F476367

General Info

Members Datasets Scaffolds Average Seq Length
704 364 677 314

Family's Representative Sequence

Representative Sequence 3300039110|Ga0400487_03596|Ga0400487_03596_2128_3123
Length 331
Sequence MADYLLNEWLVNWPVGWLLAGLQTLLFIAIAPLLAGWIKLKKCRLQNRIAPSIWQPYRDLRKLFRKESVIAANASWIFRTTPYIVFGTTVLAAGVVPLIATDLPSAAIADVIVLVGFFALARFFLALAGMDIGTAFGGMGSSREMTLASLTEPAMLMAVFTLAMTASTTNLSTTIEVILSQGIVLRPSFIFAALGLMMVAIAETGRIPIDNPATHLELTMVHEAMILEYSGRHLAMLEWAQQIKLMVYGVLIVNLFVPWGIATELTEVALLVGSVAIIAKLALLGVILAISETVLAKLRLFRAPNYISFAFLLCLLGLLSHVILEVQQSTL

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
6 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
7 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
8 2643221618 Ensifer sp. Root231 Isolate Unclassified
9 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
10 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
11 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
12 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
13 2906610324
14 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
15 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
16 2922425934
17 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
18 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
19 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
20 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
21 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
22 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
23 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
113 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
155 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
158 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
159 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
160 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
164 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
165 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
169 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
170 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
174 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
189 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
202 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
205 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
206 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
207 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
208 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
209 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
231 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
234 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
235 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
250 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
268 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
280 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
313 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
314 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
315 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
316 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
317 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
320 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
321 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
322 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
331 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
337 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
338 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
339 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
340 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
341 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
342 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
343 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
344 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
345 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
346 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
347 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
348 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
349 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
350 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
351 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
352 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
353 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
354 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
355 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
356 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
357 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
358 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
361 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
362 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
363 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
364 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.3
Metatranscriptomes 0.14
Isolates 3.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.69
Nodule 2.41
Rhizoplane 9.09
Rhizosphere 81.96
Stem 0
Stem Tuber 0
Unclassified 2.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10024687 3300001979 Bacteria 2037
2 JGI24737J22298_10048358 3300001990 Bacteria 1295
3 JGI25153J46596_10000946 3300003215 Bacteria 17627
4 JGI25404J52841_10015246 3300003659 Bacteria 1668
5 Ga0065165_1000785 3300005262 Bacteria 42533
6 Ga0065715_10104321 3300005293 Bacteria 2970
7 Ga0065707_10091172 3300005295 Bacteria 3993
8 Ga0070658_10079674 3300005327 Bacteria 2690
9 Ga0070683_100006806 3300005329 Bacteria 9604
10 Ga0070683_100062439 3300005329 Bacteria 3464
11 Ga0070683_100163185 3300005329 Bacteria 2114
12 Ga0070666_10137277 3300005335 Bacteria 1702
13 Ga0070680_100042057 3300005336 Bacteria 3706
14 Ga0068868_100226201 3300005338 Bacteria 1568
15 Ga0070660_100003489 3300005339 Bacteria 10834
16 Ga0070689_100024765 3300005340 Bacteria 4504
17 Ga0070661_100411955 3300005344 Bacteria 1070
18 Ga0070669_100018253 3300005353 Bacteria 5012
19 Ga0070674_100237939 3300005356 Bacteria 1424
20 Ga0070673_100007902 3300005364 Bacteria 7051
21 Ga0070667_100101443 3300005367 Bacteria 2486
22 Ga0070667_100126654 3300005367 Bacteria 2226
23 Ga0070709_10112069 3300005434 Bacteria 1835
24 Ga0070713_100409851 3300005436 Bacteria 1267
25 Ga0070700_100248498 3300005441 Bacteria 1275
26 Ga0070694_100104069 3300005444 Bacteria 2012
27 Ga0070708_100018422 3300005445 Bacteria 5844
28 Ga0070708_100020728 3300005445 Bacteria 5550
29 Ga0070663_100009487 3300005455 Bacteria 6029
30 Ga0070663_100078723 3300005455 Bacteria 2417
31 Ga0070681_10004100 3300005458 Bacteria 13769
32 Ga0070681_10027203 3300005458 Bacteria 5751
33 Ga0070681_10442004 3300005458 Bacteria 1212
34 Ga0070685_10101294 3300005466 Bacteria 1759
35 Ga0070706_100009059 3300005467 Bacteria 9263
36 Ga0070698_100004962 3300005471 Bacteria 14580
37 Ga0070698_100413951 3300005471 Bacteria 1282
38 Ga0070699_100005057 3300005518 Bacteria 11609
39 Ga0070699_100010430 3300005518 Bacteria 8041
40 Ga0070679_100092199 3300005530 Bacteria 3017
41 Ga0070684_100133696 3300005535 Bacteria 2239
42 Ga0070684_100209282 3300005535 Bacteria 1777
43 Ga0070697_100033689 3300005536 Bacteria 4127
44 Ga0070697_100065682 3300005536 Bacteria 2965
45 Ga0068853_100255074 3300005539 Bacteria 1611
46 Ga0070672_100106865 3300005543 Bacteria 2277
47 Ga0070686_100091167 3300005544 Bacteria 2039
48 Ga0070696_100052793 3300005546 Bacteria 2828
49 Ga0070665_100109558 3300005548 Bacteria 2764
50 Ga0070665_100345927 3300005548 Bacteria 1492
51 Ga0070704_100005398 3300005549 Bacteria 7444
52 Ga0068855_100007706 3300005563 Bacteria 13003
53 Ga0068855_100037426 3300005563 Bacteria 5769
54 Ga0068855_100198230 3300005563 Bacteria 2261
55 Ga0068855_100406711 3300005563 Bacteria 1491
56 Ga0068857_100084493 3300005577 Bacteria 2836
57 Ga0068854_100082238 3300005578 Bacteria 2380
58 Ga0070702_100141454 3300005615 Bacteria 1533
59 Ga0068864_100080001 3300005618 Bacteria 2863
60 Ga0068866_10025656 3300005718 Bacteria 2773
61 Ga0068863_100265397 3300005841 Bacteria 1661
62 Ga0081455_10001555 3300005937 Bacteria 28179
63 Ga0081455_10002076 3300005937 Bacteria 23889
64 Ga0081455_10008768 3300005937 Bacteria 10470
65 Ga0081455_10044348 3300005937 Bacteria 3881
66 Ga0081455_10055152 3300005937 Bacteria 3382
67 Ga0081455_10217206 3300005937 Bacteria 1420
68 Ga0081540_1002923 3300005983 Bacteria 13756
69 Ga0081539_10019455 3300005985 Bacteria 4646
70 Ga0070717_10015928 3300006028 Bacteria 5819
71 Ga0070717_10054441 3300006028 Bacteria 3299
72 Ga0070717_10201423 3300006028 Bacteria 1744
73 Ga0075365_10130583 3300006038 Bacteria 1738
74 Ga0070712_100288144 3300006175 Bacteria 1325
75 Ga0075369_10031986 3300006186 Bacteria 2224
76 Ga0097621_100155598 3300006237 Bacteria 1962
77 Ga0097621_100500030 3300006237 Bacteria 1101
78 Ga0075428_100015159 3300006844 Bacteria 8549
79 Ga0075428_100594867 3300006844 Bacteria 1182
80 Ga0075430_100009149 3300006846 Bacteria 8369
81 Ga0075430_100218435 3300006846 Bacteria 1582
82 Ga0075431_100018426 3300006847 Bacteria 7109
83 Ga0075433_10028952 3300006852 Bacteria 4714
84 Ga0075434_100008951 3300006871 Bacteria 9323
85 Ga0075434_100276654 3300006871 Bacteria 1698
86 Ga0075429_100008886 3300006880 Bacteria 8733
87 Ga0075436_100001243 3300006914 Bacteria 17319
88 Ga0075436_100322393 3300006914 Bacteria 1110
89 Ga0075435_100020921 3300007076 Bacteria 5024
90 Ga0099794_10002299 3300007265 Bacteria 7025
91 Ga0099794_10008987 3300007265 Bacteria 4171
92 Ga0099794_10050643 3300007265 Bacteria 1998
93 Ga0099795_10004297 3300007788 Bacteria 3658
94 Ga0099795_10011809 3300007788 Bacteria 2626
95 Ga0099795_10024949 3300007788 Bacteria 1999
96 Ga0105240_10016507 3300009093 Bacteria 9994
97 Ga0105240_10020582 3300009093 Bacteria 8793
98 Ga0111539_10007260 3300009094 Bacteria 14189
99 Ga0111539_10015669 3300009094 Bacteria 9422
100 Ga0105247_10009021 3300009101 Bacteria 6074
101 Ga0105247_10011300 3300009101 Bacteria 5385
102 Ga0114129_10018961 3300009147 Bacteria 9800
103 Ga0114129_10024866 3300009147 Bacteria 8491
104 Ga0114129_10203045 3300009147 Bacteria 2683
105 Ga0114129_10535767 3300009147 Bacteria 1525
106 Ga0105243_10034348 3300009148 Bacteria 3925
107 Ga0105243_10052495 3300009148 Bacteria 3229
108 Ga0105242_10244586 3300009176 Bacteria 1614
109 Ga0105248_10275210 3300009177 Bacteria 1895
110 Ga0105237_10131772 3300009545 Bacteria 2494
111 Ga0105237_10150598 3300009545 Bacteria 2323
112 Ga0105238_10034573 3300009551 Bacteria 5142
113 Ga0105238_10037267 3300009551 Bacteria 4944
114 Ga0105238_10469470 3300009551 Bacteria 1257
115 Ga0105249_10011069 3300009553 Bacteria 7927
116 Ga0105249_10031333 3300009553 Bacteria 4809
117 Ga0099796_10001698 3300010159 Bacteria 4566
118 Ga0099796_10012365 3300010159 Bacteria 2409
119 Ga0099796_10025076 3300010159 Bacteria 1879
120 Ga0105239_10005103 3300010375 Bacteria 15500
121 Ga0105239_10046428 3300010375 Bacteria 4760
122 Ga0105239_10157445 3300010375 Bacteria 2537
123 Ga0105246_10282562 3300011119 Bacteria 1332
124 Ga0157370_10008657 3300013104 Bacteria 10951
125 Ga0157369_10634955 3300013105 Bacteria 1102
126 Ga0157374_10369865 3300013296 Bacteria 1427
127 Ga0157378_10030990 3300013297 Bacteria 4722
128 Ga0157378_10081545 3300013297 Bacteria 2924
129 Ga0157375_10003393 3300013308 Bacteria 13812
130 Ga0157375_10046525 3300013308 Bacteria 4231
131 Ga0163163_10006150 3300014325 Bacteria 10461
132 Ga0163163_10082676 3300014325 Bacteria 3215
133 Ga0163163_10116319 3300014325 Bacteria 2705
134 Ga0163163_10426129 3300014325 Bacteria 1386
135 Ga0157380_10172391 3300014326 Bacteria 1892
136 Ga0157379_10006642 3300014968 Bacteria 9980
137 Ga0157376_10085855 3300014969 Bacteria 2712
138 Ga0213872_10034640 3300021361 Bacteria 2311
139 Ga0213872_10048695 3300021361 Bacteria 1926
140 Ga0213876_10000130 3300021384 Bacteria 81967
141 Ga0213871_10030191 3300021441 Bacteria 1409
142 Ga0213871_10044856 3300021441 Bacteria 1196
143 Ga0228598_1005683 3300024227 Bacteria 2599
144 Ga0209233_1002293 3300025261 Bacteria 7134
145 Ga0209233_1008990 3300025261 Bacteria 3057
146 Ga0209025_1053107 3300025294 Bacteria 1593
147 Ga0209257_1010814 3300025304 Bacteria 4526
148 Ga0207697_10035372 3300025315 Bacteria 2045
149 Ga0207692_10066504 3300025898 Bacteria 1884
150 Ga0207699_10259310 3300025906 Bacteria 1201
151 Ga0207705_10003526 3300025909 Bacteria 11920
152 Ga0207707_10003874 3300025912 Bacteria 13268
153 Ga0207707_10017265 3300025912 Bacteria 6289
154 Ga0207695_10069050 3300025913 Bacteria 3618
155 Ga0207695_10081479 3300025913 Bacteria 3275
156 Ga0207671_10162612 3300025914 Bacteria 1729
157 Ga0207693_10017660 3300025915 Bacteria 5688
158 Ga0207663_10025255 3300025916 Bacteria 3432
159 Ga0207660_10089440 3300025917 Bacteria 2279
160 Ga0207657_10013834 3300025919 Bacteria 7897
161 Ga0207644_10127265 3300025931 Bacteria 1946
162 Ga0207691_10150524 3300025940 Bacteria 2046
163 Ga0207711_10119510 3300025941 Bacteria 2351
164 Ga0207661_10158516 3300025944 Bacteria 1962
165 Ga0207661_10497456 3300025944 Bacteria 1114
166 Ga0207667_10037084 3300025949 Bacteria 5214
167 Ga0207658_10051795 3300025986 Bacteria 3027
168 Ga0207703_10021926 3300026035 Bacteria 5002
169 Ga0207639_10306754 3300026041 Bacteria 1405
170 Ga0207678_10027109 3300026067 Bacteria 4996
171 Ga0207702_10071299 3300026078 Bacteria 2991
172 Ga0207641_10050088 3300026088 Bacteria 3533
173 Ga0207676_10067232 3300026095 Bacteria 2862
174 Ga0207683_10039727 3300026121 Bacteria 4105
175 Ga0209179_1002942 3300027512 Bacteria 2381
176 Ga0209974_10029266 3300027876 Bacteria 1824
177 Ga0207428_10000219 3300027907 Bacteria 79717
178 Ga0268266_10071331 3300028379 Bacteria 3011
179 Ga0268266_10285401 3300028379 Bacteria 1536
180 Ga0265334_10001560 3300028573 Bacteria 11039
181 Ga0265338_10026478 3300028800 Bacteria 5846
182 Ga0265338_10056371 3300028800 Bacteria 3485
183 Ga0265338_10087780 3300028800 Bacteria 2583
184 Ga0265338_10161562 3300028800 Bacteria 1729
185 Ga0265325_10008336 3300031241 Bacteria 6121
186 Ga0265325_10150068 3300031241 Bacteria 1103
187 Ga0265340_10033125 3300031247 Bacteria 2575
188 Ga0265340_10045766 3300031247 Bacteria 2136
189 Ga0265339_10000137 3300031249 Bacteria 60322
190 Ga0265339_10002052 3300031249 Bacteria 14798
191 Ga0265327_10000742 3300031251 Bacteria 50671
192 Ga0265327_10000881 3300031251 Bacteria 44377
193 Ga0265327_10003707 3300031251 Bacteria 14241
194 Ga0265327_10033545 3300031251 Bacteria 2859
195 Ga0265327_10033945 3300031251 Bacteria 2837
196 Ga0265316_10001619 3300031344 Bacteria 24014
197 Ga0265316_10004775 3300031344 Bacteria 13370
198 Ga0265316_10068276 3300031344 Bacteria 2747
199 Ga0265313_10000782 3300031595 Bacteria 32152
200 Ga0307508_10000105 3300031616 Bacteria 99107
201 Ga0316575_10003138 3300031665 Bacteria 5647
202 Ga0316575_10005544 3300031665 Bacteria 4501
203 Ga0316575_10043597 3300031665 Bacteria 1778
204 Ga0316579_10000638 3300031691 Bacteria 11884
205 Ga0316579_10001822 3300031691 Bacteria 7867
206 Ga0316579_10004581 3300031691 Bacteria 5501
207 Ga0316579_10008234 3300031691 Bacteria 4340
208 Ga0316579_10022911 3300031691 Bacteria 2798
209 Ga0316579_10027196 3300031691 Bacteria 2595
210 Ga0265314_10004203 3300031711 Bacteria 13513
211 Ga0265314_10021511 3300031711 Bacteria 4956
212 Ga0265314_10080132 3300031711 Bacteria 2157
213 Ga0316576_10083088 3300031727 Bacteria 2379
214 Ga0316576_10172436 3300031727 Bacteria 1633
215 Ga0316578_10005177 3300031728 Bacteria 6289
216 Ga0316578_10055741 3300031728 Bacteria 2320
217 Ga0307516_10000657 3300031730 Bacteria 46760
218 Ga0307516_10025929 3300031730 Bacteria 5960
219 Ga0316577_10002289 3300031733 Bacteria 9440
220 Ga0316577_10002995 3300031733 Bacteria 8458
221 Ga0307406_10309247 3300031901 Bacteria 1218
222 Ga0307409_100067374 3300031995 Bacteria 2827
223 Ga0316585_10000195 3300032137 Bacteria 12419
224 Ga0316585_10002967 3300032137 Bacteria 4632
225 Ga0316580_10001428 3300032139 Bacteria 6234
226 Ga0316593_10088053 3300032168 Bacteria 1091
227 Ga0315911_1000003 3300033442 Bacteria 502217
228 Ga0373926_0003849 3300035083 Bacteria 4901
229 Ga0373944_0000604 3300035089 Bacteria 8539
230 Ga0373949_0025860 3300035090 Bacteria 1372
231 Ga0373932_0004658 3300035112 Bacteria 3239
232 Ga0373936_0003825 3300035113 Bacteria 5668
233 Ga0373939_0044504 3300035114 Bacteria 1351
234 Ga0373945_0001800 3300035116 Bacteria 6616
235 Ga0373954_0000062 3300035118 Bacteria 38112
236 Ga0373954_0025920 3300035118 Bacteria 2684
237 Ga0373957_0020306 3300035120 Bacteria 2346
238 Ga0373957_0072616 3300035120 Bacteria 1348
239 Ga0373943_0007472 3300035170 Bacteria 4910
240 Ga0373946_0004350 3300035171 Bacteria 5069
241 Ga0373946_0029888 3300035171 Bacteria 2172
242 Ga0373955_0073867 3300035172 Bacteria 1912
243 Ga0373961_0028767 3300035241 Bacteria 1534
244 Ga0316574_0006936 3300035398 Bacteria 6168
245 Ga0316574_0047906 3300035398 Bacteria 2654
246 Ga0316574_0089001 3300035398 Bacteria 1966
247 Ga0316574_0095231 3300035398 Bacteria 1902
248 Ga0373924_0003093 3300035410 Bacteria 5679
249 Ga0373931_0031368 3300035691 Bacteria 2743
250 Ga0373935_0002036 3300035692 Bacteria 11424
251 Ga0373935_0016174 3300035692 Bacteria 4515
252 Ga0373935_0030724 3300035692 Bacteria 3330
253 Ga0373927_0008757 3300035695 Bacteria 6798
254 Ga0373927_0017373 3300035695 Bacteria 4735
255 Ga0373927_0031229 3300035695 Bacteria 3473
256 Ga0373927_0193005 3300035695 Bacteria 1336
257 Ga0373933_0005995 3300035724 Bacteria 6615
258 Ga0373933_0086134 3300035724 Bacteria 1933
259 Ga0373947_0004669 3300035725 Bacteria 8029
260 Ga0373947_0016784 3300035725 Bacteria 4206
261 Ga0373947_0048990 3300035725 Bacteria 2536
262 Ga0373937_0002933 3300036401 Bacteria 14270
263 Ga0373937_0006804 3300036401 Bacteria 9867
264 Ga0373937_0008181 3300036401 Bacteria 9084
265 Ga0373937_0029181 3300036401 Bacteria 4995
266 Ga0316582_0003599 3300036647 Bacteria 7639
267 Ga0316582_0004787 3300036647 Bacteria 6896
268 Ga0316582_0010970 3300036647 Bacteria 4991
269 Ga0316582_0037763 3300036647 Bacteria 2997
270 Ga0316584_0006337 3300036712 Bacteria 8016
271 Ga0316584_0017667 3300036712 Bacteria 5134
272 Ga0316584_0042040 3300036712 Bacteria 3408
273 Ga0316584_0049027 3300036712 Bacteria 3156
274 Ga0316584_0063254 3300036712 Bacteria 2770
275 Ga0316584_0087930 3300036712 Bacteria 2326
276 Ga0316584_0139275 3300036712 Bacteria 1810
277 Ga0373925_0033905 3300037068 Bacteria 3762
278 Ga0373925_0038765 3300037068 Bacteria 3524
279 Ga0373925_0073484 3300037068 Bacteria 2588
280 Ga0395899_0002665 3300037312 Bacteria 14397
281 Ga0395899_0006791 3300037312 Bacteria 8869
282 Ga0395900_0000381 3300037418 Bacteria 63938
283 Ga0395900_0009733 3300037418 Bacteria 9844
284 Ga0395900_0097182 3300037418 Bacteria 3026
285 Ga0395898_0007562 3300037466 Bacteria 11536
286 Ga0395898_0049607 3300037466 Bacteria 4112
287 Ga0395898_0077798 3300037466 Bacteria 3202
288 Ga0395905_0004769 3300037471 Bacteria 14012
289 Ga0395905_0020451 3300037471 Bacteria 6271
290 Ga0316581_0000030 3300037588 Bacteria 15125
291 Ga0316581_0005303 3300037588 Bacteria 3348
292 Ga0316581_0042087 3300037588 Bacteria 1393
293 Ga0395901_0002517 3300038443 Bacteria 18553
294 Ga0395901_0038732 3300038443 Bacteria 4931
295 Ga0395901_0045854 3300038443 Bacteria 4539
296 Ga0395901_0118900 3300038443 Bacteria 2776
297 Ga0400487_03596 3300039110 Bacteria 6394
298 Ga0436365_0031959 3300039437 Bacteria 106267
299 Ga0436365_1292461 3300039437 Bacteria 3052
300 Ga0436360_0073247 3300039438 Bacteria 3068
301 Ga0436360_0149353 3300039438 Bacteria 3896
302 Ga0436360_0361778 3300039438 Bacteria 2261
303 Ga0436360_0708065 3300039438 Bacteria 1156
304 Ga0436360_1074814 3300039438 Bacteria 5161
305 Ga0436360_1367695 3300039438 Bacteria 2477
306 Ga0436361_0063454 3300039447 Bacteria 2685
307 Ga0436361_0369023 3300039447 Bacteria 6346
308 Ga0436361_0428243 3300039447 Bacteria 2594
309 Ga0436361_0539018 3300039447 Bacteria 2789
310 Ga0436363_0642160 3300039450 Bacteria 1756
311 Ga0436363_1372834 3300039450 Bacteria 2160
312 Ga0436362_0994339 3300039453 Bacteria 2852
313 Ga0436362_1025120 3300039453 Bacteria 1305
314 Ga0439436_0002272 3300041404 Bacteria 5754
315 Ga0439465_0002393 3300041413 Bacteria 6138
316 Ga0439441_007658 3300042001 Bacteria 1747
317 Ga0439462_0034633 3300042015 Bacteria 1341
318 Ga0450920_006237 3300042122 Bacteria 2140
319 Ga0439459_0022052 3300042438 Bacteria 1229
320 Ga0450918_004771 3300042531 Bacteria 2458
321 Ga0451577_0000035 3300042876 Bacteria 373467
322 Ga0451577_0000471 3300042876 Bacteria 69254
323 Ga0451577_0000739 3300042876 Bacteria 50382
324 Ga0451577_0002216 3300042876 Bacteria 23670
325 Ga0451577_0015764 3300042876 Bacteria 7015
326 Ga0451577_0045736 3300042876 Bacteria 3918
327 Ga0451577_0211162 3300042876 Bacteria 1753
328 Ga0451577_0305914 3300042876 Bacteria 1441
329 Ga0451577_0330122 3300042876 Bacteria 1383
330 Ga0453683_0000095 3300044673 Bacteria 132405
331 Ga0453683_0190319 3300044673 Bacteria 1302
332 Ga0466961_0051113 3300044693 Bacteria 2640
333 Ga0466963_0035869 3300044694 Bacteria 3231
334 Ga0453684_0000006 3300044712 Bacteria 1364191
335 Ga0453684_0000031 3300044712 Bacteria 752632
336 Ga0453684_0000089 3300044712 Bacteria 395064
337 Ga0453684_0000097 3300044712 Bacteria 377772
338 Ga0453684_0000176 3300044712 Bacteria 283097
339 Ga0453684_0000177 3300044712 Bacteria 282969
340 Ga0453684_0000732 3300044712 Bacteria 114945
341 Ga0453684_0002182 3300044712 Bacteria 48823
342 Ga0453684_0005947 3300044712 Bacteria 23665
343 Ga0453684_0006440 3300044712 Bacteria 22295
344 Ga0453684_0010364 3300044712 Bacteria 15951
345 Ga0453684_0014620 3300044712 Bacteria 12530
346 Ga0453684_0021800 3300044712 Bacteria 9544
347 Ga0453684_0025660 3300044712 Bacteria 8548
348 Ga0453684_0032406 3300044712 Bacteria 7315
349 Ga0453684_0032690 3300044712 Bacteria 7272
350 Ga0453684_0033541 3300044712 Bacteria 7154
351 Ga0453684_0073235 3300044712 Bacteria 4320
352 Ga0453684_0100025 3300044712 Bacteria 3550
353 Ga0453684_0100546 3300044712 Bacteria 3539
354 Ga0453684_0105141 3300044712 Bacteria 3444
355 Ga0453684_0133742 3300044712 Bacteria 2972
356 Ga0453684_0922051 3300044712 Bacteria 934
357 Ga0466971_0011207 3300044719 Bacteria 3928
358 Ga0451576_0000056 3300045051 Bacteria 303398
359 Ga0451576_0000361 3300045051 Bacteria 109138
360 Ga0451576_0000806 3300045051 Bacteria 61449
361 Ga0451576_0001345 3300045051 Bacteria 42474
362 Ga0451576_0023943 3300045051 Bacteria 6601
363 Ga0451576_0025858 3300045051 Bacteria 6322
364 Ga0451576_0173741 3300045051 Bacteria 2249
365 Ga0451576_0334927 3300045051 Bacteria 1584
366 Ga0451576_0609320 3300045051 Bacteria 1148
367 Ga0466958_0022162 3300045836 Bacteria 3719
368 Ga0495592_0003291 3300046454 Bacteria 11580
369 Ga0495592_0179686 3300046454 Bacteria 1442
370 Ga0495592_0428408 3300046454 Bacteria 833
371 Ga0495603_0002952 3300046455 Bacteria 10061
372 Ga0495603_0027620 3300046455 Bacteria 3424
373 Ga0495591_042423 3300046458 Bacteria 1286
374 Ga0495629_0001640 3300046459 Bacteria 17572
375 Ga0495629_0020353 3300046459 Bacteria 4740
376 Ga0495629_0023236 3300046459 Bacteria 4418
377 Ga0495641_0003962 3300046461 Bacteria 10757
378 Ga0495641_0011719 3300046461 Bacteria 4965
379 Ga0495651_0008882 3300046462 Bacteria 7716
380 Ga0495653_0020998 3300046463 Bacteria 5291
381 Ga0495580_0004604 3300046472 Bacteria 11573
382 Ga0495582_0005832 3300046473 Bacteria 6861
383 Ga0495582_0011370 3300046473 Bacteria 4905
384 Ga0495582_0045136 3300046473 Bacteria 2427
385 Ga0495582_0108975 3300046473 Bacteria 1555
386 Ga0495639_0001566 3300046475 Bacteria 10222
387 Ga0495639_0026056 3300046475 Bacteria 2582
388 Ga0495662_0010471 3300046476 Bacteria 4540
389 Ga0495662_0091346 3300046476 Bacteria 1485
390 Ga0495664_0005011 3300046477 Bacteria 7249
391 Ga0495664_0016146 3300046477 Bacteria 4252
392 Ga0495584_0017160 3300046491 Bacteria 3689
393 Ga0495584_0054883 3300046491 Bacteria 2005
394 Ga0495585_0018483 3300046492 Bacteria 4019
395 Ga0495585_0083604 3300046492 Bacteria 1727
396 Ga0495594_0016763 3300046499 Bacteria 3863
397 Ga0495594_0060909 3300046499 Bacteria 2088
398 Ga0495594_0216700 3300046499 Bacteria 1092
399 Ga0495607_0007920 3300046501 Bacteria 7305
400 Ga0495606_0032077 3300046507 Bacteria 3644
401 Ga0495608_0006686 3300046511 Bacteria 8177
402 Ga0495608_0010335 3300046511 Bacteria 6513
403 Ga0495608_0186712 3300046511 Bacteria 1310
404 Ga0495618_0012578 3300046514 Bacteria 5141
405 Ga0495618_0123901 3300046514 Bacteria 1655
406 Ga0495628_0010228 3300046516 Bacteria 7981
407 Ga0495630_0041990 3300046517 Bacteria 3415
408 Ga0495644_0004819 3300046523 Bacteria 5305
409 Ga0495648_0015002 3300046524 Bacteria 5644
410 Ga0495666_0004818 3300046526 Bacteria 6823
411 Ga0495666_0006104 3300046526 Bacteria 6060
412 Ga0495652_0018574 3300046529 Bacteria 6197
413 Ga0495652_0040865 3300046529 Bacteria 4008
414 Ga0495665_0008763 3300046531 Bacteria 5491
415 Ga0495665_0021877 3300046531 Bacteria 3439
416 Ga0495640_0041943 3300046533 Bacteria 3195
417 Ga0495640_0061733 3300046533 Bacteria 2544
418 Ga0495586_0004394 3300046535 Bacteria 7529
419 Ga0495587_0018466 3300046536 Bacteria 4325
420 Ga0495587_0097553 3300046536 Bacteria 1695
421 Ga0495621_0081752 3300046539 Bacteria 1205
422 Ga0495645_0001251 3300046543 Bacteria 17319
423 Ga0495622_0017687 3300046557 Bacteria 3318
424 Ga0495633_0010960 3300046558 Bacteria 4923
425 Ga0495667_0024282 3300046559 Bacteria 4082
426 Ga0495667_0067972 3300046559 Bacteria 2328
427 Ga0495667_0225723 3300046559 Bacteria 1194
428 Ga0495656_0001215 3300046615 Bacteria 8389
429 Ga0495656_0077176 3300046615 Bacteria 1494
430 Ga0495668_0198921 3300046616 Bacteria 1097
431 Ga0495634_0078762 3300046642 Bacteria 2158
432 Ga0495611_0003868 3300046648 Bacteria 6533
433 Ga0495635_0007616 3300046663 Bacteria 7556
434 Ga0495635_0117106 3300046663 Bacteria 1818
435 Ga0495659_0001029 3300046664 Bacteria 9737
436 Ga0495588_0003197 3300046674 Bacteria 7093
437 Ga0495588_0075845 3300046674 Bacteria 1752
438 Ga0495657_0028272 3300046675 Bacteria 3947
439 Ga0495599_0005701 3300046678 Bacteria 7470
440 Ga0495599_0028550 3300046678 Bacteria 3497
441 Ga0495646_0009398 3300046680 Bacteria 6203
442 Ga0495646_0111340 3300046680 Bacteria 1558
443 Ga0495647_0004286 3300046681 Bacteria 4620
444 Ga0495647_0010294 3300046681 Bacteria 3183
445 Ga0495658_0002463 3300046683 Bacteria 9322
446 Ga0495658_0005737 3300046683 Bacteria 6099
447 Ga0495658_0068503 3300046683 Bacteria 2055
448 Ga0495658_0239895 3300046683 Bacteria 1138
449 Ga0495613_0000615 3300046689 Bacteria 28420
450 Ga0495613_0013607 3300046689 Bacteria 6039
451 Ga0495613_0029172 3300046689 Bacteria 4103
452 Ga0495624_0009958 3300046690 Bacteria 6572
453 Ga0495624_0018144 3300046690 Bacteria 4708
454 Ga0495670_0001068 3300046691 Bacteria 13296
455 Ga0495670_0022339 3300046691 Bacteria 3124
456 Ga0495671_0041925 3300046692 Bacteria 2303
457 Ga0495589_0072186 3300046794 Bacteria 1686
458 Ga0495600_0005021 3300046809 Bacteria 7954
459 Ga0495600_0025066 3300046809 Bacteria 3843
460 Ga0495600_0145126 3300046809 Bacteria 1538
461 Ga0495600_0298987 3300046809 Bacteria 1016
462 Ga0495581_0002747 3300047315 Bacteria 10042
463 Ga0495581_0082642 3300047315 Bacteria 1860
464 Ga0495604_0004824 3300047317 Bacteria 10692
465 Ga0495604_0022472 3300047317 Bacteria 5036
466 Ga0495604_0023196 3300047317 Bacteria 4953
467 Ga0495636_0046928 3300047318 Bacteria 1803
468 Ga0495636_0051239 3300047318 Bacteria 1730
469 Ga0495674_0038965 3300047319 Bacteria 4262
470 Ga0495674_0044084 3300047319 Bacteria 3967
471 Ga0495674_0151742 3300047319 Bacteria 1942
472 Ga0495676_0014348 3300047321 Bacteria 7090
473 Ga0495676_0056171 3300047321 Bacteria 3115
474 Ga0495676_0095015 3300047321 Bacteria 2219
475 Ga0495680_0019669 3300047322 Bacteria 5697
476 Ga0495680_0035652 3300047322 Bacteria 4005
477 Ga0495680_0083563 3300047322 Bacteria 2407
478 Ga0495680_0086644 3300047322 Bacteria 2356
479 Ga0495675_0006704 3300047444 Bacteria 7057
480 Ga0495679_048937 3300047446 Bacteria 1276
481 Ga0495684_0003597 3300047471 Bacteria 12086
482 Ga0495684_0046226 3300047471 Bacteria 3330
483 Ga0495684_0348629 3300047471 Bacteria 1052
484 Ga0495593_0014183 3300047673 Bacteria 4534
485 Ga0495602_0005528 3300048088 Bacteria 13260
486 Ga0495602_0199172 3300048088 Bacteria 1529
487 Ga0496100_0000842 3300048903 Bacteria 14711
488 Ga0496100_0029617 3300048903 Bacteria 3388
489 Ga0496101_0001211 3300048904 Bacteria 15442
490 Ga0496101_0001457 3300048904 Bacteria 14119
491 Ga0496101_0010153 3300048904 Bacteria 6211
492 Ga0496101_0058675 3300048904 Bacteria 2788
493 Ga0496102_0009064 3300048905 Bacteria 8537
494 Ga0496102_0011697 3300048905 Bacteria 7572
495 Ga0496102_0022723 3300048905 Bacteria 5558
496 Ga0496102_0070554 3300048905 Bacteria 3208
497 Ga0496102_0257613 3300048905 Bacteria 1645
498 Ga0496103_0010836 3300048906 Bacteria 5396
499 Ga0496103_0033318 3300048906 Bacteria 3147
500 Ga0496104_0000602 3300048907 Bacteria 30848
501 Ga0496104_0016899 3300048907 Bacteria 6635
502 Ga0496104_0026031 3300048907 Bacteria 5396
503 Ga0496104_0406781 3300048907 Bacteria 1273
504 Ga0496105_0003655 3300048908 Bacteria 11434
505 Ga0496105_0015020 3300048908 Bacteria 6161
506 Ga0496105_0064241 3300048908 Bacteria 3028
507 Ga0496105_0077378 3300048908 Bacteria 2748
508 Ga0496105_0115671 3300048908 Bacteria 2212
509 Ga0496106_0000405 3300048909 Bacteria 30644
510 Ga0496106_0032059 3300048909 Bacteria 3916
511 Ga0496106_0092378 3300048909 Bacteria 2337
512 Ga0496106_0194991 3300048909 Bacteria 1611
513 Ga0496107_0001082 3300048910 Bacteria 16345
514 Ga0496108_0003869 3300048911 Bacteria 12021
515 Ga0496108_0011968 3300048911 Bacteria 7058
516 Ga0496108_0012570 3300048911 Bacteria 6896
517 Ga0496108_0034009 3300048911 Bacteria 4233
518 Ga0496108_0043876 3300048911 Bacteria 3735
519 Ga0496108_0507883 3300048911 Bacteria 1053
520 Ga0496109_0006129 3300048912 Bacteria 10104
521 Ga0496109_0006276 3300048912 Bacteria 10002
522 Ga0496109_0009555 3300048912 Bacteria 8267
523 Ga0496109_0052215 3300048912 Bacteria 3725
524 Ga0496109_0123808 3300048912 Bacteria 2410
525 Ga0496110_0000468 3300048913 Bacteria 27460
526 Ga0496110_0015322 3300048913 Bacteria 6377
527 Ga0496110_0045555 3300048913 Bacteria 3834
528 Ga0496110_0056143 3300048913 Bacteria 3465
529 Ga0496110_0075344 3300048913 Bacteria 2998
530 Ga0496111_0001714 3300048914 Bacteria 12814
531 Ga0496111_0004338 3300048914 Bacteria 8949
532 Ga0496111_0037892 3300048914 Bacteria 3452
533 Ga0496112_0000527 3300048915 Bacteria 26121
534 Ga0496112_0004838 3300048915 Bacteria 11498
535 Ga0496112_0011978 3300048915 Bacteria 7950
536 Ga0496112_0023637 3300048915 Bacteria 5876
537 Ga0496112_0089626 3300048915 Bacteria 3044
538 Ga0496112_0113744 3300048915 Bacteria 2677
539 Ga0496112_0372948 3300048915 Bacteria 1368
540 Ga0496113_0003961 3300048916 Bacteria 8995
541 Ga0496113_0004231 3300048916 Bacteria 8782
542 Ga0496113_0011383 3300048916 Bacteria 5931
543 Ga0496113_0037525 3300048916 Bacteria 3557
544 Ga0496114_0005042 3300048917 Bacteria 10300
545 Ga0496114_0104086 3300048917 Bacteria 2427
546 Ga0496114_0104954 3300048917 Bacteria 2417
547 Ga0496115_0005817 3300048918 Bacteria 8984
548 Ga0496115_0013101 3300048918 Bacteria 6262
549 Ga0496115_0069948 3300048918 Bacteria 2844
550 Ga0496115_0388149 3300048918 Bacteria 1134
551 Ga0496126_0027336 3300048929 Bacteria 5451
552 Ga0501031_0026174 3300049568 Bacteria 3805
553 Ga0501032_0092511 3300049569 Bacteria 2006
554 Ga0501033_0007670 3300049570 Bacteria 8373
555 Ga0501034_0544156 3300049571 Bacteria 1071
556 Ga0501036_0016482 3300049572 Bacteria 6172
557 Ga0501036_0058938 3300049572 Bacteria 3253
558 Ga0501037_0105216 3300049573 Bacteria 2034
559 Ga0501037_0110705 3300049573 Bacteria 1978
560 Ga0501038_0000545 3300049574 Bacteria 33068
561 Ga0501038_0043917 3300049574 Bacteria 3885
562 Ga0501038_0090782 3300049574 Bacteria 2560
563 Ga0501039_0021356 3300049575 Bacteria 4967
564 Ga0501039_0032164 3300049575 Bacteria 4043
565 Ga0501040_0009859 3300049576 Bacteria 6238
566 Ga0501040_0044710 3300049576 Bacteria 3020
567 Ga0501041_0019389 3300049577 Bacteria 4061
568 Ga0501042_0005234 3300049578 Bacteria 8334
569 Ga0501042_0159609 3300049578 Bacteria 1627
570 Ga0501042_0311537 3300049578 Bacteria 1137
571 Ga0501043_0007360 3300049579 Bacteria 8734
572 Ga0501043_0013428 3300049579 Bacteria 6406
573 Ga0501043_0160774 3300049579 Bacteria 1755
574 Ga0501046_0006010 3300049580 Bacteria 10799
575 Ga0501046_0014699 3300049580 Bacteria 6592
576 Ga0501047_0002872 3300049581 Bacteria 16357
577 Ga0501047_0036178 3300049581 Bacteria 4770
578 Ga0501047_0096900 3300049581 Bacteria 2828
579 Ga0501047_0124159 3300049581 Bacteria 2462
580 Ga0501047_0235156 3300049581 Bacteria 1684
581 Ga0501067_0014516 3300049583 Bacteria 4361
582 Ga0501067_0046793 3300049583 Bacteria 2401
583 Ga0501068_0021670 3300049584 Bacteria 3754
584 Ga0501069_0007215 3300049585 Bacteria 5825
585 Ga0501070_0003270 3300049586 Bacteria 14061
586 Ga0501070_0043932 3300049586 Bacteria 3718
587 Ga0501070_0044384 3300049586 Bacteria 3699
588 Ga0501071_0139943 3300049587 Bacteria 1802
589 Ga0501071_0156422 3300049587 Bacteria 1702
590 Ga0501072_0013914 3300049588 Bacteria 6166
591 Ga0501074_0011655 3300049590 Bacteria 6389
592 Ga0501074_0035356 3300049590 Bacteria 3620
593 Ga0501074_0043753 3300049590 Bacteria 3241
594 Ga0501075_0023569 3300049591 Bacteria 4508
595 Ga0501076_0009701 3300049592 Bacteria 7112
596 Ga0501076_0016338 3300049592 Bacteria 5628
597 Ga0501076_0114869 3300049592 Bacteria 2178
598 Ga0501076_0336498 3300049592 Bacteria 1239
599 Ga0501077_0005430 3300049593 Bacteria 7754
600 Ga0501077_0061228 3300049593 Bacteria 2388
601 Ga0501079_0007946 3300049741 Bacteria 8044
602 Ga0501079_0010988 3300049741 Bacteria 6898
603 Ga0501079_0081736 3300049741 Bacteria 2498
604 Ga0501080_0000340 3300049742 Bacteria 35875
605 Ga0501080_0019745 3300049742 Bacteria 6240
606 Ga0501080_0082162 3300049742 Bacteria 2993
607 Ga0501080_0084625 3300049742 Bacteria 2947
608 Ga0501081_0002877 3300049743 Bacteria 10931
609 Ga0501081_0011140 3300049743 Bacteria 5880
610 Ga0501081_0013714 3300049743 Bacteria 5329
611 Ga0501035_0067270 3300049822 Bacteria 3180
612 Ga0501035_0160626 3300049822 Bacteria 1945
613 Ga0501035_0230697 3300049822 Bacteria 1578
614 Ga0501035_0246704 3300049822 Bacteria 1517
615 Ga0501044_0014341 3300049823 Bacteria 8556
616 Ga0501045_0011927 3300049824 Bacteria 6110
617 Ga0501045_0020987 3300049824 Bacteria 4669
618 Ga0501045_0094827 3300049824 Bacteria 2207
619 nmdc:mga03683_17787_c1 3300050489 Bacteria 2695
620 nmdc:mga05p37_33457_c1 3300050507 Bacteria 6295
621 nmdc:mga05p37_44774_c1 3300050507 Bacteria 5444
622 nmdc:mga09592_10439_c1 3300050508 Bacteria 7557
623 nmdc:mga09592_78389_c1 3300050508 Bacteria 2811
624 nmdc:mga0qj67_11760_c1 3300050509 Bacteria 6569
625 nmdc:mga06r32_13597_c1 3300050510 Bacteria 7379
626 nmdc:mga08y16_1925_c1 3300050511 Bacteria 21181
627 nmdc:mga0n895_124457_c1 3300050512 Bacteria 2601
628 nmdc:mga0n895_167910_c1 3300050512 Bacteria 2226
629 nmdc:mga0n895_329747_c1 3300050512 Bacteria 1546
630 nmdc:mga0n895_4364_c1 3300050512 Bacteria 11597
631 nmdc:mga0n895_65942_c1 3300050512 Bacteria 3585
632 nmdc:mga0rr50_342559_c1 3300050513 Bacteria 1256
633 nmdc:mga0rr50_68049_c1 3300050513 Bacteria 2707
634 nmdc:mga0a205_6620_c1 3300050515 Bacteria 10485
635 nmdc:mga0a205_89786_c1 3300050515 Bacteria 2970
636 Ga0495601_0001548 3300053077 Bacteria 12709
637 Ga0495601_0005375 3300053077 Bacteria 7460
638 Ga0495601_0045414 3300053077 Bacteria 2762
639 Ga0495601_0066984 3300053077 Bacteria 2286
640 Ga0495612_0003002 3300053078 Bacteria 7007
641 Ga0495612_0006083 3300053078 Bacteria 4966
642 Ga0495612_0009510 3300053078 Bacteria 3940
643 Ga0495612_0028706 3300053078 Bacteria 2240
644 Ga0495612_0078658 3300053078 Bacteria 1384
645 Ga0495612_0102084 3300053078 Bacteria 1222
646 Ga0495655_0007882 3300053083 Bacteria 2001
647 Ga0495595_0002759 3300053084 Bacteria 6902
648 Ga0495595_0016473 3300053084 Bacteria 3163
649 Ga0495619_0000052 3300053085 Bacteria 98882
650 Ga0495619_0000821 3300053085 Bacteria 20348
651 Ga0495619_0046030 3300053085 Bacteria 2867
652 Ga0500566_0000049 3300053094 Bacteria 57920
653 Ga0500641_0007196 3300053096 Bacteria 3967
654 Ga0500572_000476 3300053111 Bacteria 13916
655 Ga0500591_027619 3300053115 Bacteria 2748
656 Ga0500608_030856 3300053122 Bacteria 2542
657 Ga0500658_0186483 3300053134 Bacteria 946
658 Ga0500559_0000654 3300053136 Bacteria 23267
659 Ga0500559_0016101 3300053136 Bacteria 3158
660 Ga0500590_065126 3300053148 Bacteria 1823
661 Ga0500603_000031 3300053150 Bacteria 34081
662 Ga0500616_0145981 3300053153 Bacteria 1100
663 Ga0500630_000581 3300053159 Bacteria 16620
664 Ga0500639_000020 3300053163 Bacteria 102959
665 Ga0500636_0070433 3300053177 Bacteria 2029
666 Ga0500637_0007143 3300053178 Bacteria 5566
667 Ga0500596_003763 3300053735 Bacteria 2848
668 Ga0500601_006297 3300053737 Bacteria 1308
669 Ga0501084_0008741 3300054114 Bacteria 8374
670 Ga0501084_0014440 3300054114 Bacteria 6545
671 Ga0501084_0274441 3300054114 Bacteria 1423
672 Ga0501084_0287785 3300054114 Bacteria 1388
673 Ga0501082_0005251 3300060353 Bacteria 11259
674 Ga0501082_0115603 3300060353 Bacteria 2323
675 Ga0501082_0171500 3300060353 Bacteria 1886
676 Ga0530510_0013479 3300061734 Bacteria 5747
677 Ga0530510_0079726 3300061734 Bacteria 2381

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046454 Ga0495592_0428408 Ga0495592_0428408_15_797 260
2 3300053134 Ga0500658_0186483 Ga0500658_0186483_139_921 260
3 3300049572 Ga0501036_0016482 Ga0501036_0016482_5281_6090 262
4 3300021384 Ga0213876_10000130 Ga0213876_1000013058 265
5 3300039437 Ga0436365_0031959 Ga0436365_0031959_82458_83261 265
6 3300039450 Ga0436363_0642160 Ga0436363_0642160_534_1337 265
7 3300046461 Ga0495641_0011719 Ga0495641_0011719_2678_3475 265
8 3300046533 Ga0495640_0061733 Ga0495640_0061733_69_866 265
9 3300046680 Ga0495646_0111340 Ga0495646_0111340_694_1491 265
10 3300048911 Ga0496108_0507883 Ga0496108_0507883_218_1015 265
11 3300049581 Ga0501047_0002872 Ga0501047_0002872_12_815 265
12 3300048907 Ga0496104_0406781 Ga0496104_0406781_438_1244 268
13 3300048918 Ga0496115_0069948 Ga0496115_0069948_2023_2829 268
14 3300046809 Ga0495600_0298987 Ga0495600_0298987_31_861 276
15 3300031665 Ga0316575_10005544 Ga0316575_100055443 279
16 3300031691 Ga0316579_10027196 Ga0316579_100271962 279
17 3300031727 Ga0316576_10172436 Ga0316576_101724362 279
18 3300035398 Ga0316574_0089001 Ga0316574_0089001_616_1581 279
19 3300036647 Ga0316582_0037763 Ga0316582_0037763_1811_2776 279
20 3300044712 Ga0453684_0922051 Ga0453684_0922051_12_857 281
21 3300007788 Ga0099795_10024949 Ga0099795_100249492 282
22 3300009147 Ga0114129_10535767 Ga0114129_105357671 282
23 3300010159 Ga0099796_10025076 Ga0099796_100250763 282
24 3300005336 Ga0070680_100042057 Ga0070680_1000420573 286
25 3300005339 Ga0070660_100003489 Ga0070660_1000034893 286
26 3300005530 Ga0070679_100092199 Ga0070679_1000921992 286
27 3300005549 Ga0070704_100005398 Ga0070704_1000053985 286
28 3300005563 Ga0068855_100198230 Ga0068855_1001982303 286
29 3300009551 Ga0105238_10034573 Ga0105238_100345733 286
30 3300025909 Ga0207705_10003526 Ga0207705_100035268 286
31 3300025917 Ga0207660_10089440 Ga0207660_100894403 286
32 3300025919 Ga0207657_10013834 Ga0207657_100138344 286
33 3300025949 Ga0207667_10037084 Ga0207667_100370842 286
34 3300005546 Ga0070696_100052793 Ga0070696_1000527932 287
35 3300031728 Ga0316578_10055741 Ga0316578_100557411 288
36 3300036712 Ga0316584_0063254 Ga0316584_0063254_89_1054 288
37 3300006846 Ga0075430_100218435 Ga0075430_1002184352 290
38 3300032168 Ga0316593_10088053 Ga0316593_100880531 290
39 3300031251 Ga0265327_10033545 Ga0265327_100335452 291
40 3300049741 Ga0501079_0081736 Ga0501079_0081736_10_885 291
41 3300027876 Ga0209974_10029266 Ga0209974_100292662 295
42 3300039438 Ga0436360_0708065 Ga0436360_0708065_21_914 296
43 3300005436 Ga0070713_100409851 Ga0070713_1004098512 297
44 3300049578 Ga0501042_0311537 Ga0501042_0311537_16_933 298
45 3300031691 Ga0316579_10004581 Ga0316579_100045813 299
46 3300032137 Ga0316585_10002967 Ga0316585_100029672 299
47 3300036647 Ga0316582_0004787 Ga0316582_0004787_3908_4861 299
48 3300036712 Ga0316584_0139275 Ga0316584_0139275_59_1054 299
49 3300037588 Ga0316581_0005303 Ga0316581_0005303_2284_3279 299
50 3300044712 Ga0453684_0100025 Ga0453684_0100025_18_983 299
51 3300047471 Ga0495684_0348629 Ga0495684_0348629_138_1037 299
52 3300044712 Ga0453684_0032406 Ga0453684_0032406_2499_3440 300
53 3300046559 Ga0495667_0067972 Ga0495667_0067972_976_1932 302
54 3300048088 Ga0495602_0199172 Ga0495602_0199172_55_1011 302
55 3300005356 Ga0070674_100237939 Ga0070674_1002379392 304
56 3300005466 Ga0070685_10101294 Ga0070685_101012942 304
57 3300005543 Ga0070672_100106865 Ga0070672_1001068652 304
58 3300005718 Ga0068866_10025656 Ga0068866_100256562 304
59 3300006237 Ga0097621_100155598 Ga0097621_1001555982 304
60 3300014326 Ga0157380_10172391 Ga0157380_101723912 304
61 3300025315 Ga0207697_10035372 Ga0207697_100353722 304
62 3300025940 Ga0207691_10150524 Ga0207691_101505242 304
63 3300026121 Ga0207683_10039727 Ga0207683_100397272 304
64 3300046499 Ga0495594_0216700 Ga0495594_0216700_122_1078 304
65 3300048917 Ga0496114_0104954 Ga0496114_0104954_249_1205 304
66 3300005615 Ga0070702_100141454 Ga0070702_1001414542 305
67 3300009545 Ga0105237_10131772 Ga0105237_101317723 305
68 3300009551 Ga0105238_10469470 Ga0105238_104694702 305
69 3300021441 Ga0213871_10030191 Ga0213871_100301912 305
70 3300024227 Ga0228598_1005683 Ga0228598_10056832 305
71 3300025914 Ga0207671_10162612 Ga0207671_101626123 305
72 3300025931 Ga0207644_10127265 Ga0207644_101272652 305
73 3300026078 Ga0207702_10071299 Ga0207702_100712992 305
74 3300042001 Ga0439441_007658 Ga0439441_007658_805_1722 305
75 3300046459 Ga0495629_0020353 Ga0495629_0020353_1186_2103 305
76 3300046536 Ga0495587_0097553 Ga0495587_0097553_765_1682 305
77 3300049571 Ga0501034_0544156 Ga0501034_0544156_19_936 305
78 3300049579 Ga0501043_0160774 Ga0501043_0160774_29_985 305
79 3300049822 Ga0501035_0230697 Ga0501035_0230697_99_1055 305
80 3300049823 Ga0501044_0014341 Ga0501044_0014341_4194_5150 305
81 3300053136 Ga0500559_0016101 Ga0500559_0016101_1668_2600 305
82 3300053148 Ga0500590_065126 Ga0500590_065126_870_1787 305
83 3300053153 Ga0500616_0145981 Ga0500616_0145981_163_1080 305
84 3300045051 Ga0451576_0334927 Ga0451576_0334927_138_1082 306
85 3300048905 Ga0496102_0070554 Ga0496102_0070554_454_1410 306
86 3300048909 Ga0496106_0194991 Ga0496106_0194991_151_1107 306
87 3300048912 Ga0496109_0123808 Ga0496109_0123808_1239_2195 306
88 3300048914 Ga0496111_0037892 Ga0496111_0037892_2188_3144 306
89 3300041404 Ga0439436_0002272 Ga0439436_0002272_133_1089 308
90 3300041413 Ga0439465_0002393 Ga0439465_0002393_326_1282 308
91 3300042015 Ga0439462_0034633 Ga0439462_0034633_39_995 308
92 3300042122 Ga0450920_006237 Ga0450920_006237_414_1370 308
93 3300042531 Ga0450918_004771 Ga0450918_004771_105_1061 308
94 3300025941 Ga0207711_10119510 Ga0207711_101195102 309
95 3300042876 Ga0451577_0305914 Ga0451577_0305914_47_976 309
96 3300049587 Ga0501071_0139943 Ga0501071_0139943_826_1782 309
97 3300049591 Ga0501075_0023569 Ga0501075_0023569_2855_3811 309
98 3300049592 Ga0501076_0009701 Ga0501076_0009701_5672_6628 309
99 3300049593 Ga0501077_0005430 Ga0501077_0005430_5813_6769 309
100 3300049741 Ga0501079_0010988 Ga0501079_0010988_5709_6665 309
101 3300049742 Ga0501080_0082162 Ga0501080_0082162_1938_2894 309
102 3300049743 Ga0501081_0002877 Ga0501081_0002877_2255_3211 309
103 3300054114 Ga0501084_0008741 Ga0501084_0008741_7348_8304 309
104 3300060353 Ga0501082_0171500 Ga0501082_0171500_70_1026 309
105 3300005338 Ga0068868_100226201 Ga0068868_1002262011 310
106 3300006237 Ga0097621_100500030 Ga0097621_1005000302 310
107 3300007788 Ga0099795_10004297 Ga0099795_100042972 310
108 3300010159 Ga0099796_10012365 Ga0099796_100123653 310
109 3300013296 Ga0157374_10369865 Ga0157374_103698652 310
110 3300025906 Ga0207699_10259310 Ga0207699_102593102 310
111 3300037068 Ga0373925_0033905 Ga0373925_0033905_2010_2942 310
112 3300046476 Ga0495662_0091346 Ga0495662_0091346_97_1029 310
113 3300046531 Ga0495665_0021877 Ga0495665_0021877_1407_2363 310
114 iso_pu_bacteria 2897803580 2897807417 310
115 3300031251 Ga0265327_10000742 Ga0265327_1000074227 311
116 3300031251 Ga0265327_10000881 Ga0265327_1000088121 311
117 3300031344 Ga0265316_10001619 Ga0265316_100016194 311
118 3300049576 Ga0501040_0044710 Ga0501040_0044710_518_1474 311
119 3300061734 Ga0530510_0013479 Ga0530510_0013479_2132_3088 311
120 iso_pu_bacteria 2932794094 2932796601 311
121 iso_pu_bacteria 2932801729 2932802617 311
122 iso_pu_bacteria 2935760218 2935768584 311
123 iso_pu_bacteria 2935883170 2935883572 311
124 3300009177 Ga0105248_10275210 Ga0105248_102752102 312
125 3300010375 Ga0105239_10046428 Ga0105239_100464283 312
126 3300014325 Ga0163163_10116319 Ga0163163_101163191 312
127 3300025944 Ga0207661_10497456 Ga0207661_104974562 312
128 3300036401 Ga0373937_0029181 Ga0373937_0029181_720_1658 312
129 3300046477 Ga0495664_0005011 Ga0495664_0005011_1549_2487 312
130 3300046511 Ga0495608_0010335 Ga0495608_0010335_845_1783 312
131 3300046514 Ga0495618_0123901 Ga0495618_0123901_188_1126 312
132 3300046536 Ga0495587_0018466 Ga0495587_0018466_2349_3287 312
133 3300046543 Ga0495645_0001251 Ga0495645_0001251_7250_8188 312
134 3300046663 Ga0495635_0117106 Ga0495635_0117106_216_1154 312
135 3300046675 Ga0495657_0028272 Ga0495657_0028272_1324_2262 312
136 3300046678 Ga0495599_0005701 Ga0495599_0005701_709_1647 312
137 3300046680 Ga0495646_0009398 Ga0495646_0009398_5243_6181 312
138 3300047317 Ga0495604_0023196 Ga0495604_0023196_184_1122 312
139 3300047319 Ga0495674_0151742 Ga0495674_0151742_635_1573 312
140 3300047444 Ga0495675_0006704 Ga0495675_0006704_3182_4120 312
141 3300048088 Ga0495602_0005528 Ga0495602_0005528_9147_10085 312
142 3300049592 Ga0501076_0016338 Ga0501076_0016338_3793_4749 312
143 3300049741 Ga0501079_0007946 Ga0501079_0007946_5210_6166 312
144 3300049743 Ga0501081_0011140 Ga0501081_0011140_1879_2835 312
145 3300049824 Ga0501045_0011927 Ga0501045_0011927_3646_4602 312
146 3300053077 Ga0495601_0001548 Ga0495601_0001548_7738_8676 312
147 3300053078 Ga0495612_0003002 Ga0495612_0003002_1284_2222 312
148 3300053084 Ga0495595_0016473 Ga0495595_0016473_88_1026 312
149 3300054114 Ga0501084_0274441 Ga0501084_0274441_305_1261 312
150 3300060353 Ga0501082_0005251 Ga0501082_0005251_8803_9759 312
151 iso_pu_bacteria 2597490356 2599106409 312
152 iso_pu_bacteria 2846952575 2846956207 312
153 iso_pu_bacteria 2935959822 2935967063 312
154 iso_pu_bacteria 8006933436 8006943173 312
155 iso_pu_bacteria 8006973647 8006982968 312
156 3300031251 Ga0265327_10003707 Ga0265327_1000370712 313
157 3300031251 Ga0265327_10033945 Ga0265327_100339452 313
158 3300031344 Ga0265316_10004775 Ga0265316_100047754 313
159 3300031665 Ga0316575_10043597 Ga0316575_100435972 313
160 3300031711 Ga0265314_10004203 Ga0265314_100042036 313
161 3300042876 Ga0451577_0000035 Ga0451577_0000035_340961_341905 313
162 3300042876 Ga0451577_0000471 Ga0451577_0000471_31885_32829 313
163 3300042876 Ga0451577_0000739 Ga0451577_0000739_1753_2697 313
164 3300042876 Ga0451577_0002216 Ga0451577_0002216_9661_10605 313
165 3300042876 Ga0451577_0015764 Ga0451577_0015764_2544_3488 313
166 3300042876 Ga0451577_0045736 Ga0451577_0045736_2310_3254 313
167 3300042876 Ga0451577_0211162 Ga0451577_0211162_419_1363 313
168 3300042876 Ga0451577_0330122 Ga0451577_0330122_136_1083 313
169 3300044673 Ga0453683_0000095 Ga0453683_0000095_58016_58960 313
170 3300044673 Ga0453683_0190319 Ga0453683_0190319_201_1145 313
171 3300044712 Ga0453684_0000089 Ga0453684_0000089_36041_36985 313
172 3300044712 Ga0453684_0000097 Ga0453684_0000097_340968_341912 313
173 3300044712 Ga0453684_0000176 Ga0453684_0000176_235500_236444 313
174 3300044712 Ga0453684_0000177 Ga0453684_0000177_132683_133627 313
175 3300044712 Ga0453684_0002182 Ga0453684_0002182_35698_36651 313
176 3300044712 Ga0453684_0006440 Ga0453684_0006440_13312_14256 313
177 3300044712 Ga0453684_0014620 Ga0453684_0014620_360_1304 313
178 3300044712 Ga0453684_0033541 Ga0453684_0033541_967_1911 313
179 3300044712 Ga0453684_0073235 Ga0453684_0073235_1546_2490 313
180 3300044712 Ga0453684_0100546 Ga0453684_0100546_675_1619 313
181 3300045051 Ga0451576_0000806 Ga0451576_0000806_55165_56109 313
182 3300045051 Ga0451576_0001345 Ga0451576_0001345_23327_24271 313
183 3300045051 Ga0451576_0025858 Ga0451576_0025858_2356_3300 313
184 3300045051 Ga0451576_0609320 Ga0451576_0609320_53_997 313
185 3300050512 nmdc:mga0n895_65942_c1 nmdc:mga0n895_65942_c1_34_990 313
186 3300050515 nmdc:mga0a205_89786_c1 nmdc:mga0a205_89786_c1_351_1307 313
187 3300031665 Ga0316575_10003138 Ga0316575_100031384 314
188 3300031691 Ga0316579_10000638 Ga0316579_100006388 314
189 3300031711 Ga0265314_10021511 Ga0265314_100215112 314
190 3300031727 Ga0316576_10083088 Ga0316576_100830882 314
191 3300031733 Ga0316577_10002995 Ga0316577_100029957 314
192 3300032137 Ga0316585_10000195 Ga0316585_100001957 314
193 3300032139 Ga0316580_10001428 Ga0316580_100014282 314
194 3300035398 Ga0316574_0006936 Ga0316574_0006936_3607_4551 314
195 3300035398 Ga0316574_0047906 Ga0316574_0047906_165_1121 314
196 3300036647 Ga0316582_0003599 Ga0316582_0003599_1886_2830 314
197 3300036712 Ga0316584_0017667 Ga0316584_0017667_3240_4184 314
198 3300037588 Ga0316581_0000030 Ga0316581_0000030_2899_3843 314
199 3300044712 Ga0453684_0005947 Ga0453684_0005947_523_1470 314
200 3300044712 Ga0453684_0021800 Ga0453684_0021800_6392_7339 314
201 3300044712 Ga0453684_0025660 Ga0453684_0025660_1957_2904 314
202 3300044712 Ga0453684_0105141 Ga0453684_0105141_1879_2823 314
203 3300044712 Ga0453684_0133742 Ga0453684_0133742_1551_2498 314
204 3300045051 Ga0451576_0000361 Ga0451576_0000361_11081_12040 314
205 iso_pu_bacteria 2513237096 2513657247 314
206 iso_pu_bacteria 2513237104 2513715400 314
207 iso_pu_bacteria 2513237137 2513857715 314
208 iso_pu_bacteria 2513237145 2513919255 314
209 iso_pu_bacteria 2517287029 2517411314 314
210 iso_pu_bacteria 2517572143 2517891048 314
211 iso_pu_bacteria 2643221618 2644104486 314
212 iso_pu_bacteria 2791355197 2793066402 314
213 iso_pu_bacteria 2906610324 2906616245 314
214 iso_pu_bacteria 2906635258 2906640335 314
215 iso_pu_bacteria 2906660503 2906667255 314
216 iso_pu_bacteria 2922425934 2922431761 314
217 iso_pu_bacteria 2941499720 2941506184 314
218 iso_pu_bacteria 3005474847 3005481579 314
219 iso_pu_bacteria 8006926726 8006932277 314
220 iso_pu_bacteria 8019565922 8019575115 314
221 3300005434 Ga0070709_10112069 Ga0070709_101120692 315
222 3300005445 Ga0070708_100020728 Ga0070708_1000207283 315
223 3300005458 Ga0070681_10004100 Ga0070681_100041004 315
224 3300005467 Ga0070706_100009059 Ga0070706_1000090595 315
225 3300005471 Ga0070698_100004962 Ga0070698_10000496213 315
226 3300005518 Ga0070699_100010430 Ga0070699_1000104304 315
227 3300005544 Ga0070686_100091167 Ga0070686_1000911672 315
228 3300005937 Ga0081455_10001555 Ga0081455_1000155517 315
229 3300009148 Ga0105243_10034348 Ga0105243_100343484 315
230 3300025912 Ga0207707_10003874 Ga0207707_100038744 315
231 3300031616 Ga0307508_10000105 Ga0307508_1000010514 315
232 3300031691 Ga0316579_10001822 Ga0316579_100018224 315
233 3300036647 Ga0316582_0010970 Ga0316582_0010970_3027_3977 315
234 3300036712 Ga0316584_0049027 Ga0316584_0049027_1063_2025 315
235 3300044712 Ga0453684_0000732 Ga0453684_0000732_82889_83887 315
236 3300044712 Ga0453684_0010364 Ga0453684_0010364_9807_10766 315
237 3300044712 Ga0453684_0032690 Ga0453684_0032690_3940_4887 315
238 3300045051 Ga0451576_0000056 Ga0451576_0000056_207447_208394 315
239 3300005335 Ga0070666_10137277 Ga0070666_101372772 316
240 3300005340 Ga0070689_100024765 Ga0070689_1000247652 316
241 3300005367 Ga0070667_100101443 Ga0070667_1001014432 316
242 3300005367 Ga0070667_100126654 Ga0070667_1001266542 316
243 3300005458 Ga0070681_10442004 Ga0070681_104420041 316
244 3300005471 Ga0070698_100413951 Ga0070698_1004139512 316
245 3300005563 Ga0068855_100007706 Ga0068855_1000077063 316
246 3300005563 Ga0068855_100037426 Ga0068855_1000374264 316
247 3300005578 Ga0068854_100082238 Ga0068854_1000822382 316
248 3300005618 Ga0068864_100080001 Ga0068864_1000800012 316
249 3300009101 Ga0105247_10011300 Ga0105247_100113003 316
250 3300009147 Ga0114129_10018961 Ga0114129_100189617 316
251 3300009553 Ga0105249_10011069 Ga0105249_100110692 316
252 3300013308 Ga0157375_10003393 Ga0157375_1000339313 316
253 3300014325 Ga0163163_10426129 Ga0163163_104261292 316
254 3300025913 Ga0207695_10069050 Ga0207695_100690502 316
255 3300025916 Ga0207663_10025255 Ga0207663_100252552 316
256 3300025986 Ga0207658_10051795 Ga0207658_100517953 316
257 3300026035 Ga0207703_10021926 Ga0207703_100219262 316
258 3300026095 Ga0207676_10067232 Ga0207676_100672322 316
259 3300031247 Ga0265340_10045766 Ga0265340_100457662 316
260 3300031249 Ga0265339_10002052 Ga0265339_100020529 316
261 3300031691 Ga0316579_10008234 Ga0316579_100082342 316
262 3300031691 Ga0316579_10022911 Ga0316579_100229113 316
263 3300031733 Ga0316577_10002289 Ga0316577_100022892 316
264 3300035118 Ga0373954_0000062 Ga0373954_0000062_18598_19551 316
265 3300035398 Ga0316574_0095231 Ga0316574_0095231_546_1499 316
266 3300035724 Ga0373933_0005995 Ga0373933_0005995_627_1580 316
267 3300036401 Ga0373937_0008181 Ga0373937_0008181_2734_3687 316
268 3300036712 Ga0316584_0042040 Ga0316584_0042040_2383_3348 316
269 3300036712 Ga0316584_0087930 Ga0316584_0087930_1260_2213 316
270 3300037588 Ga0316581_0042087 Ga0316581_0042087_19_984 316
271 3300044693 Ga0466961_0051113 Ga0466961_0051113_1218_2168 316
272 3300044694 Ga0466963_0035869 Ga0466963_0035869_1283_2233 316
273 3300044712 Ga0453684_0000006 Ga0453684_0000006_456257_457210 316
274 3300044712 Ga0453684_0000031 Ga0453684_0000031_250169_251122 316
275 3300044719 Ga0466971_0011207 Ga0466971_0011207_2944_3894 316
276 3300045836 Ga0466958_0022162 Ga0466958_0022162_2434_3384 316
277 3300047322 Ga0495680_0035652 Ga0495680_0035652_1140_2090 316
278 3300048903 Ga0496100_0029617 Ga0496100_0029617_89_1039 316
279 3300048904 Ga0496101_0001457 Ga0496101_0001457_2641_3591 316
280 3300048905 Ga0496102_0022723 Ga0496102_0022723_2747_3697 316
281 3300048906 Ga0496103_0033318 Ga0496103_0033318_715_1665 316
282 3300048908 Ga0496105_0003655 Ga0496105_0003655_1574_2524 316
283 3300048909 Ga0496106_0032059 Ga0496106_0032059_736_1686 316
284 3300048913 Ga0496110_0075344 Ga0496110_0075344_1909_2859 316
285 3300048915 Ga0496112_0011978 Ga0496112_0011978_6121_7071 316
286 3300048917 Ga0496114_0005042 Ga0496114_0005042_8444_9394 316
287 3300049581 Ga0501047_0235156 Ga0501047_0235156_685_1644 316
288 3300049742 Ga0501080_0084625 Ga0501080_0084625_836_1786 316
289 3300050507 nmdc:mga05p37_33457_c1 nmdc:mga05p37_33457_c1_115_1065 316
290 3300005329 Ga0070683_100163185 Ga0070683_1001631852 317
291 3300005535 Ga0070684_100133696 Ga0070684_1001336962 317
292 3300005539 Ga0068853_100255074 Ga0068853_1002550742 317
293 3300026041 Ga0207639_10306754 Ga0207639_103067542 317
294 3300039110 Ga0400487_03596 Ga0400487_03596_2128_3123 317
295 3300049583 Ga0501067_0046793 Ga0501067_0046793_1332_2285 317
296 iso_pu_bacteria 2842333319 2842333887 317
297 3300001979 JGI24740J21852_10024687 JGI24740J21852_100246873 318
298 3300001990 JGI24737J22298_10048358 JGI24737J22298_100483582 318
299 3300003215 JGI25153J46596_10000946 JGI25153J46596_100009465 318
300 3300003659 JGI25404J52841_10015246 JGI25404J52841_100152462 318
301 3300005262 Ga0065165_1000785 Ga0065165_100078511 318
302 3300005293 Ga0065715_10104321 Ga0065715_101043212 318
303 3300005295 Ga0065707_10091172 Ga0065707_100911724 318
304 3300005327 Ga0070658_10079674 Ga0070658_100796742 318
305 3300005329 Ga0070683_100006806 Ga0070683_1000068069 318
306 3300005329 Ga0070683_100062439 Ga0070683_1000624393 318
307 3300005344 Ga0070661_100411955 Ga0070661_1004119551 318
308 3300005353 Ga0070669_100018253 Ga0070669_1000182533 318
309 3300005364 Ga0070673_100007902 Ga0070673_1000079024 318
310 3300005441 Ga0070700_100248498 Ga0070700_1002484982 318
311 3300005444 Ga0070694_100104069 Ga0070694_1001040692 318
312 3300005445 Ga0070708_100018422 Ga0070708_1000184226 318
313 3300005455 Ga0070663_100009487 Ga0070663_1000094874 318
314 3300005455 Ga0070663_100078723 Ga0070663_1000787232 318
315 3300005458 Ga0070681_10027203 Ga0070681_100272031 318
316 3300005518 Ga0070699_100005057 Ga0070699_1000050578 318
317 3300005535 Ga0070684_100209282 Ga0070684_1002092822 318
318 3300005536 Ga0070697_100033689 Ga0070697_1000336892 318
319 3300005536 Ga0070697_100065682 Ga0070697_1000656823 318
320 3300005548 Ga0070665_100109558 Ga0070665_1001095583 318
321 3300005548 Ga0070665_100345927 Ga0070665_1003459272 318
322 3300005563 Ga0068855_100406711 Ga0068855_1004067112 318
323 3300005577 Ga0068857_100084493 Ga0068857_1000844931 318
324 3300005841 Ga0068863_100265397 Ga0068863_1002653972 318
325 3300005937 Ga0081455_10002076 Ga0081455_100020762 318
326 3300005937 Ga0081455_10008768 Ga0081455_100087688 318
327 3300005937 Ga0081455_10044348 Ga0081455_100443482 318
328 3300005937 Ga0081455_10055152 Ga0081455_100551522 318
329 3300005937 Ga0081455_10217206 Ga0081455_102172062 318
330 3300005983 Ga0081540_1002923 Ga0081540_10029233 318
331 3300005985 Ga0081539_10019455 Ga0081539_100194553 318
332 3300006028 Ga0070717_10015928 Ga0070717_100159284 318
333 3300006028 Ga0070717_10054441 Ga0070717_100544412 318
334 3300006028 Ga0070717_10201423 Ga0070717_102014232 318
335 3300006038 Ga0075365_10130583 Ga0075365_101305832 318
336 3300006175 Ga0070712_100288144 Ga0070712_1002881442 318
337 3300006186 Ga0075369_10031986 Ga0075369_100319863 318
338 3300006844 Ga0075428_100015159 Ga0075428_1000151593 318
339 3300006844 Ga0075428_100594867 Ga0075428_1005948671 318
340 3300006846 Ga0075430_100009149 Ga0075430_1000091497 318
341 3300006847 Ga0075431_100018426 Ga0075431_1000184263 318
342 3300006852 Ga0075433_10028952 Ga0075433_100289523 318
343 3300006871 Ga0075434_100008951 Ga0075434_1000089512 318
344 3300006871 Ga0075434_100276654 Ga0075434_1002766542 318
345 3300006880 Ga0075429_100008886 Ga0075429_1000088867 318
346 3300006914 Ga0075436_100001243 Ga0075436_10000124317 318
347 3300006914 Ga0075436_100322393 Ga0075436_1003223932 318
348 3300007076 Ga0075435_100020921 Ga0075435_1000209212 318
349 3300007265 Ga0099794_10002299 Ga0099794_100022992 318
350 3300007265 Ga0099794_10008987 Ga0099794_100089873 318
351 3300007265 Ga0099794_10050643 Ga0099794_100506432 318
352 3300007788 Ga0099795_10011809 Ga0099795_100118092 318
353 3300009093 Ga0105240_10016507 Ga0105240_100165074 318
354 3300009093 Ga0105240_10020582 Ga0105240_100205823 318
355 3300009094 Ga0111539_10007260 Ga0111539_100072608 318
356 3300009094 Ga0111539_10015669 Ga0111539_100156692 318
357 3300009101 Ga0105247_10009021 Ga0105247_100090214 318
358 3300009147 Ga0114129_10024866 Ga0114129_100248663 318
359 3300009147 Ga0114129_10203045 Ga0114129_102030453 318
360 3300009148 Ga0105243_10052495 Ga0105243_100524953 318
361 3300009176 Ga0105242_10244586 Ga0105242_102445862 318
362 3300009545 Ga0105237_10150598 Ga0105237_101505983 318
363 3300009551 Ga0105238_10037267 Ga0105238_100372672 318
364 3300009553 Ga0105249_10031333 Ga0105249_100313333 318
365 3300010159 Ga0099796_10001698 Ga0099796_100016983 318
366 3300010375 Ga0105239_10005103 Ga0105239_100051034 318
367 3300010375 Ga0105239_10157445 Ga0105239_101574452 318
368 3300011119 Ga0105246_10282562 Ga0105246_102825622 318
369 3300013104 Ga0157370_10008657 Ga0157370_100086572 318
370 3300013105 Ga0157369_10634955 Ga0157369_106349552 318
371 3300013297 Ga0157378_10030990 Ga0157378_100309902 318
372 3300013297 Ga0157378_10081545 Ga0157378_100815452 318
373 3300013308 Ga0157375_10046525 Ga0157375_100465254 318
374 3300014325 Ga0163163_10006150 Ga0163163_100061506 318
375 3300014325 Ga0163163_10082676 Ga0163163_100826762 318
376 3300014968 Ga0157379_10006642 Ga0157379_1000664211 318
377 3300014969 Ga0157376_10085855 Ga0157376_100858552 318
378 3300021361 Ga0213872_10034640 Ga0213872_100346402 318
379 3300021361 Ga0213872_10048695 Ga0213872_100486952 318
380 3300021441 Ga0213871_10044856 Ga0213871_100448562 318
381 3300025261 Ga0209233_1002293 Ga0209233_10022936 318
382 3300025261 Ga0209233_1008990 Ga0209233_10089902 318
383 3300025294 Ga0209025_1053107 Ga0209025_10531072 318
384 3300025304 Ga0209257_1010814 Ga0209257_10108143 318
385 3300025898 Ga0207692_10066504 Ga0207692_100665042 318
386 3300025912 Ga0207707_10017265 Ga0207707_100172653 318
387 3300025913 Ga0207695_10081479 Ga0207695_100814792 318
388 3300025915 Ga0207693_10017660 Ga0207693_100176604 318
389 3300025944 Ga0207661_10158516 Ga0207661_101585162 318
390 3300026067 Ga0207678_10027109 Ga0207678_100271094 318
391 3300026088 Ga0207641_10050088 Ga0207641_100500882 318
392 3300027512 Ga0209179_1002942 Ga0209179_10029422 318
393 3300027907 Ga0207428_10000219 Ga0207428_1000021965 318
394 3300028379 Ga0268266_10071331 Ga0268266_100713312 318
395 3300028379 Ga0268266_10285401 Ga0268266_102854012 318
396 3300028573 Ga0265334_10001560 Ga0265334_1000156010 318
397 3300028800 Ga0265338_10026478 Ga0265338_100264782 318
398 3300028800 Ga0265338_10056371 Ga0265338_100563712 318
399 3300028800 Ga0265338_10087780 Ga0265338_100877802 318
400 3300028800 Ga0265338_10161562 Ga0265338_101615621 318
401 3300031241 Ga0265325_10008336 Ga0265325_100083367 318
402 3300031241 Ga0265325_10150068 Ga0265325_101500682 318
403 3300031247 Ga0265340_10033125 Ga0265340_100331253 318
404 3300031249 Ga0265339_10000137 Ga0265339_1000013733 318
405 3300031344 Ga0265316_10068276 Ga0265316_100682762 318
406 3300031595 Ga0265313_10000782 Ga0265313_1000078229 318
407 3300031711 Ga0265314_10080132 Ga0265314_100801322 318
408 3300031728 Ga0316578_10005177 Ga0316578_100051772 318
409 3300031730 Ga0307516_10000657 Ga0307516_1000065725 318
410 3300031730 Ga0307516_10025929 Ga0307516_100259296 318
411 3300031901 Ga0307406_10309247 Ga0307406_103092472 318
412 3300031995 Ga0307409_100067374 Ga0307409_1000673743 318
413 3300033442 Ga0315911_1000003 Ga0315911_1000003338 318
414 3300035083 Ga0373926_0003849 Ga0373926_0003849_3252_4208 318
415 3300035089 Ga0373944_0000604 Ga0373944_0000604_2582_3538 318
416 3300035090 Ga0373949_0025860 Ga0373949_0025860_295_1251 318
417 3300035112 Ga0373932_0004658 Ga0373932_0004658_1446_2402 318
418 3300035113 Ga0373936_0003825 Ga0373936_0003825_2820_3776 318
419 3300035114 Ga0373939_0044504 Ga0373939_0044504_294_1250 318
420 3300035116 Ga0373945_0001800 Ga0373945_0001800_2797_3753 318
421 3300035118 Ga0373954_0025920 Ga0373954_0025920_1617_2573 318
422 3300035120 Ga0373957_0020306 Ga0373957_0020306_136_1092 318
423 3300035120 Ga0373957_0072616 Ga0373957_0072616_295_1251 318
424 3300035170 Ga0373943_0007472 Ga0373943_0007472_1523_2479 318
425 3300035171 Ga0373946_0004350 Ga0373946_0004350_3165_4121 318
426 3300035171 Ga0373946_0029888 Ga0373946_0029888_834_1790 318
427 3300035172 Ga0373955_0073867 Ga0373955_0073867_96_1052 318
428 3300035241 Ga0373961_0028767 Ga0373961_0028767_289_1245 318
429 3300035410 Ga0373924_0003093 Ga0373924_0003093_2541_3497 318
430 3300035691 Ga0373931_0031368 Ga0373931_0031368_1268_2224 318
431 3300035692 Ga0373935_0002036 Ga0373935_0002036_4055_5011 318
432 3300035692 Ga0373935_0016174 Ga0373935_0016174_2556_3512 318
433 3300035692 Ga0373935_0030724 Ga0373935_0030724_895_1851 318
434 3300035695 Ga0373927_0008757 Ga0373927_0008757_2843_3799 318
435 3300035695 Ga0373927_0017373 Ga0373927_0017373_3298_4254 318
436 3300035695 Ga0373927_0031229 Ga0373927_0031229_599_1555 318
437 3300035695 Ga0373927_0193005 Ga0373927_0193005_65_1021 318
438 3300035724 Ga0373933_0086134 Ga0373933_0086134_846_1802 318
439 3300035725 Ga0373947_0004669 Ga0373947_0004669_4499_5455 318
440 3300035725 Ga0373947_0016784 Ga0373947_0016784_1179_2135 318
441 3300035725 Ga0373947_0048990 Ga0373947_0048990_536_1492 318
442 3300036401 Ga0373937_0002933 Ga0373937_0002933_12454_13410 318
443 3300036401 Ga0373937_0006804 Ga0373937_0006804_4298_5254 318
444 3300036712 Ga0316584_0006337 Ga0316584_0006337_4372_5328 318
445 3300037068 Ga0373925_0038765 Ga0373925_0038765_1184_2140 318
446 3300037068 Ga0373925_0073484 Ga0373925_0073484_1299_2255 318
447 3300037312 Ga0395899_0002665 Ga0395899_0002665_9104_10066 318
448 3300037312 Ga0395899_0006791 Ga0395899_0006791_1569_2525 318
449 3300037418 Ga0395900_0000381 Ga0395900_0000381_56214_57176 318
450 3300037418 Ga0395900_0009733 Ga0395900_0009733_39_995 318
451 3300037418 Ga0395900_0097182 Ga0395900_0097182_1561_2517 318
452 3300037466 Ga0395898_0007562 Ga0395898_0007562_6867_7829 318
453 3300037466 Ga0395898_0049607 Ga0395898_0049607_185_1141 318
454 3300037466 Ga0395898_0077798 Ga0395898_0077798_763_1719 318
455 3300037471 Ga0395905_0004769 Ga0395905_0004769_9879_10841 318
456 3300037471 Ga0395905_0020451 Ga0395905_0020451_2873_3829 318
457 3300038443 Ga0395901_0002517 Ga0395901_0002517_7313_8275 318
458 3300038443 Ga0395901_0038732 Ga0395901_0038732_886_1842 318
459 3300038443 Ga0395901_0045854 Ga0395901_0045854_463_1419 318
460 3300038443 Ga0395901_0118900 Ga0395901_0118900_491_1453 318
461 3300039437 Ga0436365_1292461 Ga0436365_1292461_582_1538 318
462 3300039438 Ga0436360_0073247 Ga0436360_0073247_461_1417 318
463 3300039438 Ga0436360_0149353 Ga0436360_0149353_1315_2274 318
464 3300039438 Ga0436360_0361778 Ga0436360_0361778_1105_2082 318
465 3300039438 Ga0436360_1074814 Ga0436360_1074814_3109_4068 318
466 3300039438 Ga0436360_1367695 Ga0436360_1367695_570_1529 318
467 3300039447 Ga0436361_0063454 Ga0436361_0063454_890_1849 318
468 3300039447 Ga0436361_0369023 Ga0436361_0369023_1663_2619 318
469 3300039447 Ga0436361_0428243 Ga0436361_0428243_1347_2306 318
470 3300039447 Ga0436361_0539018 Ga0436361_0539018_742_1701 318
471 3300039450 Ga0436363_1372834 Ga0436363_1372834_1118_2074 318
472 3300039453 Ga0436362_0994339 Ga0436362_0994339_1629_2588 318
473 3300039453 Ga0436362_1025120 Ga0436362_1025120_179_1138 318
474 3300042438 Ga0439459_0022052 Ga0439459_0022052_121_1077 318
475 3300045051 Ga0451576_0023943 Ga0451576_0023943_4117_5073 318
476 3300045051 Ga0451576_0173741 Ga0451576_0173741_1009_1965 318
477 3300046454 Ga0495592_0003291 Ga0495592_0003291_8015_8971 318
478 3300046454 Ga0495592_0179686 Ga0495592_0179686_359_1315 318
479 3300046455 Ga0495603_0002952 Ga0495603_0002952_1267_2223 318
480 3300046455 Ga0495603_0027620 Ga0495603_0027620_157_1113 318
481 3300046458 Ga0495591_042423 Ga0495591_042423_175_1131 318
482 3300046459 Ga0495629_0001640 Ga0495629_0001640_12596_13552 318
483 3300046459 Ga0495629_0023236 Ga0495629_0023236_1312_2268 318
484 3300046461 Ga0495641_0003962 Ga0495641_0003962_5822_6778 318
485 3300046462 Ga0495651_0008882 Ga0495651_0008882_5723_6679 318
486 3300046463 Ga0495653_0020998 Ga0495653_0020998_2817_3773 318
487 3300046472 Ga0495580_0004604 Ga0495580_0004604_3625_4581 318
488 3300046473 Ga0495582_0005832 Ga0495582_0005832_3627_4583 318
489 3300046473 Ga0495582_0011370 Ga0495582_0011370_446_1402 318
490 3300046473 Ga0495582_0045136 Ga0495582_0045136_1248_2204 318
491 3300046473 Ga0495582_0108975 Ga0495582_0108975_205_1161 318
492 3300046475 Ga0495639_0001566 Ga0495639_0001566_3457_4413 318
493 3300046475 Ga0495639_0026056 Ga0495639_0026056_250_1206 318
494 3300046476 Ga0495662_0010471 Ga0495662_0010471_1385_2341 318
495 3300046477 Ga0495664_0016146 Ga0495664_0016146_764_1720 318
496 3300046491 Ga0495584_0017160 Ga0495584_0017160_191_1147 318
497 3300046491 Ga0495584_0054883 Ga0495584_0054883_874_1830 318
498 3300046492 Ga0495585_0018483 Ga0495585_0018483_2608_3564 318
499 3300046492 Ga0495585_0083604 Ga0495585_0083604_412_1368 318
500 3300046499 Ga0495594_0016763 Ga0495594_0016763_222_1178 318
501 3300046499 Ga0495594_0060909 Ga0495594_0060909_620_1576 318
502 3300046501 Ga0495607_0007920 Ga0495607_0007920_1072_2028 318
503 3300046507 Ga0495606_0032077 Ga0495606_0032077_2287_3243 318
504 3300046511 Ga0495608_0006686 Ga0495608_0006686_1384_2340 318
505 3300046511 Ga0495608_0186712 Ga0495608_0186712_235_1191 318
506 3300046514 Ga0495618_0012578 Ga0495618_0012578_1170_2126 318
507 3300046516 Ga0495628_0010228 Ga0495628_0010228_3821_4777 318
508 3300046517 Ga0495630_0041990 Ga0495630_0041990_1312_2268 318
509 3300046523 Ga0495644_0004819 Ga0495644_0004819_874_1830 318
510 3300046524 Ga0495648_0015002 Ga0495648_0015002_1930_2886 318
511 3300046526 Ga0495666_0004818 Ga0495666_0004818_2939_3895 318
512 3300046526 Ga0495666_0006104 Ga0495666_0006104_2042_2998 318
513 3300046529 Ga0495652_0018574 Ga0495652_0018574_1617_2573 318
514 3300046529 Ga0495652_0040865 Ga0495652_0040865_2140_3096 318
515 3300046531 Ga0495665_0008763 Ga0495665_0008763_232_1188 318
516 3300046533 Ga0495640_0041943 Ga0495640_0041943_1554_2510 318
517 3300046535 Ga0495586_0004394 Ga0495586_0004394_4165_5121 318
518 3300046539 Ga0495621_0081752 Ga0495621_0081752_160_1116 318
519 3300046557 Ga0495622_0017687 Ga0495622_0017687_133_1104 318
520 3300046558 Ga0495633_0010960 Ga0495633_0010960_1529_2485 318
521 3300046559 Ga0495667_0024282 Ga0495667_0024282_1515_2471 318
522 3300046559 Ga0495667_0225723 Ga0495667_0225723_25_981 318
523 3300046615 Ga0495656_0001215 Ga0495656_0001215_3036_3992 318
524 3300046615 Ga0495656_0077176 Ga0495656_0077176_414_1370 318
525 3300046616 Ga0495668_0198921 Ga0495668_0198921_22_978 318
526 3300046642 Ga0495634_0078762 Ga0495634_0078762_636_1592 318
527 3300046648 Ga0495611_0003868 Ga0495611_0003868_1080_2036 318
528 3300046663 Ga0495635_0007616 Ga0495635_0007616_3378_4334 318
529 3300046664 Ga0495659_0001029 Ga0495659_0001029_4223_5179 318
530 3300046674 Ga0495588_0003197 Ga0495588_0003197_3139_4095 318
531 3300046674 Ga0495588_0075845 Ga0495588_0075845_464_1420 318
532 3300046678 Ga0495599_0028550 Ga0495599_0028550_599_1555 318
533 3300046681 Ga0495647_0004286 Ga0495647_0004286_2532_3488 318
534 3300046681 Ga0495647_0010294 Ga0495647_0010294_1826_2782 318
535 3300046683 Ga0495658_0002463 Ga0495658_0002463_5764_6720 318
536 3300046683 Ga0495658_0005737 Ga0495658_0005737_1617_2573 318
537 3300046683 Ga0495658_0068503 Ga0495658_0068503_262_1218 318
538 3300046683 Ga0495658_0239895 Ga0495658_0239895_52_1008 318
539 3300046689 Ga0495613_0000615 Ga0495613_0000615_23480_24442 318
540 3300046689 Ga0495613_0013607 Ga0495613_0013607_1668_2624 318
541 3300046689 Ga0495613_0029172 Ga0495613_0029172_528_1484 318
542 3300046690 Ga0495624_0009958 Ga0495624_0009958_1152_2108 318
543 3300046690 Ga0495624_0018144 Ga0495624_0018144_2041_2997 318
544 3300046691 Ga0495670_0001068 Ga0495670_0001068_5464_6420 318
545 3300046691 Ga0495670_0022339 Ga0495670_0022339_1202_2158 318
546 3300046692 Ga0495671_0041925 Ga0495671_0041925_688_1644 318
547 3300046794 Ga0495589_0072186 Ga0495589_0072186_683_1639 318
548 3300046809 Ga0495600_0005021 Ga0495600_0005021_5320_6276 318
549 3300046809 Ga0495600_0025066 Ga0495600_0025066_1130_2086 318
550 3300046809 Ga0495600_0145126 Ga0495600_0145126_194_1150 318
551 3300047315 Ga0495581_0002747 Ga0495581_0002747_4987_5943 318
552 3300047315 Ga0495581_0082642 Ga0495581_0082642_303_1259 318
553 3300047317 Ga0495604_0004824 Ga0495604_0004824_1866_2822 318
554 3300047317 Ga0495604_0022472 Ga0495604_0022472_1508_2464 318
555 3300047318 Ga0495636_0046928 Ga0495636_0046928_265_1221 318
556 3300047318 Ga0495636_0051239 Ga0495636_0051239_117_1073 318
557 3300047319 Ga0495674_0038965 Ga0495674_0038965_515_1471 318
558 3300047319 Ga0495674_0044084 Ga0495674_0044084_2517_3473 318
559 3300047321 Ga0495676_0014348 Ga0495676_0014348_4227_5183 318
560 3300047321 Ga0495676_0056171 Ga0495676_0056171_619_1575 318
561 3300047321 Ga0495676_0095015 Ga0495676_0095015_1218_2174 318
562 3300047322 Ga0495680_0019669 Ga0495680_0019669_1702_2658 318
563 3300047322 Ga0495680_0083563 Ga0495680_0083563_1242_2198 318
564 3300047322 Ga0495680_0086644 Ga0495680_0086644_841_1797 318
565 3300047446 Ga0495679_048937 Ga0495679_048937_249_1205 318
566 3300047471 Ga0495684_0003597 Ga0495684_0003597_7054_8010 318
567 3300047471 Ga0495684_0046226 Ga0495684_0046226_2282_3238 318
568 3300047673 Ga0495593_0014183 Ga0495593_0014183_1132_2088 318
569 3300048903 Ga0496100_0000842 Ga0496100_0000842_6450_7406 318
570 3300048904 Ga0496101_0001211 Ga0496101_0001211_4485_5441 318
571 3300048904 Ga0496101_0010153 Ga0496101_0010153_2238_3194 318
572 3300048904 Ga0496101_0058675 Ga0496101_0058675_178_1134 318
573 3300048905 Ga0496102_0009064 Ga0496102_0009064_3257_4213 318
574 3300048905 Ga0496102_0011697 Ga0496102_0011697_476_1432 318
575 3300048905 Ga0496102_0257613 Ga0496102_0257613_645_1601 318
576 3300048906 Ga0496103_0010836 Ga0496103_0010836_3626_4582 318
577 3300048907 Ga0496104_0000602 Ga0496104_0000602_24681_25637 318
578 3300048907 Ga0496104_0016899 Ga0496104_0016899_2152_3108 318
579 3300048907 Ga0496104_0026031 Ga0496104_0026031_3724_4680 318
580 3300048908 Ga0496105_0015020 Ga0496105_0015020_3372_4328 318
581 3300048908 Ga0496105_0064241 Ga0496105_0064241_1540_2496 318
582 3300048908 Ga0496105_0077378 Ga0496105_0077378_1002_1958 318
583 3300048908 Ga0496105_0115671 Ga0496105_0115671_257_1213 318
584 3300048909 Ga0496106_0000405 Ga0496106_0000405_5395_6351 318
585 3300048909 Ga0496106_0092378 Ga0496106_0092378_35_991 318
586 3300048910 Ga0496107_0001082 Ga0496107_0001082_11815_12771 318
587 3300048911 Ga0496108_0003869 Ga0496108_0003869_1171_2127 318
588 3300048911 Ga0496108_0011968 Ga0496108_0011968_1039_1995 318
589 3300048911 Ga0496108_0012570 Ga0496108_0012570_899_1855 318
590 3300048911 Ga0496108_0034009 Ga0496108_0034009_2468_3424 318
591 3300048911 Ga0496108_0043876 Ga0496108_0043876_2435_3391 318
592 3300048912 Ga0496109_0006129 Ga0496109_0006129_2521_3477 318
593 3300048912 Ga0496109_0006276 Ga0496109_0006276_2858_3814 318
594 3300048912 Ga0496109_0009555 Ga0496109_0009555_4326_5282 318
595 3300048912 Ga0496109_0052215 Ga0496109_0052215_1604_2560 318
596 3300048913 Ga0496110_0000468 Ga0496110_0000468_3418_4374 318
597 3300048913 Ga0496110_0015322 Ga0496110_0015322_5209_6165 318
598 3300048913 Ga0496110_0045555 Ga0496110_0045555_544_1500 318
599 3300048913 Ga0496110_0056143 Ga0496110_0056143_2342_3298 318
600 3300048914 Ga0496111_0001714 Ga0496111_0001714_11020_11976 318
601 3300048914 Ga0496111_0004338 Ga0496111_0004338_6333_7289 318
602 3300048915 Ga0496112_0000527 Ga0496112_0000527_21854_22810 318
603 3300048915 Ga0496112_0004838 Ga0496112_0004838_5845_6801 318
604 3300048915 Ga0496112_0023637 Ga0496112_0023637_760_1716 318
605 3300048915 Ga0496112_0089626 Ga0496112_0089626_15_971 318
606 3300048915 Ga0496112_0113744 Ga0496112_0113744_830_1786 318
607 3300048915 Ga0496112_0372948 Ga0496112_0372948_37_993 318
608 3300048916 Ga0496113_0003961 Ga0496113_0003961_1343_2299 318
609 3300048916 Ga0496113_0004231 Ga0496113_0004231_2751_3707 318
610 3300048916 Ga0496113_0011383 Ga0496113_0011383_2897_3853 318
611 3300048916 Ga0496113_0037525 Ga0496113_0037525_1215_2171 318
612 3300048917 Ga0496114_0104086 Ga0496114_0104086_448_1404 318
613 3300048918 Ga0496115_0005817 Ga0496115_0005817_4512_5468 318
614 3300048918 Ga0496115_0013101 Ga0496115_0013101_3078_4034 318
615 3300048918 Ga0496115_0388149 Ga0496115_0388149_41_997 318
616 3300048929 Ga0496126_0027336 Ga0496126_0027336_4137_5093 318
617 3300049568 Ga0501031_0026174 Ga0501031_0026174_924_1880 318
618 3300049569 Ga0501032_0092511 Ga0501032_0092511_81_1037 318
619 3300049570 Ga0501033_0007670 Ga0501033_0007670_6679_7635 318
620 3300049572 Ga0501036_0058938 Ga0501036_0058938_1706_2662 318
621 3300049573 Ga0501037_0105216 Ga0501037_0105216_441_1397 318
622 3300049573 Ga0501037_0110705 Ga0501037_0110705_348_1304 318
623 3300049574 Ga0501038_0000545 Ga0501038_0000545_153_1109 318
624 3300049574 Ga0501038_0043917 Ga0501038_0043917_1185_2141 318
625 3300049574 Ga0501038_0090782 Ga0501038_0090782_382_1338 318
626 3300049575 Ga0501039_0021356 Ga0501039_0021356_1707_2663 318
627 3300049575 Ga0501039_0032164 Ga0501039_0032164_1844_2800 318
628 3300049576 Ga0501040_0009859 Ga0501040_0009859_1904_2860 318
629 3300049577 Ga0501041_0019389 Ga0501041_0019389_2501_3457 318
630 3300049578 Ga0501042_0005234 Ga0501042_0005234_1597_2553 318
631 3300049578 Ga0501042_0159609 Ga0501042_0159609_583_1539 318
632 3300049579 Ga0501043_0007360 Ga0501043_0007360_750_1706 318
633 3300049579 Ga0501043_0013428 Ga0501043_0013428_4767_5723 318
634 3300049580 Ga0501046_0006010 Ga0501046_0006010_3165_4121 318
635 3300049580 Ga0501046_0014699 Ga0501046_0014699_2902_3858 318
636 3300049581 Ga0501047_0036178 Ga0501047_0036178_2717_3673 318
637 3300049581 Ga0501047_0096900 Ga0501047_0096900_1340_2296 318
638 3300049581 Ga0501047_0124159 Ga0501047_0124159_1079_2050 318
639 3300049583 Ga0501067_0014516 Ga0501067_0014516_34_990 318
640 3300049584 Ga0501068_0021670 Ga0501068_0021670_153_1109 318
641 3300049585 Ga0501069_0007215 Ga0501069_0007215_1225_2181 318
642 3300049586 Ga0501070_0003270 Ga0501070_0003270_6427_7383 318
643 3300049586 Ga0501070_0043932 Ga0501070_0043932_533_1489 318
644 3300049586 Ga0501070_0044384 Ga0501070_0044384_1072_2028 318
645 3300049587 Ga0501071_0156422 Ga0501071_0156422_676_1632 318
646 3300049588 Ga0501072_0013914 Ga0501072_0013914_1878_2834 318
647 3300049590 Ga0501074_0011655 Ga0501074_0011655_5173_6129 318
648 3300049590 Ga0501074_0035356 Ga0501074_0035356_1946_2902 318
649 3300049590 Ga0501074_0043753 Ga0501074_0043753_1630_2586 318
650 3300049592 Ga0501076_0114869 Ga0501076_0114869_1145_2101 318
651 3300049592 Ga0501076_0336498 Ga0501076_0336498_89_1045 318
652 3300049593 Ga0501077_0061228 Ga0501077_0061228_290_1246 318
653 3300049742 Ga0501080_0000340 Ga0501080_0000340_34581_35537 318
654 3300049742 Ga0501080_0019745 Ga0501080_0019745_2021_2977 318
655 3300049743 Ga0501081_0013714 Ga0501081_0013714_1639_2595 318
656 3300049822 Ga0501035_0067270 Ga0501035_0067270_1699_2655 318
657 3300049822 Ga0501035_0160626 Ga0501035_0160626_603_1559 318
658 3300049822 Ga0501035_0246704 Ga0501035_0246704_412_1368 318
659 3300049824 Ga0501045_0020987 Ga0501045_0020987_1080_2036 318
660 3300049824 Ga0501045_0094827 Ga0501045_0094827_394_1350 318
661 3300050489 nmdc:mga03683_17787_c1 nmdc:mga03683_17787_c1_1667_2623 318
662 3300050507 nmdc:mga05p37_44774_c1 nmdc:mga05p37_44774_c1_1995_2951 318
663 3300050508 nmdc:mga09592_10439_c1 nmdc:mga09592_10439_c1_4629_5585 318
664 3300050508 nmdc:mga09592_78389_c1 nmdc:mga09592_78389_c1_886_1842 318
665 3300050509 nmdc:mga0qj67_11760_c1 nmdc:mga0qj67_11760_c1_4501_5457 318
666 3300050510 nmdc:mga06r32_13597_c1 nmdc:mga06r32_13597_c1_1241_2197 318
667 3300050511 nmdc:mga08y16_1925_c1 nmdc:mga08y16_1925_c1_12373_13329 318
668 3300050512 nmdc:mga0n895_124457_c1 nmdc:mga0n895_124457_c1_376_1332 318
669 3300050512 nmdc:mga0n895_167910_c1 nmdc:mga0n895_167910_c1_1040_1996 318
670 3300050512 nmdc:mga0n895_329747_c1 nmdc:mga0n895_329747_c1_408_1364 318
671 3300050512 nmdc:mga0n895_4364_c1 nmdc:mga0n895_4364_c1_7853_8809 318
672 3300050513 nmdc:mga0rr50_342559_c1 nmdc:mga0rr50_342559_c1_214_1170 318
673 3300050513 nmdc:mga0rr50_68049_c1 nmdc:mga0rr50_68049_c1_1032_1988 318
674 3300050515 nmdc:mga0a205_6620_c1 nmdc:mga0a205_6620_c1_5801_6757 318
675 3300053077 Ga0495601_0005375 Ga0495601_0005375_4467_5423 318
676 3300053077 Ga0495601_0045414 Ga0495601_0045414_1239_2195 318
677 3300053077 Ga0495601_0066984 Ga0495601_0066984_567_1523 318
678 3300053078 Ga0495612_0006083 Ga0495612_0006083_1178_2134 318
679 3300053078 Ga0495612_0009510 Ga0495612_0009510_367_1323 318
680 3300053078 Ga0495612_0028706 Ga0495612_0028706_504_1460 318
681 3300053078 Ga0495612_0078658 Ga0495612_0078658_313_1269 318
682 3300053078 Ga0495612_0102084 Ga0495612_0102084_22_978 318
683 3300053083 Ga0495655_0007882 Ga0495655_0007882_181_1137 318
684 3300053084 Ga0495595_0002759 Ga0495595_0002759_2633_3589 318
685 3300053085 Ga0495619_0000052 Ga0495619_0000052_10943_11899 318
686 3300053085 Ga0495619_0000821 Ga0495619_0000821_11406_12362 318
687 3300053085 Ga0495619_0046030 Ga0495619_0046030_636_1592 318
688 3300053094 Ga0500566_0000049 Ga0500566_0000049_27938_28894 318
689 3300053096 Ga0500641_0007196 Ga0500641_0007196_988_1944 318
690 3300053111 Ga0500572_000476 Ga0500572_000476_6746_7702 318
691 3300053115 Ga0500591_027619 Ga0500591_027619_1424_2380 318
692 3300053122 Ga0500608_030856 Ga0500608_030856_108_1064 318
693 3300053136 Ga0500559_0000654 Ga0500559_0000654_4021_4977 318
694 3300053150 Ga0500603_000031 Ga0500603_000031_11883_12839 318
695 3300053159 Ga0500630_000581 Ga0500630_000581_6414_7370 318
696 3300053163 Ga0500639_000020 Ga0500639_000020_98329_99285 318
697 3300053177 Ga0500636_0070433 Ga0500636_0070433_169_1125 318
698 3300053178 Ga0500637_0007143 Ga0500637_0007143_601_1557 318
699 3300053735 Ga0500596_003763 Ga0500596_003763_804_1760 318
700 3300053737 Ga0500601_006297 Ga0500601_006297_184_1140 318
701 3300054114 Ga0501084_0014440 Ga0501084_0014440_3659_4615 318
702 3300054114 Ga0501084_0287785 Ga0501084_0287785_286_1242 318
703 3300060353 Ga0501082_0115603 Ga0501082_0115603_981_1937 318
704 3300061734 Ga0530510_0079726 Ga0530510_0079726_32_988 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00146

NADHdh

NADH dehydrogenase

19

323

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z0s-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) 0.8966 10 314
7z0t-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) 0.8953 10 314
7z0s-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) 0.8801 10 314
7z0t-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) 0.8777 10 314
7f9o-assembly1.cif.gz_G psi-ndh supercomplex of barley 0.8038 15 316
ID Description Score Start End Superfamily
af_Q59R29_400_561_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3318 101 281 1.20.1250.20
af_Q59R29_400_561_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3243 101 281 1.20.1250.20
af_Q09934_214_431_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3199 67 247 1.20.1640.10
af_Q6YK44_74_579_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3179 65 311 1.20.1250.20
af_A0A1D8PQZ7_87_288_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3084 93 313 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3D3AY45-F1-model_v4 Formate hydrogenlyase 0.9812 69 195 GO:0005886
GO:0016829
AF-A0A3D3AY45-F1-model_v4 Formate hydrogenlyase 0.9662 69 195 GO:0005886
GO:0016829
AF-A0A257PYX2-F1-model_v4 Formate hydrogenlyase 0.9585 4 195 GO:0005886
AF-A0A534DSG4-F1-model_v4 deleted 0.9576 6 153
AF-A0A3N5MWE9-F1-model_v4 Formate hydrogenlyase 0.9554 1 288 GO:0005886
GO:0016829

Feature Viewer

pLDDT pTM Quality
86.43 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map