F476367
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 704 | 364 | 677 | 314 |
Family's Representative Sequence
| Representative Sequence | 3300039110|Ga0400487_03596|Ga0400487_03596_2128_3123 |
| Length | 331 |
| Sequence | MADYLLNEWLVNWPVGWLLAGLQTLLFIAIAPLLAGWIKLKKCRLQNRIAPSIWQPYRDLRKLFRKESVIAANASWIFRTTPYIVFGTTVLAAGVVPLIATDLPSAAIADVIVLVGFFALARFFLALAGMDIGTAFGGMGSSREMTLASLTEPAMLMAVFTLAMTASTTNLSTTIEVILSQGIVLRPSFIFAALGLMMVAIAETGRIPIDNPATHLELTMVHEAMILEYSGRHLAMLEWAQQIKLMVYGVLIVNLFVPWGIATELTEVALLVGSVAIIAKLALLGVILAISETVLAKLRLFRAPNYISFAFLLCLLGLLSHVILEVQQSTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 5 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 6 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 7 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 8 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 9 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 10 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 11 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 12 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 13 | 2906610324 | |||
| 14 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 15 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 16 | 2922425934 | |||
| 17 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 18 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 19 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 20 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 21 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 22 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 23 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 24 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 25 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 113 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 114 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 148 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 149 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 151 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 154 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 155 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 156 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 158 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 159 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 160 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 161 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 164 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 165 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 167 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 168 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 173 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 176 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 181 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 189 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 200 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 201 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 202 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 203 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 204 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 205 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 206 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 207 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 208 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 209 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 210 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 215 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 216 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 217 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 284 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 285 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 286 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 287 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 343 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 344 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 345 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 346 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 347 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 349 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 350 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 351 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 352 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 353 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 354 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 356 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 357 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 358 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 361 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 362 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 363 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 364 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.3 |
| Metatranscriptomes | 0.14 |
| Isolates | 3.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.69 |
| Nodule | 2.41 |
| Rhizoplane | 9.09 |
| Rhizosphere | 81.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10024687 | 3300001979 | Bacteria | 2037 |
| 2 | JGI24737J22298_10048358 | 3300001990 | Bacteria | 1295 |
| 3 | JGI25153J46596_10000946 | 3300003215 | Bacteria | 17627 |
| 4 | JGI25404J52841_10015246 | 3300003659 | Bacteria | 1668 |
| 5 | Ga0065165_1000785 | 3300005262 | Bacteria | 42533 |
| 6 | Ga0065715_10104321 | 3300005293 | Bacteria | 2970 |
| 7 | Ga0065707_10091172 | 3300005295 | Bacteria | 3993 |
| 8 | Ga0070658_10079674 | 3300005327 | Bacteria | 2690 |
| 9 | Ga0070683_100006806 | 3300005329 | Bacteria | 9604 |
| 10 | Ga0070683_100062439 | 3300005329 | Bacteria | 3464 |
| 11 | Ga0070683_100163185 | 3300005329 | Bacteria | 2114 |
| 12 | Ga0070666_10137277 | 3300005335 | Bacteria | 1702 |
| 13 | Ga0070680_100042057 | 3300005336 | Bacteria | 3706 |
| 14 | Ga0068868_100226201 | 3300005338 | Bacteria | 1568 |
| 15 | Ga0070660_100003489 | 3300005339 | Bacteria | 10834 |
| 16 | Ga0070689_100024765 | 3300005340 | Bacteria | 4504 |
| 17 | Ga0070661_100411955 | 3300005344 | Bacteria | 1070 |
| 18 | Ga0070669_100018253 | 3300005353 | Bacteria | 5012 |
| 19 | Ga0070674_100237939 | 3300005356 | Bacteria | 1424 |
| 20 | Ga0070673_100007902 | 3300005364 | Bacteria | 7051 |
| 21 | Ga0070667_100101443 | 3300005367 | Bacteria | 2486 |
| 22 | Ga0070667_100126654 | 3300005367 | Bacteria | 2226 |
| 23 | Ga0070709_10112069 | 3300005434 | Bacteria | 1835 |
| 24 | Ga0070713_100409851 | 3300005436 | Bacteria | 1267 |
| 25 | Ga0070700_100248498 | 3300005441 | Bacteria | 1275 |
| 26 | Ga0070694_100104069 | 3300005444 | Bacteria | 2012 |
| 27 | Ga0070708_100018422 | 3300005445 | Bacteria | 5844 |
| 28 | Ga0070708_100020728 | 3300005445 | Bacteria | 5550 |
| 29 | Ga0070663_100009487 | 3300005455 | Bacteria | 6029 |
| 30 | Ga0070663_100078723 | 3300005455 | Bacteria | 2417 |
| 31 | Ga0070681_10004100 | 3300005458 | Bacteria | 13769 |
| 32 | Ga0070681_10027203 | 3300005458 | Bacteria | 5751 |
| 33 | Ga0070681_10442004 | 3300005458 | Bacteria | 1212 |
| 34 | Ga0070685_10101294 | 3300005466 | Bacteria | 1759 |
| 35 | Ga0070706_100009059 | 3300005467 | Bacteria | 9263 |
| 36 | Ga0070698_100004962 | 3300005471 | Bacteria | 14580 |
| 37 | Ga0070698_100413951 | 3300005471 | Bacteria | 1282 |
| 38 | Ga0070699_100005057 | 3300005518 | Bacteria | 11609 |
| 39 | Ga0070699_100010430 | 3300005518 | Bacteria | 8041 |
| 40 | Ga0070679_100092199 | 3300005530 | Bacteria | 3017 |
| 41 | Ga0070684_100133696 | 3300005535 | Bacteria | 2239 |
| 42 | Ga0070684_100209282 | 3300005535 | Bacteria | 1777 |
| 43 | Ga0070697_100033689 | 3300005536 | Bacteria | 4127 |
| 44 | Ga0070697_100065682 | 3300005536 | Bacteria | 2965 |
| 45 | Ga0068853_100255074 | 3300005539 | Bacteria | 1611 |
| 46 | Ga0070672_100106865 | 3300005543 | Bacteria | 2277 |
| 47 | Ga0070686_100091167 | 3300005544 | Bacteria | 2039 |
| 48 | Ga0070696_100052793 | 3300005546 | Bacteria | 2828 |
| 49 | Ga0070665_100109558 | 3300005548 | Bacteria | 2764 |
| 50 | Ga0070665_100345927 | 3300005548 | Bacteria | 1492 |
| 51 | Ga0070704_100005398 | 3300005549 | Bacteria | 7444 |
| 52 | Ga0068855_100007706 | 3300005563 | Bacteria | 13003 |
| 53 | Ga0068855_100037426 | 3300005563 | Bacteria | 5769 |
| 54 | Ga0068855_100198230 | 3300005563 | Bacteria | 2261 |
| 55 | Ga0068855_100406711 | 3300005563 | Bacteria | 1491 |
| 56 | Ga0068857_100084493 | 3300005577 | Bacteria | 2836 |
| 57 | Ga0068854_100082238 | 3300005578 | Bacteria | 2380 |
| 58 | Ga0070702_100141454 | 3300005615 | Bacteria | 1533 |
| 59 | Ga0068864_100080001 | 3300005618 | Bacteria | 2863 |
| 60 | Ga0068866_10025656 | 3300005718 | Bacteria | 2773 |
| 61 | Ga0068863_100265397 | 3300005841 | Bacteria | 1661 |
| 62 | Ga0081455_10001555 | 3300005937 | Bacteria | 28179 |
| 63 | Ga0081455_10002076 | 3300005937 | Bacteria | 23889 |
| 64 | Ga0081455_10008768 | 3300005937 | Bacteria | 10470 |
| 65 | Ga0081455_10044348 | 3300005937 | Bacteria | 3881 |
| 66 | Ga0081455_10055152 | 3300005937 | Bacteria | 3382 |
| 67 | Ga0081455_10217206 | 3300005937 | Bacteria | 1420 |
| 68 | Ga0081540_1002923 | 3300005983 | Bacteria | 13756 |
| 69 | Ga0081539_10019455 | 3300005985 | Bacteria | 4646 |
| 70 | Ga0070717_10015928 | 3300006028 | Bacteria | 5819 |
| 71 | Ga0070717_10054441 | 3300006028 | Bacteria | 3299 |
| 72 | Ga0070717_10201423 | 3300006028 | Bacteria | 1744 |
| 73 | Ga0075365_10130583 | 3300006038 | Bacteria | 1738 |
| 74 | Ga0070712_100288144 | 3300006175 | Bacteria | 1325 |
| 75 | Ga0075369_10031986 | 3300006186 | Bacteria | 2224 |
| 76 | Ga0097621_100155598 | 3300006237 | Bacteria | 1962 |
| 77 | Ga0097621_100500030 | 3300006237 | Bacteria | 1101 |
| 78 | Ga0075428_100015159 | 3300006844 | Bacteria | 8549 |
| 79 | Ga0075428_100594867 | 3300006844 | Bacteria | 1182 |
| 80 | Ga0075430_100009149 | 3300006846 | Bacteria | 8369 |
| 81 | Ga0075430_100218435 | 3300006846 | Bacteria | 1582 |
| 82 | Ga0075431_100018426 | 3300006847 | Bacteria | 7109 |
| 83 | Ga0075433_10028952 | 3300006852 | Bacteria | 4714 |
| 84 | Ga0075434_100008951 | 3300006871 | Bacteria | 9323 |
| 85 | Ga0075434_100276654 | 3300006871 | Bacteria | 1698 |
| 86 | Ga0075429_100008886 | 3300006880 | Bacteria | 8733 |
| 87 | Ga0075436_100001243 | 3300006914 | Bacteria | 17319 |
| 88 | Ga0075436_100322393 | 3300006914 | Bacteria | 1110 |
| 89 | Ga0075435_100020921 | 3300007076 | Bacteria | 5024 |
| 90 | Ga0099794_10002299 | 3300007265 | Bacteria | 7025 |
| 91 | Ga0099794_10008987 | 3300007265 | Bacteria | 4171 |
| 92 | Ga0099794_10050643 | 3300007265 | Bacteria | 1998 |
| 93 | Ga0099795_10004297 | 3300007788 | Bacteria | 3658 |
| 94 | Ga0099795_10011809 | 3300007788 | Bacteria | 2626 |
| 95 | Ga0099795_10024949 | 3300007788 | Bacteria | 1999 |
| 96 | Ga0105240_10016507 | 3300009093 | Bacteria | 9994 |
| 97 | Ga0105240_10020582 | 3300009093 | Bacteria | 8793 |
| 98 | Ga0111539_10007260 | 3300009094 | Bacteria | 14189 |
| 99 | Ga0111539_10015669 | 3300009094 | Bacteria | 9422 |
| 100 | Ga0105247_10009021 | 3300009101 | Bacteria | 6074 |
| 101 | Ga0105247_10011300 | 3300009101 | Bacteria | 5385 |
| 102 | Ga0114129_10018961 | 3300009147 | Bacteria | 9800 |
| 103 | Ga0114129_10024866 | 3300009147 | Bacteria | 8491 |
| 104 | Ga0114129_10203045 | 3300009147 | Bacteria | 2683 |
| 105 | Ga0114129_10535767 | 3300009147 | Bacteria | 1525 |
| 106 | Ga0105243_10034348 | 3300009148 | Bacteria | 3925 |
| 107 | Ga0105243_10052495 | 3300009148 | Bacteria | 3229 |
| 108 | Ga0105242_10244586 | 3300009176 | Bacteria | 1614 |
| 109 | Ga0105248_10275210 | 3300009177 | Bacteria | 1895 |
| 110 | Ga0105237_10131772 | 3300009545 | Bacteria | 2494 |
| 111 | Ga0105237_10150598 | 3300009545 | Bacteria | 2323 |
| 112 | Ga0105238_10034573 | 3300009551 | Bacteria | 5142 |
| 113 | Ga0105238_10037267 | 3300009551 | Bacteria | 4944 |
| 114 | Ga0105238_10469470 | 3300009551 | Bacteria | 1257 |
| 115 | Ga0105249_10011069 | 3300009553 | Bacteria | 7927 |
| 116 | Ga0105249_10031333 | 3300009553 | Bacteria | 4809 |
| 117 | Ga0099796_10001698 | 3300010159 | Bacteria | 4566 |
| 118 | Ga0099796_10012365 | 3300010159 | Bacteria | 2409 |
| 119 | Ga0099796_10025076 | 3300010159 | Bacteria | 1879 |
| 120 | Ga0105239_10005103 | 3300010375 | Bacteria | 15500 |
| 121 | Ga0105239_10046428 | 3300010375 | Bacteria | 4760 |
| 122 | Ga0105239_10157445 | 3300010375 | Bacteria | 2537 |
| 123 | Ga0105246_10282562 | 3300011119 | Bacteria | 1332 |
| 124 | Ga0157370_10008657 | 3300013104 | Bacteria | 10951 |
| 125 | Ga0157369_10634955 | 3300013105 | Bacteria | 1102 |
| 126 | Ga0157374_10369865 | 3300013296 | Bacteria | 1427 |
| 127 | Ga0157378_10030990 | 3300013297 | Bacteria | 4722 |
| 128 | Ga0157378_10081545 | 3300013297 | Bacteria | 2924 |
| 129 | Ga0157375_10003393 | 3300013308 | Bacteria | 13812 |
| 130 | Ga0157375_10046525 | 3300013308 | Bacteria | 4231 |
| 131 | Ga0163163_10006150 | 3300014325 | Bacteria | 10461 |
| 132 | Ga0163163_10082676 | 3300014325 | Bacteria | 3215 |
| 133 | Ga0163163_10116319 | 3300014325 | Bacteria | 2705 |
| 134 | Ga0163163_10426129 | 3300014325 | Bacteria | 1386 |
| 135 | Ga0157380_10172391 | 3300014326 | Bacteria | 1892 |
| 136 | Ga0157379_10006642 | 3300014968 | Bacteria | 9980 |
| 137 | Ga0157376_10085855 | 3300014969 | Bacteria | 2712 |
| 138 | Ga0213872_10034640 | 3300021361 | Bacteria | 2311 |
| 139 | Ga0213872_10048695 | 3300021361 | Bacteria | 1926 |
| 140 | Ga0213876_10000130 | 3300021384 | Bacteria | 81967 |
| 141 | Ga0213871_10030191 | 3300021441 | Bacteria | 1409 |
| 142 | Ga0213871_10044856 | 3300021441 | Bacteria | 1196 |
| 143 | Ga0228598_1005683 | 3300024227 | Bacteria | 2599 |
| 144 | Ga0209233_1002293 | 3300025261 | Bacteria | 7134 |
| 145 | Ga0209233_1008990 | 3300025261 | Bacteria | 3057 |
| 146 | Ga0209025_1053107 | 3300025294 | Bacteria | 1593 |
| 147 | Ga0209257_1010814 | 3300025304 | Bacteria | 4526 |
| 148 | Ga0207697_10035372 | 3300025315 | Bacteria | 2045 |
| 149 | Ga0207692_10066504 | 3300025898 | Bacteria | 1884 |
| 150 | Ga0207699_10259310 | 3300025906 | Bacteria | 1201 |
| 151 | Ga0207705_10003526 | 3300025909 | Bacteria | 11920 |
| 152 | Ga0207707_10003874 | 3300025912 | Bacteria | 13268 |
| 153 | Ga0207707_10017265 | 3300025912 | Bacteria | 6289 |
| 154 | Ga0207695_10069050 | 3300025913 | Bacteria | 3618 |
| 155 | Ga0207695_10081479 | 3300025913 | Bacteria | 3275 |
| 156 | Ga0207671_10162612 | 3300025914 | Bacteria | 1729 |
| 157 | Ga0207693_10017660 | 3300025915 | Bacteria | 5688 |
| 158 | Ga0207663_10025255 | 3300025916 | Bacteria | 3432 |
| 159 | Ga0207660_10089440 | 3300025917 | Bacteria | 2279 |
| 160 | Ga0207657_10013834 | 3300025919 | Bacteria | 7897 |
| 161 | Ga0207644_10127265 | 3300025931 | Bacteria | 1946 |
| 162 | Ga0207691_10150524 | 3300025940 | Bacteria | 2046 |
| 163 | Ga0207711_10119510 | 3300025941 | Bacteria | 2351 |
| 164 | Ga0207661_10158516 | 3300025944 | Bacteria | 1962 |
| 165 | Ga0207661_10497456 | 3300025944 | Bacteria | 1114 |
| 166 | Ga0207667_10037084 | 3300025949 | Bacteria | 5214 |
| 167 | Ga0207658_10051795 | 3300025986 | Bacteria | 3027 |
| 168 | Ga0207703_10021926 | 3300026035 | Bacteria | 5002 |
| 169 | Ga0207639_10306754 | 3300026041 | Bacteria | 1405 |
| 170 | Ga0207678_10027109 | 3300026067 | Bacteria | 4996 |
| 171 | Ga0207702_10071299 | 3300026078 | Bacteria | 2991 |
| 172 | Ga0207641_10050088 | 3300026088 | Bacteria | 3533 |
| 173 | Ga0207676_10067232 | 3300026095 | Bacteria | 2862 |
| 174 | Ga0207683_10039727 | 3300026121 | Bacteria | 4105 |
| 175 | Ga0209179_1002942 | 3300027512 | Bacteria | 2381 |
| 176 | Ga0209974_10029266 | 3300027876 | Bacteria | 1824 |
| 177 | Ga0207428_10000219 | 3300027907 | Bacteria | 79717 |
| 178 | Ga0268266_10071331 | 3300028379 | Bacteria | 3011 |
| 179 | Ga0268266_10285401 | 3300028379 | Bacteria | 1536 |
| 180 | Ga0265334_10001560 | 3300028573 | Bacteria | 11039 |
| 181 | Ga0265338_10026478 | 3300028800 | Bacteria | 5846 |
| 182 | Ga0265338_10056371 | 3300028800 | Bacteria | 3485 |
| 183 | Ga0265338_10087780 | 3300028800 | Bacteria | 2583 |
| 184 | Ga0265338_10161562 | 3300028800 | Bacteria | 1729 |
| 185 | Ga0265325_10008336 | 3300031241 | Bacteria | 6121 |
| 186 | Ga0265325_10150068 | 3300031241 | Bacteria | 1103 |
| 187 | Ga0265340_10033125 | 3300031247 | Bacteria | 2575 |
| 188 | Ga0265340_10045766 | 3300031247 | Bacteria | 2136 |
| 189 | Ga0265339_10000137 | 3300031249 | Bacteria | 60322 |
| 190 | Ga0265339_10002052 | 3300031249 | Bacteria | 14798 |
| 191 | Ga0265327_10000742 | 3300031251 | Bacteria | 50671 |
| 192 | Ga0265327_10000881 | 3300031251 | Bacteria | 44377 |
| 193 | Ga0265327_10003707 | 3300031251 | Bacteria | 14241 |
| 194 | Ga0265327_10033545 | 3300031251 | Bacteria | 2859 |
| 195 | Ga0265327_10033945 | 3300031251 | Bacteria | 2837 |
| 196 | Ga0265316_10001619 | 3300031344 | Bacteria | 24014 |
| 197 | Ga0265316_10004775 | 3300031344 | Bacteria | 13370 |
| 198 | Ga0265316_10068276 | 3300031344 | Bacteria | 2747 |
| 199 | Ga0265313_10000782 | 3300031595 | Bacteria | 32152 |
| 200 | Ga0307508_10000105 | 3300031616 | Bacteria | 99107 |
| 201 | Ga0316575_10003138 | 3300031665 | Bacteria | 5647 |
| 202 | Ga0316575_10005544 | 3300031665 | Bacteria | 4501 |
| 203 | Ga0316575_10043597 | 3300031665 | Bacteria | 1778 |
| 204 | Ga0316579_10000638 | 3300031691 | Bacteria | 11884 |
| 205 | Ga0316579_10001822 | 3300031691 | Bacteria | 7867 |
| 206 | Ga0316579_10004581 | 3300031691 | Bacteria | 5501 |
| 207 | Ga0316579_10008234 | 3300031691 | Bacteria | 4340 |
| 208 | Ga0316579_10022911 | 3300031691 | Bacteria | 2798 |
| 209 | Ga0316579_10027196 | 3300031691 | Bacteria | 2595 |
| 210 | Ga0265314_10004203 | 3300031711 | Bacteria | 13513 |
| 211 | Ga0265314_10021511 | 3300031711 | Bacteria | 4956 |
| 212 | Ga0265314_10080132 | 3300031711 | Bacteria | 2157 |
| 213 | Ga0316576_10083088 | 3300031727 | Bacteria | 2379 |
| 214 | Ga0316576_10172436 | 3300031727 | Bacteria | 1633 |
| 215 | Ga0316578_10005177 | 3300031728 | Bacteria | 6289 |
| 216 | Ga0316578_10055741 | 3300031728 | Bacteria | 2320 |
| 217 | Ga0307516_10000657 | 3300031730 | Bacteria | 46760 |
| 218 | Ga0307516_10025929 | 3300031730 | Bacteria | 5960 |
| 219 | Ga0316577_10002289 | 3300031733 | Bacteria | 9440 |
| 220 | Ga0316577_10002995 | 3300031733 | Bacteria | 8458 |
| 221 | Ga0307406_10309247 | 3300031901 | Bacteria | 1218 |
| 222 | Ga0307409_100067374 | 3300031995 | Bacteria | 2827 |
| 223 | Ga0316585_10000195 | 3300032137 | Bacteria | 12419 |
| 224 | Ga0316585_10002967 | 3300032137 | Bacteria | 4632 |
| 225 | Ga0316580_10001428 | 3300032139 | Bacteria | 6234 |
| 226 | Ga0316593_10088053 | 3300032168 | Bacteria | 1091 |
| 227 | Ga0315911_1000003 | 3300033442 | Bacteria | 502217 |
| 228 | Ga0373926_0003849 | 3300035083 | Bacteria | 4901 |
| 229 | Ga0373944_0000604 | 3300035089 | Bacteria | 8539 |
| 230 | Ga0373949_0025860 | 3300035090 | Bacteria | 1372 |
| 231 | Ga0373932_0004658 | 3300035112 | Bacteria | 3239 |
| 232 | Ga0373936_0003825 | 3300035113 | Bacteria | 5668 |
| 233 | Ga0373939_0044504 | 3300035114 | Bacteria | 1351 |
| 234 | Ga0373945_0001800 | 3300035116 | Bacteria | 6616 |
| 235 | Ga0373954_0000062 | 3300035118 | Bacteria | 38112 |
| 236 | Ga0373954_0025920 | 3300035118 | Bacteria | 2684 |
| 237 | Ga0373957_0020306 | 3300035120 | Bacteria | 2346 |
| 238 | Ga0373957_0072616 | 3300035120 | Bacteria | 1348 |
| 239 | Ga0373943_0007472 | 3300035170 | Bacteria | 4910 |
| 240 | Ga0373946_0004350 | 3300035171 | Bacteria | 5069 |
| 241 | Ga0373946_0029888 | 3300035171 | Bacteria | 2172 |
| 242 | Ga0373955_0073867 | 3300035172 | Bacteria | 1912 |
| 243 | Ga0373961_0028767 | 3300035241 | Bacteria | 1534 |
| 244 | Ga0316574_0006936 | 3300035398 | Bacteria | 6168 |
| 245 | Ga0316574_0047906 | 3300035398 | Bacteria | 2654 |
| 246 | Ga0316574_0089001 | 3300035398 | Bacteria | 1966 |
| 247 | Ga0316574_0095231 | 3300035398 | Bacteria | 1902 |
| 248 | Ga0373924_0003093 | 3300035410 | Bacteria | 5679 |
| 249 | Ga0373931_0031368 | 3300035691 | Bacteria | 2743 |
| 250 | Ga0373935_0002036 | 3300035692 | Bacteria | 11424 |
| 251 | Ga0373935_0016174 | 3300035692 | Bacteria | 4515 |
| 252 | Ga0373935_0030724 | 3300035692 | Bacteria | 3330 |
| 253 | Ga0373927_0008757 | 3300035695 | Bacteria | 6798 |
| 254 | Ga0373927_0017373 | 3300035695 | Bacteria | 4735 |
| 255 | Ga0373927_0031229 | 3300035695 | Bacteria | 3473 |
| 256 | Ga0373927_0193005 | 3300035695 | Bacteria | 1336 |
| 257 | Ga0373933_0005995 | 3300035724 | Bacteria | 6615 |
| 258 | Ga0373933_0086134 | 3300035724 | Bacteria | 1933 |
| 259 | Ga0373947_0004669 | 3300035725 | Bacteria | 8029 |
| 260 | Ga0373947_0016784 | 3300035725 | Bacteria | 4206 |
| 261 | Ga0373947_0048990 | 3300035725 | Bacteria | 2536 |
| 262 | Ga0373937_0002933 | 3300036401 | Bacteria | 14270 |
| 263 | Ga0373937_0006804 | 3300036401 | Bacteria | 9867 |
| 264 | Ga0373937_0008181 | 3300036401 | Bacteria | 9084 |
| 265 | Ga0373937_0029181 | 3300036401 | Bacteria | 4995 |
| 266 | Ga0316582_0003599 | 3300036647 | Bacteria | 7639 |
| 267 | Ga0316582_0004787 | 3300036647 | Bacteria | 6896 |
| 268 | Ga0316582_0010970 | 3300036647 | Bacteria | 4991 |
| 269 | Ga0316582_0037763 | 3300036647 | Bacteria | 2997 |
| 270 | Ga0316584_0006337 | 3300036712 | Bacteria | 8016 |
| 271 | Ga0316584_0017667 | 3300036712 | Bacteria | 5134 |
| 272 | Ga0316584_0042040 | 3300036712 | Bacteria | 3408 |
| 273 | Ga0316584_0049027 | 3300036712 | Bacteria | 3156 |
| 274 | Ga0316584_0063254 | 3300036712 | Bacteria | 2770 |
| 275 | Ga0316584_0087930 | 3300036712 | Bacteria | 2326 |
| 276 | Ga0316584_0139275 | 3300036712 | Bacteria | 1810 |
| 277 | Ga0373925_0033905 | 3300037068 | Bacteria | 3762 |
| 278 | Ga0373925_0038765 | 3300037068 | Bacteria | 3524 |
| 279 | Ga0373925_0073484 | 3300037068 | Bacteria | 2588 |
| 280 | Ga0395899_0002665 | 3300037312 | Bacteria | 14397 |
| 281 | Ga0395899_0006791 | 3300037312 | Bacteria | 8869 |
| 282 | Ga0395900_0000381 | 3300037418 | Bacteria | 63938 |
| 283 | Ga0395900_0009733 | 3300037418 | Bacteria | 9844 |
| 284 | Ga0395900_0097182 | 3300037418 | Bacteria | 3026 |
| 285 | Ga0395898_0007562 | 3300037466 | Bacteria | 11536 |
| 286 | Ga0395898_0049607 | 3300037466 | Bacteria | 4112 |
| 287 | Ga0395898_0077798 | 3300037466 | Bacteria | 3202 |
| 288 | Ga0395905_0004769 | 3300037471 | Bacteria | 14012 |
| 289 | Ga0395905_0020451 | 3300037471 | Bacteria | 6271 |
| 290 | Ga0316581_0000030 | 3300037588 | Bacteria | 15125 |
| 291 | Ga0316581_0005303 | 3300037588 | Bacteria | 3348 |
| 292 | Ga0316581_0042087 | 3300037588 | Bacteria | 1393 |
| 293 | Ga0395901_0002517 | 3300038443 | Bacteria | 18553 |
| 294 | Ga0395901_0038732 | 3300038443 | Bacteria | 4931 |
| 295 | Ga0395901_0045854 | 3300038443 | Bacteria | 4539 |
| 296 | Ga0395901_0118900 | 3300038443 | Bacteria | 2776 |
| 297 | Ga0400487_03596 | 3300039110 | Bacteria | 6394 |
| 298 | Ga0436365_0031959 | 3300039437 | Bacteria | 106267 |
| 299 | Ga0436365_1292461 | 3300039437 | Bacteria | 3052 |
| 300 | Ga0436360_0073247 | 3300039438 | Bacteria | 3068 |
| 301 | Ga0436360_0149353 | 3300039438 | Bacteria | 3896 |
| 302 | Ga0436360_0361778 | 3300039438 | Bacteria | 2261 |
| 303 | Ga0436360_0708065 | 3300039438 | Bacteria | 1156 |
| 304 | Ga0436360_1074814 | 3300039438 | Bacteria | 5161 |
| 305 | Ga0436360_1367695 | 3300039438 | Bacteria | 2477 |
| 306 | Ga0436361_0063454 | 3300039447 | Bacteria | 2685 |
| 307 | Ga0436361_0369023 | 3300039447 | Bacteria | 6346 |
| 308 | Ga0436361_0428243 | 3300039447 | Bacteria | 2594 |
| 309 | Ga0436361_0539018 | 3300039447 | Bacteria | 2789 |
| 310 | Ga0436363_0642160 | 3300039450 | Bacteria | 1756 |
| 311 | Ga0436363_1372834 | 3300039450 | Bacteria | 2160 |
| 312 | Ga0436362_0994339 | 3300039453 | Bacteria | 2852 |
| 313 | Ga0436362_1025120 | 3300039453 | Bacteria | 1305 |
| 314 | Ga0439436_0002272 | 3300041404 | Bacteria | 5754 |
| 315 | Ga0439465_0002393 | 3300041413 | Bacteria | 6138 |
| 316 | Ga0439441_007658 | 3300042001 | Bacteria | 1747 |
| 317 | Ga0439462_0034633 | 3300042015 | Bacteria | 1341 |
| 318 | Ga0450920_006237 | 3300042122 | Bacteria | 2140 |
| 319 | Ga0439459_0022052 | 3300042438 | Bacteria | 1229 |
| 320 | Ga0450918_004771 | 3300042531 | Bacteria | 2458 |
| 321 | Ga0451577_0000035 | 3300042876 | Bacteria | 373467 |
| 322 | Ga0451577_0000471 | 3300042876 | Bacteria | 69254 |
| 323 | Ga0451577_0000739 | 3300042876 | Bacteria | 50382 |
| 324 | Ga0451577_0002216 | 3300042876 | Bacteria | 23670 |
| 325 | Ga0451577_0015764 | 3300042876 | Bacteria | 7015 |
| 326 | Ga0451577_0045736 | 3300042876 | Bacteria | 3918 |
| 327 | Ga0451577_0211162 | 3300042876 | Bacteria | 1753 |
| 328 | Ga0451577_0305914 | 3300042876 | Bacteria | 1441 |
| 329 | Ga0451577_0330122 | 3300042876 | Bacteria | 1383 |
| 330 | Ga0453683_0000095 | 3300044673 | Bacteria | 132405 |
| 331 | Ga0453683_0190319 | 3300044673 | Bacteria | 1302 |
| 332 | Ga0466961_0051113 | 3300044693 | Bacteria | 2640 |
| 333 | Ga0466963_0035869 | 3300044694 | Bacteria | 3231 |
| 334 | Ga0453684_0000006 | 3300044712 | Bacteria | 1364191 |
| 335 | Ga0453684_0000031 | 3300044712 | Bacteria | 752632 |
| 336 | Ga0453684_0000089 | 3300044712 | Bacteria | 395064 |
| 337 | Ga0453684_0000097 | 3300044712 | Bacteria | 377772 |
| 338 | Ga0453684_0000176 | 3300044712 | Bacteria | 283097 |
| 339 | Ga0453684_0000177 | 3300044712 | Bacteria | 282969 |
| 340 | Ga0453684_0000732 | 3300044712 | Bacteria | 114945 |
| 341 | Ga0453684_0002182 | 3300044712 | Bacteria | 48823 |
| 342 | Ga0453684_0005947 | 3300044712 | Bacteria | 23665 |
| 343 | Ga0453684_0006440 | 3300044712 | Bacteria | 22295 |
| 344 | Ga0453684_0010364 | 3300044712 | Bacteria | 15951 |
| 345 | Ga0453684_0014620 | 3300044712 | Bacteria | 12530 |
| 346 | Ga0453684_0021800 | 3300044712 | Bacteria | 9544 |
| 347 | Ga0453684_0025660 | 3300044712 | Bacteria | 8548 |
| 348 | Ga0453684_0032406 | 3300044712 | Bacteria | 7315 |
| 349 | Ga0453684_0032690 | 3300044712 | Bacteria | 7272 |
| 350 | Ga0453684_0033541 | 3300044712 | Bacteria | 7154 |
| 351 | Ga0453684_0073235 | 3300044712 | Bacteria | 4320 |
| 352 | Ga0453684_0100025 | 3300044712 | Bacteria | 3550 |
| 353 | Ga0453684_0100546 | 3300044712 | Bacteria | 3539 |
| 354 | Ga0453684_0105141 | 3300044712 | Bacteria | 3444 |
| 355 | Ga0453684_0133742 | 3300044712 | Bacteria | 2972 |
| 356 | Ga0453684_0922051 | 3300044712 | Bacteria | 934 |
| 357 | Ga0466971_0011207 | 3300044719 | Bacteria | 3928 |
| 358 | Ga0451576_0000056 | 3300045051 | Bacteria | 303398 |
| 359 | Ga0451576_0000361 | 3300045051 | Bacteria | 109138 |
| 360 | Ga0451576_0000806 | 3300045051 | Bacteria | 61449 |
| 361 | Ga0451576_0001345 | 3300045051 | Bacteria | 42474 |
| 362 | Ga0451576_0023943 | 3300045051 | Bacteria | 6601 |
| 363 | Ga0451576_0025858 | 3300045051 | Bacteria | 6322 |
| 364 | Ga0451576_0173741 | 3300045051 | Bacteria | 2249 |
| 365 | Ga0451576_0334927 | 3300045051 | Bacteria | 1584 |
| 366 | Ga0451576_0609320 | 3300045051 | Bacteria | 1148 |
| 367 | Ga0466958_0022162 | 3300045836 | Bacteria | 3719 |
| 368 | Ga0495592_0003291 | 3300046454 | Bacteria | 11580 |
| 369 | Ga0495592_0179686 | 3300046454 | Bacteria | 1442 |
| 370 | Ga0495592_0428408 | 3300046454 | Bacteria | 833 |
| 371 | Ga0495603_0002952 | 3300046455 | Bacteria | 10061 |
| 372 | Ga0495603_0027620 | 3300046455 | Bacteria | 3424 |
| 373 | Ga0495591_042423 | 3300046458 | Bacteria | 1286 |
| 374 | Ga0495629_0001640 | 3300046459 | Bacteria | 17572 |
| 375 | Ga0495629_0020353 | 3300046459 | Bacteria | 4740 |
| 376 | Ga0495629_0023236 | 3300046459 | Bacteria | 4418 |
| 377 | Ga0495641_0003962 | 3300046461 | Bacteria | 10757 |
| 378 | Ga0495641_0011719 | 3300046461 | Bacteria | 4965 |
| 379 | Ga0495651_0008882 | 3300046462 | Bacteria | 7716 |
| 380 | Ga0495653_0020998 | 3300046463 | Bacteria | 5291 |
| 381 | Ga0495580_0004604 | 3300046472 | Bacteria | 11573 |
| 382 | Ga0495582_0005832 | 3300046473 | Bacteria | 6861 |
| 383 | Ga0495582_0011370 | 3300046473 | Bacteria | 4905 |
| 384 | Ga0495582_0045136 | 3300046473 | Bacteria | 2427 |
| 385 | Ga0495582_0108975 | 3300046473 | Bacteria | 1555 |
| 386 | Ga0495639_0001566 | 3300046475 | Bacteria | 10222 |
| 387 | Ga0495639_0026056 | 3300046475 | Bacteria | 2582 |
| 388 | Ga0495662_0010471 | 3300046476 | Bacteria | 4540 |
| 389 | Ga0495662_0091346 | 3300046476 | Bacteria | 1485 |
| 390 | Ga0495664_0005011 | 3300046477 | Bacteria | 7249 |
| 391 | Ga0495664_0016146 | 3300046477 | Bacteria | 4252 |
| 392 | Ga0495584_0017160 | 3300046491 | Bacteria | 3689 |
| 393 | Ga0495584_0054883 | 3300046491 | Bacteria | 2005 |
| 394 | Ga0495585_0018483 | 3300046492 | Bacteria | 4019 |
| 395 | Ga0495585_0083604 | 3300046492 | Bacteria | 1727 |
| 396 | Ga0495594_0016763 | 3300046499 | Bacteria | 3863 |
| 397 | Ga0495594_0060909 | 3300046499 | Bacteria | 2088 |
| 398 | Ga0495594_0216700 | 3300046499 | Bacteria | 1092 |
| 399 | Ga0495607_0007920 | 3300046501 | Bacteria | 7305 |
| 400 | Ga0495606_0032077 | 3300046507 | Bacteria | 3644 |
| 401 | Ga0495608_0006686 | 3300046511 | Bacteria | 8177 |
| 402 | Ga0495608_0010335 | 3300046511 | Bacteria | 6513 |
| 403 | Ga0495608_0186712 | 3300046511 | Bacteria | 1310 |
| 404 | Ga0495618_0012578 | 3300046514 | Bacteria | 5141 |
| 405 | Ga0495618_0123901 | 3300046514 | Bacteria | 1655 |
| 406 | Ga0495628_0010228 | 3300046516 | Bacteria | 7981 |
| 407 | Ga0495630_0041990 | 3300046517 | Bacteria | 3415 |
| 408 | Ga0495644_0004819 | 3300046523 | Bacteria | 5305 |
| 409 | Ga0495648_0015002 | 3300046524 | Bacteria | 5644 |
| 410 | Ga0495666_0004818 | 3300046526 | Bacteria | 6823 |
| 411 | Ga0495666_0006104 | 3300046526 | Bacteria | 6060 |
| 412 | Ga0495652_0018574 | 3300046529 | Bacteria | 6197 |
| 413 | Ga0495652_0040865 | 3300046529 | Bacteria | 4008 |
| 414 | Ga0495665_0008763 | 3300046531 | Bacteria | 5491 |
| 415 | Ga0495665_0021877 | 3300046531 | Bacteria | 3439 |
| 416 | Ga0495640_0041943 | 3300046533 | Bacteria | 3195 |
| 417 | Ga0495640_0061733 | 3300046533 | Bacteria | 2544 |
| 418 | Ga0495586_0004394 | 3300046535 | Bacteria | 7529 |
| 419 | Ga0495587_0018466 | 3300046536 | Bacteria | 4325 |
| 420 | Ga0495587_0097553 | 3300046536 | Bacteria | 1695 |
| 421 | Ga0495621_0081752 | 3300046539 | Bacteria | 1205 |
| 422 | Ga0495645_0001251 | 3300046543 | Bacteria | 17319 |
| 423 | Ga0495622_0017687 | 3300046557 | Bacteria | 3318 |
| 424 | Ga0495633_0010960 | 3300046558 | Bacteria | 4923 |
| 425 | Ga0495667_0024282 | 3300046559 | Bacteria | 4082 |
| 426 | Ga0495667_0067972 | 3300046559 | Bacteria | 2328 |
| 427 | Ga0495667_0225723 | 3300046559 | Bacteria | 1194 |
| 428 | Ga0495656_0001215 | 3300046615 | Bacteria | 8389 |
| 429 | Ga0495656_0077176 | 3300046615 | Bacteria | 1494 |
| 430 | Ga0495668_0198921 | 3300046616 | Bacteria | 1097 |
| 431 | Ga0495634_0078762 | 3300046642 | Bacteria | 2158 |
| 432 | Ga0495611_0003868 | 3300046648 | Bacteria | 6533 |
| 433 | Ga0495635_0007616 | 3300046663 | Bacteria | 7556 |
| 434 | Ga0495635_0117106 | 3300046663 | Bacteria | 1818 |
| 435 | Ga0495659_0001029 | 3300046664 | Bacteria | 9737 |
| 436 | Ga0495588_0003197 | 3300046674 | Bacteria | 7093 |
| 437 | Ga0495588_0075845 | 3300046674 | Bacteria | 1752 |
| 438 | Ga0495657_0028272 | 3300046675 | Bacteria | 3947 |
| 439 | Ga0495599_0005701 | 3300046678 | Bacteria | 7470 |
| 440 | Ga0495599_0028550 | 3300046678 | Bacteria | 3497 |
| 441 | Ga0495646_0009398 | 3300046680 | Bacteria | 6203 |
| 442 | Ga0495646_0111340 | 3300046680 | Bacteria | 1558 |
| 443 | Ga0495647_0004286 | 3300046681 | Bacteria | 4620 |
| 444 | Ga0495647_0010294 | 3300046681 | Bacteria | 3183 |
| 445 | Ga0495658_0002463 | 3300046683 | Bacteria | 9322 |
| 446 | Ga0495658_0005737 | 3300046683 | Bacteria | 6099 |
| 447 | Ga0495658_0068503 | 3300046683 | Bacteria | 2055 |
| 448 | Ga0495658_0239895 | 3300046683 | Bacteria | 1138 |
| 449 | Ga0495613_0000615 | 3300046689 | Bacteria | 28420 |
| 450 | Ga0495613_0013607 | 3300046689 | Bacteria | 6039 |
| 451 | Ga0495613_0029172 | 3300046689 | Bacteria | 4103 |
| 452 | Ga0495624_0009958 | 3300046690 | Bacteria | 6572 |
| 453 | Ga0495624_0018144 | 3300046690 | Bacteria | 4708 |
| 454 | Ga0495670_0001068 | 3300046691 | Bacteria | 13296 |
| 455 | Ga0495670_0022339 | 3300046691 | Bacteria | 3124 |
| 456 | Ga0495671_0041925 | 3300046692 | Bacteria | 2303 |
| 457 | Ga0495589_0072186 | 3300046794 | Bacteria | 1686 |
| 458 | Ga0495600_0005021 | 3300046809 | Bacteria | 7954 |
| 459 | Ga0495600_0025066 | 3300046809 | Bacteria | 3843 |
| 460 | Ga0495600_0145126 | 3300046809 | Bacteria | 1538 |
| 461 | Ga0495600_0298987 | 3300046809 | Bacteria | 1016 |
| 462 | Ga0495581_0002747 | 3300047315 | Bacteria | 10042 |
| 463 | Ga0495581_0082642 | 3300047315 | Bacteria | 1860 |
| 464 | Ga0495604_0004824 | 3300047317 | Bacteria | 10692 |
| 465 | Ga0495604_0022472 | 3300047317 | Bacteria | 5036 |
| 466 | Ga0495604_0023196 | 3300047317 | Bacteria | 4953 |
| 467 | Ga0495636_0046928 | 3300047318 | Bacteria | 1803 |
| 468 | Ga0495636_0051239 | 3300047318 | Bacteria | 1730 |
| 469 | Ga0495674_0038965 | 3300047319 | Bacteria | 4262 |
| 470 | Ga0495674_0044084 | 3300047319 | Bacteria | 3967 |
| 471 | Ga0495674_0151742 | 3300047319 | Bacteria | 1942 |
| 472 | Ga0495676_0014348 | 3300047321 | Bacteria | 7090 |
| 473 | Ga0495676_0056171 | 3300047321 | Bacteria | 3115 |
| 474 | Ga0495676_0095015 | 3300047321 | Bacteria | 2219 |
| 475 | Ga0495680_0019669 | 3300047322 | Bacteria | 5697 |
| 476 | Ga0495680_0035652 | 3300047322 | Bacteria | 4005 |
| 477 | Ga0495680_0083563 | 3300047322 | Bacteria | 2407 |
| 478 | Ga0495680_0086644 | 3300047322 | Bacteria | 2356 |
| 479 | Ga0495675_0006704 | 3300047444 | Bacteria | 7057 |
| 480 | Ga0495679_048937 | 3300047446 | Bacteria | 1276 |
| 481 | Ga0495684_0003597 | 3300047471 | Bacteria | 12086 |
| 482 | Ga0495684_0046226 | 3300047471 | Bacteria | 3330 |
| 483 | Ga0495684_0348629 | 3300047471 | Bacteria | 1052 |
| 484 | Ga0495593_0014183 | 3300047673 | Bacteria | 4534 |
| 485 | Ga0495602_0005528 | 3300048088 | Bacteria | 13260 |
| 486 | Ga0495602_0199172 | 3300048088 | Bacteria | 1529 |
| 487 | Ga0496100_0000842 | 3300048903 | Bacteria | 14711 |
| 488 | Ga0496100_0029617 | 3300048903 | Bacteria | 3388 |
| 489 | Ga0496101_0001211 | 3300048904 | Bacteria | 15442 |
| 490 | Ga0496101_0001457 | 3300048904 | Bacteria | 14119 |
| 491 | Ga0496101_0010153 | 3300048904 | Bacteria | 6211 |
| 492 | Ga0496101_0058675 | 3300048904 | Bacteria | 2788 |
| 493 | Ga0496102_0009064 | 3300048905 | Bacteria | 8537 |
| 494 | Ga0496102_0011697 | 3300048905 | Bacteria | 7572 |
| 495 | Ga0496102_0022723 | 3300048905 | Bacteria | 5558 |
| 496 | Ga0496102_0070554 | 3300048905 | Bacteria | 3208 |
| 497 | Ga0496102_0257613 | 3300048905 | Bacteria | 1645 |
| 498 | Ga0496103_0010836 | 3300048906 | Bacteria | 5396 |
| 499 | Ga0496103_0033318 | 3300048906 | Bacteria | 3147 |
| 500 | Ga0496104_0000602 | 3300048907 | Bacteria | 30848 |
| 501 | Ga0496104_0016899 | 3300048907 | Bacteria | 6635 |
| 502 | Ga0496104_0026031 | 3300048907 | Bacteria | 5396 |
| 503 | Ga0496104_0406781 | 3300048907 | Bacteria | 1273 |
| 504 | Ga0496105_0003655 | 3300048908 | Bacteria | 11434 |
| 505 | Ga0496105_0015020 | 3300048908 | Bacteria | 6161 |
| 506 | Ga0496105_0064241 | 3300048908 | Bacteria | 3028 |
| 507 | Ga0496105_0077378 | 3300048908 | Bacteria | 2748 |
| 508 | Ga0496105_0115671 | 3300048908 | Bacteria | 2212 |
| 509 | Ga0496106_0000405 | 3300048909 | Bacteria | 30644 |
| 510 | Ga0496106_0032059 | 3300048909 | Bacteria | 3916 |
| 511 | Ga0496106_0092378 | 3300048909 | Bacteria | 2337 |
| 512 | Ga0496106_0194991 | 3300048909 | Bacteria | 1611 |
| 513 | Ga0496107_0001082 | 3300048910 | Bacteria | 16345 |
| 514 | Ga0496108_0003869 | 3300048911 | Bacteria | 12021 |
| 515 | Ga0496108_0011968 | 3300048911 | Bacteria | 7058 |
| 516 | Ga0496108_0012570 | 3300048911 | Bacteria | 6896 |
| 517 | Ga0496108_0034009 | 3300048911 | Bacteria | 4233 |
| 518 | Ga0496108_0043876 | 3300048911 | Bacteria | 3735 |
| 519 | Ga0496108_0507883 | 3300048911 | Bacteria | 1053 |
| 520 | Ga0496109_0006129 | 3300048912 | Bacteria | 10104 |
| 521 | Ga0496109_0006276 | 3300048912 | Bacteria | 10002 |
| 522 | Ga0496109_0009555 | 3300048912 | Bacteria | 8267 |
| 523 | Ga0496109_0052215 | 3300048912 | Bacteria | 3725 |
| 524 | Ga0496109_0123808 | 3300048912 | Bacteria | 2410 |
| 525 | Ga0496110_0000468 | 3300048913 | Bacteria | 27460 |
| 526 | Ga0496110_0015322 | 3300048913 | Bacteria | 6377 |
| 527 | Ga0496110_0045555 | 3300048913 | Bacteria | 3834 |
| 528 | Ga0496110_0056143 | 3300048913 | Bacteria | 3465 |
| 529 | Ga0496110_0075344 | 3300048913 | Bacteria | 2998 |
| 530 | Ga0496111_0001714 | 3300048914 | Bacteria | 12814 |
| 531 | Ga0496111_0004338 | 3300048914 | Bacteria | 8949 |
| 532 | Ga0496111_0037892 | 3300048914 | Bacteria | 3452 |
| 533 | Ga0496112_0000527 | 3300048915 | Bacteria | 26121 |
| 534 | Ga0496112_0004838 | 3300048915 | Bacteria | 11498 |
| 535 | Ga0496112_0011978 | 3300048915 | Bacteria | 7950 |
| 536 | Ga0496112_0023637 | 3300048915 | Bacteria | 5876 |
| 537 | Ga0496112_0089626 | 3300048915 | Bacteria | 3044 |
| 538 | Ga0496112_0113744 | 3300048915 | Bacteria | 2677 |
| 539 | Ga0496112_0372948 | 3300048915 | Bacteria | 1368 |
| 540 | Ga0496113_0003961 | 3300048916 | Bacteria | 8995 |
| 541 | Ga0496113_0004231 | 3300048916 | Bacteria | 8782 |
| 542 | Ga0496113_0011383 | 3300048916 | Bacteria | 5931 |
| 543 | Ga0496113_0037525 | 3300048916 | Bacteria | 3557 |
| 544 | Ga0496114_0005042 | 3300048917 | Bacteria | 10300 |
| 545 | Ga0496114_0104086 | 3300048917 | Bacteria | 2427 |
| 546 | Ga0496114_0104954 | 3300048917 | Bacteria | 2417 |
| 547 | Ga0496115_0005817 | 3300048918 | Bacteria | 8984 |
| 548 | Ga0496115_0013101 | 3300048918 | Bacteria | 6262 |
| 549 | Ga0496115_0069948 | 3300048918 | Bacteria | 2844 |
| 550 | Ga0496115_0388149 | 3300048918 | Bacteria | 1134 |
| 551 | Ga0496126_0027336 | 3300048929 | Bacteria | 5451 |
| 552 | Ga0501031_0026174 | 3300049568 | Bacteria | 3805 |
| 553 | Ga0501032_0092511 | 3300049569 | Bacteria | 2006 |
| 554 | Ga0501033_0007670 | 3300049570 | Bacteria | 8373 |
| 555 | Ga0501034_0544156 | 3300049571 | Bacteria | 1071 |
| 556 | Ga0501036_0016482 | 3300049572 | Bacteria | 6172 |
| 557 | Ga0501036_0058938 | 3300049572 | Bacteria | 3253 |
| 558 | Ga0501037_0105216 | 3300049573 | Bacteria | 2034 |
| 559 | Ga0501037_0110705 | 3300049573 | Bacteria | 1978 |
| 560 | Ga0501038_0000545 | 3300049574 | Bacteria | 33068 |
| 561 | Ga0501038_0043917 | 3300049574 | Bacteria | 3885 |
| 562 | Ga0501038_0090782 | 3300049574 | Bacteria | 2560 |
| 563 | Ga0501039_0021356 | 3300049575 | Bacteria | 4967 |
| 564 | Ga0501039_0032164 | 3300049575 | Bacteria | 4043 |
| 565 | Ga0501040_0009859 | 3300049576 | Bacteria | 6238 |
| 566 | Ga0501040_0044710 | 3300049576 | Bacteria | 3020 |
| 567 | Ga0501041_0019389 | 3300049577 | Bacteria | 4061 |
| 568 | Ga0501042_0005234 | 3300049578 | Bacteria | 8334 |
| 569 | Ga0501042_0159609 | 3300049578 | Bacteria | 1627 |
| 570 | Ga0501042_0311537 | 3300049578 | Bacteria | 1137 |
| 571 | Ga0501043_0007360 | 3300049579 | Bacteria | 8734 |
| 572 | Ga0501043_0013428 | 3300049579 | Bacteria | 6406 |
| 573 | Ga0501043_0160774 | 3300049579 | Bacteria | 1755 |
| 574 | Ga0501046_0006010 | 3300049580 | Bacteria | 10799 |
| 575 | Ga0501046_0014699 | 3300049580 | Bacteria | 6592 |
| 576 | Ga0501047_0002872 | 3300049581 | Bacteria | 16357 |
| 577 | Ga0501047_0036178 | 3300049581 | Bacteria | 4770 |
| 578 | Ga0501047_0096900 | 3300049581 | Bacteria | 2828 |
| 579 | Ga0501047_0124159 | 3300049581 | Bacteria | 2462 |
| 580 | Ga0501047_0235156 | 3300049581 | Bacteria | 1684 |
| 581 | Ga0501067_0014516 | 3300049583 | Bacteria | 4361 |
| 582 | Ga0501067_0046793 | 3300049583 | Bacteria | 2401 |
| 583 | Ga0501068_0021670 | 3300049584 | Bacteria | 3754 |
| 584 | Ga0501069_0007215 | 3300049585 | Bacteria | 5825 |
| 585 | Ga0501070_0003270 | 3300049586 | Bacteria | 14061 |
| 586 | Ga0501070_0043932 | 3300049586 | Bacteria | 3718 |
| 587 | Ga0501070_0044384 | 3300049586 | Bacteria | 3699 |
| 588 | Ga0501071_0139943 | 3300049587 | Bacteria | 1802 |
| 589 | Ga0501071_0156422 | 3300049587 | Bacteria | 1702 |
| 590 | Ga0501072_0013914 | 3300049588 | Bacteria | 6166 |
| 591 | Ga0501074_0011655 | 3300049590 | Bacteria | 6389 |
| 592 | Ga0501074_0035356 | 3300049590 | Bacteria | 3620 |
| 593 | Ga0501074_0043753 | 3300049590 | Bacteria | 3241 |
| 594 | Ga0501075_0023569 | 3300049591 | Bacteria | 4508 |
| 595 | Ga0501076_0009701 | 3300049592 | Bacteria | 7112 |
| 596 | Ga0501076_0016338 | 3300049592 | Bacteria | 5628 |
| 597 | Ga0501076_0114869 | 3300049592 | Bacteria | 2178 |
| 598 | Ga0501076_0336498 | 3300049592 | Bacteria | 1239 |
| 599 | Ga0501077_0005430 | 3300049593 | Bacteria | 7754 |
| 600 | Ga0501077_0061228 | 3300049593 | Bacteria | 2388 |
| 601 | Ga0501079_0007946 | 3300049741 | Bacteria | 8044 |
| 602 | Ga0501079_0010988 | 3300049741 | Bacteria | 6898 |
| 603 | Ga0501079_0081736 | 3300049741 | Bacteria | 2498 |
| 604 | Ga0501080_0000340 | 3300049742 | Bacteria | 35875 |
| 605 | Ga0501080_0019745 | 3300049742 | Bacteria | 6240 |
| 606 | Ga0501080_0082162 | 3300049742 | Bacteria | 2993 |
| 607 | Ga0501080_0084625 | 3300049742 | Bacteria | 2947 |
| 608 | Ga0501081_0002877 | 3300049743 | Bacteria | 10931 |
| 609 | Ga0501081_0011140 | 3300049743 | Bacteria | 5880 |
| 610 | Ga0501081_0013714 | 3300049743 | Bacteria | 5329 |
| 611 | Ga0501035_0067270 | 3300049822 | Bacteria | 3180 |
| 612 | Ga0501035_0160626 | 3300049822 | Bacteria | 1945 |
| 613 | Ga0501035_0230697 | 3300049822 | Bacteria | 1578 |
| 614 | Ga0501035_0246704 | 3300049822 | Bacteria | 1517 |
| 615 | Ga0501044_0014341 | 3300049823 | Bacteria | 8556 |
| 616 | Ga0501045_0011927 | 3300049824 | Bacteria | 6110 |
| 617 | Ga0501045_0020987 | 3300049824 | Bacteria | 4669 |
| 618 | Ga0501045_0094827 | 3300049824 | Bacteria | 2207 |
| 619 | nmdc:mga03683_17787_c1 | 3300050489 | Bacteria | 2695 |
| 620 | nmdc:mga05p37_33457_c1 | 3300050507 | Bacteria | 6295 |
| 621 | nmdc:mga05p37_44774_c1 | 3300050507 | Bacteria | 5444 |
| 622 | nmdc:mga09592_10439_c1 | 3300050508 | Bacteria | 7557 |
| 623 | nmdc:mga09592_78389_c1 | 3300050508 | Bacteria | 2811 |
| 624 | nmdc:mga0qj67_11760_c1 | 3300050509 | Bacteria | 6569 |
| 625 | nmdc:mga06r32_13597_c1 | 3300050510 | Bacteria | 7379 |
| 626 | nmdc:mga08y16_1925_c1 | 3300050511 | Bacteria | 21181 |
| 627 | nmdc:mga0n895_124457_c1 | 3300050512 | Bacteria | 2601 |
| 628 | nmdc:mga0n895_167910_c1 | 3300050512 | Bacteria | 2226 |
| 629 | nmdc:mga0n895_329747_c1 | 3300050512 | Bacteria | 1546 |
| 630 | nmdc:mga0n895_4364_c1 | 3300050512 | Bacteria | 11597 |
| 631 | nmdc:mga0n895_65942_c1 | 3300050512 | Bacteria | 3585 |
| 632 | nmdc:mga0rr50_342559_c1 | 3300050513 | Bacteria | 1256 |
| 633 | nmdc:mga0rr50_68049_c1 | 3300050513 | Bacteria | 2707 |
| 634 | nmdc:mga0a205_6620_c1 | 3300050515 | Bacteria | 10485 |
| 635 | nmdc:mga0a205_89786_c1 | 3300050515 | Bacteria | 2970 |
| 636 | Ga0495601_0001548 | 3300053077 | Bacteria | 12709 |
| 637 | Ga0495601_0005375 | 3300053077 | Bacteria | 7460 |
| 638 | Ga0495601_0045414 | 3300053077 | Bacteria | 2762 |
| 639 | Ga0495601_0066984 | 3300053077 | Bacteria | 2286 |
| 640 | Ga0495612_0003002 | 3300053078 | Bacteria | 7007 |
| 641 | Ga0495612_0006083 | 3300053078 | Bacteria | 4966 |
| 642 | Ga0495612_0009510 | 3300053078 | Bacteria | 3940 |
| 643 | Ga0495612_0028706 | 3300053078 | Bacteria | 2240 |
| 644 | Ga0495612_0078658 | 3300053078 | Bacteria | 1384 |
| 645 | Ga0495612_0102084 | 3300053078 | Bacteria | 1222 |
| 646 | Ga0495655_0007882 | 3300053083 | Bacteria | 2001 |
| 647 | Ga0495595_0002759 | 3300053084 | Bacteria | 6902 |
| 648 | Ga0495595_0016473 | 3300053084 | Bacteria | 3163 |
| 649 | Ga0495619_0000052 | 3300053085 | Bacteria | 98882 |
| 650 | Ga0495619_0000821 | 3300053085 | Bacteria | 20348 |
| 651 | Ga0495619_0046030 | 3300053085 | Bacteria | 2867 |
| 652 | Ga0500566_0000049 | 3300053094 | Bacteria | 57920 |
| 653 | Ga0500641_0007196 | 3300053096 | Bacteria | 3967 |
| 654 | Ga0500572_000476 | 3300053111 | Bacteria | 13916 |
| 655 | Ga0500591_027619 | 3300053115 | Bacteria | 2748 |
| 656 | Ga0500608_030856 | 3300053122 | Bacteria | 2542 |
| 657 | Ga0500658_0186483 | 3300053134 | Bacteria | 946 |
| 658 | Ga0500559_0000654 | 3300053136 | Bacteria | 23267 |
| 659 | Ga0500559_0016101 | 3300053136 | Bacteria | 3158 |
| 660 | Ga0500590_065126 | 3300053148 | Bacteria | 1823 |
| 661 | Ga0500603_000031 | 3300053150 | Bacteria | 34081 |
| 662 | Ga0500616_0145981 | 3300053153 | Bacteria | 1100 |
| 663 | Ga0500630_000581 | 3300053159 | Bacteria | 16620 |
| 664 | Ga0500639_000020 | 3300053163 | Bacteria | 102959 |
| 665 | Ga0500636_0070433 | 3300053177 | Bacteria | 2029 |
| 666 | Ga0500637_0007143 | 3300053178 | Bacteria | 5566 |
| 667 | Ga0500596_003763 | 3300053735 | Bacteria | 2848 |
| 668 | Ga0500601_006297 | 3300053737 | Bacteria | 1308 |
| 669 | Ga0501084_0008741 | 3300054114 | Bacteria | 8374 |
| 670 | Ga0501084_0014440 | 3300054114 | Bacteria | 6545 |
| 671 | Ga0501084_0274441 | 3300054114 | Bacteria | 1423 |
| 672 | Ga0501084_0287785 | 3300054114 | Bacteria | 1388 |
| 673 | Ga0501082_0005251 | 3300060353 | Bacteria | 11259 |
| 674 | Ga0501082_0115603 | 3300060353 | Bacteria | 2323 |
| 675 | Ga0501082_0171500 | 3300060353 | Bacteria | 1886 |
| 676 | Ga0530510_0013479 | 3300061734 | Bacteria | 5747 |
| 677 | Ga0530510_0079726 | 3300061734 | Bacteria | 2381 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046454 | Ga0495592_0428408 | Ga0495592_0428408_15_797 | 260 |
| 2 | 3300053134 | Ga0500658_0186483 | Ga0500658_0186483_139_921 | 260 |
| 3 | 3300049572 | Ga0501036_0016482 | Ga0501036_0016482_5281_6090 | 262 |
| 4 | 3300021384 | Ga0213876_10000130 | Ga0213876_1000013058 | 265 |
| 5 | 3300039437 | Ga0436365_0031959 | Ga0436365_0031959_82458_83261 | 265 |
| 6 | 3300039450 | Ga0436363_0642160 | Ga0436363_0642160_534_1337 | 265 |
| 7 | 3300046461 | Ga0495641_0011719 | Ga0495641_0011719_2678_3475 | 265 |
| 8 | 3300046533 | Ga0495640_0061733 | Ga0495640_0061733_69_866 | 265 |
| 9 | 3300046680 | Ga0495646_0111340 | Ga0495646_0111340_694_1491 | 265 |
| 10 | 3300048911 | Ga0496108_0507883 | Ga0496108_0507883_218_1015 | 265 |
| 11 | 3300049581 | Ga0501047_0002872 | Ga0501047_0002872_12_815 | 265 |
| 12 | 3300048907 | Ga0496104_0406781 | Ga0496104_0406781_438_1244 | 268 |
| 13 | 3300048918 | Ga0496115_0069948 | Ga0496115_0069948_2023_2829 | 268 |
| 14 | 3300046809 | Ga0495600_0298987 | Ga0495600_0298987_31_861 | 276 |
| 15 | 3300031665 | Ga0316575_10005544 | Ga0316575_100055443 | 279 |
| 16 | 3300031691 | Ga0316579_10027196 | Ga0316579_100271962 | 279 |
| 17 | 3300031727 | Ga0316576_10172436 | Ga0316576_101724362 | 279 |
| 18 | 3300035398 | Ga0316574_0089001 | Ga0316574_0089001_616_1581 | 279 |
| 19 | 3300036647 | Ga0316582_0037763 | Ga0316582_0037763_1811_2776 | 279 |
| 20 | 3300044712 | Ga0453684_0922051 | Ga0453684_0922051_12_857 | 281 |
| 21 | 3300007788 | Ga0099795_10024949 | Ga0099795_100249492 | 282 |
| 22 | 3300009147 | Ga0114129_10535767 | Ga0114129_105357671 | 282 |
| 23 | 3300010159 | Ga0099796_10025076 | Ga0099796_100250763 | 282 |
| 24 | 3300005336 | Ga0070680_100042057 | Ga0070680_1000420573 | 286 |
| 25 | 3300005339 | Ga0070660_100003489 | Ga0070660_1000034893 | 286 |
| 26 | 3300005530 | Ga0070679_100092199 | Ga0070679_1000921992 | 286 |
| 27 | 3300005549 | Ga0070704_100005398 | Ga0070704_1000053985 | 286 |
| 28 | 3300005563 | Ga0068855_100198230 | Ga0068855_1001982303 | 286 |
| 29 | 3300009551 | Ga0105238_10034573 | Ga0105238_100345733 | 286 |
| 30 | 3300025909 | Ga0207705_10003526 | Ga0207705_100035268 | 286 |
| 31 | 3300025917 | Ga0207660_10089440 | Ga0207660_100894403 | 286 |
| 32 | 3300025919 | Ga0207657_10013834 | Ga0207657_100138344 | 286 |
| 33 | 3300025949 | Ga0207667_10037084 | Ga0207667_100370842 | 286 |
| 34 | 3300005546 | Ga0070696_100052793 | Ga0070696_1000527932 | 287 |
| 35 | 3300031728 | Ga0316578_10055741 | Ga0316578_100557411 | 288 |
| 36 | 3300036712 | Ga0316584_0063254 | Ga0316584_0063254_89_1054 | 288 |
| 37 | 3300006846 | Ga0075430_100218435 | Ga0075430_1002184352 | 290 |
| 38 | 3300032168 | Ga0316593_10088053 | Ga0316593_100880531 | 290 |
| 39 | 3300031251 | Ga0265327_10033545 | Ga0265327_100335452 | 291 |
| 40 | 3300049741 | Ga0501079_0081736 | Ga0501079_0081736_10_885 | 291 |
| 41 | 3300027876 | Ga0209974_10029266 | Ga0209974_100292662 | 295 |
| 42 | 3300039438 | Ga0436360_0708065 | Ga0436360_0708065_21_914 | 296 |
| 43 | 3300005436 | Ga0070713_100409851 | Ga0070713_1004098512 | 297 |
| 44 | 3300049578 | Ga0501042_0311537 | Ga0501042_0311537_16_933 | 298 |
| 45 | 3300031691 | Ga0316579_10004581 | Ga0316579_100045813 | 299 |
| 46 | 3300032137 | Ga0316585_10002967 | Ga0316585_100029672 | 299 |
| 47 | 3300036647 | Ga0316582_0004787 | Ga0316582_0004787_3908_4861 | 299 |
| 48 | 3300036712 | Ga0316584_0139275 | Ga0316584_0139275_59_1054 | 299 |
| 49 | 3300037588 | Ga0316581_0005303 | Ga0316581_0005303_2284_3279 | 299 |
| 50 | 3300044712 | Ga0453684_0100025 | Ga0453684_0100025_18_983 | 299 |
| 51 | 3300047471 | Ga0495684_0348629 | Ga0495684_0348629_138_1037 | 299 |
| 52 | 3300044712 | Ga0453684_0032406 | Ga0453684_0032406_2499_3440 | 300 |
| 53 | 3300046559 | Ga0495667_0067972 | Ga0495667_0067972_976_1932 | 302 |
| 54 | 3300048088 | Ga0495602_0199172 | Ga0495602_0199172_55_1011 | 302 |
| 55 | 3300005356 | Ga0070674_100237939 | Ga0070674_1002379392 | 304 |
| 56 | 3300005466 | Ga0070685_10101294 | Ga0070685_101012942 | 304 |
| 57 | 3300005543 | Ga0070672_100106865 | Ga0070672_1001068652 | 304 |
| 58 | 3300005718 | Ga0068866_10025656 | Ga0068866_100256562 | 304 |
| 59 | 3300006237 | Ga0097621_100155598 | Ga0097621_1001555982 | 304 |
| 60 | 3300014326 | Ga0157380_10172391 | Ga0157380_101723912 | 304 |
| 61 | 3300025315 | Ga0207697_10035372 | Ga0207697_100353722 | 304 |
| 62 | 3300025940 | Ga0207691_10150524 | Ga0207691_101505242 | 304 |
| 63 | 3300026121 | Ga0207683_10039727 | Ga0207683_100397272 | 304 |
| 64 | 3300046499 | Ga0495594_0216700 | Ga0495594_0216700_122_1078 | 304 |
| 65 | 3300048917 | Ga0496114_0104954 | Ga0496114_0104954_249_1205 | 304 |
| 66 | 3300005615 | Ga0070702_100141454 | Ga0070702_1001414542 | 305 |
| 67 | 3300009545 | Ga0105237_10131772 | Ga0105237_101317723 | 305 |
| 68 | 3300009551 | Ga0105238_10469470 | Ga0105238_104694702 | 305 |
| 69 | 3300021441 | Ga0213871_10030191 | Ga0213871_100301912 | 305 |
| 70 | 3300024227 | Ga0228598_1005683 | Ga0228598_10056832 | 305 |
| 71 | 3300025914 | Ga0207671_10162612 | Ga0207671_101626123 | 305 |
| 72 | 3300025931 | Ga0207644_10127265 | Ga0207644_101272652 | 305 |
| 73 | 3300026078 | Ga0207702_10071299 | Ga0207702_100712992 | 305 |
| 74 | 3300042001 | Ga0439441_007658 | Ga0439441_007658_805_1722 | 305 |
| 75 | 3300046459 | Ga0495629_0020353 | Ga0495629_0020353_1186_2103 | 305 |
| 76 | 3300046536 | Ga0495587_0097553 | Ga0495587_0097553_765_1682 | 305 |
| 77 | 3300049571 | Ga0501034_0544156 | Ga0501034_0544156_19_936 | 305 |
| 78 | 3300049579 | Ga0501043_0160774 | Ga0501043_0160774_29_985 | 305 |
| 79 | 3300049822 | Ga0501035_0230697 | Ga0501035_0230697_99_1055 | 305 |
| 80 | 3300049823 | Ga0501044_0014341 | Ga0501044_0014341_4194_5150 | 305 |
| 81 | 3300053136 | Ga0500559_0016101 | Ga0500559_0016101_1668_2600 | 305 |
| 82 | 3300053148 | Ga0500590_065126 | Ga0500590_065126_870_1787 | 305 |
| 83 | 3300053153 | Ga0500616_0145981 | Ga0500616_0145981_163_1080 | 305 |
| 84 | 3300045051 | Ga0451576_0334927 | Ga0451576_0334927_138_1082 | 306 |
| 85 | 3300048905 | Ga0496102_0070554 | Ga0496102_0070554_454_1410 | 306 |
| 86 | 3300048909 | Ga0496106_0194991 | Ga0496106_0194991_151_1107 | 306 |
| 87 | 3300048912 | Ga0496109_0123808 | Ga0496109_0123808_1239_2195 | 306 |
| 88 | 3300048914 | Ga0496111_0037892 | Ga0496111_0037892_2188_3144 | 306 |
| 89 | 3300041404 | Ga0439436_0002272 | Ga0439436_0002272_133_1089 | 308 |
| 90 | 3300041413 | Ga0439465_0002393 | Ga0439465_0002393_326_1282 | 308 |
| 91 | 3300042015 | Ga0439462_0034633 | Ga0439462_0034633_39_995 | 308 |
| 92 | 3300042122 | Ga0450920_006237 | Ga0450920_006237_414_1370 | 308 |
| 93 | 3300042531 | Ga0450918_004771 | Ga0450918_004771_105_1061 | 308 |
| 94 | 3300025941 | Ga0207711_10119510 | Ga0207711_101195102 | 309 |
| 95 | 3300042876 | Ga0451577_0305914 | Ga0451577_0305914_47_976 | 309 |
| 96 | 3300049587 | Ga0501071_0139943 | Ga0501071_0139943_826_1782 | 309 |
| 97 | 3300049591 | Ga0501075_0023569 | Ga0501075_0023569_2855_3811 | 309 |
| 98 | 3300049592 | Ga0501076_0009701 | Ga0501076_0009701_5672_6628 | 309 |
| 99 | 3300049593 | Ga0501077_0005430 | Ga0501077_0005430_5813_6769 | 309 |
| 100 | 3300049741 | Ga0501079_0010988 | Ga0501079_0010988_5709_6665 | 309 |
| 101 | 3300049742 | Ga0501080_0082162 | Ga0501080_0082162_1938_2894 | 309 |
| 102 | 3300049743 | Ga0501081_0002877 | Ga0501081_0002877_2255_3211 | 309 |
| 103 | 3300054114 | Ga0501084_0008741 | Ga0501084_0008741_7348_8304 | 309 |
| 104 | 3300060353 | Ga0501082_0171500 | Ga0501082_0171500_70_1026 | 309 |
| 105 | 3300005338 | Ga0068868_100226201 | Ga0068868_1002262011 | 310 |
| 106 | 3300006237 | Ga0097621_100500030 | Ga0097621_1005000302 | 310 |
| 107 | 3300007788 | Ga0099795_10004297 | Ga0099795_100042972 | 310 |
| 108 | 3300010159 | Ga0099796_10012365 | Ga0099796_100123653 | 310 |
| 109 | 3300013296 | Ga0157374_10369865 | Ga0157374_103698652 | 310 |
| 110 | 3300025906 | Ga0207699_10259310 | Ga0207699_102593102 | 310 |
| 111 | 3300037068 | Ga0373925_0033905 | Ga0373925_0033905_2010_2942 | 310 |
| 112 | 3300046476 | Ga0495662_0091346 | Ga0495662_0091346_97_1029 | 310 |
| 113 | 3300046531 | Ga0495665_0021877 | Ga0495665_0021877_1407_2363 | 310 |
| 114 | iso_pu_bacteria | 2897803580 | 2897807417 | 310 |
| 115 | 3300031251 | Ga0265327_10000742 | Ga0265327_1000074227 | 311 |
| 116 | 3300031251 | Ga0265327_10000881 | Ga0265327_1000088121 | 311 |
| 117 | 3300031344 | Ga0265316_10001619 | Ga0265316_100016194 | 311 |
| 118 | 3300049576 | Ga0501040_0044710 | Ga0501040_0044710_518_1474 | 311 |
| 119 | 3300061734 | Ga0530510_0013479 | Ga0530510_0013479_2132_3088 | 311 |
| 120 | iso_pu_bacteria | 2932794094 | 2932796601 | 311 |
| 121 | iso_pu_bacteria | 2932801729 | 2932802617 | 311 |
| 122 | iso_pu_bacteria | 2935760218 | 2935768584 | 311 |
| 123 | iso_pu_bacteria | 2935883170 | 2935883572 | 311 |
| 124 | 3300009177 | Ga0105248_10275210 | Ga0105248_102752102 | 312 |
| 125 | 3300010375 | Ga0105239_10046428 | Ga0105239_100464283 | 312 |
| 126 | 3300014325 | Ga0163163_10116319 | Ga0163163_101163191 | 312 |
| 127 | 3300025944 | Ga0207661_10497456 | Ga0207661_104974562 | 312 |
| 128 | 3300036401 | Ga0373937_0029181 | Ga0373937_0029181_720_1658 | 312 |
| 129 | 3300046477 | Ga0495664_0005011 | Ga0495664_0005011_1549_2487 | 312 |
| 130 | 3300046511 | Ga0495608_0010335 | Ga0495608_0010335_845_1783 | 312 |
| 131 | 3300046514 | Ga0495618_0123901 | Ga0495618_0123901_188_1126 | 312 |
| 132 | 3300046536 | Ga0495587_0018466 | Ga0495587_0018466_2349_3287 | 312 |
| 133 | 3300046543 | Ga0495645_0001251 | Ga0495645_0001251_7250_8188 | 312 |
| 134 | 3300046663 | Ga0495635_0117106 | Ga0495635_0117106_216_1154 | 312 |
| 135 | 3300046675 | Ga0495657_0028272 | Ga0495657_0028272_1324_2262 | 312 |
| 136 | 3300046678 | Ga0495599_0005701 | Ga0495599_0005701_709_1647 | 312 |
| 137 | 3300046680 | Ga0495646_0009398 | Ga0495646_0009398_5243_6181 | 312 |
| 138 | 3300047317 | Ga0495604_0023196 | Ga0495604_0023196_184_1122 | 312 |
| 139 | 3300047319 | Ga0495674_0151742 | Ga0495674_0151742_635_1573 | 312 |
| 140 | 3300047444 | Ga0495675_0006704 | Ga0495675_0006704_3182_4120 | 312 |
| 141 | 3300048088 | Ga0495602_0005528 | Ga0495602_0005528_9147_10085 | 312 |
| 142 | 3300049592 | Ga0501076_0016338 | Ga0501076_0016338_3793_4749 | 312 |
| 143 | 3300049741 | Ga0501079_0007946 | Ga0501079_0007946_5210_6166 | 312 |
| 144 | 3300049743 | Ga0501081_0011140 | Ga0501081_0011140_1879_2835 | 312 |
| 145 | 3300049824 | Ga0501045_0011927 | Ga0501045_0011927_3646_4602 | 312 |
| 146 | 3300053077 | Ga0495601_0001548 | Ga0495601_0001548_7738_8676 | 312 |
| 147 | 3300053078 | Ga0495612_0003002 | Ga0495612_0003002_1284_2222 | 312 |
| 148 | 3300053084 | Ga0495595_0016473 | Ga0495595_0016473_88_1026 | 312 |
| 149 | 3300054114 | Ga0501084_0274441 | Ga0501084_0274441_305_1261 | 312 |
| 150 | 3300060353 | Ga0501082_0005251 | Ga0501082_0005251_8803_9759 | 312 |
| 151 | iso_pu_bacteria | 2597490356 | 2599106409 | 312 |
| 152 | iso_pu_bacteria | 2846952575 | 2846956207 | 312 |
| 153 | iso_pu_bacteria | 2935959822 | 2935967063 | 312 |
| 154 | iso_pu_bacteria | 8006933436 | 8006943173 | 312 |
| 155 | iso_pu_bacteria | 8006973647 | 8006982968 | 312 |
| 156 | 3300031251 | Ga0265327_10003707 | Ga0265327_1000370712 | 313 |
| 157 | 3300031251 | Ga0265327_10033945 | Ga0265327_100339452 | 313 |
| 158 | 3300031344 | Ga0265316_10004775 | Ga0265316_100047754 | 313 |
| 159 | 3300031665 | Ga0316575_10043597 | Ga0316575_100435972 | 313 |
| 160 | 3300031711 | Ga0265314_10004203 | Ga0265314_100042036 | 313 |
| 161 | 3300042876 | Ga0451577_0000035 | Ga0451577_0000035_340961_341905 | 313 |
| 162 | 3300042876 | Ga0451577_0000471 | Ga0451577_0000471_31885_32829 | 313 |
| 163 | 3300042876 | Ga0451577_0000739 | Ga0451577_0000739_1753_2697 | 313 |
| 164 | 3300042876 | Ga0451577_0002216 | Ga0451577_0002216_9661_10605 | 313 |
| 165 | 3300042876 | Ga0451577_0015764 | Ga0451577_0015764_2544_3488 | 313 |
| 166 | 3300042876 | Ga0451577_0045736 | Ga0451577_0045736_2310_3254 | 313 |
| 167 | 3300042876 | Ga0451577_0211162 | Ga0451577_0211162_419_1363 | 313 |
| 168 | 3300042876 | Ga0451577_0330122 | Ga0451577_0330122_136_1083 | 313 |
| 169 | 3300044673 | Ga0453683_0000095 | Ga0453683_0000095_58016_58960 | 313 |
| 170 | 3300044673 | Ga0453683_0190319 | Ga0453683_0190319_201_1145 | 313 |
| 171 | 3300044712 | Ga0453684_0000089 | Ga0453684_0000089_36041_36985 | 313 |
| 172 | 3300044712 | Ga0453684_0000097 | Ga0453684_0000097_340968_341912 | 313 |
| 173 | 3300044712 | Ga0453684_0000176 | Ga0453684_0000176_235500_236444 | 313 |
| 174 | 3300044712 | Ga0453684_0000177 | Ga0453684_0000177_132683_133627 | 313 |
| 175 | 3300044712 | Ga0453684_0002182 | Ga0453684_0002182_35698_36651 | 313 |
| 176 | 3300044712 | Ga0453684_0006440 | Ga0453684_0006440_13312_14256 | 313 |
| 177 | 3300044712 | Ga0453684_0014620 | Ga0453684_0014620_360_1304 | 313 |
| 178 | 3300044712 | Ga0453684_0033541 | Ga0453684_0033541_967_1911 | 313 |
| 179 | 3300044712 | Ga0453684_0073235 | Ga0453684_0073235_1546_2490 | 313 |
| 180 | 3300044712 | Ga0453684_0100546 | Ga0453684_0100546_675_1619 | 313 |
| 181 | 3300045051 | Ga0451576_0000806 | Ga0451576_0000806_55165_56109 | 313 |
| 182 | 3300045051 | Ga0451576_0001345 | Ga0451576_0001345_23327_24271 | 313 |
| 183 | 3300045051 | Ga0451576_0025858 | Ga0451576_0025858_2356_3300 | 313 |
| 184 | 3300045051 | Ga0451576_0609320 | Ga0451576_0609320_53_997 | 313 |
| 185 | 3300050512 | nmdc:mga0n895_65942_c1 | nmdc:mga0n895_65942_c1_34_990 | 313 |
| 186 | 3300050515 | nmdc:mga0a205_89786_c1 | nmdc:mga0a205_89786_c1_351_1307 | 313 |
| 187 | 3300031665 | Ga0316575_10003138 | Ga0316575_100031384 | 314 |
| 188 | 3300031691 | Ga0316579_10000638 | Ga0316579_100006388 | 314 |
| 189 | 3300031711 | Ga0265314_10021511 | Ga0265314_100215112 | 314 |
| 190 | 3300031727 | Ga0316576_10083088 | Ga0316576_100830882 | 314 |
| 191 | 3300031733 | Ga0316577_10002995 | Ga0316577_100029957 | 314 |
| 192 | 3300032137 | Ga0316585_10000195 | Ga0316585_100001957 | 314 |
| 193 | 3300032139 | Ga0316580_10001428 | Ga0316580_100014282 | 314 |
| 194 | 3300035398 | Ga0316574_0006936 | Ga0316574_0006936_3607_4551 | 314 |
| 195 | 3300035398 | Ga0316574_0047906 | Ga0316574_0047906_165_1121 | 314 |
| 196 | 3300036647 | Ga0316582_0003599 | Ga0316582_0003599_1886_2830 | 314 |
| 197 | 3300036712 | Ga0316584_0017667 | Ga0316584_0017667_3240_4184 | 314 |
| 198 | 3300037588 | Ga0316581_0000030 | Ga0316581_0000030_2899_3843 | 314 |
| 199 | 3300044712 | Ga0453684_0005947 | Ga0453684_0005947_523_1470 | 314 |
| 200 | 3300044712 | Ga0453684_0021800 | Ga0453684_0021800_6392_7339 | 314 |
| 201 | 3300044712 | Ga0453684_0025660 | Ga0453684_0025660_1957_2904 | 314 |
| 202 | 3300044712 | Ga0453684_0105141 | Ga0453684_0105141_1879_2823 | 314 |
| 203 | 3300044712 | Ga0453684_0133742 | Ga0453684_0133742_1551_2498 | 314 |
| 204 | 3300045051 | Ga0451576_0000361 | Ga0451576_0000361_11081_12040 | 314 |
| 205 | iso_pu_bacteria | 2513237096 | 2513657247 | 314 |
| 206 | iso_pu_bacteria | 2513237104 | 2513715400 | 314 |
| 207 | iso_pu_bacteria | 2513237137 | 2513857715 | 314 |
| 208 | iso_pu_bacteria | 2513237145 | 2513919255 | 314 |
| 209 | iso_pu_bacteria | 2517287029 | 2517411314 | 314 |
| 210 | iso_pu_bacteria | 2517572143 | 2517891048 | 314 |
| 211 | iso_pu_bacteria | 2643221618 | 2644104486 | 314 |
| 212 | iso_pu_bacteria | 2791355197 | 2793066402 | 314 |
| 213 | iso_pu_bacteria | 2906610324 | 2906616245 | 314 |
| 214 | iso_pu_bacteria | 2906635258 | 2906640335 | 314 |
| 215 | iso_pu_bacteria | 2906660503 | 2906667255 | 314 |
| 216 | iso_pu_bacteria | 2922425934 | 2922431761 | 314 |
| 217 | iso_pu_bacteria | 2941499720 | 2941506184 | 314 |
| 218 | iso_pu_bacteria | 3005474847 | 3005481579 | 314 |
| 219 | iso_pu_bacteria | 8006926726 | 8006932277 | 314 |
| 220 | iso_pu_bacteria | 8019565922 | 8019575115 | 314 |
| 221 | 3300005434 | Ga0070709_10112069 | Ga0070709_101120692 | 315 |
| 222 | 3300005445 | Ga0070708_100020728 | Ga0070708_1000207283 | 315 |
| 223 | 3300005458 | Ga0070681_10004100 | Ga0070681_100041004 | 315 |
| 224 | 3300005467 | Ga0070706_100009059 | Ga0070706_1000090595 | 315 |
| 225 | 3300005471 | Ga0070698_100004962 | Ga0070698_10000496213 | 315 |
| 226 | 3300005518 | Ga0070699_100010430 | Ga0070699_1000104304 | 315 |
| 227 | 3300005544 | Ga0070686_100091167 | Ga0070686_1000911672 | 315 |
| 228 | 3300005937 | Ga0081455_10001555 | Ga0081455_1000155517 | 315 |
| 229 | 3300009148 | Ga0105243_10034348 | Ga0105243_100343484 | 315 |
| 230 | 3300025912 | Ga0207707_10003874 | Ga0207707_100038744 | 315 |
| 231 | 3300031616 | Ga0307508_10000105 | Ga0307508_1000010514 | 315 |
| 232 | 3300031691 | Ga0316579_10001822 | Ga0316579_100018224 | 315 |
| 233 | 3300036647 | Ga0316582_0010970 | Ga0316582_0010970_3027_3977 | 315 |
| 234 | 3300036712 | Ga0316584_0049027 | Ga0316584_0049027_1063_2025 | 315 |
| 235 | 3300044712 | Ga0453684_0000732 | Ga0453684_0000732_82889_83887 | 315 |
| 236 | 3300044712 | Ga0453684_0010364 | Ga0453684_0010364_9807_10766 | 315 |
| 237 | 3300044712 | Ga0453684_0032690 | Ga0453684_0032690_3940_4887 | 315 |
| 238 | 3300045051 | Ga0451576_0000056 | Ga0451576_0000056_207447_208394 | 315 |
| 239 | 3300005335 | Ga0070666_10137277 | Ga0070666_101372772 | 316 |
| 240 | 3300005340 | Ga0070689_100024765 | Ga0070689_1000247652 | 316 |
| 241 | 3300005367 | Ga0070667_100101443 | Ga0070667_1001014432 | 316 |
| 242 | 3300005367 | Ga0070667_100126654 | Ga0070667_1001266542 | 316 |
| 243 | 3300005458 | Ga0070681_10442004 | Ga0070681_104420041 | 316 |
| 244 | 3300005471 | Ga0070698_100413951 | Ga0070698_1004139512 | 316 |
| 245 | 3300005563 | Ga0068855_100007706 | Ga0068855_1000077063 | 316 |
| 246 | 3300005563 | Ga0068855_100037426 | Ga0068855_1000374264 | 316 |
| 247 | 3300005578 | Ga0068854_100082238 | Ga0068854_1000822382 | 316 |
| 248 | 3300005618 | Ga0068864_100080001 | Ga0068864_1000800012 | 316 |
| 249 | 3300009101 | Ga0105247_10011300 | Ga0105247_100113003 | 316 |
| 250 | 3300009147 | Ga0114129_10018961 | Ga0114129_100189617 | 316 |
| 251 | 3300009553 | Ga0105249_10011069 | Ga0105249_100110692 | 316 |
| 252 | 3300013308 | Ga0157375_10003393 | Ga0157375_1000339313 | 316 |
| 253 | 3300014325 | Ga0163163_10426129 | Ga0163163_104261292 | 316 |
| 254 | 3300025913 | Ga0207695_10069050 | Ga0207695_100690502 | 316 |
| 255 | 3300025916 | Ga0207663_10025255 | Ga0207663_100252552 | 316 |
| 256 | 3300025986 | Ga0207658_10051795 | Ga0207658_100517953 | 316 |
| 257 | 3300026035 | Ga0207703_10021926 | Ga0207703_100219262 | 316 |
| 258 | 3300026095 | Ga0207676_10067232 | Ga0207676_100672322 | 316 |
| 259 | 3300031247 | Ga0265340_10045766 | Ga0265340_100457662 | 316 |
| 260 | 3300031249 | Ga0265339_10002052 | Ga0265339_100020529 | 316 |
| 261 | 3300031691 | Ga0316579_10008234 | Ga0316579_100082342 | 316 |
| 262 | 3300031691 | Ga0316579_10022911 | Ga0316579_100229113 | 316 |
| 263 | 3300031733 | Ga0316577_10002289 | Ga0316577_100022892 | 316 |
| 264 | 3300035118 | Ga0373954_0000062 | Ga0373954_0000062_18598_19551 | 316 |
| 265 | 3300035398 | Ga0316574_0095231 | Ga0316574_0095231_546_1499 | 316 |
| 266 | 3300035724 | Ga0373933_0005995 | Ga0373933_0005995_627_1580 | 316 |
| 267 | 3300036401 | Ga0373937_0008181 | Ga0373937_0008181_2734_3687 | 316 |
| 268 | 3300036712 | Ga0316584_0042040 | Ga0316584_0042040_2383_3348 | 316 |
| 269 | 3300036712 | Ga0316584_0087930 | Ga0316584_0087930_1260_2213 | 316 |
| 270 | 3300037588 | Ga0316581_0042087 | Ga0316581_0042087_19_984 | 316 |
| 271 | 3300044693 | Ga0466961_0051113 | Ga0466961_0051113_1218_2168 | 316 |
| 272 | 3300044694 | Ga0466963_0035869 | Ga0466963_0035869_1283_2233 | 316 |
| 273 | 3300044712 | Ga0453684_0000006 | Ga0453684_0000006_456257_457210 | 316 |
| 274 | 3300044712 | Ga0453684_0000031 | Ga0453684_0000031_250169_251122 | 316 |
| 275 | 3300044719 | Ga0466971_0011207 | Ga0466971_0011207_2944_3894 | 316 |
| 276 | 3300045836 | Ga0466958_0022162 | Ga0466958_0022162_2434_3384 | 316 |
| 277 | 3300047322 | Ga0495680_0035652 | Ga0495680_0035652_1140_2090 | 316 |
| 278 | 3300048903 | Ga0496100_0029617 | Ga0496100_0029617_89_1039 | 316 |
| 279 | 3300048904 | Ga0496101_0001457 | Ga0496101_0001457_2641_3591 | 316 |
| 280 | 3300048905 | Ga0496102_0022723 | Ga0496102_0022723_2747_3697 | 316 |
| 281 | 3300048906 | Ga0496103_0033318 | Ga0496103_0033318_715_1665 | 316 |
| 282 | 3300048908 | Ga0496105_0003655 | Ga0496105_0003655_1574_2524 | 316 |
| 283 | 3300048909 | Ga0496106_0032059 | Ga0496106_0032059_736_1686 | 316 |
| 284 | 3300048913 | Ga0496110_0075344 | Ga0496110_0075344_1909_2859 | 316 |
| 285 | 3300048915 | Ga0496112_0011978 | Ga0496112_0011978_6121_7071 | 316 |
| 286 | 3300048917 | Ga0496114_0005042 | Ga0496114_0005042_8444_9394 | 316 |
| 287 | 3300049581 | Ga0501047_0235156 | Ga0501047_0235156_685_1644 | 316 |
| 288 | 3300049742 | Ga0501080_0084625 | Ga0501080_0084625_836_1786 | 316 |
| 289 | 3300050507 | nmdc:mga05p37_33457_c1 | nmdc:mga05p37_33457_c1_115_1065 | 316 |
| 290 | 3300005329 | Ga0070683_100163185 | Ga0070683_1001631852 | 317 |
| 291 | 3300005535 | Ga0070684_100133696 | Ga0070684_1001336962 | 317 |
| 292 | 3300005539 | Ga0068853_100255074 | Ga0068853_1002550742 | 317 |
| 293 | 3300026041 | Ga0207639_10306754 | Ga0207639_103067542 | 317 |
| 294 | 3300039110 | Ga0400487_03596 | Ga0400487_03596_2128_3123 | 317 |
| 295 | 3300049583 | Ga0501067_0046793 | Ga0501067_0046793_1332_2285 | 317 |
| 296 | iso_pu_bacteria | 2842333319 | 2842333887 | 317 |
| 297 | 3300001979 | JGI24740J21852_10024687 | JGI24740J21852_100246873 | 318 |
| 298 | 3300001990 | JGI24737J22298_10048358 | JGI24737J22298_100483582 | 318 |
| 299 | 3300003215 | JGI25153J46596_10000946 | JGI25153J46596_100009465 | 318 |
| 300 | 3300003659 | JGI25404J52841_10015246 | JGI25404J52841_100152462 | 318 |
| 301 | 3300005262 | Ga0065165_1000785 | Ga0065165_100078511 | 318 |
| 302 | 3300005293 | Ga0065715_10104321 | Ga0065715_101043212 | 318 |
| 303 | 3300005295 | Ga0065707_10091172 | Ga0065707_100911724 | 318 |
| 304 | 3300005327 | Ga0070658_10079674 | Ga0070658_100796742 | 318 |
| 305 | 3300005329 | Ga0070683_100006806 | Ga0070683_1000068069 | 318 |
| 306 | 3300005329 | Ga0070683_100062439 | Ga0070683_1000624393 | 318 |
| 307 | 3300005344 | Ga0070661_100411955 | Ga0070661_1004119551 | 318 |
| 308 | 3300005353 | Ga0070669_100018253 | Ga0070669_1000182533 | 318 |
| 309 | 3300005364 | Ga0070673_100007902 | Ga0070673_1000079024 | 318 |
| 310 | 3300005441 | Ga0070700_100248498 | Ga0070700_1002484982 | 318 |
| 311 | 3300005444 | Ga0070694_100104069 | Ga0070694_1001040692 | 318 |
| 312 | 3300005445 | Ga0070708_100018422 | Ga0070708_1000184226 | 318 |
| 313 | 3300005455 | Ga0070663_100009487 | Ga0070663_1000094874 | 318 |
| 314 | 3300005455 | Ga0070663_100078723 | Ga0070663_1000787232 | 318 |
| 315 | 3300005458 | Ga0070681_10027203 | Ga0070681_100272031 | 318 |
| 316 | 3300005518 | Ga0070699_100005057 | Ga0070699_1000050578 | 318 |
| 317 | 3300005535 | Ga0070684_100209282 | Ga0070684_1002092822 | 318 |
| 318 | 3300005536 | Ga0070697_100033689 | Ga0070697_1000336892 | 318 |
| 319 | 3300005536 | Ga0070697_100065682 | Ga0070697_1000656823 | 318 |
| 320 | 3300005548 | Ga0070665_100109558 | Ga0070665_1001095583 | 318 |
| 321 | 3300005548 | Ga0070665_100345927 | Ga0070665_1003459272 | 318 |
| 322 | 3300005563 | Ga0068855_100406711 | Ga0068855_1004067112 | 318 |
| 323 | 3300005577 | Ga0068857_100084493 | Ga0068857_1000844931 | 318 |
| 324 | 3300005841 | Ga0068863_100265397 | Ga0068863_1002653972 | 318 |
| 325 | 3300005937 | Ga0081455_10002076 | Ga0081455_100020762 | 318 |
| 326 | 3300005937 | Ga0081455_10008768 | Ga0081455_100087688 | 318 |
| 327 | 3300005937 | Ga0081455_10044348 | Ga0081455_100443482 | 318 |
| 328 | 3300005937 | Ga0081455_10055152 | Ga0081455_100551522 | 318 |
| 329 | 3300005937 | Ga0081455_10217206 | Ga0081455_102172062 | 318 |
| 330 | 3300005983 | Ga0081540_1002923 | Ga0081540_10029233 | 318 |
| 331 | 3300005985 | Ga0081539_10019455 | Ga0081539_100194553 | 318 |
| 332 | 3300006028 | Ga0070717_10015928 | Ga0070717_100159284 | 318 |
| 333 | 3300006028 | Ga0070717_10054441 | Ga0070717_100544412 | 318 |
| 334 | 3300006028 | Ga0070717_10201423 | Ga0070717_102014232 | 318 |
| 335 | 3300006038 | Ga0075365_10130583 | Ga0075365_101305832 | 318 |
| 336 | 3300006175 | Ga0070712_100288144 | Ga0070712_1002881442 | 318 |
| 337 | 3300006186 | Ga0075369_10031986 | Ga0075369_100319863 | 318 |
| 338 | 3300006844 | Ga0075428_100015159 | Ga0075428_1000151593 | 318 |
| 339 | 3300006844 | Ga0075428_100594867 | Ga0075428_1005948671 | 318 |
| 340 | 3300006846 | Ga0075430_100009149 | Ga0075430_1000091497 | 318 |
| 341 | 3300006847 | Ga0075431_100018426 | Ga0075431_1000184263 | 318 |
| 342 | 3300006852 | Ga0075433_10028952 | Ga0075433_100289523 | 318 |
| 343 | 3300006871 | Ga0075434_100008951 | Ga0075434_1000089512 | 318 |
| 344 | 3300006871 | Ga0075434_100276654 | Ga0075434_1002766542 | 318 |
| 345 | 3300006880 | Ga0075429_100008886 | Ga0075429_1000088867 | 318 |
| 346 | 3300006914 | Ga0075436_100001243 | Ga0075436_10000124317 | 318 |
| 347 | 3300006914 | Ga0075436_100322393 | Ga0075436_1003223932 | 318 |
| 348 | 3300007076 | Ga0075435_100020921 | Ga0075435_1000209212 | 318 |
| 349 | 3300007265 | Ga0099794_10002299 | Ga0099794_100022992 | 318 |
| 350 | 3300007265 | Ga0099794_10008987 | Ga0099794_100089873 | 318 |
| 351 | 3300007265 | Ga0099794_10050643 | Ga0099794_100506432 | 318 |
| 352 | 3300007788 | Ga0099795_10011809 | Ga0099795_100118092 | 318 |
| 353 | 3300009093 | Ga0105240_10016507 | Ga0105240_100165074 | 318 |
| 354 | 3300009093 | Ga0105240_10020582 | Ga0105240_100205823 | 318 |
| 355 | 3300009094 | Ga0111539_10007260 | Ga0111539_100072608 | 318 |
| 356 | 3300009094 | Ga0111539_10015669 | Ga0111539_100156692 | 318 |
| 357 | 3300009101 | Ga0105247_10009021 | Ga0105247_100090214 | 318 |
| 358 | 3300009147 | Ga0114129_10024866 | Ga0114129_100248663 | 318 |
| 359 | 3300009147 | Ga0114129_10203045 | Ga0114129_102030453 | 318 |
| 360 | 3300009148 | Ga0105243_10052495 | Ga0105243_100524953 | 318 |
| 361 | 3300009176 | Ga0105242_10244586 | Ga0105242_102445862 | 318 |
| 362 | 3300009545 | Ga0105237_10150598 | Ga0105237_101505983 | 318 |
| 363 | 3300009551 | Ga0105238_10037267 | Ga0105238_100372672 | 318 |
| 364 | 3300009553 | Ga0105249_10031333 | Ga0105249_100313333 | 318 |
| 365 | 3300010159 | Ga0099796_10001698 | Ga0099796_100016983 | 318 |
| 366 | 3300010375 | Ga0105239_10005103 | Ga0105239_100051034 | 318 |
| 367 | 3300010375 | Ga0105239_10157445 | Ga0105239_101574452 | 318 |
| 368 | 3300011119 | Ga0105246_10282562 | Ga0105246_102825622 | 318 |
| 369 | 3300013104 | Ga0157370_10008657 | Ga0157370_100086572 | 318 |
| 370 | 3300013105 | Ga0157369_10634955 | Ga0157369_106349552 | 318 |
| 371 | 3300013297 | Ga0157378_10030990 | Ga0157378_100309902 | 318 |
| 372 | 3300013297 | Ga0157378_10081545 | Ga0157378_100815452 | 318 |
| 373 | 3300013308 | Ga0157375_10046525 | Ga0157375_100465254 | 318 |
| 374 | 3300014325 | Ga0163163_10006150 | Ga0163163_100061506 | 318 |
| 375 | 3300014325 | Ga0163163_10082676 | Ga0163163_100826762 | 318 |
| 376 | 3300014968 | Ga0157379_10006642 | Ga0157379_1000664211 | 318 |
| 377 | 3300014969 | Ga0157376_10085855 | Ga0157376_100858552 | 318 |
| 378 | 3300021361 | Ga0213872_10034640 | Ga0213872_100346402 | 318 |
| 379 | 3300021361 | Ga0213872_10048695 | Ga0213872_100486952 | 318 |
| 380 | 3300021441 | Ga0213871_10044856 | Ga0213871_100448562 | 318 |
| 381 | 3300025261 | Ga0209233_1002293 | Ga0209233_10022936 | 318 |
| 382 | 3300025261 | Ga0209233_1008990 | Ga0209233_10089902 | 318 |
| 383 | 3300025294 | Ga0209025_1053107 | Ga0209025_10531072 | 318 |
| 384 | 3300025304 | Ga0209257_1010814 | Ga0209257_10108143 | 318 |
| 385 | 3300025898 | Ga0207692_10066504 | Ga0207692_100665042 | 318 |
| 386 | 3300025912 | Ga0207707_10017265 | Ga0207707_100172653 | 318 |
| 387 | 3300025913 | Ga0207695_10081479 | Ga0207695_100814792 | 318 |
| 388 | 3300025915 | Ga0207693_10017660 | Ga0207693_100176604 | 318 |
| 389 | 3300025944 | Ga0207661_10158516 | Ga0207661_101585162 | 318 |
| 390 | 3300026067 | Ga0207678_10027109 | Ga0207678_100271094 | 318 |
| 391 | 3300026088 | Ga0207641_10050088 | Ga0207641_100500882 | 318 |
| 392 | 3300027512 | Ga0209179_1002942 | Ga0209179_10029422 | 318 |
| 393 | 3300027907 | Ga0207428_10000219 | Ga0207428_1000021965 | 318 |
| 394 | 3300028379 | Ga0268266_10071331 | Ga0268266_100713312 | 318 |
| 395 | 3300028379 | Ga0268266_10285401 | Ga0268266_102854012 | 318 |
| 396 | 3300028573 | Ga0265334_10001560 | Ga0265334_1000156010 | 318 |
| 397 | 3300028800 | Ga0265338_10026478 | Ga0265338_100264782 | 318 |
| 398 | 3300028800 | Ga0265338_10056371 | Ga0265338_100563712 | 318 |
| 399 | 3300028800 | Ga0265338_10087780 | Ga0265338_100877802 | 318 |
| 400 | 3300028800 | Ga0265338_10161562 | Ga0265338_101615621 | 318 |
| 401 | 3300031241 | Ga0265325_10008336 | Ga0265325_100083367 | 318 |
| 402 | 3300031241 | Ga0265325_10150068 | Ga0265325_101500682 | 318 |
| 403 | 3300031247 | Ga0265340_10033125 | Ga0265340_100331253 | 318 |
| 404 | 3300031249 | Ga0265339_10000137 | Ga0265339_1000013733 | 318 |
| 405 | 3300031344 | Ga0265316_10068276 | Ga0265316_100682762 | 318 |
| 406 | 3300031595 | Ga0265313_10000782 | Ga0265313_1000078229 | 318 |
| 407 | 3300031711 | Ga0265314_10080132 | Ga0265314_100801322 | 318 |
| 408 | 3300031728 | Ga0316578_10005177 | Ga0316578_100051772 | 318 |
| 409 | 3300031730 | Ga0307516_10000657 | Ga0307516_1000065725 | 318 |
| 410 | 3300031730 | Ga0307516_10025929 | Ga0307516_100259296 | 318 |
| 411 | 3300031901 | Ga0307406_10309247 | Ga0307406_103092472 | 318 |
| 412 | 3300031995 | Ga0307409_100067374 | Ga0307409_1000673743 | 318 |
| 413 | 3300033442 | Ga0315911_1000003 | Ga0315911_1000003338 | 318 |
| 414 | 3300035083 | Ga0373926_0003849 | Ga0373926_0003849_3252_4208 | 318 |
| 415 | 3300035089 | Ga0373944_0000604 | Ga0373944_0000604_2582_3538 | 318 |
| 416 | 3300035090 | Ga0373949_0025860 | Ga0373949_0025860_295_1251 | 318 |
| 417 | 3300035112 | Ga0373932_0004658 | Ga0373932_0004658_1446_2402 | 318 |
| 418 | 3300035113 | Ga0373936_0003825 | Ga0373936_0003825_2820_3776 | 318 |
| 419 | 3300035114 | Ga0373939_0044504 | Ga0373939_0044504_294_1250 | 318 |
| 420 | 3300035116 | Ga0373945_0001800 | Ga0373945_0001800_2797_3753 | 318 |
| 421 | 3300035118 | Ga0373954_0025920 | Ga0373954_0025920_1617_2573 | 318 |
| 422 | 3300035120 | Ga0373957_0020306 | Ga0373957_0020306_136_1092 | 318 |
| 423 | 3300035120 | Ga0373957_0072616 | Ga0373957_0072616_295_1251 | 318 |
| 424 | 3300035170 | Ga0373943_0007472 | Ga0373943_0007472_1523_2479 | 318 |
| 425 | 3300035171 | Ga0373946_0004350 | Ga0373946_0004350_3165_4121 | 318 |
| 426 | 3300035171 | Ga0373946_0029888 | Ga0373946_0029888_834_1790 | 318 |
| 427 | 3300035172 | Ga0373955_0073867 | Ga0373955_0073867_96_1052 | 318 |
| 428 | 3300035241 | Ga0373961_0028767 | Ga0373961_0028767_289_1245 | 318 |
| 429 | 3300035410 | Ga0373924_0003093 | Ga0373924_0003093_2541_3497 | 318 |
| 430 | 3300035691 | Ga0373931_0031368 | Ga0373931_0031368_1268_2224 | 318 |
| 431 | 3300035692 | Ga0373935_0002036 | Ga0373935_0002036_4055_5011 | 318 |
| 432 | 3300035692 | Ga0373935_0016174 | Ga0373935_0016174_2556_3512 | 318 |
| 433 | 3300035692 | Ga0373935_0030724 | Ga0373935_0030724_895_1851 | 318 |
| 434 | 3300035695 | Ga0373927_0008757 | Ga0373927_0008757_2843_3799 | 318 |
| 435 | 3300035695 | Ga0373927_0017373 | Ga0373927_0017373_3298_4254 | 318 |
| 436 | 3300035695 | Ga0373927_0031229 | Ga0373927_0031229_599_1555 | 318 |
| 437 | 3300035695 | Ga0373927_0193005 | Ga0373927_0193005_65_1021 | 318 |
| 438 | 3300035724 | Ga0373933_0086134 | Ga0373933_0086134_846_1802 | 318 |
| 439 | 3300035725 | Ga0373947_0004669 | Ga0373947_0004669_4499_5455 | 318 |
| 440 | 3300035725 | Ga0373947_0016784 | Ga0373947_0016784_1179_2135 | 318 |
| 441 | 3300035725 | Ga0373947_0048990 | Ga0373947_0048990_536_1492 | 318 |
| 442 | 3300036401 | Ga0373937_0002933 | Ga0373937_0002933_12454_13410 | 318 |
| 443 | 3300036401 | Ga0373937_0006804 | Ga0373937_0006804_4298_5254 | 318 |
| 444 | 3300036712 | Ga0316584_0006337 | Ga0316584_0006337_4372_5328 | 318 |
| 445 | 3300037068 | Ga0373925_0038765 | Ga0373925_0038765_1184_2140 | 318 |
| 446 | 3300037068 | Ga0373925_0073484 | Ga0373925_0073484_1299_2255 | 318 |
| 447 | 3300037312 | Ga0395899_0002665 | Ga0395899_0002665_9104_10066 | 318 |
| 448 | 3300037312 | Ga0395899_0006791 | Ga0395899_0006791_1569_2525 | 318 |
| 449 | 3300037418 | Ga0395900_0000381 | Ga0395900_0000381_56214_57176 | 318 |
| 450 | 3300037418 | Ga0395900_0009733 | Ga0395900_0009733_39_995 | 318 |
| 451 | 3300037418 | Ga0395900_0097182 | Ga0395900_0097182_1561_2517 | 318 |
| 452 | 3300037466 | Ga0395898_0007562 | Ga0395898_0007562_6867_7829 | 318 |
| 453 | 3300037466 | Ga0395898_0049607 | Ga0395898_0049607_185_1141 | 318 |
| 454 | 3300037466 | Ga0395898_0077798 | Ga0395898_0077798_763_1719 | 318 |
| 455 | 3300037471 | Ga0395905_0004769 | Ga0395905_0004769_9879_10841 | 318 |
| 456 | 3300037471 | Ga0395905_0020451 | Ga0395905_0020451_2873_3829 | 318 |
| 457 | 3300038443 | Ga0395901_0002517 | Ga0395901_0002517_7313_8275 | 318 |
| 458 | 3300038443 | Ga0395901_0038732 | Ga0395901_0038732_886_1842 | 318 |
| 459 | 3300038443 | Ga0395901_0045854 | Ga0395901_0045854_463_1419 | 318 |
| 460 | 3300038443 | Ga0395901_0118900 | Ga0395901_0118900_491_1453 | 318 |
| 461 | 3300039437 | Ga0436365_1292461 | Ga0436365_1292461_582_1538 | 318 |
| 462 | 3300039438 | Ga0436360_0073247 | Ga0436360_0073247_461_1417 | 318 |
| 463 | 3300039438 | Ga0436360_0149353 | Ga0436360_0149353_1315_2274 | 318 |
| 464 | 3300039438 | Ga0436360_0361778 | Ga0436360_0361778_1105_2082 | 318 |
| 465 | 3300039438 | Ga0436360_1074814 | Ga0436360_1074814_3109_4068 | 318 |
| 466 | 3300039438 | Ga0436360_1367695 | Ga0436360_1367695_570_1529 | 318 |
| 467 | 3300039447 | Ga0436361_0063454 | Ga0436361_0063454_890_1849 | 318 |
| 468 | 3300039447 | Ga0436361_0369023 | Ga0436361_0369023_1663_2619 | 318 |
| 469 | 3300039447 | Ga0436361_0428243 | Ga0436361_0428243_1347_2306 | 318 |
| 470 | 3300039447 | Ga0436361_0539018 | Ga0436361_0539018_742_1701 | 318 |
| 471 | 3300039450 | Ga0436363_1372834 | Ga0436363_1372834_1118_2074 | 318 |
| 472 | 3300039453 | Ga0436362_0994339 | Ga0436362_0994339_1629_2588 | 318 |
| 473 | 3300039453 | Ga0436362_1025120 | Ga0436362_1025120_179_1138 | 318 |
| 474 | 3300042438 | Ga0439459_0022052 | Ga0439459_0022052_121_1077 | 318 |
| 475 | 3300045051 | Ga0451576_0023943 | Ga0451576_0023943_4117_5073 | 318 |
| 476 | 3300045051 | Ga0451576_0173741 | Ga0451576_0173741_1009_1965 | 318 |
| 477 | 3300046454 | Ga0495592_0003291 | Ga0495592_0003291_8015_8971 | 318 |
| 478 | 3300046454 | Ga0495592_0179686 | Ga0495592_0179686_359_1315 | 318 |
| 479 | 3300046455 | Ga0495603_0002952 | Ga0495603_0002952_1267_2223 | 318 |
| 480 | 3300046455 | Ga0495603_0027620 | Ga0495603_0027620_157_1113 | 318 |
| 481 | 3300046458 | Ga0495591_042423 | Ga0495591_042423_175_1131 | 318 |
| 482 | 3300046459 | Ga0495629_0001640 | Ga0495629_0001640_12596_13552 | 318 |
| 483 | 3300046459 | Ga0495629_0023236 | Ga0495629_0023236_1312_2268 | 318 |
| 484 | 3300046461 | Ga0495641_0003962 | Ga0495641_0003962_5822_6778 | 318 |
| 485 | 3300046462 | Ga0495651_0008882 | Ga0495651_0008882_5723_6679 | 318 |
| 486 | 3300046463 | Ga0495653_0020998 | Ga0495653_0020998_2817_3773 | 318 |
| 487 | 3300046472 | Ga0495580_0004604 | Ga0495580_0004604_3625_4581 | 318 |
| 488 | 3300046473 | Ga0495582_0005832 | Ga0495582_0005832_3627_4583 | 318 |
| 489 | 3300046473 | Ga0495582_0011370 | Ga0495582_0011370_446_1402 | 318 |
| 490 | 3300046473 | Ga0495582_0045136 | Ga0495582_0045136_1248_2204 | 318 |
| 491 | 3300046473 | Ga0495582_0108975 | Ga0495582_0108975_205_1161 | 318 |
| 492 | 3300046475 | Ga0495639_0001566 | Ga0495639_0001566_3457_4413 | 318 |
| 493 | 3300046475 | Ga0495639_0026056 | Ga0495639_0026056_250_1206 | 318 |
| 494 | 3300046476 | Ga0495662_0010471 | Ga0495662_0010471_1385_2341 | 318 |
| 495 | 3300046477 | Ga0495664_0016146 | Ga0495664_0016146_764_1720 | 318 |
| 496 | 3300046491 | Ga0495584_0017160 | Ga0495584_0017160_191_1147 | 318 |
| 497 | 3300046491 | Ga0495584_0054883 | Ga0495584_0054883_874_1830 | 318 |
| 498 | 3300046492 | Ga0495585_0018483 | Ga0495585_0018483_2608_3564 | 318 |
| 499 | 3300046492 | Ga0495585_0083604 | Ga0495585_0083604_412_1368 | 318 |
| 500 | 3300046499 | Ga0495594_0016763 | Ga0495594_0016763_222_1178 | 318 |
| 501 | 3300046499 | Ga0495594_0060909 | Ga0495594_0060909_620_1576 | 318 |
| 502 | 3300046501 | Ga0495607_0007920 | Ga0495607_0007920_1072_2028 | 318 |
| 503 | 3300046507 | Ga0495606_0032077 | Ga0495606_0032077_2287_3243 | 318 |
| 504 | 3300046511 | Ga0495608_0006686 | Ga0495608_0006686_1384_2340 | 318 |
| 505 | 3300046511 | Ga0495608_0186712 | Ga0495608_0186712_235_1191 | 318 |
| 506 | 3300046514 | Ga0495618_0012578 | Ga0495618_0012578_1170_2126 | 318 |
| 507 | 3300046516 | Ga0495628_0010228 | Ga0495628_0010228_3821_4777 | 318 |
| 508 | 3300046517 | Ga0495630_0041990 | Ga0495630_0041990_1312_2268 | 318 |
| 509 | 3300046523 | Ga0495644_0004819 | Ga0495644_0004819_874_1830 | 318 |
| 510 | 3300046524 | Ga0495648_0015002 | Ga0495648_0015002_1930_2886 | 318 |
| 511 | 3300046526 | Ga0495666_0004818 | Ga0495666_0004818_2939_3895 | 318 |
| 512 | 3300046526 | Ga0495666_0006104 | Ga0495666_0006104_2042_2998 | 318 |
| 513 | 3300046529 | Ga0495652_0018574 | Ga0495652_0018574_1617_2573 | 318 |
| 514 | 3300046529 | Ga0495652_0040865 | Ga0495652_0040865_2140_3096 | 318 |
| 515 | 3300046531 | Ga0495665_0008763 | Ga0495665_0008763_232_1188 | 318 |
| 516 | 3300046533 | Ga0495640_0041943 | Ga0495640_0041943_1554_2510 | 318 |
| 517 | 3300046535 | Ga0495586_0004394 | Ga0495586_0004394_4165_5121 | 318 |
| 518 | 3300046539 | Ga0495621_0081752 | Ga0495621_0081752_160_1116 | 318 |
| 519 | 3300046557 | Ga0495622_0017687 | Ga0495622_0017687_133_1104 | 318 |
| 520 | 3300046558 | Ga0495633_0010960 | Ga0495633_0010960_1529_2485 | 318 |
| 521 | 3300046559 | Ga0495667_0024282 | Ga0495667_0024282_1515_2471 | 318 |
| 522 | 3300046559 | Ga0495667_0225723 | Ga0495667_0225723_25_981 | 318 |
| 523 | 3300046615 | Ga0495656_0001215 | Ga0495656_0001215_3036_3992 | 318 |
| 524 | 3300046615 | Ga0495656_0077176 | Ga0495656_0077176_414_1370 | 318 |
| 525 | 3300046616 | Ga0495668_0198921 | Ga0495668_0198921_22_978 | 318 |
| 526 | 3300046642 | Ga0495634_0078762 | Ga0495634_0078762_636_1592 | 318 |
| 527 | 3300046648 | Ga0495611_0003868 | Ga0495611_0003868_1080_2036 | 318 |
| 528 | 3300046663 | Ga0495635_0007616 | Ga0495635_0007616_3378_4334 | 318 |
| 529 | 3300046664 | Ga0495659_0001029 | Ga0495659_0001029_4223_5179 | 318 |
| 530 | 3300046674 | Ga0495588_0003197 | Ga0495588_0003197_3139_4095 | 318 |
| 531 | 3300046674 | Ga0495588_0075845 | Ga0495588_0075845_464_1420 | 318 |
| 532 | 3300046678 | Ga0495599_0028550 | Ga0495599_0028550_599_1555 | 318 |
| 533 | 3300046681 | Ga0495647_0004286 | Ga0495647_0004286_2532_3488 | 318 |
| 534 | 3300046681 | Ga0495647_0010294 | Ga0495647_0010294_1826_2782 | 318 |
| 535 | 3300046683 | Ga0495658_0002463 | Ga0495658_0002463_5764_6720 | 318 |
| 536 | 3300046683 | Ga0495658_0005737 | Ga0495658_0005737_1617_2573 | 318 |
| 537 | 3300046683 | Ga0495658_0068503 | Ga0495658_0068503_262_1218 | 318 |
| 538 | 3300046683 | Ga0495658_0239895 | Ga0495658_0239895_52_1008 | 318 |
| 539 | 3300046689 | Ga0495613_0000615 | Ga0495613_0000615_23480_24442 | 318 |
| 540 | 3300046689 | Ga0495613_0013607 | Ga0495613_0013607_1668_2624 | 318 |
| 541 | 3300046689 | Ga0495613_0029172 | Ga0495613_0029172_528_1484 | 318 |
| 542 | 3300046690 | Ga0495624_0009958 | Ga0495624_0009958_1152_2108 | 318 |
| 543 | 3300046690 | Ga0495624_0018144 | Ga0495624_0018144_2041_2997 | 318 |
| 544 | 3300046691 | Ga0495670_0001068 | Ga0495670_0001068_5464_6420 | 318 |
| 545 | 3300046691 | Ga0495670_0022339 | Ga0495670_0022339_1202_2158 | 318 |
| 546 | 3300046692 | Ga0495671_0041925 | Ga0495671_0041925_688_1644 | 318 |
| 547 | 3300046794 | Ga0495589_0072186 | Ga0495589_0072186_683_1639 | 318 |
| 548 | 3300046809 | Ga0495600_0005021 | Ga0495600_0005021_5320_6276 | 318 |
| 549 | 3300046809 | Ga0495600_0025066 | Ga0495600_0025066_1130_2086 | 318 |
| 550 | 3300046809 | Ga0495600_0145126 | Ga0495600_0145126_194_1150 | 318 |
| 551 | 3300047315 | Ga0495581_0002747 | Ga0495581_0002747_4987_5943 | 318 |
| 552 | 3300047315 | Ga0495581_0082642 | Ga0495581_0082642_303_1259 | 318 |
| 553 | 3300047317 | Ga0495604_0004824 | Ga0495604_0004824_1866_2822 | 318 |
| 554 | 3300047317 | Ga0495604_0022472 | Ga0495604_0022472_1508_2464 | 318 |
| 555 | 3300047318 | Ga0495636_0046928 | Ga0495636_0046928_265_1221 | 318 |
| 556 | 3300047318 | Ga0495636_0051239 | Ga0495636_0051239_117_1073 | 318 |
| 557 | 3300047319 | Ga0495674_0038965 | Ga0495674_0038965_515_1471 | 318 |
| 558 | 3300047319 | Ga0495674_0044084 | Ga0495674_0044084_2517_3473 | 318 |
| 559 | 3300047321 | Ga0495676_0014348 | Ga0495676_0014348_4227_5183 | 318 |
| 560 | 3300047321 | Ga0495676_0056171 | Ga0495676_0056171_619_1575 | 318 |
| 561 | 3300047321 | Ga0495676_0095015 | Ga0495676_0095015_1218_2174 | 318 |
| 562 | 3300047322 | Ga0495680_0019669 | Ga0495680_0019669_1702_2658 | 318 |
| 563 | 3300047322 | Ga0495680_0083563 | Ga0495680_0083563_1242_2198 | 318 |
| 564 | 3300047322 | Ga0495680_0086644 | Ga0495680_0086644_841_1797 | 318 |
| 565 | 3300047446 | Ga0495679_048937 | Ga0495679_048937_249_1205 | 318 |
| 566 | 3300047471 | Ga0495684_0003597 | Ga0495684_0003597_7054_8010 | 318 |
| 567 | 3300047471 | Ga0495684_0046226 | Ga0495684_0046226_2282_3238 | 318 |
| 568 | 3300047673 | Ga0495593_0014183 | Ga0495593_0014183_1132_2088 | 318 |
| 569 | 3300048903 | Ga0496100_0000842 | Ga0496100_0000842_6450_7406 | 318 |
| 570 | 3300048904 | Ga0496101_0001211 | Ga0496101_0001211_4485_5441 | 318 |
| 571 | 3300048904 | Ga0496101_0010153 | Ga0496101_0010153_2238_3194 | 318 |
| 572 | 3300048904 | Ga0496101_0058675 | Ga0496101_0058675_178_1134 | 318 |
| 573 | 3300048905 | Ga0496102_0009064 | Ga0496102_0009064_3257_4213 | 318 |
| 574 | 3300048905 | Ga0496102_0011697 | Ga0496102_0011697_476_1432 | 318 |
| 575 | 3300048905 | Ga0496102_0257613 | Ga0496102_0257613_645_1601 | 318 |
| 576 | 3300048906 | Ga0496103_0010836 | Ga0496103_0010836_3626_4582 | 318 |
| 577 | 3300048907 | Ga0496104_0000602 | Ga0496104_0000602_24681_25637 | 318 |
| 578 | 3300048907 | Ga0496104_0016899 | Ga0496104_0016899_2152_3108 | 318 |
| 579 | 3300048907 | Ga0496104_0026031 | Ga0496104_0026031_3724_4680 | 318 |
| 580 | 3300048908 | Ga0496105_0015020 | Ga0496105_0015020_3372_4328 | 318 |
| 581 | 3300048908 | Ga0496105_0064241 | Ga0496105_0064241_1540_2496 | 318 |
| 582 | 3300048908 | Ga0496105_0077378 | Ga0496105_0077378_1002_1958 | 318 |
| 583 | 3300048908 | Ga0496105_0115671 | Ga0496105_0115671_257_1213 | 318 |
| 584 | 3300048909 | Ga0496106_0000405 | Ga0496106_0000405_5395_6351 | 318 |
| 585 | 3300048909 | Ga0496106_0092378 | Ga0496106_0092378_35_991 | 318 |
| 586 | 3300048910 | Ga0496107_0001082 | Ga0496107_0001082_11815_12771 | 318 |
| 587 | 3300048911 | Ga0496108_0003869 | Ga0496108_0003869_1171_2127 | 318 |
| 588 | 3300048911 | Ga0496108_0011968 | Ga0496108_0011968_1039_1995 | 318 |
| 589 | 3300048911 | Ga0496108_0012570 | Ga0496108_0012570_899_1855 | 318 |
| 590 | 3300048911 | Ga0496108_0034009 | Ga0496108_0034009_2468_3424 | 318 |
| 591 | 3300048911 | Ga0496108_0043876 | Ga0496108_0043876_2435_3391 | 318 |
| 592 | 3300048912 | Ga0496109_0006129 | Ga0496109_0006129_2521_3477 | 318 |
| 593 | 3300048912 | Ga0496109_0006276 | Ga0496109_0006276_2858_3814 | 318 |
| 594 | 3300048912 | Ga0496109_0009555 | Ga0496109_0009555_4326_5282 | 318 |
| 595 | 3300048912 | Ga0496109_0052215 | Ga0496109_0052215_1604_2560 | 318 |
| 596 | 3300048913 | Ga0496110_0000468 | Ga0496110_0000468_3418_4374 | 318 |
| 597 | 3300048913 | Ga0496110_0015322 | Ga0496110_0015322_5209_6165 | 318 |
| 598 | 3300048913 | Ga0496110_0045555 | Ga0496110_0045555_544_1500 | 318 |
| 599 | 3300048913 | Ga0496110_0056143 | Ga0496110_0056143_2342_3298 | 318 |
| 600 | 3300048914 | Ga0496111_0001714 | Ga0496111_0001714_11020_11976 | 318 |
| 601 | 3300048914 | Ga0496111_0004338 | Ga0496111_0004338_6333_7289 | 318 |
| 602 | 3300048915 | Ga0496112_0000527 | Ga0496112_0000527_21854_22810 | 318 |
| 603 | 3300048915 | Ga0496112_0004838 | Ga0496112_0004838_5845_6801 | 318 |
| 604 | 3300048915 | Ga0496112_0023637 | Ga0496112_0023637_760_1716 | 318 |
| 605 | 3300048915 | Ga0496112_0089626 | Ga0496112_0089626_15_971 | 318 |
| 606 | 3300048915 | Ga0496112_0113744 | Ga0496112_0113744_830_1786 | 318 |
| 607 | 3300048915 | Ga0496112_0372948 | Ga0496112_0372948_37_993 | 318 |
| 608 | 3300048916 | Ga0496113_0003961 | Ga0496113_0003961_1343_2299 | 318 |
| 609 | 3300048916 | Ga0496113_0004231 | Ga0496113_0004231_2751_3707 | 318 |
| 610 | 3300048916 | Ga0496113_0011383 | Ga0496113_0011383_2897_3853 | 318 |
| 611 | 3300048916 | Ga0496113_0037525 | Ga0496113_0037525_1215_2171 | 318 |
| 612 | 3300048917 | Ga0496114_0104086 | Ga0496114_0104086_448_1404 | 318 |
| 613 | 3300048918 | Ga0496115_0005817 | Ga0496115_0005817_4512_5468 | 318 |
| 614 | 3300048918 | Ga0496115_0013101 | Ga0496115_0013101_3078_4034 | 318 |
| 615 | 3300048918 | Ga0496115_0388149 | Ga0496115_0388149_41_997 | 318 |
| 616 | 3300048929 | Ga0496126_0027336 | Ga0496126_0027336_4137_5093 | 318 |
| 617 | 3300049568 | Ga0501031_0026174 | Ga0501031_0026174_924_1880 | 318 |
| 618 | 3300049569 | Ga0501032_0092511 | Ga0501032_0092511_81_1037 | 318 |
| 619 | 3300049570 | Ga0501033_0007670 | Ga0501033_0007670_6679_7635 | 318 |
| 620 | 3300049572 | Ga0501036_0058938 | Ga0501036_0058938_1706_2662 | 318 |
| 621 | 3300049573 | Ga0501037_0105216 | Ga0501037_0105216_441_1397 | 318 |
| 622 | 3300049573 | Ga0501037_0110705 | Ga0501037_0110705_348_1304 | 318 |
| 623 | 3300049574 | Ga0501038_0000545 | Ga0501038_0000545_153_1109 | 318 |
| 624 | 3300049574 | Ga0501038_0043917 | Ga0501038_0043917_1185_2141 | 318 |
| 625 | 3300049574 | Ga0501038_0090782 | Ga0501038_0090782_382_1338 | 318 |
| 626 | 3300049575 | Ga0501039_0021356 | Ga0501039_0021356_1707_2663 | 318 |
| 627 | 3300049575 | Ga0501039_0032164 | Ga0501039_0032164_1844_2800 | 318 |
| 628 | 3300049576 | Ga0501040_0009859 | Ga0501040_0009859_1904_2860 | 318 |
| 629 | 3300049577 | Ga0501041_0019389 | Ga0501041_0019389_2501_3457 | 318 |
| 630 | 3300049578 | Ga0501042_0005234 | Ga0501042_0005234_1597_2553 | 318 |
| 631 | 3300049578 | Ga0501042_0159609 | Ga0501042_0159609_583_1539 | 318 |
| 632 | 3300049579 | Ga0501043_0007360 | Ga0501043_0007360_750_1706 | 318 |
| 633 | 3300049579 | Ga0501043_0013428 | Ga0501043_0013428_4767_5723 | 318 |
| 634 | 3300049580 | Ga0501046_0006010 | Ga0501046_0006010_3165_4121 | 318 |
| 635 | 3300049580 | Ga0501046_0014699 | Ga0501046_0014699_2902_3858 | 318 |
| 636 | 3300049581 | Ga0501047_0036178 | Ga0501047_0036178_2717_3673 | 318 |
| 637 | 3300049581 | Ga0501047_0096900 | Ga0501047_0096900_1340_2296 | 318 |
| 638 | 3300049581 | Ga0501047_0124159 | Ga0501047_0124159_1079_2050 | 318 |
| 639 | 3300049583 | Ga0501067_0014516 | Ga0501067_0014516_34_990 | 318 |
| 640 | 3300049584 | Ga0501068_0021670 | Ga0501068_0021670_153_1109 | 318 |
| 641 | 3300049585 | Ga0501069_0007215 | Ga0501069_0007215_1225_2181 | 318 |
| 642 | 3300049586 | Ga0501070_0003270 | Ga0501070_0003270_6427_7383 | 318 |
| 643 | 3300049586 | Ga0501070_0043932 | Ga0501070_0043932_533_1489 | 318 |
| 644 | 3300049586 | Ga0501070_0044384 | Ga0501070_0044384_1072_2028 | 318 |
| 645 | 3300049587 | Ga0501071_0156422 | Ga0501071_0156422_676_1632 | 318 |
| 646 | 3300049588 | Ga0501072_0013914 | Ga0501072_0013914_1878_2834 | 318 |
| 647 | 3300049590 | Ga0501074_0011655 | Ga0501074_0011655_5173_6129 | 318 |
| 648 | 3300049590 | Ga0501074_0035356 | Ga0501074_0035356_1946_2902 | 318 |
| 649 | 3300049590 | Ga0501074_0043753 | Ga0501074_0043753_1630_2586 | 318 |
| 650 | 3300049592 | Ga0501076_0114869 | Ga0501076_0114869_1145_2101 | 318 |
| 651 | 3300049592 | Ga0501076_0336498 | Ga0501076_0336498_89_1045 | 318 |
| 652 | 3300049593 | Ga0501077_0061228 | Ga0501077_0061228_290_1246 | 318 |
| 653 | 3300049742 | Ga0501080_0000340 | Ga0501080_0000340_34581_35537 | 318 |
| 654 | 3300049742 | Ga0501080_0019745 | Ga0501080_0019745_2021_2977 | 318 |
| 655 | 3300049743 | Ga0501081_0013714 | Ga0501081_0013714_1639_2595 | 318 |
| 656 | 3300049822 | Ga0501035_0067270 | Ga0501035_0067270_1699_2655 | 318 |
| 657 | 3300049822 | Ga0501035_0160626 | Ga0501035_0160626_603_1559 | 318 |
| 658 | 3300049822 | Ga0501035_0246704 | Ga0501035_0246704_412_1368 | 318 |
| 659 | 3300049824 | Ga0501045_0020987 | Ga0501045_0020987_1080_2036 | 318 |
| 660 | 3300049824 | Ga0501045_0094827 | Ga0501045_0094827_394_1350 | 318 |
| 661 | 3300050489 | nmdc:mga03683_17787_c1 | nmdc:mga03683_17787_c1_1667_2623 | 318 |
| 662 | 3300050507 | nmdc:mga05p37_44774_c1 | nmdc:mga05p37_44774_c1_1995_2951 | 318 |
| 663 | 3300050508 | nmdc:mga09592_10439_c1 | nmdc:mga09592_10439_c1_4629_5585 | 318 |
| 664 | 3300050508 | nmdc:mga09592_78389_c1 | nmdc:mga09592_78389_c1_886_1842 | 318 |
| 665 | 3300050509 | nmdc:mga0qj67_11760_c1 | nmdc:mga0qj67_11760_c1_4501_5457 | 318 |
| 666 | 3300050510 | nmdc:mga06r32_13597_c1 | nmdc:mga06r32_13597_c1_1241_2197 | 318 |
| 667 | 3300050511 | nmdc:mga08y16_1925_c1 | nmdc:mga08y16_1925_c1_12373_13329 | 318 |
| 668 | 3300050512 | nmdc:mga0n895_124457_c1 | nmdc:mga0n895_124457_c1_376_1332 | 318 |
| 669 | 3300050512 | nmdc:mga0n895_167910_c1 | nmdc:mga0n895_167910_c1_1040_1996 | 318 |
| 670 | 3300050512 | nmdc:mga0n895_329747_c1 | nmdc:mga0n895_329747_c1_408_1364 | 318 |
| 671 | 3300050512 | nmdc:mga0n895_4364_c1 | nmdc:mga0n895_4364_c1_7853_8809 | 318 |
| 672 | 3300050513 | nmdc:mga0rr50_342559_c1 | nmdc:mga0rr50_342559_c1_214_1170 | 318 |
| 673 | 3300050513 | nmdc:mga0rr50_68049_c1 | nmdc:mga0rr50_68049_c1_1032_1988 | 318 |
| 674 | 3300050515 | nmdc:mga0a205_6620_c1 | nmdc:mga0a205_6620_c1_5801_6757 | 318 |
| 675 | 3300053077 | Ga0495601_0005375 | Ga0495601_0005375_4467_5423 | 318 |
| 676 | 3300053077 | Ga0495601_0045414 | Ga0495601_0045414_1239_2195 | 318 |
| 677 | 3300053077 | Ga0495601_0066984 | Ga0495601_0066984_567_1523 | 318 |
| 678 | 3300053078 | Ga0495612_0006083 | Ga0495612_0006083_1178_2134 | 318 |
| 679 | 3300053078 | Ga0495612_0009510 | Ga0495612_0009510_367_1323 | 318 |
| 680 | 3300053078 | Ga0495612_0028706 | Ga0495612_0028706_504_1460 | 318 |
| 681 | 3300053078 | Ga0495612_0078658 | Ga0495612_0078658_313_1269 | 318 |
| 682 | 3300053078 | Ga0495612_0102084 | Ga0495612_0102084_22_978 | 318 |
| 683 | 3300053083 | Ga0495655_0007882 | Ga0495655_0007882_181_1137 | 318 |
| 684 | 3300053084 | Ga0495595_0002759 | Ga0495595_0002759_2633_3589 | 318 |
| 685 | 3300053085 | Ga0495619_0000052 | Ga0495619_0000052_10943_11899 | 318 |
| 686 | 3300053085 | Ga0495619_0000821 | Ga0495619_0000821_11406_12362 | 318 |
| 687 | 3300053085 | Ga0495619_0046030 | Ga0495619_0046030_636_1592 | 318 |
| 688 | 3300053094 | Ga0500566_0000049 | Ga0500566_0000049_27938_28894 | 318 |
| 689 | 3300053096 | Ga0500641_0007196 | Ga0500641_0007196_988_1944 | 318 |
| 690 | 3300053111 | Ga0500572_000476 | Ga0500572_000476_6746_7702 | 318 |
| 691 | 3300053115 | Ga0500591_027619 | Ga0500591_027619_1424_2380 | 318 |
| 692 | 3300053122 | Ga0500608_030856 | Ga0500608_030856_108_1064 | 318 |
| 693 | 3300053136 | Ga0500559_0000654 | Ga0500559_0000654_4021_4977 | 318 |
| 694 | 3300053150 | Ga0500603_000031 | Ga0500603_000031_11883_12839 | 318 |
| 695 | 3300053159 | Ga0500630_000581 | Ga0500630_000581_6414_7370 | 318 |
| 696 | 3300053163 | Ga0500639_000020 | Ga0500639_000020_98329_99285 | 318 |
| 697 | 3300053177 | Ga0500636_0070433 | Ga0500636_0070433_169_1125 | 318 |
| 698 | 3300053178 | Ga0500637_0007143 | Ga0500637_0007143_601_1557 | 318 |
| 699 | 3300053735 | Ga0500596_003763 | Ga0500596_003763_804_1760 | 318 |
| 700 | 3300053737 | Ga0500601_006297 | Ga0500601_006297_184_1140 | 318 |
| 701 | 3300054114 | Ga0501084_0014440 | Ga0501084_0014440_3659_4615 | 318 |
| 702 | 3300054114 | Ga0501084_0287785 | Ga0501084_0287785_286_1242 | 318 |
| 703 | 3300060353 | Ga0501082_0115603 | Ga0501082_0115603_981_1937 | 318 |
| 704 | 3300061734 | Ga0530510_0079726 | Ga0530510_0079726_32_988 | 318 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7z0s-assembly1.cif.gz_D | structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) | 0.8966 | 10 | 314 |
| 7z0t-assembly1.cif.gz_D | structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) | 0.8953 | 10 | 314 |
| 7z0s-assembly1.cif.gz_D | structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) | 0.8801 | 10 | 314 |
| 7z0t-assembly1.cif.gz_D | structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) | 0.8777 | 10 | 314 |
| 7f9o-assembly1.cif.gz_G | psi-ndh supercomplex of barley | 0.8038 | 15 | 316 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q59R29_400_561_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3318 | 101 | 281 | 1.20.1250.20 |
| af_Q59R29_400_561_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3243 | 101 | 281 | 1.20.1250.20 |
| af_Q09934_214_431_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.3199 | 67 | 247 | 1.20.1640.10 |
| af_Q6YK44_74_579_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3179 | 65 | 311 | 1.20.1250.20 |
| af_A0A1D8PQZ7_87_288_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3084 | 93 | 313 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3AY45-F1-model_v4 | Formate hydrogenlyase | 0.9812 | 69 | 195 |
GO:0005886
GO:0016829 |
| AF-A0A3D3AY45-F1-model_v4 | Formate hydrogenlyase | 0.9662 | 69 | 195 |
GO:0005886
GO:0016829 |
| AF-A0A257PYX2-F1-model_v4 | Formate hydrogenlyase | 0.9585 | 4 | 195 |
GO:0005886
|
| AF-A0A534DSG4-F1-model_v4 | deleted | 0.9576 | 6 | 153 |
|
| AF-A0A3N5MWE9-F1-model_v4 | Formate hydrogenlyase | 0.9554 | 1 | 288 |
GO:0005886
GO:0016829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar