F476662

General Info

Members Datasets Scaffolds Average Seq Length
709 365 709 130

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0588497|Ga0373937_0588497_300_851
Length 152
Sequence MRPTADSPHGYLHVGAEAAPMVERLREFFKTFLLIELLKGMAVTGRYLFARKITVQYPEEHTPQSARFRGLHALRRYPNGEERCIACKLCEAVCPALAITIESEQREDETRILEYHGEKRSDLHYTKEMLLAVGDRYEAEIARDRASDAAYR

Samples

Sample ID Description Type Environment
1 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
118 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
119 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
123 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
129 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
130 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
198 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
206 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
207 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
208 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
209 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
210 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
211 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
212 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
213 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
219 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
220 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
221 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
234 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
235 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
236 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
237 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
240 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
246 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
247 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
248 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
249 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
252 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
253 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
254 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
255 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
258 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
263 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
264 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
265 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
268 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
269 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
270 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
271 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
272 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
273 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
274 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
275 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
276 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
277 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
278 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
279 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
280 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
281 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
282 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
285 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
286 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
287 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
288 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
289 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
290 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
291 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
292 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
293 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
294 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
307 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
308 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
311 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
315 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
331 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
332 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
336 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
337 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
338 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
339 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
340 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
341 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
342 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
348 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
349 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
350 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
351 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
352 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
353 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
354 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
355 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
356 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
357 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
358 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
359 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
360 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
361 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 1.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.12
Nodule 0.28
Rhizoplane 2.96
Rhizosphere 80.11
Stem 0
Stem Tuber 0
Unclassified 3.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000051 3300002704 Bacteria 76772
2 JGI25156J39149_1000155 3300002705 Bacteria 50271
3 JGI25156J39149_1000196 3300002705 Bacteria 42272
4 JGI25154J39366_1000170 3300002738 Bacteria 50275
5 JGI25154J39366_1000471 3300002738 Bacteria 21074
6 JGI25154J39366_1000527 3300002738 Bacteria 19218
7 JGI25157J39369_1000091 3300002741 Bacteria 76837
8 JGI25150J39212_1012396 3300002774 Bacteria 1511
9 JGI25159J45721_1000317 3300002987 Bacteria 22524
10 JGI25159J45721_1000910 3300002987 Bacteria 12859
11 JGI25151J46595_10015102 3300003187 Bacteria 3420
12 JGI25151J46595_10016827 3300003187 Bacteria 3190
13 JGI25151J46595_10043790 3300003187 Bacteria 1597
14 JGI25153J46596_10093638 3300003215 Bacteria 720
15 JGI25160J50197_1000067 3300003354 Bacteria 113436
16 JGI25160J50197_1047532 3300003354 Bacteria 933
17 JGI25161J50226_1000035 3300003374 Bacteria 133666
18 Ga0007417J51691_1031991 3300003544 Bacteria 9194
19 Ga0007409J51694_1013012 3300003575 Bacteria 10513
20 Ga0007416J51690_1021228 3300003577 Bacteria 10458
21 Ga0055529_1000080 3300003763 Bacteria 148614
22 Ga0055526_1002909 3300003771 Bacteria 11254
23 Ga0055537_1001588 3300003773 Bacteria 8587
24 Ga0055537_1002902 3300003773 Bacteria 5475
25 Ga0055524_1000006 3300003775 Bacteria 324702
26 Ga0055536_1000020 3300003781 Bacteria 199649
27 Ga0055534_1007801 3300003784 Bacteria 2498
28 Ga0055528_1001140 3300003790 Bacteria 17289
29 Ga0055528_1001336 3300003790 Bacteria 15343
30 Ga0055530_10000154 3300003791 Bacteria 61878
31 Ga0055530_10016037 3300003791 Bacteria 2413
32 Ga0055540_1000005 3300003792 Bacteria 378126
33 Ga0055543_1001037 3300004625 Bacteria 12358
34 Ga0065165_1054762 3300005262 Bacteria 1116
35 Ga0065165_1092771 3300005262 Bacteria 766
36 Ga0065165_1120598 3300005262 Bacteria 636
37 Ga0065165_1128678 3300005262 Bacteria 607
38 Ga0065714_10372924 3300005288 Bacteria 614
39 Ga0065715_10104050 3300005293 Bacteria 2989
40 Ga0065715_10329917 3300005293 Bacteria 986
41 Ga0065715_10794821 3300005293 Bacteria 612
42 Ga0070658_10049961 3300005327 Bacteria 3389
43 Ga0070658_10055388 3300005327 Bacteria 3222
44 Ga0070658_10388004 3300005327 Bacteria 1199
45 Ga0070676_10001342 3300005328 Bacteria 12362
46 Ga0070676_10088682 3300005328 Bacteria 1890
47 Ga0070683_100212333 3300005329 Bacteria 1839
48 Ga0070690_100030238 3300005330 Bacteria 3364
49 Ga0070670_100048959 3300005331 Bacteria 3636
50 Ga0070670_100289798 3300005331 Bacteria 1430
51 Ga0070670_100816162 3300005331 Bacteria 843
52 Ga0068869_100001218 3300005334 Bacteria 15146
53 Ga0070666_10000716 3300005335 Bacteria 20098
54 Ga0070680_100277986 3300005336 Bacteria 1418
55 Ga0070680_100670820 3300005336 Bacteria 891
56 Ga0070682_100188682 3300005337 Bacteria 1446
57 Ga0070660_100010228 3300005339 Bacteria 6620
58 Ga0070660_100306191 3300005339 Bacteria 1303
59 Ga0070660_101289680 3300005339 Bacteria 620
60 Ga0070689_100571971 3300005340 Bacteria 976
61 Ga0070687_100371360 3300005343 Bacteria 929
62 Ga0070661_100009048 3300005344 Bacteria 6889
63 Ga0070661_100010951 3300005344 Bacteria 6320
64 Ga0070661_100019060 3300005344 Bacteria 4885
65 Ga0070661_100028133 3300005344 Bacteria 4054
66 Ga0070661_100305622 3300005344 Bacteria 1239
67 Ga0070668_100003744 3300005347 Bacteria 11220
68 Ga0070668_100028135 3300005347 Bacteria 4267
69 Ga0070668_100037342 3300005347 Bacteria 3709
70 Ga0070668_100061958 3300005347 Bacteria 2898
71 Ga0070668_100515703 3300005347 Bacteria 1037
72 Ga0070669_100011574 3300005353 Bacteria 6261
73 Ga0070669_100269932 3300005353 Bacteria 1360
74 Ga0070675_100016873 3300005354 Bacteria 5799
75 Ga0070675_100041450 3300005354 Bacteria 3760
76 Ga0070675_100084369 3300005354 Bacteria 2653
77 Ga0070675_100203039 3300005354 Bacteria 1721
78 Ga0070675_100400776 3300005354 Bacteria 1224
79 Ga0070675_100577173 3300005354 Bacteria 1019
80 Ga0070671_100036793 3300005355 Bacteria 4059
81 Ga0070671_100312844 3300005355 Bacteria 1338
82 Ga0070673_100009031 3300005364 Bacteria 6673
83 Ga0070673_100052589 3300005364 Bacteria 3196
84 Ga0070673_101534131 3300005364 Bacteria 629
85 Ga0070659_100033099 3300005366 Bacteria 4013
86 Ga0070659_100089359 3300005366 Bacteria 2468
87 Ga0070659_101390418 3300005366 Bacteria 624
88 Ga0070667_100075986 3300005367 Bacteria 2868
89 Ga0070667_100275458 3300005367 Bacteria 1510
90 Ga0070667_101135996 3300005367 Bacteria 731
91 Ga0070714_100171797 3300005435 Bacteria 1967
92 Ga0070714_100224887 3300005435 Bacteria 1726
93 Ga0070714_100244300 3300005435 Bacteria 1658
94 Ga0070713_100000033 3300005436 Bacteria 86758
95 Ga0070700_100563925 3300005441 Bacteria 887
96 Ga0070708_100355772 3300005445 Bacteria 1380
97 Ga0070663_100006826 3300005455 Bacteria 6904
98 Ga0070663_100032502 3300005455 Bacteria 3597
99 Ga0070663_100333121 3300005455 Bacteria 1224
100 Ga0070663_100628885 3300005455 Bacteria 906
101 Ga0070663_100690630 3300005455 Bacteria 867
102 Ga0070663_101388483 3300005455 Bacteria 622
103 Ga0070678_100030374 3300005456 Bacteria 3714
104 Ga0070678_100139053 3300005456 Bacteria 1940
105 Ga0070662_100001307 3300005457 Bacteria 15307
106 Ga0070662_100330755 3300005457 Bacteria 1245
107 Ga0070681_10022328 3300005458 Bacteria 6354
108 Ga0070681_10371602 3300005458 Bacteria 1340
109 Ga0070681_10450812 3300005458 Bacteria 1199
110 Ga0070681_10514909 3300005458 Bacteria 1110
111 Ga0068867_100000669 3300005459 Bacteria 22732
112 Ga0068867_100101746 3300005459 Bacteria 2195
113 Ga0068867_100197805 3300005459 Bacteria 1607
114 Ga0068867_100205089 3300005459 Bacteria 1580
115 Ga0070706_100242027 3300005467 Bacteria 1685
116 Ga0070679_100035613 3300005530 Bacteria 4939
117 Ga0070679_100059722 3300005530 Bacteria 3800
118 Ga0070679_101156924 3300005530 Bacteria 719
119 Ga0070684_100001976 3300005535 Bacteria 15071
120 Ga0070684_100115845 3300005535 Bacteria 2407
121 Ga0068853_100014825 3300005539 Bacteria 6399
122 Ga0068853_100026172 3300005539 Bacteria 4898
123 Ga0068853_100050746 3300005539 Bacteria 3570
124 Ga0068853_101193537 3300005539 Bacteria 735
125 Ga0070672_100000521 3300005543 Bacteria 22450
126 Ga0070672_100025883 3300005543 Bacteria 4358
127 Ga0070672_100719780 3300005543 Bacteria 875
128 Ga0070695_100315811 3300005545 Bacteria 1160
129 Ga0070696_100018750 3300005546 Bacteria 4680
130 Ga0070665_100004881 3300005548 Bacteria 13927
131 Ga0070665_100045852 3300005548 Bacteria 4390
132 Ga0070665_100067776 3300005548 Bacteria 3578
133 Ga0068855_100001489 3300005563 Bacteria 29301
134 Ga0068855_100127359 3300005563 Bacteria 2910
135 Ga0070664_100062550 3300005564 Bacteria 3173
136 Ga0070664_100068301 3300005564 Bacteria 3038
137 Ga0070664_100073941 3300005564 Bacteria 2924
138 Ga0070664_100182683 3300005564 Bacteria 1865
139 Ga0068857_100083605 3300005577 Bacteria 2852
140 Ga0068857_100176712 3300005577 Bacteria 1942
141 Ga0068854_100014738 3300005578 Bacteria 5160
142 Ga0068854_100097843 3300005578 Bacteria 2194
143 Ga0068854_100140020 3300005578 Bacteria 1856
144 Ga0068856_100001071 3300005614 Bacteria 28975
145 Ga0068856_100119425 3300005614 Bacteria 2637
146 Ga0068856_100213613 3300005614 Bacteria 1944
147 Ga0068856_100481112 3300005614 Bacteria 1263
148 Ga0070702_100164891 3300005615 Bacteria 1436
149 Ga0070702_100741403 3300005615 Bacteria 753
150 Ga0068852_100013125 3300005616 Bacteria 6330
151 Ga0068852_100150988 3300005616 Bacteria 2160
152 Ga0068859_100046678 3300005617 Bacteria 4350
153 Ga0068859_100217762 3300005617 Bacteria 1997
154 Ga0068864_100037394 3300005618 Bacteria 4142
155 Ga0068864_100258956 3300005618 Bacteria 1618
156 Ga0068861_100119862 3300005719 Bacteria 2121
157 Ga0068861_100158341 3300005719 Bacteria 1865
158 Ga0068861_100240492 3300005719 Bacteria 1539
159 Ga0068851_10003430 3300005834 Bacteria 7053
160 Ga0068851_10007770 3300005834 Bacteria 4932
161 Ga0068851_10045007 3300005834 Bacteria 2230
162 Ga0068870_10635525 3300005840 Bacteria 729
163 Ga0068863_100070031 3300005841 Bacteria 3317
164 Ga0068863_100107206 3300005841 Bacteria 2658
165 Ga0068863_100174846 3300005841 Bacteria 2060
166 Ga0068863_100226395 3300005841 Bacteria 1803
167 Ga0068863_100590479 3300005841 Bacteria 1099
168 Ga0068858_100011950 3300005842 Bacteria 8182
169 Ga0068860_100001951 3300005843 Bacteria 21825
170 Ga0068860_100015231 3300005843 Bacteria 7512
171 Ga0068860_100038331 3300005843 Bacteria 4584
172 Ga0068860_100348988 3300005843 Bacteria 1456
173 Ga0068860_101103828 3300005843 Bacteria 813
174 Ga0068862_100015315 3300005844 Bacteria 6367
175 Ga0068862_100034893 3300005844 Bacteria 4258
176 Ga0068862_100655855 3300005844 Bacteria 1013
177 Ga0068862_101384102 3300005844 Bacteria 706
178 Ga0070717_10054394 3300006028 Bacteria 3301
179 Ga0075363_100559376 3300006048 Bacteria 683
180 Ga0075364_10335894 3300006051 Bacteria 1029
181 Ga0075432_10013675 3300006058 Bacteria 2758
182 Ga0070712_100229400 3300006175 Bacteria 1474
183 Ga0075362_10029314 3300006177 Bacteria 2371
184 Ga0075369_10016462 3300006186 Bacteria 2984
185 Ga0075366_10000047 3300006195 Bacteria 43345
186 Ga0075366_10041485 3300006195 Bacteria 2725
187 Ga0075366_10050146 3300006195 Bacteria 2478
188 Ga0075366_10101600 3300006195 Bacteria 1726
189 Ga0097621_100003273 3300006237 Bacteria 11139
190 Ga0097621_100491450 3300006237 Bacteria 1111
191 Ga0097621_100799915 3300006237 Bacteria 874
192 Ga0097621_100808942 3300006237 Bacteria 869
193 Ga0068871_100016262 3300006358 Bacteria 5597
194 Ga0068871_100513976 3300006358 Bacteria 1081
195 Ga0068871_100579435 3300006358 Bacteria 1019
196 Ga0075434_100486687 3300006871 Bacteria 1255
197 Ga0075429_100633405 3300006880 Bacteria 937
198 Ga0075436_100207511 3300006914 Bacteria 1388
199 Ga0097620_100046682 3300006931 Bacteria 4350
200 Ga0097620_100217763 3300006931 Bacteria 1997
201 Ga0079104_1007537 3300006946 Bacteria 3922
202 Ga0105240_10243610 3300009093 Bacteria 2083
203 Ga0105240_10268473 3300009093 Bacteria 1965
204 Ga0111539_10016757 3300009094 Bacteria 9082
205 Ga0111539_10067447 3300009094 Bacteria 4225
206 Ga0111539_10264223 3300009094 Bacteria 2003
207 Ga0111539_10458083 3300009094 Bacteria 1485
208 Ga0105245_10255336 3300009098 Bacteria 1704
209 Ga0105243_10428772 3300009148 Bacteria 1235
210 Ga0105241_10108797 3300009174 Bacteria 2216
211 Ga0105241_10758448 3300009174 Bacteria 890
212 Ga0105248_10007274 3300009177 Bacteria 12143
213 Ga0105248_10683479 3300009177 Bacteria 1158
214 Ga0105248_10986077 3300009177 Bacteria 952
215 Ga0105237_10144530 3300009545 Bacteria 2373
216 Ga0105237_10491591 3300009545 Bacteria 1233
217 Ga0105237_11097989 3300009545 Bacteria 802
218 Ga0105249_10233053 3300009553 Bacteria 1816
219 Ga0105249_10260886 3300009553 Bacteria 1722
220 Ga0105239_10068982 3300010375 Bacteria 3885
221 Ga0105239_10448588 3300010375 Bacteria 1463
222 Ga0105239_12013156 3300010375 Bacteria 670
223 Ga0105246_10229650 3300011119 Bacteria 1460
224 Ga0105246_10479914 3300011119 Bacteria 1051
225 Ga0157373_10025194 3300013100 Bacteria 4305
226 Ga0157373_10052383 3300013100 Bacteria 2904
227 Ga0157371_10000681 3300013102 Bacteria 40170
228 Ga0157371_10234383 3300013102 Bacteria 1320
229 Ga0157370_10075209 3300013104 Bacteria 3185
230 Ga0157370_10138987 3300013104 Bacteria 2263
231 Ga0157370_10183411 3300013104 Bacteria 1944
232 Ga0157370_10653302 3300013104 Bacteria 961
233 Ga0157369_10374158 3300013105 Bacteria 1479
234 Ga0157369_10549255 3300013105 Bacteria 1194
235 Ga0157374_10045513 3300013296 Bacteria 4061
236 Ga0157374_10663917 3300013296 Bacteria 1055
237 Ga0157378_10121654 3300013297 Bacteria 2406
238 Ga0157378_10129638 3300013297 Bacteria 2333
239 Ga0157378_10136183 3300013297 Bacteria 2277
240 Ga0157378_10327245 3300013297 Bacteria 1490
241 Ga0157378_10618284 3300013297 Bacteria 1096
242 Ga0163162_10068551 3300013306 Bacteria 3599
243 Ga0163162_10082034 3300013306 Bacteria 3296
244 Ga0157372_10019800 3300013307 Bacteria 7252
245 Ga0157372_10067990 3300013307 Bacteria 4005
246 Ga0157372_10078030 3300013307 Bacteria 3741
247 Ga0157372_10146322 3300013307 Bacteria 2725
248 Ga0157372_10338631 3300013307 Bacteria 1752
249 Ga0157375_10089299 3300013308 Bacteria 3138
250 Ga0157375_10294734 3300013308 Bacteria 1785
251 Ga0157375_10410852 3300013308 Bacteria 1520
252 Ga0157375_10416265 3300013308 Bacteria 1510
253 Ga0157375_11752086 3300013308 Bacteria 736
254 Ga0157380_10140540 3300014326 Bacteria 2074
255 Ga0157380_10284412 3300014326 Bacteria 1515
256 Ga0157379_10014702 3300014968 Bacteria 6866
257 Ga0157376_10017423 3300014969 Bacteria 5479
258 Ga0157376_10065502 3300014969 Bacteria 3068
259 Ga0157376_10163922 3300014969 Bacteria 2017
260 Ga0182006_1000026 3300015261 Bacteria 253543
261 Ga0182007_10033033 3300015262 Bacteria 1755
262 Ga0182005_1000007 3300015265 Bacteria 490994
263 Ga0163161_10045173 3300017792 Bacteria 3176
264 Ga0163161_10690677 3300017792 Bacteria 849
265 Ga0206356_10947281 3300020070 Bacteria 1852
266 Ga0209435_100062 3300025206 Bacteria 77288
267 Ga0209436_112151 3300025208 Bacteria 1475
268 Ga0209437_103551 3300025233 Bacteria 2806
269 Ga0209437_111870 3300025233 Bacteria 1288
270 Ga0207425_1000143 3300025245 Bacteria 62334
271 Ga0207425_1001034 3300025245 Bacteria 12970
272 Ga0207425_1003980 3300025245 Bacteria 4546
273 Ga0209646_1000001 3300025246 Bacteria 3092932
274 Ga0209646_1000010 3300025246 Bacteria 573803
275 Ga0209026_1000224 3300025250 Bacteria 77298
276 Ga0209759_1000013 3300025256 Bacteria 399300
277 Ga0209129_1038406 3300025258 Bacteria 767
278 Ga0209565_1002095 3300025263 Bacteria 7622
279 Ga0207666_1034174 3300025271 Bacteria 785
280 Ga0209455_1000037 3300025272 Bacteria 464097
281 Ga0209673_1000043 3300025273 Bacteria 291503
282 Ga0209130_1000241 3300025284 Bacteria 70093
283 Ga0209130_1000741 3300025284 Bacteria 28625
284 Ga0209675_1001094 3300025291 Bacteria 16654
285 Ga0209675_1001429 3300025291 Bacteria 13803
286 Ga0209675_1051093 3300025291 Bacteria 853
287 Ga0209676_1000007 3300025292 Bacteria 1029371
288 Ga0209676_1000066 3300025292 Bacteria 317897
289 Ga0209676_1004056 3300025292 Bacteria 8425
290 Ga0209025_1001845 3300025294 Bacteria 24883
291 Ga0209025_1002489 3300025294 Bacteria 19371
292 Ga0209025_1003025 3300025294 Bacteria 16602
293 Ga0209025_1006292 3300025294 Bacteria 9279
294 Ga0209564_1000009 3300025295 Bacteria 950196
295 Ga0209564_1000033 3300025295 Bacteria 446200
296 Ga0209564_1000285 3300025295 Bacteria 102585
297 Ga0209564_1000877 3300025295 Bacteria 40004
298 Ga0209564_1012207 3300025295 Bacteria 3764
299 Ga0209758_1001766 3300025297 Bacteria 23985
300 Ga0209758_1028562 3300025297 Bacteria 2355
301 Ga0209050_1000003 3300025298 Bacteria 1609245
302 Ga0209050_1010854 3300025298 Bacteria 4418
303 Ga0209050_1020223 3300025298 Bacteria 2486
304 Ga0209256_1000001 3300025299 Bacteria 2166974
305 Ga0209256_1011350 3300025299 Bacteria 3574
306 Ga0207426_1000247 3300025302 Bacteria 119659
307 Ga0207426_1004487 3300025302 Bacteria 6769
308 Ga0209051_1000003 3300025303 Bacteria 1609245
309 Ga0209257_1000020 3300025304 Bacteria 773356
310 Ga0209257_1008893 3300025304 Bacteria 5537
311 Ga0207656_10020275 3300025321 Bacteria 2641
312 Ga0207656_10034153 3300025321 Bacteria 2122
313 Ga0207655_1010587 3300025728 Bacteria 5578
314 Ga0207653_10094797 3300025885 Bacteria 1050
315 Ga0207688_10069795 3300025901 Bacteria 1992
316 Ga0207680_10078818 3300025903 Bacteria 2064
317 Ga0207680_10097346 3300025903 Bacteria 1884
318 Ga0207645_10001626 3300025907 Bacteria 18332
319 Ga0207705_10045438 3300025909 Bacteria 3156
320 Ga0207705_10109443 3300025909 Bacteria 2040
321 Ga0207705_10886852 3300025909 Bacteria 691
322 Ga0207684_10575384 3300025910 Bacteria 963
323 Ga0207654_10152225 3300025911 Bacteria 1486
324 Ga0207707_10002203 3300025912 Bacteria 17655
325 Ga0207707_10077641 3300025912 Bacteria 2899
326 Ga0207707_10090993 3300025912 Bacteria 2666
327 Ga0207695_10172205 3300025913 Bacteria 2090
328 Ga0207671_10241137 3300025914 Bacteria 1420
329 Ga0207671_10415996 3300025914 Bacteria 1069
330 Ga0207693_10264395 3300025915 Bacteria 1348
331 Ga0207660_10043785 3300025917 Bacteria 3146
332 Ga0207660_10404292 3300025917 Bacteria 1100
333 Ga0207657_10000371 3300025919 Bacteria 47425
334 Ga0207657_10001198 3300025919 Bacteria 27571
335 Ga0207657_10280122 3300025919 Bacteria 1324
336 Ga0207649_10025257 3300025920 Bacteria 3462
337 Ga0207649_10027706 3300025920 Bacteria 3329
338 Ga0207649_10078253 3300025920 Bacteria 2133
339 Ga0207649_10144550 3300025920 Bacteria 1631
340 Ga0207652_10066192 3300025921 Bacteria 3131
341 Ga0207681_10025230 3300025923 Bacteria 3821
342 Ga0207681_10228713 3300025923 Bacteria 1442
343 Ga0207694_10008827 3300025924 Bacteria 7604
344 Ga0207694_10259762 3300025924 Bacteria 1422
345 Ga0207650_10031328 3300025925 Bacteria 3839
346 Ga0207650_10047703 3300025925 Bacteria 3157
347 Ga0207650_10119221 3300025925 Bacteria 2052
348 Ga0207650_10637739 3300025925 Bacteria 898
349 Ga0207659_10017403 3300025926 Bacteria 4696
350 Ga0207659_10038080 3300025926 Bacteria 3342
351 Ga0207659_10362039 3300025926 Bacteria 1206
352 Ga0207659_10659837 3300025926 Bacteria 894
353 Ga0207687_10218812 3300025927 Bacteria 1498
354 Ga0207700_10000099 3300025928 Bacteria 53179
355 Ga0207664_10007399 3300025929 Bacteria 7613
356 Ga0207664_10215663 3300025929 Bacteria 1662
357 Ga0207644_10118251 3300025931 Bacteria 2014
358 Ga0207690_10040293 3300025932 Bacteria 3053
359 Ga0207690_10594290 3300025932 Bacteria 903
360 Ga0207706_10000179 3300025933 Bacteria 70768
361 Ga0207706_10140078 3300025933 Bacteria 2128
362 Ga0207706_10216825 3300025933 Bacteria 1677
363 Ga0207706_10580012 3300025933 Bacteria 964
364 Ga0207686_10079245 3300025934 Bacteria 2138
365 Ga0207669_10038059 3300025937 Bacteria 2766
366 Ga0207691_10000041 3300025940 Bacteria 106275
367 Ga0207691_10124826 3300025940 Bacteria 2278
368 Ga0207711_10054932 3300025941 Bacteria 3418
369 Ga0207711_10400165 3300025941 Bacteria 1276
370 Ga0207689_10053519 3300025942 Bacteria 3326
371 Ga0207689_10284864 3300025942 Bacteria 1368
372 Ga0207661_10643872 3300025944 Bacteria 974
373 Ga0207679_10115434 3300025945 Bacteria 2127
374 Ga0207679_10441467 3300025945 Bacteria 1152
375 Ga0207679_10453106 3300025945 Bacteria 1138
376 Ga0207679_10569974 3300025945 Bacteria 1017
377 Ga0207667_10007667 3300025949 Bacteria 12923
378 Ga0207667_10093363 3300025949 Bacteria 3107
379 Ga0207667_10310679 3300025949 Bacteria 1610
380 Ga0207651_10468064 3300025960 Bacteria 1084
381 Ga0207712_10534231 3300025961 Bacteria 1007
382 Ga0207668_10045971 3300025972 Bacteria 2980
383 Ga0207668_10185991 3300025972 Bacteria 1642
384 Ga0207668_10643379 3300025972 Bacteria 927
385 Ga0207640_10024147 3300025981 Bacteria 3663
386 Ga0207640_10045512 3300025981 Bacteria 2818
387 Ga0207658_10078480 3300025986 Bacteria 2523
388 Ga0207658_10316637 3300025986 Bacteria 1349
389 Ga0207677_10009713 3300026023 Bacteria 5420
390 Ga0207703_10040546 3300026035 Bacteria 3726
391 Ga0207703_11679105 3300026035 Bacteria 611
392 Ga0207639_10026255 3300026041 Bacteria 4232
393 Ga0207639_10079529 3300026041 Bacteria 2591
394 Ga0207639_10145699 3300026041 Bacteria 1978
395 Ga0207639_10170133 3300026041 Bacteria 1844
396 Ga0207678_10021176 3300026067 Bacteria 5699
397 Ga0207678_10050423 3300026067 Bacteria 3596
398 Ga0207678_10121481 3300026067 Bacteria 2229
399 Ga0207678_10766079 3300026067 Bacteria 851
400 Ga0207678_10786309 3300026067 Bacteria 840
401 Ga0207702_10000997 3300026078 Bacteria 29032
402 Ga0207702_10173702 3300026078 Bacteria 1978
403 Ga0207641_10181869 3300026088 Bacteria 1926
404 Ga0207641_10377625 3300026088 Bacteria 1356
405 Ga0207648_10025927 3300026089 Bacteria 5215
406 Ga0207648_10025971 3300026089 Bacteria 5209
407 Ga0207648_10162793 3300026089 Bacteria 1971
408 Ga0207648_10592460 3300026089 Bacteria 1021
409 Ga0207676_10120265 3300026095 Bacteria 2213
410 Ga0207676_10187229 3300026095 Bacteria 1818
411 Ga0207674_10001773 3300026116 Bacteria 27553
412 Ga0207674_10163647 3300026116 Bacteria 2179
413 Ga0207675_100183941 3300026118 Bacteria 2002
414 Ga0207675_100377039 3300026118 Bacteria 1394
415 Ga0207683_10000011 3300026121 Bacteria 140261
416 Ga0207683_10095896 3300026121 Bacteria 2645
417 Ga0207698_10007538 3300026142 Bacteria 6819
418 Ga0207698_11148708 3300026142 Bacteria 790
419 Ga0209281_1012000 3300027111 Bacteria 1920
420 Ga0209969_1004991 3300027360 Bacteria 1857
421 Ga0209974_10053467 3300027876 Bacteria 1360
422 Ga0207428_10007629 3300027907 Bacteria 9851
423 Ga0207428_10050071 3300027907 Bacteria 3343
424 Ga0268266_10069497 3300028379 Bacteria 3051
425 Ga0268264_10023348 3300028381 Bacteria 5046
426 Ga0265323_10063812 3300028653 Bacteria 1275
427 Ga0307515_10235834 3300028794 Bacteria 1611
428 Ga0265324_10000006 3300029957 Bacteria 267048
429 Ga0265324_10000180 3300029957 Bacteria 48263
430 Ga0265324_10016237 3300029957 Bacteria 2723
431 Ga0316177_1082218 3300030731 Bacteria 1313
432 Ga0316181_1149069 3300030744 Bacteria 1681
433 Ga0316182_1388674 3300030745 Bacteria 1705
434 Ga0265330_10102575 3300031235 Bacteria 1224
435 Ga0265328_10000001 3300031239 Bacteria 371500
436 Ga0265325_10000110 3300031241 Bacteria 56687
437 Ga0265325_10023232 3300031241 Bacteria 3389
438 Ga0265331_10005458 3300031250 Bacteria 7674
439 Ga0265331_10008224 3300031250 Bacteria 5950
440 Ga0265331_10024729 3300031250 Bacteria 3036
441 Ga0265331_10051752 3300031250 Bacteria 1965
442 Ga0265331_10257198 3300031250 Bacteria 783
443 Ga0265327_10000588 3300031251 Bacteria 61029
444 Ga0265327_10045923 3300031251 Bacteria 2317
445 Ga0265316_10038264 3300031344 Bacteria 3866
446 Ga0265316_10069121 3300031344 Bacteria 2726
447 Ga0265316_10119684 3300031344 Bacteria 1989
448 Ga0265316_10288588 3300031344 Bacteria 1197
449 Ga0307513_10000054 3300031456 Bacteria 148887
450 Ga0307509_10000006 3300031507 Bacteria 421538
451 Ga0307408_100049572 3300031548 Bacteria 3016
452 Ga0307408_100133369 3300031548 Bacteria 1940
453 Ga0307408_100254986 3300031548 Bacteria 1449
454 Ga0307408_100774566 3300031548 Bacteria 869
455 Ga0316575_10000032 3300031665 Bacteria 33845
456 Ga0265314_10000397 3300031711 Bacteria 59137
457 Ga0265314_10001258 3300031711 Bacteria 28871
458 Ga0265314_10009646 3300031711 Bacteria 8130
459 Ga0265314_10016544 3300031711 Bacteria 5819
460 Ga0265342_10012278 3300031712 Bacteria 5808
461 Ga0316576_10607811 3300031727 Bacteria 798
462 Ga0307516_10399959 3300031730 Bacteria 1033
463 Ga0307405_10003332 3300031731 Bacteria 7357
464 Ga0307413_10002017 3300031824 Bacteria 8074
465 Ga0307413_10472582 3300031824 Bacteria 1000
466 Ga0307410_10202752 3300031852 Bacteria 1515
467 Ga0307406_10172291 3300031901 Bacteria 1567
468 Ga0307412_10053323 3300031911 Bacteria 2680
469 Ga0307412_10410005 3300031911 Bacteria 1106
470 Ga0307412_11013948 3300031911 Bacteria 734
471 Ga0307412_11594645 3300031911 Bacteria 596
472 Ga0307409_100258470 3300031995 Bacteria 1596
473 Ga0307416_100035982 3300032002 Bacteria 3790
474 Ga0307416_100501394 3300032002 Bacteria 1278
475 Ga0307414_10030059 3300032004 Bacteria 3544
476 Ga0307411_10018632 3300032005 Bacteria 3988
477 Ga0307415_100025599 3300032126 Bacteria 3706
478 Ga0316583_10021856 3300032133 Bacteria 2293
479 Ga0316583_10082050 3300032133 Bacteria 1126
480 Ga0373926_0072586 3300035083 Bacteria 1266
481 Ga0373928_0029931 3300035084 Bacteria 1200
482 Ga0373928_0178783 3300035084 Bacteria 602
483 Ga0373939_0003438 3300035114 Bacteria 3714
484 Ga0373960_0357809 3300035121 Bacteria 555
485 Ga0373937_0588497 3300036401 Bacteria 1056
486 Ga0316584_0055797 3300036712 Bacteria 2958
487 Ga0395899_0001965 3300037312 Bacteria 16903
488 Ga0395899_0551156 3300037312 Bacteria 741
489 Ga0395900_0014339 3300037418 Bacteria 8092
490 Ga0395900_0024345 3300037418 Bacteria 6199
491 Ga0395898_0009746 3300037466 Bacteria 10067
492 Ga0395898_0114968 3300037466 Bacteria 2578
493 Ga0395905_0013281 3300037471 Bacteria 7899
494 Ga0395905_0013691 3300037471 Bacteria 7769
495 Ga0395905_0019556 3300037471 Bacteria 6418
496 Ga0395905_0037345 3300037471 Bacteria 4561
497 Ga0395905_0067029 3300037471 Bacteria 3361
498 Ga0395905_0138870 3300037471 Bacteria 2286
499 Ga0395905_0198815 3300037471 Bacteria 1879
500 Ga0395905_0552492 3300037471 Bacteria 1053
501 Ga0395905_0842224 3300037471 Bacteria 820
502 Ga0395901_0027151 3300038443 Bacteria 5880
503 Ga0395901_0048355 3300038443 Bacteria 4417
504 Ga0395901_0156195 3300038443 Bacteria 2396
505 Ga0395901_0351426 3300038443 Bacteria 1521
506 Ga0395901_0476816 3300038443 Bacteria 1273
507 Ga0400490_47983 3300038726 Bacteria 10023
508 Ga0436361_0344944 3300039447 Bacteria 4344
509 Ga0436361_1195038 3300039447 Bacteria 1308
510 Ga0451791_1835022 3300041451 Bacteria 776
511 Ga0451795_1551090 3300041456 Bacteria 754
512 Ga0451804_0427897 3300041463 Bacteria 848
513 Ga0451577_0000080 3300042876 Bacteria 218034
514 Ga0451577_0093859 3300042876 Bacteria 2680
515 Ga0451577_0305633 3300042876 Bacteria 1441
516 Ga0466969_0010029 3300044656 Bacteria 5022
517 Ga0466972_0112731 3300044658 Bacteria 1284
518 Ga0453683_0000049 3300044673 Bacteria 206697
519 Ga0466965_0052930 3300044683 Bacteria 2017
520 Ga0466966_0019611 3300044684 Bacteria 4449
521 Ga0453684_0000237 3300044712 Bacteria 236999
522 Ga0453684_0000286 3300044712 Bacteria 218034
523 Ga0453684_0003300 3300044712 Bacteria 36795
524 Ga0453684_0006085 3300044712 Bacteria 23282
525 Ga0453684_0086624 3300044712 Bacteria 3886
526 Ga0453684_0366082 3300044712 Bacteria 1622
527 Ga0453684_1317235 3300044712 Bacteria 753
528 Ga0453684_1522500 3300044712 Bacteria 689
529 Ga0466970_0022377 3300044765 Bacteria 3299
530 Ga0466970_0180016 3300044765 Bacteria 1173
531 Ga0466960_0041746 3300044901 Bacteria 2174
532 Ga0466960_0331552 3300044901 Bacteria 864
533 Ga0466959_0056630 3300045049 Bacteria 2860
534 Ga0466959_0084193 3300045049 Bacteria 2289
535 Ga0451576_0000034 3300045051 Bacteria 390778
536 Ga0451576_0000102 3300045051 Bacteria 218034
537 Ga0451576_0376837 3300045051 Bacteria 1487
538 Ga0451576_1279952 3300045051 Bacteria 765
539 Ga0451576_1431499 3300045051 Bacteria 719
540 Ga0466958_0437195 3300045836 Bacteria 847
541 Ga0495617_000037 3300046452 Bacteria 134553
542 Ga0495627_000008 3300046453 Bacteria 572150
543 Ga0495590_0000089 3300046457 Bacteria 57394
544 Ga0495638_0000329 3300046460 Bacteria 60063
545 Ga0495638_0130847 3300046460 Bacteria 1474
546 Ga0495653_0000038 3300046463 Bacteria 120385
547 Ga0495650_0003518 3300046471 Bacteria 11346
548 Ga0495650_0004834 3300046471 Bacteria 9017
549 Ga0495650_0005997 3300046471 Bacteria 7691
550 Ga0495650_0010456 3300046471 Bacteria 5176
551 Ga0495650_0016142 3300046471 Bacteria 3795
552 Ga0495605_0002030 3300046474 Bacteria 12766
553 Ga0495585_0012995 3300046492 Bacteria 4887
554 Ga0495607_0012687 3300046501 Bacteria 5550
555 Ga0495607_0032811 3300046501 Bacteria 3165
556 Ga0495583_0000464 3300046506 Bacteria 59972
557 Ga0495606_0000011 3300046507 Bacteria 296816
558 Ga0495606_0000064 3300046507 Bacteria 183631
559 Ga0495606_0008212 3300046507 Bacteria 9127
560 Ga0495606_0015425 3300046507 Bacteria 5885
561 Ga0495606_0015437 3300046507 Bacteria 5883
562 Ga0495606_0024643 3300046507 Bacteria 4329
563 Ga0495610_0000003 3300046512 Bacteria 1203910
564 Ga0495610_0020763 3300046512 Bacteria 3636
565 Ga0495610_0030292 3300046512 Bacteria 2837
566 Ga0495637_0164188 3300046520 Bacteria 831
567 Ga0495643_0006906 3300046522 Bacteria 7391
568 Ga0495643_0028163 3300046522 Bacteria 3152
569 Ga0495648_0000001 3300046524 Bacteria 696872
570 Ga0495648_0033549 3300046524 Bacteria 3350
571 Ga0495648_0065957 3300046524 Bacteria 2124
572 Ga0495648_0107235 3300046524 Bacteria 1527
573 Ga0495642_0007721 3300046528 Bacteria 4122
574 Ga0495654_0038980 3300046530 Bacteria 2373
575 Ga0495609_0019147 3300046538 Bacteria 3169
576 Ga0495597_0005062 3300046542 Bacteria 7049
577 Ga0495622_0000068 3300046557 Bacteria 90633
578 Ga0495622_0006132 3300046557 Bacteria 5585
579 Ga0495633_0007375 3300046558 Bacteria 6335
580 Ga0495633_0008653 3300046558 Bacteria 5714
581 Ga0495633_0246580 3300046558 Bacteria 815
582 Ga0495668_0001239 3300046616 Bacteria 25630
583 Ga0495668_0012767 3300046616 Bacteria 4974
584 Ga0495668_0019170 3300046616 Bacteria 3947
585 Ga0495668_0143062 3300046616 Bacteria 1309
586 Ga0495625_0005736 3300046660 Bacteria 11222
587 Ga0495625_0008141 3300046660 Bacteria 8981
588 Ga0495625_0019712 3300046660 Bacteria 5222
589 Ga0495625_0033686 3300046660 Bacteria 3784
590 Ga0495661_0002158 3300046665 Bacteria 15383
591 Ga0495661_0037675 3300046665 Bacteria 3017
592 Ga0495588_0335158 3300046674 Bacteria 795
593 Ga0495671_0000001 3300046692 Bacteria 1169494
594 Ga0495660_0011707 3300046810 Bacteria 5089
595 Ga0495660_0019417 3300046810 Bacteria 3902
596 Ga0495660_0041115 3300046810 Bacteria 2561
597 Ga0495636_0068742 3300047318 Bacteria 1508
598 Ga0495672_0000302 3300047320 Bacteria 66589
599 Ga0495687_008955 3300047443 Bacteria 5661
600 Ga0495687_029278 3300047443 Bacteria 2551
601 Ga0495679_009967 3300047446 Bacteria 3763
602 Ga0495673_0000097 3300047469 Bacteria 182247
603 Ga0495673_0000100 3300047469 Bacteria 173962
604 Ga0495686_0018201 3300047472 Bacteria 4719
605 Ga0495686_0028559 3300047472 Bacteria 3632
606 Ga0496101_0074089 3300048904 Bacteria 2503
607 Ga0496101_0580009 3300048904 Bacteria 887
608 Ga0496102_0001475 3300048905 Bacteria 20760
609 Ga0496102_0266769 3300048905 Bacteria 1614
610 Ga0496104_0431437 3300048907 Bacteria 1230
611 Ga0496106_0002475 3300048909 Bacteria 13763
612 Ga0496107_0112465 3300048910 Bacteria 2002
613 Ga0496107_0691015 3300048910 Bacteria 751
614 Ga0496108_0013970 3300048911 Bacteria 6550
615 Ga0496108_0510383 3300048911 Bacteria 1050
616 Ga0496109_0089029 3300048912 Bacteria 2853
617 Ga0496110_0070547 3300048913 Bacteria 3096
618 Ga0496110_0271182 3300048913 Bacteria 1545
619 Ga0496111_0053765 3300048914 Bacteria 2910
620 Ga0496111_0274884 3300048914 Bacteria 1250
621 Ga0496114_0012788 3300048917 Bacteria 6719
622 Ga0496114_0013659 3300048917 Bacteria 6510
623 Ga0496115_0484993 3300048918 Bacteria 995
624 Ga0496116_0148072 3300048919 Bacteria 1309
625 Ga0496119_0392834 3300048922 Bacteria 663
626 Ga0496120_0476488 3300048923 Bacteria 539
627 Ga0496122_0147189 3300048925 Bacteria 1461
628 Ga0496123_0013346 3300048926 Bacteria 6906
629 Ga0496125_0133305 3300048928 Bacteria 1744
630 Ga0496126_0014001 3300048929 Bacteria 8128
631 Ga0496126_0143238 3300048929 Bacteria 2055
632 Ga0501310_007907 3300049130 Bacteria 1145
633 Ga0495678_000128 3300049459 Bacteria 89099
634 Ga0495678_022689 3300049459 Bacteria 2740
635 Ga0495678_042991 3300049459 Bacteria 1797
636 Ga0501311_001467 3300049527 Bacteria 2058
637 Ga0501315_049047 3300049531 Bacteria 659
638 Ga0501322_019171 3300049538 Bacteria 590
639 Ga0501031_0027721 3300049568 Bacteria 3693
640 Ga0501032_0010188 3300049569 Bacteria 6784
641 Ga0501033_0040060 3300049570 Bacteria 3498
642 Ga0501034_0005376 3300049571 Bacteria 14011
643 Ga0501034_0126349 3300049571 Bacteria 2542
644 Ga0501034_1413026 3300049571 Bacteria 571
645 Ga0501036_0058733 3300049572 Bacteria 3259
646 Ga0501036_0117448 3300049572 Bacteria 2247
647 Ga0501037_0001887 3300049573 Bacteria 15235
648 Ga0501037_0004664 3300049573 Bacteria 9957
649 Ga0501037_0033043 3300049573 Bacteria 3822
650 Ga0501038_0003864 3300049574 Bacteria 13921
651 Ga0501038_0020288 3300049574 Bacteria 5978
652 Ga0501038_0030062 3300049574 Bacteria 4810
653 Ga0501039_0003351 3300049575 Bacteria 11972
654 Ga0501039_0129507 3300049575 Bacteria 1980
655 Ga0501039_0157378 3300049575 Bacteria 1785
656 Ga0501042_1263259 3300049578 Bacteria 538
657 Ga0501043_0007959 3300049579 Bacteria 8372
658 Ga0501043_0340272 3300049579 Bacteria 1141
659 Ga0501046_0409791 3300049580 Bacteria 978
660 Ga0501047_0034967 3300049581 Bacteria 4852
661 Ga0501047_0226504 3300049581 Bacteria 1724
662 Ga0501068_0181508 3300049584 Bacteria 1331
663 Ga0501070_0024315 3300049586 Bacteria 5081
664 Ga0501070_0032902 3300049586 Bacteria 4337
665 Ga0501072_0178723 3300049588 Bacteria 1693
666 Ga0501073_0061269 3300049589 Bacteria 2626
667 Ga0501073_0253991 3300049589 Bacteria 1213
668 Ga0501074_0004026 3300049590 Bacteria 10482
669 Ga0501074_0016929 3300049590 Bacteria 5289
670 Ga0501075_0044860 3300049591 Bacteria 3317
671 Ga0501209_000841 3300049656 Bacteria 3981
672 Ga0501257_073175 3300049686 Bacteria 878
673 Ga0501225_0110563 3300049705 Bacteria 810
674 Ga0501080_0004472 3300049742 Bacteria 12445
675 Ga0501080_0057515 3300049742 Bacteria 3620
676 Ga0501080_0676748 3300049742 Bacteria 911
677 Ga0501280_000570 3300049776 Bacteria 8565
678 Ga0501044_0015304 3300049823 Bacteria 8262
679 nmdc:mga03683_124487_c1 3300050489 Bacteria 1149
680 nmdc:mga03683_145006_c1 3300050489 Bacteria 1069
681 nmdc:mga0k408_1337_c1 3300050493 Bacteria 13338
682 nmdc:mga0k408_21809_c1 3300050493 Bacteria 3602
683 nmdc:mga0k408_44254_c1 3300050493 Bacteria 2566
684 nmdc:mga09592_598217_c1 3300050508 Bacteria 945
685 nmdc:mga08y16_15466_c1 3300050511 Bacteria 8025
686 nmdc:mga08y16_184336_c1 3300050511 Bacteria 2166
687 nmdc:mga08y16_195903_c1 3300050511 Bacteria 2094
688 nmdc:mga08y16_27850_c1 3300050511 Bacteria 5956
689 nmdc:mga08y16_775554_c1 3300050511 Bacteria 953
690 nmdc:mga0n895_145007_c1 3300050512 Bacteria 2403
691 nmdc:mga0sz30_22870_c1 3300050516 Bacteria 2539
692 Ga0500641_0014809 3300053096 Bacteria 2882
693 Ga0500650_0074263 3300053098 Bacteria 1590
694 Ga0500593_006380 3300053117 Bacteria 4716
695 Ga0500607_194762 3300053121 Bacteria 880
696 Ga0500618_001153 3300053125 Bacteria 12820
697 Ga0500628_017355 3300053129 Bacteria 1405
698 Ga0500586_003447 3300053145 Bacteria 3740
699 Ga0500604_0033057 3300053151 Bacteria 1528
700 Ga0500622_0000002 3300053156 Bacteria 646442
701 Ga0500627_0255996 3300053158 Bacteria 774
702 Ga0500645_001223 3300053730 Bacteria 13536
703 Ga0500587_027065 3300053739 Bacteria 772
704 Ga0500661_045973 3300055283 Bacteria 776
705 Ga0587068_036369 3300059641 Bacteria 876
706 Ga0587076_015332 3300059645 Bacteria 1193
707 Ga0587111_0036871 3300060346 Bacteria 1025
708 Ga0501082_0041092 3300060353 Bacteria 3987
709 Ga0530510_0675589 3300061734 Bacteria 787

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031250 Ga0265331_10024729 Ga0265331_100247292 109
2 3300035084 Ga0373928_0178783 Ga0373928_0178783_23_478 109
3 3300049705 Ga0501225_0110563 Ga0501225_0110563_286_741 110
4 3300036712 Ga0316584_0055797 Ga0316584_0055797_1090_1578 117
5 3300044712 Ga0453684_0000237 Ga0453684_0000237_160813_161301 117
6 3300044712 Ga0453684_0366082 Ga0453684_0366082_763_1251 117
7 3300005455 Ga0070663_101388483 Ga0070663_1013884831 118
8 3300005615 Ga0070702_100741403 Ga0070702_1007414031 118
9 3300009094 Ga0111539_10067447 Ga0111539_100674472 118
10 3300009098 Ga0105245_10255336 Ga0105245_102553362 118
11 3300011119 Ga0105246_10229650 Ga0105246_102296501 118
12 3300013297 Ga0157378_10618284 Ga0157378_106182842 118
13 3300014969 Ga0157376_10017423 Ga0157376_100174232 118
14 3300025933 Ga0207706_10140078 Ga0207706_101400783 118
15 3300027907 Ga0207428_10007629 Ga0207428_100076298 118
16 3300031507 Ga0307509_10000006 Ga0307509_10000006321 118
17 3300035121 Ga0373960_0357809 Ga0373960_0357809_33_536 118
18 3300037471 Ga0395905_0552492 Ga0395905_0552492_166_654 118
19 3300037471 Ga0395905_0842224 Ga0395905_0842224_101_589 118
20 3300042876 Ga0451577_0305633 Ga0451577_0305633_200_688 118
21 3300044765 Ga0466970_0022377 Ga0466970_0022377_1306_1794 118
22 3300045049 Ga0466959_0084193 Ga0466959_0084193_1096_1584 118
23 3300046452 Ga0495617_000037 Ga0495617_000037_3445_3933 118
24 3300046463 Ga0495653_0000038 Ga0495653_0000038_117884_118372 118
25 3300046471 Ga0495650_0003518 Ga0495650_0003518_3175_3663 118
26 3300046492 Ga0495585_0012995 Ga0495585_0012995_1572_2060 118
27 3300046507 Ga0495606_0015437 Ga0495606_0015437_2010_2498 118
28 3300046512 Ga0495610_0000003 Ga0495610_0000003_419601_420089 118
29 3300046524 Ga0495648_0033549 Ga0495648_0033549_192_680 118
30 3300046524 Ga0495648_0107235 Ga0495648_0107235_179_667 118
31 3300046530 Ga0495654_0038980 Ga0495654_0038980_1805_2293 118
32 3300046542 Ga0495597_0005062 Ga0495597_0005062_3230_3718 118
33 3300046558 Ga0495633_0246580 Ga0495633_0246580_222_710 118
34 3300046616 Ga0495668_0019170 Ga0495668_0019170_3404_3892 118
35 3300046616 Ga0495668_0143062 Ga0495668_0143062_687_1175 118
36 3300046665 Ga0495661_0002158 Ga0495661_0002158_7361_7849 118
37 3300046665 Ga0495661_0037675 Ga0495661_0037675_692_1180 118
38 3300046692 Ga0495671_0000001 Ga0495671_0000001_256090_256578 118
39 3300046810 Ga0495660_0041115 Ga0495660_0041115_1553_2041 118
40 3300047318 Ga0495636_0068742 Ga0495636_0068742_975_1463 118
41 3300047443 Ga0495687_029278 Ga0495687_029278_288_776 118
42 3300047446 Ga0495679_009967 Ga0495679_009967_2158_2646 118
43 3300047469 Ga0495673_0000100 Ga0495673_0000100_170045_170533 118
44 3300048904 Ga0496101_0580009 Ga0496101_0580009_78_566 118
45 3300048911 Ga0496108_0013970 Ga0496108_0013970_315_803 118
46 3300048912 Ga0496109_0089029 Ga0496109_0089029_1614_2102 118
47 3300048913 Ga0496110_0070547 Ga0496110_0070547_2048_2536 118
48 3300048917 Ga0496114_0012788 Ga0496114_0012788_5740_6228 118
49 3300048919 Ga0496116_0148072 Ga0496116_0148072_775_1263 118
50 3300048922 Ga0496119_0392834 Ga0496119_0392834_28_516 118
51 3300048923 Ga0496120_0476488 Ga0496120_0476488_16_504 118
52 3300048925 Ga0496122_0147189 Ga0496122_0147189_248_736 118
53 3300048926 Ga0496123_0013346 Ga0496123_0013346_4444_4932 118
54 3300048929 Ga0496126_0014001 Ga0496126_0014001_5851_6339 118
55 3300050511 nmdc:mga08y16_27850_c1 nmdc:mga08y16_27850_c1_5172_5660 118
56 3300053125 Ga0500618_001153 Ga0500618_001153_10895_11383 118
57 3300059641 Ga0587068_036369 Ga0587068_036369_165_653 118
58 3300059645 Ga0587076_015332 Ga0587076_015332_161_649 118
59 3300060346 Ga0587111_0036871 Ga0587111_0036871_71_559 118
60 3300061734 Ga0530510_0675589 Ga0530510_0675589_114_602 118
61 3300002738 JGI25154J39366_1000471 JGI25154J39366_100047110 119
62 3300003187 JGI25151J46595_10015102 JGI25151J46595_100151023 119
63 3300003187 JGI25151J46595_10043790 JGI25151J46595_100437903 119
64 3300003763 Ga0055529_1000080 Ga0055529_100008031 119
65 3300003771 Ga0055526_1002909 Ga0055526_10029098 119
66 3300003781 Ga0055536_1000020 Ga0055536_100002028 119
67 3300003784 Ga0055534_1007801 Ga0055534_10078014 119
68 3300005366 Ga0070659_101390418 Ga0070659_1013904181 119
69 3300006028 Ga0070717_10054394 Ga0070717_100543944 119
70 3300006358 Ga0068871_100513976 Ga0068871_1005139762 119
71 3300006946 Ga0079104_1007537 Ga0079104_10075373 119
72 3300009545 Ga0105237_10491591 Ga0105237_104915912 119
73 3300010375 Ga0105239_10448588 Ga0105239_104485883 119
74 3300013297 Ga0157378_10121654 Ga0157378_101216544 119
75 3300013308 Ga0157375_10089299 Ga0157375_100892994 119
76 3300014969 Ga0157376_10065502 Ga0157376_100655024 119
77 3300015261 Ga0182006_1000026 Ga0182006_100002681 119
78 3300015262 Ga0182007_10033033 Ga0182007_100330332 119
79 3300015265 Ga0182005_1000007 Ga0182005_1000007298 119
80 3300017792 Ga0163161_10045173 Ga0163161_100451734 119
81 3300025233 Ga0209437_103551 Ga0209437_1035512 119
82 3300025233 Ga0209437_111870 Ga0209437_1118702 119
83 3300025245 Ga0207425_1000143 Ga0207425_100014349 119
84 3300025246 Ga0209646_1000010 Ga0209646_1000010225 119
85 3300025272 Ga0209455_1000037 Ga0209455_1000037116 119
86 3300025291 Ga0209675_1001094 Ga0209675_100109414 119
87 3300025292 Ga0209676_1000066 Ga0209676_100006643 119
88 3300025294 Ga0209025_1001845 Ga0209025_100184518 119
89 3300025294 Ga0209025_1006292 Ga0209025_10062928 119
90 3300025295 Ga0209564_1000009 Ga0209564_1000009354 119
91 3300025295 Ga0209564_1000033 Ga0209564_1000033265 119
92 3300025297 Ga0209758_1001766 Ga0209758_100176619 119
93 3300025728 Ga0207655_1010587 Ga0207655_10105873 119
94 3300025885 Ga0207653_10094797 Ga0207653_100947971 119
95 3300025914 Ga0207671_10415996 Ga0207671_104159962 119
96 3300025915 Ga0207693_10264395 Ga0207693_102643952 119
97 3300025949 Ga0207667_10310679 Ga0207667_103106792 119
98 3300027111 Ga0209281_1012000 Ga0209281_10120004 119
99 3300028653 Ga0265323_10063812 Ga0265323_100638122 119
100 3300030731 Ga0316177_1082218 Ga0316177_10822182 119
101 3300030744 Ga0316181_1149069 Ga0316181_11490692 119
102 3300030745 Ga0316182_1388674 Ga0316182_13886742 119
103 3300031711 Ga0265314_10016544 Ga0265314_100165446 119
104 3300032004 Ga0307414_10030059 Ga0307414_100300594 119
105 3300035114 Ga0373939_0003438 Ga0373939_0003438_2823_3311 119
106 3300038443 Ga0395901_0156195 Ga0395901_0156195_584_1072 119
107 3300039447 Ga0436361_0344944 Ga0436361_0344944_1352_1840 119
108 3300039447 Ga0436361_1195038 Ga0436361_1195038_107_595 119
109 3300042876 Ga0451577_0093859 Ga0451577_0093859_724_1212 119
110 3300044712 Ga0453684_0006085 Ga0453684_0006085_11297_11785 119
111 3300044712 Ga0453684_1522500 Ga0453684_1522500_167_652 119
112 3300044901 Ga0466960_0331552 Ga0466960_0331552_133_621 119
113 3300046453 Ga0495627_000008 Ga0495627_000008_515610_516098 119
114 3300046457 Ga0495590_0000089 Ga0495590_0000089_1885_2373 119
115 3300046460 Ga0495638_0000329 Ga0495638_0000329_1933_2421 119
116 3300046460 Ga0495638_0130847 Ga0495638_0130847_522_1010 119
117 3300046471 Ga0495650_0004834 Ga0495650_0004834_1035_1523 119
118 3300046471 Ga0495650_0005997 Ga0495650_0005997_1002_1490 119
119 3300046471 Ga0495650_0010456 Ga0495650_0010456_1937_2425 119
120 3300046471 Ga0495650_0016142 Ga0495650_0016142_296_784 119
121 3300046474 Ga0495605_0002030 Ga0495605_0002030_4287_4775 119
122 3300046501 Ga0495607_0012687 Ga0495607_0012687_1869_2357 119
123 3300046501 Ga0495607_0032811 Ga0495607_0032811_2569_3057 119
124 3300046506 Ga0495583_0000464 Ga0495583_0000464_57508_57996 119
125 3300046507 Ga0495606_0000011 Ga0495606_0000011_26569_27057 119
126 3300046507 Ga0495606_0000064 Ga0495606_0000064_179758_180246 119
127 3300046507 Ga0495606_0008212 Ga0495606_0008212_385_873 119
128 3300046507 Ga0495606_0015425 Ga0495606_0015425_1919_2407 119
129 3300046507 Ga0495606_0024643 Ga0495606_0024643_3208_3696 119
130 3300046512 Ga0495610_0020763 Ga0495610_0020763_1247_1735 119
131 3300046512 Ga0495610_0030292 Ga0495610_0030292_2193_2681 119
132 3300046520 Ga0495637_0164188 Ga0495637_0164188_56_544 119
133 3300046522 Ga0495643_0006906 Ga0495643_0006906_3383_3871 119
134 3300046522 Ga0495643_0028163 Ga0495643_0028163_2602_3090 119
135 3300046524 Ga0495648_0000001 Ga0495648_0000001_6701_7189 119
136 3300046524 Ga0495648_0065957 Ga0495648_0065957_1567_2055 119
137 3300046528 Ga0495642_0007721 Ga0495642_0007721_817_1305 119
138 3300046538 Ga0495609_0019147 Ga0495609_0019147_736_1224 119
139 3300046557 Ga0495622_0000068 Ga0495622_0000068_83903_84391 119
140 3300046557 Ga0495622_0006132 Ga0495622_0006132_1846_2334 119
141 3300046558 Ga0495633_0007375 Ga0495633_0007375_1495_1983 119
142 3300046558 Ga0495633_0008653 Ga0495633_0008653_3344_3832 119
143 3300046616 Ga0495668_0001239 Ga0495668_0001239_21395_21883 119
144 3300046616 Ga0495668_0012767 Ga0495668_0012767_2825_3313 119
145 3300046660 Ga0495625_0005736 Ga0495625_0005736_7548_8036 119
146 3300046660 Ga0495625_0008141 Ga0495625_0008141_1884_2372 119
147 3300046660 Ga0495625_0019712 Ga0495625_0019712_3275_3763 119
148 3300046660 Ga0495625_0033686 Ga0495625_0033686_1580_2068 119
149 3300046674 Ga0495588_0335158 Ga0495588_0335158_242_730 119
150 3300046810 Ga0495660_0011707 Ga0495660_0011707_1838_2326 119
151 3300046810 Ga0495660_0019417 Ga0495660_0019417_1637_2125 119
152 3300047320 Ga0495672_0000302 Ga0495672_0000302_1900_2388 119
153 3300047443 Ga0495687_008955 Ga0495687_008955_1296_1784 119
154 3300047469 Ga0495673_0000097 Ga0495673_0000097_3422_3910 119
155 3300047472 Ga0495686_0018201 Ga0495686_0018201_423_911 119
156 3300047472 Ga0495686_0028559 Ga0495686_0028559_152_640 119
157 3300048907 Ga0496104_0431437 Ga0496104_0431437_306_794 119
158 3300048910 Ga0496107_0112465 Ga0496107_0112465_1304_1792 119
159 3300048911 Ga0496108_0510383 Ga0496108_0510383_261_749 119
160 3300048914 Ga0496111_0053765 Ga0496111_0053765_1480_1968 119
161 3300048917 Ga0496114_0013659 Ga0496114_0013659_4750_5238 119
162 3300048928 Ga0496125_0133305 Ga0496125_0133305_505_993 119
163 3300049130 Ga0501310_007907 Ga0501310_007907_131_619 119
164 3300049459 Ga0495678_000128 Ga0495678_000128_28641_29129 119
165 3300049459 Ga0495678_022689 Ga0495678_022689_704_1192 119
166 3300049459 Ga0495678_042991 Ga0495678_042991_158_646 119
167 3300049527 Ga0501311_001467 Ga0501311_001467_170_658 119
168 3300049531 Ga0501315_049047 Ga0501315_049047_126_614 119
169 3300049538 Ga0501322_019171 Ga0501322_019171_46_534 119
170 3300049571 Ga0501034_1413026 Ga0501034_1413026_31_543 119
171 3300049686 Ga0501257_073175 Ga0501257_073175_60_548 119
172 3300053121 Ga0500607_194762 Ga0500607_194762_96_584 119
173 3300053145 Ga0500586_003447 Ga0500586_003447_518_1006 119
174 3300003544 Ga0007417J51691_1031991 Ga0007417J51691_103199110 120
175 3300003575 Ga0007409J51694_1013012 Ga0007409J51694_101301211 120
176 3300003577 Ga0007416J51690_1021228 Ga0007416J51690_102122811 120
177 3300005293 Ga0065715_10794821 Ga0065715_107948211 120
178 3300005339 Ga0070660_101289680 Ga0070660_1012896801 120
179 3300005343 Ga0070687_100371360 Ga0070687_1003713601 120
180 3300005344 Ga0070661_100028133 Ga0070661_1000281334 120
181 3300005344 Ga0070661_100305622 Ga0070661_1003056222 120
182 3300005435 Ga0070714_100224887 Ga0070714_1002248871 120
183 3300005441 Ga0070700_100563925 Ga0070700_1005639252 120
184 3300005458 Ga0070681_10022328 Ga0070681_100223284 120
185 3300005458 Ga0070681_10450812 Ga0070681_104508121 120
186 3300005458 Ga0070681_10514909 Ga0070681_105149091 120
187 3300005459 Ga0068867_100205089 Ga0068867_1002050891 120
188 3300005530 Ga0070679_100035613 Ga0070679_1000356135 120
189 3300005530 Ga0070679_101156924 Ga0070679_1011569242 120
190 3300005545 Ga0070695_100315811 Ga0070695_1003158112 120
191 3300005546 Ga0070696_100018750 Ga0070696_1000187505 120
192 3300005564 Ga0070664_100073941 Ga0070664_1000739414 120
193 3300005578 Ga0068854_100140020 Ga0068854_1001400202 120
194 3300005614 Ga0068856_100119425 Ga0068856_1001194252 120
195 3300005614 Ga0068856_100481112 Ga0068856_1004811121 120
196 3300005719 Ga0068861_100158341 Ga0068861_1001583414 120
197 3300005840 Ga0068870_10635525 Ga0068870_106355252 120
198 3300005843 Ga0068860_101103828 Ga0068860_1011038282 120
199 3300005844 Ga0068862_100655855 Ga0068862_1006558552 120
200 3300006195 Ga0075366_10000047 Ga0075366_1000004730 120
201 3300009093 Ga0105240_10243610 Ga0105240_102436101 120
202 3300009094 Ga0111539_10016757 Ga0111539_100167576 120
203 3300009148 Ga0105243_10428772 Ga0105243_104287721 120
204 3300009174 Ga0105241_10758448 Ga0105241_107584482 120
205 3300010375 Ga0105239_12013156 Ga0105239_120131561 120
206 3300013104 Ga0157370_10138987 Ga0157370_101389872 120
207 3300013297 Ga0157378_10327245 Ga0157378_103272452 120
208 3300013307 Ga0157372_10078030 Ga0157372_100780304 120
209 3300013308 Ga0157375_10416265 Ga0157375_104162652 120
210 3300025912 Ga0207707_10090993 Ga0207707_100909932 120
211 3300025913 Ga0207695_10172205 Ga0207695_101722051 120
212 3300025920 Ga0207649_10025257 Ga0207649_100252572 120
213 3300025921 Ga0207652_10066192 Ga0207652_100661924 120
214 3300025929 Ga0207664_10215663 Ga0207664_102156633 120
215 3300025933 Ga0207706_10580012 Ga0207706_105800121 120
216 3300025945 Ga0207679_10441467 Ga0207679_104414672 120
217 3300026078 Ga0207702_10173702 Ga0207702_101737022 120
218 3300026089 Ga0207648_10592460 Ga0207648_105924602 120
219 3300027360 Ga0209969_1004991 Ga0209969_10049912 120
220 3300027876 Ga0209974_10053467 Ga0209974_100534672 120
221 3300027907 Ga0207428_10050071 Ga0207428_100500713 120
222 3300029957 Ga0265324_10000006 Ga0265324_10000006123 120
223 3300029957 Ga0265324_10000180 Ga0265324_1000018032 120
224 3300029957 Ga0265324_10016237 Ga0265324_100162374 120
225 3300031241 Ga0265325_10000110 Ga0265325_1000011012 120
226 3300031241 Ga0265325_10023232 Ga0265325_100232322 120
227 3300031250 Ga0265331_10051752 Ga0265331_100517523 120
228 3300031250 Ga0265331_10257198 Ga0265331_102571981 120
229 3300031344 Ga0265316_10038264 Ga0265316_100382643 120
230 3300031344 Ga0265316_10069121 Ga0265316_100691212 120
231 3300031344 Ga0265316_10119684 Ga0265316_101196844 120
232 3300031344 Ga0265316_10288588 Ga0265316_102885882 120
233 3300031548 Ga0307408_100774566 Ga0307408_1007745662 120
234 3300031665 Ga0316575_10000032 Ga0316575_1000003223 120
235 3300031711 Ga0265314_10000397 Ga0265314_1000039748 120
236 3300031711 Ga0265314_10009646 Ga0265314_100096464 120
237 3300031727 Ga0316576_10607811 Ga0316576_106078112 120
238 3300032133 Ga0316583_10021856 Ga0316583_100218563 120
239 3300032133 Ga0316583_10082050 Ga0316583_100820502 120
240 3300035083 Ga0373926_0072586 Ga0373926_0072586_106_594 120
241 3300035084 Ga0373928_0029931 Ga0373928_0029931_232_720 120
242 3300037471 Ga0395905_0067029 Ga0395905_0067029_1028_1516 120
243 3300041451 Ga0451791_1835022 Ga0451791_1835022_72_560 120
244 3300042876 Ga0451577_0000080 Ga0451577_0000080_141131_141619 120
245 3300044673 Ga0453683_0000049 Ga0453683_0000049_141131_141619 120
246 3300044712 Ga0453684_0000286 Ga0453684_0000286_76416_76904 120
247 3300044712 Ga0453684_0003300 Ga0453684_0003300_16851_17339 120
248 3300044712 Ga0453684_0086624 Ga0453684_0086624_2681_3169 120
249 3300045051 Ga0451576_0000034 Ga0451576_0000034_245265_245753 120
250 3300045051 Ga0451576_0000102 Ga0451576_0000102_141131_141619 120
251 3300045051 Ga0451576_0376837 Ga0451576_0376837_391_879 120
252 3300045051 Ga0451576_1279952 Ga0451576_1279952_23_511 120
253 3300045051 Ga0451576_1431499 Ga0451576_1431499_148_648 120
254 3300048910 Ga0496107_0691015 Ga0496107_0691015_235_723 120
255 3300048913 Ga0496110_0271182 Ga0496110_0271182_955_1443 120
256 3300048914 Ga0496111_0274884 Ga0496111_0274884_594_1082 120
257 3300048929 Ga0496126_0143238 Ga0496126_0143238_1019_1510 120
258 3300049568 Ga0501031_0027721 Ga0501031_0027721_2850_3338 120
259 3300049569 Ga0501032_0010188 Ga0501032_0010188_4854_5342 120
260 3300049570 Ga0501033_0040060 Ga0501033_0040060_889_1377 120
261 3300049571 Ga0501034_0005376 Ga0501034_0005376_9893_10381 120
262 3300049571 Ga0501034_0126349 Ga0501034_0126349_889_1377 120
263 3300049572 Ga0501036_0058733 Ga0501036_0058733_1384_1872 120
264 3300049572 Ga0501036_0117448 Ga0501036_0117448_227_715 120
265 3300049573 Ga0501037_0001887 Ga0501037_0001887_336_824 120
266 3300049573 Ga0501037_0004664 Ga0501037_0004664_3768_4256 120
267 3300049573 Ga0501037_0033043 Ga0501037_0033043_1883_2371 120
268 3300049574 Ga0501038_0003864 Ga0501038_0003864_3640_4128 120
269 3300049574 Ga0501038_0020288 Ga0501038_0020288_277_765 120
270 3300049574 Ga0501038_0030062 Ga0501038_0030062_2212_2700 120
271 3300049575 Ga0501039_0003351 Ga0501039_0003351_4015_4503 120
272 3300049575 Ga0501039_0129507 Ga0501039_0129507_62_550 120
273 3300049575 Ga0501039_0157378 Ga0501039_0157378_657_1145 120
274 3300049578 Ga0501042_1263259 Ga0501042_1263259_11_499 120
275 3300049579 Ga0501043_0007959 Ga0501043_0007959_2076_2564 120
276 3300049579 Ga0501043_0340272 Ga0501043_0340272_272_784 120
277 3300049580 Ga0501046_0409791 Ga0501046_0409791_198_686 120
278 3300049581 Ga0501047_0034967 Ga0501047_0034967_597_1085 120
279 3300049581 Ga0501047_0226504 Ga0501047_0226504_780_1268 120
280 3300049584 Ga0501068_0181508 Ga0501068_0181508_55_543 120
281 3300049586 Ga0501070_0024315 Ga0501070_0024315_3561_4049 120
282 3300049586 Ga0501070_0032902 Ga0501070_0032902_1669_2157 120
283 3300049588 Ga0501072_0178723 Ga0501072_0178723_300_788 120
284 3300049589 Ga0501073_0061269 Ga0501073_0061269_597_1085 120
285 3300049589 Ga0501073_0253991 Ga0501073_0253991_25_513 120
286 3300049590 Ga0501074_0004026 Ga0501074_0004026_6310_6798 120
287 3300049590 Ga0501074_0016929 Ga0501074_0016929_3190_3678 120
288 3300049591 Ga0501075_0044860 Ga0501075_0044860_1730_2218 120
289 3300049656 Ga0501209_000841 Ga0501209_000841_1516_2007 120
290 3300049742 Ga0501080_0004472 Ga0501080_0004472_3939_4427 120
291 3300049742 Ga0501080_0057515 Ga0501080_0057515_1884_2372 120
292 3300049742 Ga0501080_0676748 Ga0501080_0676748_31_543 120
293 3300049776 Ga0501280_000570 Ga0501280_000570_3954_4442 120
294 3300049823 Ga0501044_0015304 Ga0501044_0015304_170_658 120
295 3300050493 nmdc:mga0k408_1337_c1 nmdc:mga0k408_1337_c1_10956_11444 120
296 3300050511 nmdc:mga08y16_15466_c1 nmdc:mga08y16_15466_c1_4794_5282 120
297 3300060353 Ga0501082_0041092 Ga0501082_0041092_3376_3864 120
298 3300005293 Ga0065715_10104050 Ga0065715_101040503 121
299 3300005293 Ga0065715_10329917 Ga0065715_103299171 121
300 3300005327 Ga0070658_10049961 Ga0070658_100499614 121
301 3300005327 Ga0070658_10055388 Ga0070658_100553883 121
302 3300005327 Ga0070658_10388004 Ga0070658_103880041 121
303 3300005328 Ga0070676_10001342 Ga0070676_100013427 121
304 3300005328 Ga0070676_10088682 Ga0070676_100886823 121
305 3300005329 Ga0070683_100212333 Ga0070683_1002123332 121
306 3300005330 Ga0070690_100030238 Ga0070690_1000302382 121
307 3300005331 Ga0070670_100048959 Ga0070670_1000489592 121
308 3300005331 Ga0070670_100289798 Ga0070670_1002897982 121
309 3300005331 Ga0070670_100816162 Ga0070670_1008161622 121
310 3300005334 Ga0068869_100001218 Ga0068869_1000012187 121
311 3300005335 Ga0070666_10000716 Ga0070666_1000071615 121
312 3300005336 Ga0070680_100277986 Ga0070680_1002779861 121
313 3300005339 Ga0070660_100010228 Ga0070660_1000102284 121
314 3300005339 Ga0070660_100306191 Ga0070660_1003061912 121
315 3300005340 Ga0070689_100571971 Ga0070689_1005719712 121
316 3300005344 Ga0070661_100010951 Ga0070661_1000109513 121
317 3300005344 Ga0070661_100019060 Ga0070661_1000190603 121
318 3300005347 Ga0070668_100003744 Ga0070668_1000037443 121
319 3300005347 Ga0070668_100028135 Ga0070668_1000281352 121
320 3300005347 Ga0070668_100037342 Ga0070668_1000373424 121
321 3300005347 Ga0070668_100061958 Ga0070668_1000619583 121
322 3300005353 Ga0070669_100011574 Ga0070669_1000115743 121
323 3300005353 Ga0070669_100269932 Ga0070669_1002699322 121
324 3300005354 Ga0070675_100016873 Ga0070675_1000168733 121
325 3300005354 Ga0070675_100041450 Ga0070675_1000414503 121
326 3300005354 Ga0070675_100084369 Ga0070675_1000843691 121
327 3300005354 Ga0070675_100203039 Ga0070675_1002030392 121
328 3300005354 Ga0070675_100400776 Ga0070675_1004007762 121
329 3300005355 Ga0070671_100036793 Ga0070671_1000367933 121
330 3300005355 Ga0070671_100312844 Ga0070671_1003128442 121
331 3300005364 Ga0070673_100052589 Ga0070673_1000525892 121
332 3300005364 Ga0070673_101534131 Ga0070673_1015341311 121
333 3300005366 Ga0070659_100033099 Ga0070659_1000330993 121
334 3300005366 Ga0070659_100089359 Ga0070659_1000893594 121
335 3300005367 Ga0070667_100075986 Ga0070667_1000759863 121
336 3300005367 Ga0070667_100275458 Ga0070667_1002754581 121
337 3300005367 Ga0070667_101135996 Ga0070667_1011359961 121
338 3300005435 Ga0070714_100171797 Ga0070714_1001717971 121
339 3300005435 Ga0070714_100244300 Ga0070714_1002443002 121
340 3300005436 Ga0070713_100000033 Ga0070713_10000003347 121
341 3300005445 Ga0070708_100355772 Ga0070708_1003557722 121
342 3300005455 Ga0070663_100333121 Ga0070663_1003331212 121
343 3300005455 Ga0070663_100628885 Ga0070663_1006288851 121
344 3300005455 Ga0070663_100690630 Ga0070663_1006906302 121
345 3300005456 Ga0070678_100030374 Ga0070678_1000303743 121
346 3300005456 Ga0070678_100139053 Ga0070678_1001390532 121
347 3300005457 Ga0070662_100330755 Ga0070662_1003307552 121
348 3300005458 Ga0070681_10371602 Ga0070681_103716022 121
349 3300005459 Ga0068867_100000669 Ga0068867_10000066910 121
350 3300005459 Ga0068867_100101746 Ga0068867_1001017464 121
351 3300005459 Ga0068867_100197805 Ga0068867_1001978053 121
352 3300005530 Ga0070679_100059722 Ga0070679_1000597223 121
353 3300005535 Ga0070684_100001976 Ga0070684_1000019764 121
354 3300005535 Ga0070684_100115845 Ga0070684_1001158451 121
355 3300005539 Ga0068853_100026172 Ga0068853_1000261724 121
356 3300005539 Ga0068853_100050746 Ga0068853_1000507462 121
357 3300005539 Ga0068853_101193537 Ga0068853_1011935371 121
358 3300005543 Ga0070672_100000521 Ga0070672_1000005213 121
359 3300005543 Ga0070672_100025883 Ga0070672_1000258834 121
360 3300005543 Ga0070672_100719780 Ga0070672_1007197802 121
361 3300005548 Ga0070665_100004881 Ga0070665_10000488113 121
362 3300005548 Ga0070665_100045852 Ga0070665_1000458523 121
363 3300005564 Ga0070664_100062550 Ga0070664_1000625503 121
364 3300005577 Ga0068857_100083605 Ga0068857_1000836053 121
365 3300005577 Ga0068857_100176712 Ga0068857_1001767122 121
366 3300005578 Ga0068854_100014738 Ga0068854_1000147381 121
367 3300005578 Ga0068854_100097843 Ga0068854_1000978432 121
368 3300005614 Ga0068856_100213613 Ga0068856_1002136131 121
369 3300005615 Ga0070702_100164891 Ga0070702_1001648912 121
370 3300005616 Ga0068852_100013125 Ga0068852_1000131253 121
371 3300005616 Ga0068852_100150988 Ga0068852_1001509883 121
372 3300005617 Ga0068859_100046678 Ga0068859_1000466784 121
373 3300005617 Ga0068859_100217762 Ga0068859_1002177622 121
374 3300005618 Ga0068864_100037394 Ga0068864_1000373944 121
375 3300005618 Ga0068864_100258956 Ga0068864_1002589562 121
376 3300005719 Ga0068861_100119862 Ga0068861_1001198623 121
377 3300005719 Ga0068861_100240492 Ga0068861_1002404923 121
378 3300005834 Ga0068851_10003430 Ga0068851_100034303 121
379 3300005834 Ga0068851_10007770 Ga0068851_100077703 121
380 3300005834 Ga0068851_10045007 Ga0068851_100450072 121
381 3300005841 Ga0068863_100070031 Ga0068863_1000700313 121
382 3300005841 Ga0068863_100107206 Ga0068863_1001072062 121
383 3300005841 Ga0068863_100174846 Ga0068863_1001748464 121
384 3300005841 Ga0068863_100226395 Ga0068863_1002263952 121
385 3300005841 Ga0068863_100590479 Ga0068863_1005904791 121
386 3300005842 Ga0068858_100011950 Ga0068858_1000119508 121
387 3300005843 Ga0068860_100001951 Ga0068860_1000019515 121
388 3300005843 Ga0068860_100015231 Ga0068860_1000152312 121
389 3300005843 Ga0068860_100038331 Ga0068860_1000383313 121
390 3300005844 Ga0068862_100015315 Ga0068862_1000153152 121
391 3300005844 Ga0068862_100034893 Ga0068862_1000348934 121
392 3300005844 Ga0068862_101384102 Ga0068862_1013841022 121
393 3300006048 Ga0075363_100559376 Ga0075363_1005593762 121
394 3300006175 Ga0070712_100229400 Ga0070712_1002294002 121
395 3300006195 Ga0075366_10101600 Ga0075366_101016002 121
396 3300006237 Ga0097621_100003273 Ga0097621_1000032733 121
397 3300006237 Ga0097621_100491450 Ga0097621_1004914501 121
398 3300006237 Ga0097621_100808942 Ga0097621_1008089422 121
399 3300006358 Ga0068871_100016262 Ga0068871_1000162624 121
400 3300006914 Ga0075436_100207511 Ga0075436_1002075111 121
401 3300006931 Ga0097620_100046682 Ga0097620_1000466823 121
402 3300006931 Ga0097620_100217763 Ga0097620_1002177632 121
403 3300009093 Ga0105240_10268473 Ga0105240_102684732 121
404 3300009094 Ga0111539_10264223 Ga0111539_102642232 121
405 3300009094 Ga0111539_10458083 Ga0111539_104580832 121
406 3300009174 Ga0105241_10108797 Ga0105241_101087971 121
407 3300009177 Ga0105248_10007274 Ga0105248_1000727410 121
408 3300009177 Ga0105248_10986077 Ga0105248_109860772 121
409 3300009545 Ga0105237_10144530 Ga0105237_101445304 121
410 3300009553 Ga0105249_10233053 Ga0105249_102330533 121
411 3300009553 Ga0105249_10260886 Ga0105249_102608862 121
412 3300010375 Ga0105239_10068982 Ga0105239_100689823 121
413 3300011119 Ga0105246_10479914 Ga0105246_104799141 121
414 3300013100 Ga0157373_10052383 Ga0157373_100523833 121
415 3300013102 Ga0157371_10234383 Ga0157371_102343832 121
416 3300013104 Ga0157370_10075209 Ga0157370_100752092 121
417 3300013104 Ga0157370_10183411 Ga0157370_101834113 121
418 3300013104 Ga0157370_10653302 Ga0157370_106533021 121
419 3300013105 Ga0157369_10374158 Ga0157369_103741582 121
420 3300013105 Ga0157369_10549255 Ga0157369_105492552 121
421 3300013296 Ga0157374_10045513 Ga0157374_100455134 121
422 3300013297 Ga0157378_10129638 Ga0157378_101296383 121
423 3300013297 Ga0157378_10136183 Ga0157378_101361832 121
424 3300013306 Ga0163162_10082034 Ga0163162_100820343 121
425 3300013307 Ga0157372_10067990 Ga0157372_100679904 121
426 3300013307 Ga0157372_10146322 Ga0157372_101463222 121
427 3300013307 Ga0157372_10338631 Ga0157372_103386312 121
428 3300013308 Ga0157375_10294734 Ga0157375_102947342 121
429 3300013308 Ga0157375_11752086 Ga0157375_117520862 121
430 3300014326 Ga0157380_10140540 Ga0157380_101405402 121
431 3300014326 Ga0157380_10284412 Ga0157380_102844122 121
432 3300014968 Ga0157379_10014702 Ga0157379_100147025 121
433 3300014969 Ga0157376_10163922 Ga0157376_101639223 121
434 3300017792 Ga0163161_10690677 Ga0163161_106906772 121
435 3300020070 Ga0206356_10947281 Ga0206356_109472813 121
436 3300025271 Ga0207666_1034174 Ga0207666_10341742 121
437 3300025321 Ga0207656_10020275 Ga0207656_100202752 121
438 3300025321 Ga0207656_10034153 Ga0207656_100341533 121
439 3300025901 Ga0207688_10069795 Ga0207688_100697952 121
440 3300025903 Ga0207680_10078818 Ga0207680_100788181 121
441 3300025903 Ga0207680_10097346 Ga0207680_100973462 121
442 3300025907 Ga0207645_10001626 Ga0207645_1000162611 121
443 3300025909 Ga0207705_10045438 Ga0207705_100454382 121
444 3300025909 Ga0207705_10109443 Ga0207705_101094433 121
445 3300025909 Ga0207705_10886852 Ga0207705_108868521 121
446 3300025911 Ga0207654_10152225 Ga0207654_101522252 121
447 3300025912 Ga0207707_10002203 Ga0207707_100022031 121
448 3300025914 Ga0207671_10241137 Ga0207671_102411372 121
449 3300025917 Ga0207660_10043785 Ga0207660_100437853 121
450 3300025919 Ga0207657_10001198 Ga0207657_100011981 121
451 3300025920 Ga0207649_10027706 Ga0207649_100277063 121
452 3300025920 Ga0207649_10078253 Ga0207649_100782531 121
453 3300025923 Ga0207681_10025230 Ga0207681_100252303 121
454 3300025923 Ga0207681_10228713 Ga0207681_102287132 121
455 3300025924 Ga0207694_10008827 Ga0207694_100088277 121
456 3300025924 Ga0207694_10259762 Ga0207694_102597623 121
457 3300025925 Ga0207650_10031328 Ga0207650_100313283 121
458 3300025925 Ga0207650_10047703 Ga0207650_100477032 121
459 3300025925 Ga0207650_10119221 Ga0207650_101192214 121
460 3300025925 Ga0207650_10637739 Ga0207650_106377392 121
461 3300025926 Ga0207659_10017403 Ga0207659_100174034 121
462 3300025926 Ga0207659_10038080 Ga0207659_100380802 121
463 3300025926 Ga0207659_10659837 Ga0207659_106598372 121
464 3300025928 Ga0207700_10000099 Ga0207700_1000009946 121
465 3300025929 Ga0207664_10007399 Ga0207664_100073993 121
466 3300025931 Ga0207644_10118251 Ga0207644_101182512 121
467 3300025932 Ga0207690_10040293 Ga0207690_100402933 121
468 3300025932 Ga0207690_10594290 Ga0207690_105942902 121
469 3300025933 Ga0207706_10216825 Ga0207706_102168252 121
470 3300025937 Ga0207669_10038059 Ga0207669_100380594 121
471 3300025940 Ga0207691_10000041 Ga0207691_1000004132 121
472 3300025940 Ga0207691_10124826 Ga0207691_101248263 121
473 3300025941 Ga0207711_10054932 Ga0207711_100549322 121
474 3300025942 Ga0207689_10053519 Ga0207689_100535194 121
475 3300025944 Ga0207661_10643872 Ga0207661_106438721 121
476 3300025945 Ga0207679_10115434 Ga0207679_101154344 121
477 3300025945 Ga0207679_10453106 Ga0207679_104531062 121
478 3300025949 Ga0207667_10007667 Ga0207667_1000766714 121
479 3300025960 Ga0207651_10468064 Ga0207651_104680642 121
480 3300025961 Ga0207712_10534231 Ga0207712_105342311 121
481 3300025972 Ga0207668_10045971 Ga0207668_100459712 121
482 3300025972 Ga0207668_10185991 Ga0207668_101859912 121
483 3300025972 Ga0207668_10643379 Ga0207668_106433792 121
484 3300025981 Ga0207640_10045512 Ga0207640_100455122 121
485 3300025986 Ga0207658_10078480 Ga0207658_100784803 121
486 3300025986 Ga0207658_10316637 Ga0207658_103166371 121
487 3300026023 Ga0207677_10009713 Ga0207677_100097136 121
488 3300026035 Ga0207703_10040546 Ga0207703_100405461 121
489 3300026035 Ga0207703_11679105 Ga0207703_116791051 121
490 3300026041 Ga0207639_10026255 Ga0207639_100262553 121
491 3300026041 Ga0207639_10079529 Ga0207639_100795291 121
492 3300026041 Ga0207639_10145699 Ga0207639_101456992 121
493 3300026067 Ga0207678_10021176 Ga0207678_100211763 121
494 3300026067 Ga0207678_10050423 Ga0207678_100504234 121
495 3300026067 Ga0207678_10121481 Ga0207678_101214812 121
496 3300026067 Ga0207678_10766079 Ga0207678_107660792 121
497 3300026067 Ga0207678_10786309 Ga0207678_107863092 121
498 3300026088 Ga0207641_10181869 Ga0207641_101818692 121
499 3300026088 Ga0207641_10377625 Ga0207641_103776252 121
500 3300026089 Ga0207648_10025927 Ga0207648_100259274 121
501 3300026089 Ga0207648_10025971 Ga0207648_100259713 121
502 3300026089 Ga0207648_10162793 Ga0207648_101627933 121
503 3300026095 Ga0207676_10120265 Ga0207676_101202654 121
504 3300026095 Ga0207676_10187229 Ga0207676_101872293 121
505 3300026116 Ga0207674_10001773 Ga0207674_100017731 121
506 3300026116 Ga0207674_10163647 Ga0207674_101636473 121
507 3300026118 Ga0207675_100183941 Ga0207675_1001839412 121
508 3300026121 Ga0207683_10000011 Ga0207683_1000001185 121
509 3300026121 Ga0207683_10095896 Ga0207683_100958962 121
510 3300026142 Ga0207698_10007538 Ga0207698_100075384 121
511 3300026142 Ga0207698_11148708 Ga0207698_111487082 121
512 3300028379 Ga0268266_10069497 Ga0268266_100694974 121
513 3300028381 Ga0268264_10023348 Ga0268264_100233482 121
514 3300028794 Ga0307515_10235834 Ga0307515_102358342 121
515 3300031239 Ga0265328_10000001 Ga0265328_10000001100 121
516 3300031548 Ga0307408_100254986 Ga0307408_1002549861 121
517 3300031730 Ga0307516_10399959 Ga0307516_103999592 121
518 3300031911 Ga0307412_10410005 Ga0307412_104100052 121
519 3300031911 Ga0307412_11013948 Ga0307412_110139482 121
520 3300031911 Ga0307412_11594645 Ga0307412_115946451 121
521 3300032002 Ga0307416_100501394 Ga0307416_1005013942 121
522 3300038726 Ga0400490_47983 Ga0400490_47983_2779_3270 121
523 3300041463 Ga0451804_0427897 Ga0451804_0427897_121_612 121
524 3300044712 Ga0453684_1317235 Ga0453684_1317235_195_686 121
525 3300048918 Ga0496115_0484993 Ga0496115_0484993_226_717 121
526 3300050511 nmdc:mga08y16_184336_c1 nmdc:mga08y16_184336_c1_446_937 121
527 3300050511 nmdc:mga08y16_195903_c1 nmdc:mga08y16_195903_c1_678_1169 121
528 3300050511 nmdc:mga08y16_775554_c1 nmdc:mga08y16_775554_c1_167_670 121
529 3300050512 nmdc:mga0n895_145007_c1 nmdc:mga0n895_145007_c1_719_1210 121
530 3300053156 Ga0500622_0000002 Ga0500622_0000002_570893_571384 121
531 3300005336 Ga0070680_100670820 Ga0070680_1006708202 122
532 3300005344 Ga0070661_100009048 Ga0070661_1000090484 122
533 3300005347 Ga0070668_100515703 Ga0070668_1005157032 122
534 3300005354 Ga0070675_100577173 Ga0070675_1005771732 122
535 3300005364 Ga0070673_100009031 Ga0070673_1000090314 122
536 3300005455 Ga0070663_100006826 Ga0070663_1000068266 122
537 3300005457 Ga0070662_100001307 Ga0070662_10000130710 122
538 3300005467 Ga0070706_100242027 Ga0070706_1002420273 122
539 3300005539 Ga0068853_100014825 Ga0068853_1000148256 122
540 3300005563 Ga0068855_100001489 Ga0068855_10000148915 122
541 3300005564 Ga0070664_100068301 Ga0070664_1000683012 122
542 3300005614 Ga0068856_100001071 Ga0068856_1000010712 122
543 3300006880 Ga0075429_100633405 Ga0075429_1006334052 122
544 3300009545 Ga0105237_11097989 Ga0105237_110979892 122
545 3300013100 Ga0157373_10025194 Ga0157373_100251941 122
546 3300013102 Ga0157371_10000681 Ga0157371_100006813 122
547 3300013307 Ga0157372_10019800 Ga0157372_100198007 122
548 3300025910 Ga0207684_10575384 Ga0207684_105753842 122
549 3300025912 Ga0207707_10077641 Ga0207707_100776414 122
550 3300025917 Ga0207660_10404292 Ga0207660_104042922 122
551 3300025919 Ga0207657_10000371 Ga0207657_100003713 122
552 3300025919 Ga0207657_10280122 Ga0207657_102801222 122
553 3300025920 Ga0207649_10144550 Ga0207649_101445502 122
554 3300025926 Ga0207659_10362039 Ga0207659_103620392 122
555 3300025933 Ga0207706_10000179 Ga0207706_1000017932 122
556 3300025945 Ga0207679_10569974 Ga0207679_105699742 122
557 3300025949 Ga0207667_10093363 Ga0207667_100933633 122
558 3300025981 Ga0207640_10024147 Ga0207640_100241473 122
559 3300026041 Ga0207639_10170133 Ga0207639_101701332 122
560 3300026078 Ga0207702_10000997 Ga0207702_1000099724 122
561 3300031548 Ga0307408_100133369 Ga0307408_1001333692 122
562 3300031731 Ga0307405_10003332 Ga0307405_100033324 122
563 3300031824 Ga0307413_10002017 Ga0307413_100020175 122
564 3300031852 Ga0307410_10202752 Ga0307410_102027522 122
565 3300031901 Ga0307406_10172291 Ga0307406_101722912 122
566 3300031911 Ga0307412_10053323 Ga0307412_100533234 122
567 3300031995 Ga0307409_100258470 Ga0307409_1002584702 122
568 3300032002 Ga0307416_100035982 Ga0307416_1000359823 122
569 3300032005 Ga0307411_10018632 Ga0307411_100186325 122
570 3300032126 Ga0307415_100025599 Ga0307415_1000255993 122
571 3300041456 Ga0451795_1551090 Ga0451795_1551090_121_621 122
572 3300045836 Ga0466958_0437195 Ga0466958_0437195_252_764 122
573 3300048904 Ga0496101_0074089 Ga0496101_0074089_1841_2338 122
574 3300048905 Ga0496102_0001475 Ga0496102_0001475_14189_14686 122
575 3300048909 Ga0496106_0002475 Ga0496106_0002475_6076_6573 122
576 3300050508 nmdc:mga09592_598217_c1 nmdc:mga09592_598217_c1_371_868 122
577 3300002704 JGI25155J39150_1000051 JGI25155J39150_100005155 123
578 3300002705 JGI25156J39149_1000155 JGI25156J39149_10001551 123
579 3300002705 JGI25156J39149_1000196 JGI25156J39149_100019627 123
580 3300002738 JGI25154J39366_1000170 JGI25154J39366_10001701 123
581 3300002738 JGI25154J39366_1000527 JGI25154J39366_10005274 123
582 3300002741 JGI25157J39369_1000091 JGI25157J39369_100009155 123
583 3300002774 JGI25150J39212_1012396 JGI25150J39212_10123962 123
584 3300002987 JGI25159J45721_1000317 JGI25159J45721_100031724 123
585 3300002987 JGI25159J45721_1000910 JGI25159J45721_10009104 123
586 3300003187 JGI25151J46595_10016827 JGI25151J46595_100168273 123
587 3300003215 JGI25153J46596_10093638 JGI25153J46596_100936381 123
588 3300003354 JGI25160J50197_1000067 JGI25160J50197_10000676 123
589 3300003354 JGI25160J50197_1047532 JGI25160J50197_10475322 123
590 3300003374 JGI25161J50226_1000035 JGI25161J50226_100003527 123
591 3300003773 Ga0055537_1001588 Ga0055537_10015889 123
592 3300003773 Ga0055537_1002902 Ga0055537_10029022 123
593 3300003775 Ga0055524_1000006 Ga0055524_10000068 123
594 3300003790 Ga0055528_1001140 Ga0055528_10011404 123
595 3300003790 Ga0055528_1001336 Ga0055528_100133612 123
596 3300003791 Ga0055530_10000154 Ga0055530_1000015461 123
597 3300003791 Ga0055530_10016037 Ga0055530_100160372 123
598 3300003792 Ga0055540_1000005 Ga0055540_1000005304 123
599 3300004625 Ga0055543_1001037 Ga0055543_100103712 123
600 3300005262 Ga0065165_1054762 Ga0065165_10547621 123
601 3300005262 Ga0065165_1092771 Ga0065165_10927711 123
602 3300005262 Ga0065165_1120598 Ga0065165_11205981 123
603 3300005262 Ga0065165_1128678 Ga0065165_11286781 123
604 3300005288 Ga0065714_10372924 Ga0065714_103729241 123
605 3300005337 Ga0070682_100188682 Ga0070682_1001886822 123
606 3300005455 Ga0070663_100032502 Ga0070663_1000325024 123
607 3300005548 Ga0070665_100067776 Ga0070665_1000677764 123
608 3300005563 Ga0068855_100127359 Ga0068855_1001273592 123
609 3300005564 Ga0070664_100182683 Ga0070664_1001826832 123
610 3300005843 Ga0068860_100348988 Ga0068860_1003489883 123
611 3300006051 Ga0075364_10335894 Ga0075364_103358942 123
612 3300006058 Ga0075432_10013675 Ga0075432_100136753 123
613 3300006177 Ga0075362_10029314 Ga0075362_100293142 123
614 3300006186 Ga0075369_10016462 Ga0075369_100164622 123
615 3300006195 Ga0075366_10041485 Ga0075366_100414854 123
616 3300006195 Ga0075366_10050146 Ga0075366_100501463 123
617 3300006237 Ga0097621_100799915 Ga0097621_1007999152 123
618 3300006358 Ga0068871_100579435 Ga0068871_1005794352 123
619 3300006871 Ga0075434_100486687 Ga0075434_1004866872 123
620 3300009177 Ga0105248_10683479 Ga0105248_106834792 123
621 3300013296 Ga0157374_10663917 Ga0157374_106639172 123
622 3300013306 Ga0163162_10068551 Ga0163162_100685513 123
623 3300013308 Ga0157375_10410852 Ga0157375_104108522 123
624 3300025206 Ga0209435_100062 Ga0209435_10006227 123
625 3300025208 Ga0209436_112151 Ga0209436_1121513 123
626 3300025245 Ga0207425_1001034 Ga0207425_10010344 123
627 3300025245 Ga0207425_1003980 Ga0207425_10039803 123
628 3300025246 Ga0209646_1000001 Ga0209646_1000001316 123
629 3300025250 Ga0209026_1000224 Ga0209026_100022427 123
630 3300025256 Ga0209759_1000013 Ga0209759_1000013316 123
631 3300025258 Ga0209129_1038406 Ga0209129_10384062 123
632 3300025263 Ga0209565_1002095 Ga0209565_10020955 123
633 3300025273 Ga0209673_1000043 Ga0209673_100004399 123
634 3300025284 Ga0209130_1000241 Ga0209130_10002416 123
635 3300025284 Ga0209130_1000741 Ga0209130_10007414 123
636 3300025291 Ga0209675_1001429 Ga0209675_10014294 123
637 3300025291 Ga0209675_1051093 Ga0209675_10510932 123
638 3300025292 Ga0209676_1000007 Ga0209676_1000007395 123
639 3300025292 Ga0209676_1004056 Ga0209676_10040563 123
640 3300025294 Ga0209025_1002489 Ga0209025_10024893 123
641 3300025294 Ga0209025_1003025 Ga0209025_10030256 123
642 3300025295 Ga0209564_1000285 Ga0209564_100028562 123
643 3300025295 Ga0209564_1000877 Ga0209564_10008779 123
644 3300025295 Ga0209564_1012207 Ga0209564_10122073 123
645 3300025297 Ga0209758_1028562 Ga0209758_10285623 123
646 3300025298 Ga0209050_1000003 Ga0209050_10000031113 123
647 3300025298 Ga0209050_1010854 Ga0209050_10108541 123
648 3300025298 Ga0209050_1020223 Ga0209050_10202234 123
649 3300025299 Ga0209256_1000001 Ga0209256_10000011120 123
650 3300025299 Ga0209256_1011350 Ga0209256_10113503 123
651 3300025302 Ga0207426_1000247 Ga0207426_1000247112 123
652 3300025302 Ga0207426_1004487 Ga0207426_10044873 123
653 3300025303 Ga0209051_1000003 Ga0209051_10000031113 123
654 3300025304 Ga0209257_1000020 Ga0209257_1000020395 123
655 3300025304 Ga0209257_1008893 Ga0209257_10088933 123
656 3300025927 Ga0207687_10218812 Ga0207687_102188123 123
657 3300025934 Ga0207686_10079245 Ga0207686_100792452 123
658 3300025941 Ga0207711_10400165 Ga0207711_104001652 123
659 3300025942 Ga0207689_10284864 Ga0207689_102848641 123
660 3300026118 Ga0207675_100377039 Ga0207675_1003770392 123
661 3300031235 Ga0265330_10102575 Ga0265330_101025751 123
662 3300031250 Ga0265331_10005458 Ga0265331_100054585 123
663 3300031250 Ga0265331_10008224 Ga0265331_100082244 123
664 3300031251 Ga0265327_10000588 Ga0265327_1000058831 123
665 3300031251 Ga0265327_10045923 Ga0265327_100459232 123
666 3300031456 Ga0307513_10000054 Ga0307513_1000005428 123
667 3300031548 Ga0307408_100049572 Ga0307408_1000495722 123
668 3300031711 Ga0265314_10001258 Ga0265314_1000125831 123
669 3300031712 Ga0265342_10012278 Ga0265342_100122782 123
670 3300031824 Ga0307413_10472582 Ga0307413_104725822 123
671 3300036401 Ga0373937_0588497 Ga0373937_0588497_300_851 123
672 3300037312 Ga0395899_0001965 Ga0395899_0001965_6256_6780 123
673 3300037312 Ga0395899_0551156 Ga0395899_0551156_138_653 123
674 3300037418 Ga0395900_0014339 Ga0395900_0014339_3443_3958 123
675 3300037418 Ga0395900_0024345 Ga0395900_0024345_2878_3402 123
676 3300037466 Ga0395898_0009746 Ga0395898_0009746_3641_4165 123
677 3300037466 Ga0395898_0114968 Ga0395898_0114968_1410_1925 123
678 3300037471 Ga0395905_0013281 Ga0395905_0013281_3925_4434 123
679 3300037471 Ga0395905_0013691 Ga0395905_0013691_2706_3218 123
680 3300037471 Ga0395905_0019556 Ga0395905_0019556_4337_4855 123
681 3300037471 Ga0395905_0037345 Ga0395905_0037345_1501_2061 123
682 3300037471 Ga0395905_0138870 Ga0395905_0138870_1763_2275 123
683 3300037471 Ga0395905_0198815 Ga0395905_0198815_1165_1680 123
684 3300038443 Ga0395901_0027151 Ga0395901_0027151_5209_5733 123
685 3300038443 Ga0395901_0048355 Ga0395901_0048355_3659_4171 123
686 3300038443 Ga0395901_0351426 Ga0395901_0351426_191_703 123
687 3300038443 Ga0395901_0476816 Ga0395901_0476816_238_747 123
688 3300044656 Ga0466969_0010029 Ga0466969_0010029_2584_3096 123
689 3300044658 Ga0466972_0112731 Ga0466972_0112731_173_685 123
690 3300044683 Ga0466965_0052930 Ga0466965_0052930_1211_1723 123
691 3300044684 Ga0466966_0019611 Ga0466966_0019611_2088_2600 123
692 3300044765 Ga0466970_0180016 Ga0466970_0180016_286_798 123
693 3300044901 Ga0466960_0041746 Ga0466960_0041746_191_703 123
694 3300045049 Ga0466959_0056630 Ga0466959_0056630_371_883 123
695 3300048905 Ga0496102_0266769 Ga0496102_0266769_781_1278 123
696 3300050489 nmdc:mga03683_124487_c1 nmdc:mga03683_124487_c1_351_851 123
697 3300050489 nmdc:mga03683_145006_c1 nmdc:mga03683_145006_c1_167_667 123
698 3300050493 nmdc:mga0k408_21809_c1 nmdc:mga0k408_21809_c1_566_1063 123
699 3300050493 nmdc:mga0k408_44254_c1 nmdc:mga0k408_44254_c1_216_713 123
700 3300050516 nmdc:mga0sz30_22870_c1 nmdc:mga0sz30_22870_c1_1493_1990 123
701 3300053096 Ga0500641_0014809 Ga0500641_0014809_1860_2357 123
702 3300053098 Ga0500650_0074263 Ga0500650_0074263_247_744 123
703 3300053117 Ga0500593_006380 Ga0500593_006380_1550_2047 123
704 3300053129 Ga0500628_017355 Ga0500628_017355_344_841 123
705 3300053151 Ga0500604_0033057 Ga0500604_0033057_720_1232 123
706 3300053158 Ga0500627_0255996 Ga0500627_0255996_153_650 123
707 3300053730 Ga0500645_001223 Ga0500645_001223_12893_13393 123
708 3300053739 Ga0500587_027065 Ga0500587_027065_169_666 123
709 3300055283 Ga0500661_045973 Ga0500661_045973_127_624 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00037

Fer4

4Fe-4S binding domain

80

100

0.95

Feature Viewer

pLDDT pTM Quality
59.78 0.31 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map