 |
| 629 | 3300025250 | Ga0209026_1000224 | Ga0209026_100022427 | 123 |
| 630 | 3300025256 | Ga0209759_1000013 | Ga0209759_1000013316 | 123 |
| 631 | 3300025258 | Ga0209129_1038406 | Ga0209129_10384062 | 123 |
| 632 | 3300025263 | Ga0209565_1002095 | Ga0209565_10020955 | 123 |
| 633 | 3300025273 | Ga0209673_1000043 | Ga0209673_100004399 | 123 |
| 634 | 3300025284 | Ga0209130_1000241 | Ga0209130_10002416 | 123 |
| 635 | 3300025284 | Ga0209130_1000741 | Ga0209130_10007414 | 123 |
| 636 | 3300025291 | Ga0209675_1001429 | Ga0209675_10014294 | 123 |
| 637 | 3300025291 | Ga0209675_1051093 | Ga0209675_10510932 | 123 |
| 638 | 3300025292 | Ga0209676_1000007 | Ga0209676_1000007395 | 123 |
| 639 | 3300025292 | Ga0209676_1004056 | Ga0209676_10040563 | 123 |
| 640 | 3300025294 | Ga0209025_1002489 | Ga0209025_10024893 | 123 |
| 641 | 3300025294 | Ga0209025_1003025 | Ga0209025_10030256 | 123 |
| 642 | 3300025295 | Ga0209564_1000285 | Ga0209564_100028562 | 123 |
| 643 | 3300025295 | Ga0209564_1000877 | Ga0209564_10008779 | 123 |
| 644 | 3300025295 | Ga0209564_1012207 | Ga0209564_10122073 | 123 |
| 645 | 3300025297 | Ga0209758_1028562 | Ga0209758_10285623 | 123 |
| 646 | 3300025298 | Ga0209050_1000003 | Ga0209050_10000031113 | 123 |
| 647 | 3300025298 | Ga0209050_1010854 | Ga0209050_10108541 | 123 |
| 648 | 3300025298 | Ga0209050_1020223 | Ga0209050_10202234 | 123 |
| 649 | 3300025299 | Ga0209256_1000001 | Ga0209256_10000011120 | 123 |
| 650 | 3300025299 | Ga0209256_1011350 | Ga0209256_10113503 | 123 |
| 651 | 3300025302 | Ga0207426_1000247 | Ga0207426_1000247112 | 123 |
| 652 | 3300025302 | Ga0207426_1004487 | Ga0207426_10044873 | 123 |
| 653 | 3300025303 | Ga0209051_1000003 | Ga0209051_10000031113 | 123 |
| 654 | 3300025304 | Ga0209257_1000020 | Ga0209257_1000020395 | 123 |
| 655 | 3300025304 | Ga0209257_1008893 | Ga0209257_10088933 | 123 |
| 656 | 3300025927 | Ga0207687_10218812 | Ga0207687_102188123 | 123 |
| 657 | 3300025934 | Ga0207686_10079245 | Ga0207686_100792452 | 123 |
| 658 | 3300025941 | Ga0207711_10400165 | Ga0207711_104001652 | 123 |
| 659 | 3300025942 | Ga0207689_10284864 | Ga0207689_102848641 | 123 |
| 660 | 3300026118 | Ga0207675_100377039 | Ga0207675_1003770392 | 123 |
| 661 | 3300031235 | Ga0265330_10102575 | Ga0265330_101025751 | 123 |
| 662 | 3300031250 | Ga0265331_10005458 | Ga0265331_100054585 | 123 |
| 663 | 3300031250 | Ga0265331_10008224 | Ga0265331_100082244 | 123 |
| 664 | 3300031251 | Ga0265327_10000588 | Ga0265327_1000058831 | 123 |
| 665 | 3300031251 | Ga0265327_10045923 | Ga0265327_100459232 | 123 |
| 666 | 3300031456 | Ga0307513_10000054 | Ga0307513_1000005428 | 123 |
| 667 | 3300031548 | Ga0307408_100049572 | Ga0307408_1000495722 | 123 |
| 668 | 3300031711 | Ga0265314_10001258 | Ga0265314_1000125831 | 123 |
| 669 | 3300031712 | Ga0265342_10012278 | Ga0265342_100122782 | 123 |
| 670 | 3300031824 | Ga0307413_10472582 | Ga0307413_104725822 | 123 |
| 671 | 3300036401 | Ga0373937_0588497 | Ga0373937_0588497_300_851 | 123 |
| 672 | 3300037312 | Ga0395899_0001965 | Ga0395899_0001965_6256_6780 | 123 |
| 673 | 3300037312 | Ga0395899_0551156 | Ga0395899_0551156_138_653 | 123 |
| 674 | 3300037418 | Ga0395900_0014339 | Ga0395900_0014339_3443_3958 | 123 |
| 675 | 3300037418 | Ga0395900_0024345 | Ga0395900_0024345_2878_3402 | 123 |
| 676 | 3300037466 | Ga0395898_0009746 | Ga0395898_0009746_3641_4165 | 123 |
| 677 | 3300037466 | Ga0395898_0114968 | Ga0395898_0114968_1410_1925 | 123 |
| 678 | 3300037471 | Ga0395905_0013281 | Ga0395905_0013281_3925_4434 | 123 |
| 679 | 3300037471 | Ga0395905_0013691 | Ga0395905_0013691_2706_3218 | 123 |
| 680 | 3300037471 | Ga0395905_0019556 | Ga0395905_0019556_4337_4855 | 123 |
| 681 | 3300037471 | Ga0395905_0037345 | Ga0395905_0037345_1501_2061 | 123 |
| 682 | 3300037471 | Ga0395905_0138870 | Ga0395905_0138870_1763_2275 | 123 |
| 683 | 3300037471 | Ga0395905_0198815 | Ga0395905_0198815_1165_1680 | 123 |
| 684 | 3300038443 | Ga0395901_0027151 | Ga0395901_0027151_5209_5733 | 123 |
| 685 | 3300038443 | Ga0395901_0048355 | Ga0395901_0048355_3659_4171 | 123 |
| 686 | 3300038443 | Ga0395901_0351426 | Ga0395901_0351426_191_703 | 123 |
| 687 | 3300038443 | Ga0395901_0476816 | Ga0395901_0476816_238_747 | 123 |
| 688 | 3300044656 | Ga0466969_0010029 | Ga0466969_0010029_2584_3096 | 123 |
| 689 | 3300044658 | Ga0466972_0112731 | Ga0466972_0112731_173_685 | 123 |
| 690 | 3300044683 | Ga0466965_0052930 | Ga0466965_0052930_1211_1723 | 123 |
| 691 | 3300044684 | Ga0466966_0019611 | Ga0466966_0019611_2088_2600 | 123 |
| 692 | 3300044765 | Ga0466970_0180016 | Ga0466970_0180016_286_798 | 123 |
| 693 | 3300044901 | Ga0466960_0041746 | Ga0466960_0041746_191_703 | 123 |
| 694 | 3300045049 | Ga0466959_0056630 | Ga0466959_0056630_371_883 | 123 |
| 695 | 3300048905 | Ga0496102_0266769 | Ga0496102_0266769_781_1278 | 123 |
| 696 | 3300050489 | nmdc:mga03683_124487_c1 | nmdc:mga03683_124487_c1_351_851 | 123 |
| 697 | 3300050489 | nmdc:mga03683_145006_c1 | nmdc:mga03683_145006_c1_167_667 | 123 |
| 698 | 3300050493 | nmdc:mga0k408_21809_c1 | nmdc:mga0k408_21809_c1_566_1063 | 123 |
| 699 | 3300050493 | nmdc:mga0k408_44254_c1 | nmdc:mga0k408_44254_c1_216_713 | 123 |
| 700 | 3300050516 | nmdc:mga0sz30_22870_c1 | nmdc:mga0sz30_22870_c1_1493_1990 | 123 |
| 701 | 3300053096 | Ga0500641_0014809 | Ga0500641_0014809_1860_2357 | 123 |
| 702 | 3300053098 | Ga0500650_0074263 | Ga0500650_0074263_247_744 | 123 |
| 703 | 3300053117 | Ga0500593_006380 | Ga0500593_006380_1550_2047 | 123 |
| 704 | 3300053129 | Ga0500628_017355 | Ga0500628_017355_344_841 | 123 |
| 705 | 3300053151 | Ga0500604_0033057 | Ga0500604_0033057_720_1232 | 123 |
| 706 | 3300053158 | Ga0500627_0255996 | Ga0500627_0255996_153_650 | 123 |
| 707 | 3300053730 | Ga0500645_001223 | Ga0500645_001223_12893_13393 | 123 |
| 708 | 3300053739 | Ga0500587_027065 | Ga0500587_027065_169_666 | 123 |
| 709 | 3300055283 | Ga0500661_045973 | Ga0500661_045973_127_624 | 123 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar