F475976

General Info

Members Datasets Scaffolds Average Seq Length
698 357 1396 260

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0001576|Ga0495650_0001576_3242_4027
Length 261
Sequence VSAFNPNPRQSGVLALVQERGSLSVEALAEQFGVTLQTVRRDVKLLSEAGLLARFHGGVRLPSSTTENIEYRQRQQLNDEAKRRIARAVAQAVPDGCSLMLNIGTTTEAIARELLLQRKGLRVITNNLNVAAILSDSADCELIVAGGVVRSRDRGIVGEATVDFIRQFKVDIGLIGISAIEPDGTLRDFDYREVKVARAILEHSREVWLAADHSKFNRPAMVELARIEQLDMLFTDREPPPPFVKLLADAGVSCVVAEDKP

Samples

Sample ID Description Type Environment
1 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
85 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
86 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
115 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
180 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
181 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
184 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
192 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
195 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
202 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
208 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
216 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
226 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
227 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
228 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
229 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
230 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
233 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
234 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
235 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
236 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
237 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
238 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
239 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
240 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
241 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
242 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
243 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
244 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
245 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
246 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
247 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
248 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
251 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
266 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
267 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
268 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
269 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
270 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
271 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
272 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
273 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
274 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
275 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
278 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
279 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
280 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
286 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
287 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
288 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
289 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
290 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
291 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
292 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
303 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
304 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
305 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
306 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
307 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
310 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
316 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
317 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
318 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
319 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
320 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
321 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
322 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
323 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
324 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
325 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
327 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
328 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
329 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
330 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
331 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
332 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
333 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
334 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
337 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
338 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
339 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
340 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
341 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
342 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
343 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
344 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
345 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
346 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
347 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
348 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
349 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
350 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
351 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
352 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
353 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
354 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
355 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
356 2643221596 Acidovorax sp. Root70 Isolate Unclassified
357 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.34
Nodule 1.15
Rhizoplane 2.01
Rhizosphere 65.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495650_0001576 3300046471 Bacteria 21399
2 JGI25164J39214_1002968 3300002772 Bacteria 2314
3 JGI25152J39213_1001983 3300002773 Bacteria 8097
4 JGI25151J46595_10018667 3300003187 Bacteria 2968
5 JGI25153J46596_10002706 3300003215 Bacteria 10105
6 JGI25153J46596_10004494 3300003215 Bacteria 7510
7 rootH1_10005582 3300003316 Bacteria 4893
8 rootH2_10036651 3300003320 Bacteria 5220
9 rootL2_10000012 3300003322 Bacteria 81982
10 rootH1_10001431 3300003323 Bacteria 21130
11 rootH1_10017763 3300003323 Bacteria 3915
12 rootH1_10024504 3300003323 Bacteria 4610
13 Ga0055539_1000702 3300003752 Bacteria 8565
14 Ga0055533_1000011 3300003756 Bacteria 467893
15 Ga0055525_1000644 3300003759 Bacteria 13803
16 Ga0055526_1005808 3300003771 Bacteria 6943
17 Ga0055526_1015974 3300003771 Bacteria 2976
18 Ga0055537_1011233 3300003773 Bacteria 1832
19 Ga0055524_1000292 3300003775 Bacteria 48340
20 Ga0055524_1012153 3300003775 Bacteria 3321
21 Ga0055536_1000077 3300003781 Bacteria 83559
22 Ga0055534_1001235 3300003784 Bacteria 10599
23 Ga0055534_1001449 3300003784 Bacteria 9436
24 Ga0055530_10003201 3300003791 Bacteria 9596
25 Ga0055540_1000007 3300003792 Bacteria 318178
26 Ga0055540_1013115 3300003792 Bacteria 2553
27 Ga0055540_1024915 3300003792 Bacteria 1475
28 Ga0055531_10015414 3300003794 Bacteria 3369
29 Ga0055531_10017511 3300003794 Bacteria 3019
30 Ga0055543_1004618 3300004625 Bacteria 3693
31 Ga0065165_1000086 3300005262 Bacteria 154235
32 Ga0065165_1000235 3300005262 Bacteria 96698
33 Ga0065165_1002164 3300005262 Bacteria 17774
34 Ga0070658_10180044 3300005327 Bacteria 1779
35 Ga0070676_10007395 3300005328 Bacteria 5893
36 Ga0070676_10012648 3300005328 Bacteria 4614
37 Ga0070676_10040718 3300005328 Bacteria 2692
38 Ga0070676_10221570 3300005328 Bacteria 1250
39 Ga0070676_10242809 3300005328 Bacteria 1199
40 Ga0070676_10285295 3300005328 Bacteria 1114
41 Ga0070690_100003513 3300005330 Bacteria 8581
42 Ga0070690_100499744 3300005330 Bacteria 910
43 Ga0070670_100017476 3300005331 Bacteria 6153
44 Ga0070670_100018090 3300005331 Bacteria 6049
45 Ga0070670_100022546 3300005331 Bacteria 5418
46 Ga0070677_10095174 3300005333 Bacteria 1303
47 Ga0070677_10112259 3300005333 Bacteria 1218
48 Ga0068869_100010748 3300005334 Bacteria 5977
49 Ga0068869_100024271 3300005334 Bacteria 4199
50 Ga0070666_10023861 3300005335 Bacteria 3982
51 Ga0068868_100278619 3300005338 Bacteria 1415
52 Ga0068868_100418448 3300005338 Bacteria 1160
53 Ga0070660_100114234 3300005339 Bacteria 2151
54 Ga0070687_100004291 3300005343 Bacteria 5668
55 Ga0070687_100107217 3300005343 Bacteria 1575
56 Ga0070661_100250907 3300005344 Bacteria 1365
57 Ga0070668_100087971 3300005347 Bacteria 2445
58 Ga0070669_100001506 3300005353 Bacteria 16829
59 Ga0070669_100021586 3300005353 Bacteria 4601
60 Ga0070669_100119950 3300005353 Bacteria 2005
61 Ga0070675_100039054 3300005354 Bacteria 3871
62 Ga0070675_100062470 3300005354 Bacteria 3077
63 Ga0070675_100454099 3300005354 Bacteria 1150
64 Ga0070671_100025262 3300005355 Bacteria 4873
65 Ga0070674_100007372 3300005356 Bacteria 6487
66 Ga0070674_100078756 3300005356 Bacteria 2349
67 Ga0070673_100032997 3300005364 Bacteria 3904
68 Ga0070673_100050058 3300005364 Bacteria 3264
69 Ga0070673_100164526 3300005364 Bacteria 1889
70 Ga0070673_100369477 3300005364 Bacteria 1277
71 Ga0070659_100075406 3300005366 Bacteria 2688
72 Ga0070667_100000219 3300005367 Bacteria 66264
73 Ga0070667_100000636 3300005367 Bacteria 34113
74 Ga0070667_100047331 3300005367 Bacteria 3618
75 Ga0070667_100190906 3300005367 Bacteria 1815
76 Ga0070667_100480270 3300005367 Bacteria 1138
77 Ga0070700_100027238 3300005441 Bacteria 3387
78 Ga0070708_100318586 3300005445 Bacteria 1465
79 Ga0070678_100009309 3300005456 Bacteria 5942
80 Ga0070678_100014627 3300005456 Bacteria 4958
81 Ga0070678_100093588 3300005456 Bacteria 2311
82 Ga0070662_100290304 3300005457 Bacteria 1326
83 Ga0068867_100000297 3300005459 Bacteria 32701
84 Ga0068867_100006086 3300005459 Bacteria 8545
85 Ga0068867_100016200 3300005459 Bacteria 5292
86 Ga0068867_100039213 3300005459 Bacteria 3452
87 Ga0070706_100000727 3300005467 Bacteria 37074
88 Ga0070707_100040881 3300005468 Bacteria 4436
89 Ga0070698_100136610 3300005471 Bacteria 2406
90 Ga0068853_100153202 3300005539 Bacteria 2076
91 Ga0068853_100568012 3300005539 Bacteria 1076
92 Ga0070672_100002319 3300005543 Bacteria 12025
93 Ga0070672_100005971 3300005543 Bacteria 8127
94 Ga0070672_100006495 3300005543 Bacteria 7859
95 Ga0070672_100007059 3300005543 Bacteria 7596
96 Ga0070672_100008674 3300005543 Bacteria 6970
97 Ga0070672_100018056 3300005543 Bacteria 5091
98 Ga0070686_100379535 3300005544 Bacteria 1070
99 Ga0070665_100026192 3300005548 Bacteria 5872
100 Ga0070665_100504561 3300005548 Bacteria 1221
101 Ga0068855_100032642 3300005563 Bacteria 6216
102 Ga0068855_100715096 3300005563 Bacteria 1071
103 Ga0070664_100304144 3300005564 Bacteria 1441
104 Ga0070664_100425044 3300005564 Bacteria 1217
105 Ga0068857_100003123 3300005577 Bacteria 13705
106 Ga0068857_100017323 3300005577 Bacteria 6311
107 Ga0068854_100102899 3300005578 Bacteria 2143
108 Ga0068854_100286222 3300005578 Bacteria 1329
109 Ga0068856_100004904 3300005614 Bacteria 13244
110 Ga0068856_100052872 3300005614 Bacteria 4006
111 Ga0068852_100055958 3300005616 Bacteria 3407
112 Ga0068852_100176624 3300005616 Bacteria 2005
113 Ga0068852_100212372 3300005616 Bacteria 1836
114 Ga0068852_100251623 3300005616 Bacteria 1693
115 Ga0068852_100263808 3300005616 Bacteria 1655
116 Ga0068859_100022833 3300005617 Bacteria 6272
117 Ga0068859_100045986 3300005617 Bacteria 4385
118 Ga0068864_100020795 3300005618 Bacteria 5491
119 Ga0068864_100034617 3300005618 Bacteria 4297
120 Ga0068864_100090246 3300005618 Bacteria 2701
121 Ga0068864_100433312 3300005618 Bacteria 1255
122 Ga0068866_10002065 3300005718 Bacteria 8353
123 Ga0068861_100002507 3300005719 Bacteria 11986
124 Ga0068861_100004958 3300005719 Bacteria 8965
125 Ga0068861_100004994 3300005719 Bacteria 8942
126 Ga0068861_100186346 3300005719 Bacteria 1731
127 Ga0068851_10083273 3300005834 Bacteria 1673
128 Ga0068851_10142623 3300005834 Bacteria 1304
129 Ga0068870_10060241 3300005840 Bacteria 2037
130 Ga0068870_10125488 3300005840 Bacteria 1484
131 Ga0068863_100009450 3300005841 Bacteria 9515
132 Ga0068863_100034277 3300005841 Bacteria 4836
133 Ga0068863_100225642 3300005841 Bacteria 1806
134 Ga0068858_100002624 3300005842 Bacteria 18113
135 Ga0068858_100043671 3300005842 Bacteria 4156
136 Ga0068860_100003703 3300005843 Bacteria 15733
137 Ga0068860_100007254 3300005843 Bacteria 11086
138 Ga0068860_100011329 3300005843 Bacteria 8786
139 Ga0068860_100078010 3300005843 Bacteria 3150
140 Ga0068860_100170100 3300005843 Bacteria 2104
141 Ga0068860_100237110 3300005843 Bacteria 1774
142 Ga0068862_100031416 3300005844 Bacteria 4482
143 Ga0068862_100058975 3300005844 Bacteria 3294
144 Ga0068862_100058979 3300005844 Bacteria 3294
145 Ga0068862_100125108 3300005844 Bacteria 2269
146 Ga0075365_10185404 3300006038 Bacteria 1455
147 Ga0075368_10002952 3300006042 Bacteria 5617
148 Ga0075368_10124350 3300006042 Bacteria 1070
149 Ga0075363_100066455 3300006048 Bacteria 1952
150 Ga0075432_10000627 3300006058 Bacteria 10755
151 Ga0070715_10156084 3300006163 Bacteria 1123
152 Ga0075362_10007890 3300006177 Bacteria 4049
153 Ga0075362_10084011 3300006177 Bacteria 1470
154 Ga0075367_10007883 3300006178 Bacteria 5483
155 Ga0075367_10029219 3300006178 Bacteria 3151
156 Ga0075367_10035415 3300006178 Bacteria 2889
157 Ga0075367_10138316 3300006178 Bacteria 1508
158 Ga0075369_10085819 3300006186 Bacteria 1400
159 Ga0075366_10001182 3300006195 Bacteria 12954
160 Ga0075366_10001474 3300006195 Bacteria 11732
161 Ga0075366_10010270 3300006195 Bacteria 5252
162 Ga0075366_10042201 3300006195 Bacteria 2700
163 Ga0075366_10070471 3300006195 Bacteria 2082
164 Ga0075366_10075010 3300006195 Bacteria 2017
165 Ga0075366_10132534 3300006195 Bacteria 1504
166 Ga0097621_100099234 3300006237 Bacteria 2448
167 Ga0075370_10009151 3300006353 Bacteria 5128
168 Ga0075370_10013434 3300006353 Bacteria 4353
169 Ga0075370_10029886 3300006353 Bacteria 3037
170 Ga0075370_10045165 3300006353 Bacteria 2491
171 Ga0075370_10091479 3300006353 Bacteria 1755
172 Ga0075370_10151840 3300006353 Bacteria 1357
173 Ga0068871_100037767 3300006358 Bacteria 3853
174 Ga0068865_100007422 3300006881 Bacteria 6746
175 Ga0068865_100032838 3300006881 Bacteria 3471
176 Ga0097620_100022833 3300006931 Bacteria 6272
177 Ga0097620_100045984 3300006931 Bacteria 4385
178 Ga0099823_1000016 3300006944 Bacteria 87614
179 Ga0079104_1000009 3300006946 Bacteria 367015
180 Ga0079104_1000027 3300006946 Bacteria 212641
181 Ga0099826_10000029 3300006948 Bacteria 128855
182 Ga0105251_10146958 3300009011 Bacteria 1065
183 Ga0105250_10000154 3300009092 Bacteria 59676
184 Ga0111539_10526715 3300009094 Bacteria 1377
185 Ga0111539_10942171 3300009094 Bacteria 1004
186 Ga0111539_11062630 3300009094 Bacteria 941
187 Ga0105245_10098561 3300009098 Bacteria 2701
188 Ga0105245_10141875 3300009098 Bacteria 2263
189 Ga0114129_10020593 3300009147 Bacteria 9379
190 Ga0105243_10003470 3300009148 Bacteria 12726
191 Ga0105242_10003491 3300009176 Bacteria 12216
192 Ga0105242_10094644 3300009176 Bacteria 2520
193 Ga0105237_10001445 3300009545 Bacteria 31382
194 Ga0105237_10005231 3300009545 Bacteria 14681
195 Ga0105249_10013356 3300009553 Bacteria 7252
196 Ga0105249_10078130 3300009553 Bacteria 3071
197 Ga0105249_10333303 3300009553 Bacteria 1532
198 Ga0105249_10414854 3300009553 Bacteria 1379
199 Ga0105239_10002359 3300010375 Bacteria 24075
200 Ga0105239_10130664 3300010375 Bacteria 2793
201 Ga0105246_10012737 3300011119 Bacteria 5256
202 Ga0157319_1000002 3300012497 Bacteria 410803
203 Ga0157369_10294890 3300013105 Bacteria 1688
204 Ga0157374_10235672 3300013296 Bacteria 1799
205 Ga0157378_10009410 3300013297 Bacteria 8512
206 Ga0157378_10400886 3300013297 Bacteria 1352
207 Ga0163162_10009904 3300013306 Bacteria 9269
208 Ga0163162_10162698 3300013306 Bacteria 2354
209 Ga0157372_10272658 3300013307 Bacteria 1966
210 Ga0157375_10006157 3300013308 Bacteria 10454
211 Ga0157375_10047653 3300013308 Bacteria 4187
212 Ga0157375_10080654 3300013308 Bacteria 3293
213 Ga0157380_10015513 3300014326 Bacteria 5601
214 Ga0157380_10088036 3300014326 Bacteria 2554
215 Ga0157380_10136757 3300014326 Bacteria 2098
216 Ga0157380_10236712 3300014326 Bacteria 1643
217 Ga0157380_10588045 3300014326 Bacteria 1099
218 Ga0157377_10000010 3300014745 Bacteria 380929
219 Ga0157379_10002725 3300014968 Bacteria 14911
220 Ga0157379_10009434 3300014968 Bacteria 8502
221 Ga0157379_10032264 3300014968 Bacteria 4669
222 Ga0157379_10082130 3300014968 Bacteria 2887
223 Ga0157376_10690385 3300014969 Bacteria 1025
224 Ga0163161_10029761 3300017792 Bacteria 3882
225 Ga0163161_10032861 3300017792 Bacteria 3706
226 Ga0163161_10318372 3300017792 Bacteria 1229
227 Ga0213872_10007448 3300021361 Bacteria 5386
228 Ga0209674_100003 3300025226 Bacteria 2196646
229 Ga0209563_100010 3300025230 Bacteria 1337457
230 Ga0207427_100729 3300025231 Bacteria 15297
231 Ga0207425_1000789 3300025245 Bacteria 16158
232 Ga0209646_1000066 3300025246 Bacteria 244823
233 Ga0209026_1000027 3300025250 Bacteria 351282
234 Ga0209677_100178 3300025253 Bacteria 53699
235 Ga0209677_100183 3300025253 Bacteria 51950
236 Ga0209677_102825 3300025253 Bacteria 6140
237 Ga0209759_1000131 3300025256 Bacteria 130014
238 Ga0209759_1001305 3300025256 Bacteria 14725
239 Ga0209759_1009027 3300025256 Bacteria 3055
240 Ga0209129_1000212 3300025258 Bacteria 67061
241 Ga0209565_1000084 3300025263 Bacteria 153894
242 Ga0209565_1006836 3300025263 Bacteria 3150
243 Ga0209565_1022700 3300025263 Bacteria 1297
244 Ga0209673_1007199 3300025273 Bacteria 5186
245 Ga0209673_1023529 3300025273 Bacteria 2094
246 Ga0209673_1042014 3300025273 Bacteria 1290
247 Ga0209675_1000141 3300025291 Bacteria 97537
248 Ga0209675_1000933 3300025291 Bacteria 18638
249 Ga0209676_1000012 3300025292 Bacteria 841431
250 Ga0209025_1000214 3300025294 Bacteria 138780
251 Ga0209025_1000438 3300025294 Bacteria 82121
252 Ga0209025_1002951 3300025294 Bacteria 16913
253 Ga0209025_1073094 3300025294 Bacteria 1205
254 Ga0209564_1000024 3300025295 Bacteria 535041
255 Ga0209564_1000229 3300025295 Bacteria 125047
256 Ga0209564_1000593 3300025295 Bacteria 57037
257 Ga0209564_1003205 3300025295 Bacteria 11491
258 Ga0209564_1003928 3300025295 Bacteria 9505
259 Ga0209564_1005647 3300025295 Bacteria 7028
260 Ga0209758_1000213 3300025297 Bacteria 126745
261 Ga0209758_1000558 3300025297 Bacteria 58712
262 Ga0209758_1015434 3300025297 Bacteria 3954
263 Ga0209050_1002504 3300025298 Bacteria 15481
264 Ga0209050_1002961 3300025298 Bacteria 13272
265 Ga0209050_1005060 3300025298 Bacteria 8522
266 Ga0209050_1012174 3300025298 Bacteria 3978
267 Ga0209256_1000019 3300025299 Bacteria 558627
268 Ga0209256_1000072 3300025299 Bacteria 239812
269 Ga0209256_1000233 3300025299 Bacteria 99386
270 Ga0209256_1000493 3300025299 Bacteria 58089
271 Ga0209256_1000620 3300025299 Bacteria 49039
272 Ga0209256_1016674 3300025299 Bacteria 2487
273 Ga0209051_1000004 3300025303 Bacteria 1155596
274 Ga0209051_1000244 3300025303 Bacteria 91505
275 Ga0209051_1000934 3300025303 Bacteria 28827
276 Ga0209051_1001384 3300025303 Bacteria 20901
277 Ga0209051_1009534 3300025303 Bacteria 4996
278 Ga0209051_1009932 3300025303 Bacteria 4854
279 Ga0209051_1012746 3300025303 Bacteria 4048
280 Ga0209051_1040699 3300025303 Bacteria 1662
281 Ga0209257_1000038 3300025304 Bacteria 609032
282 Ga0209257_1000044 3300025304 Bacteria 486709
283 Ga0209257_1000144 3300025304 Bacteria 197078
284 Ga0209257_1000401 3300025304 Bacteria 84658
285 Ga0209257_1002710 3300025304 Bacteria 16875
286 Ga0207697_10049327 3300025315 Bacteria 1738
287 Ga0207697_10068189 3300025315 Bacteria 1488
288 Ga0207656_10008137 3300025321 Bacteria 3850
289 Ga0207656_10103754 3300025321 Bacteria 1306
290 Ga0207696_1000388 3300025711 Bacteria 42044
291 Ga0207682_10012448 3300025893 Bacteria 3320
292 Ga0207682_10015979 3300025893 Bacteria 2925
293 Ga0207682_10148378 3300025893 Bacteria 1056
294 Ga0207688_10032487 3300025901 Bacteria 2884
295 Ga0207680_10005532 3300025903 Bacteria 6037
296 Ga0207685_10097972 3300025905 Bacteria 1248
297 Ga0207645_10004851 3300025907 Bacteria 9873
298 Ga0207645_10007226 3300025907 Bacteria 7865
299 Ga0207645_10154816 3300025907 Bacteria 1497
300 Ga0207645_10292653 3300025907 Bacteria 1083
301 Ga0207705_10055214 3300025909 Bacteria 2863
302 Ga0207705_10146359 3300025909 Bacteria 1768
303 Ga0207684_10171834 3300025910 Bacteria 1868
304 Ga0207695_10314403 3300025913 Bacteria 1456
305 Ga0207695_10364679 3300025913 Bacteria 1331
306 Ga0207671_10210521 3300025914 Bacteria 1521
307 Ga0207662_10034488 3300025918 Bacteria 2953
308 Ga0207662_10042242 3300025918 Bacteria 2687
309 Ga0207657_10150905 3300025919 Bacteria 1893
310 Ga0207646_10104383 3300025922 Bacteria 2542
311 Ga0207681_10031863 3300025923 Bacteria 3446
312 Ga0207681_10042747 3300025923 Bacteria 3029
313 Ga0207681_10243989 3300025923 Bacteria 1399
314 Ga0207650_10003617 3300025925 Bacteria 10596
315 Ga0207650_10016952 3300025925 Bacteria 5095
316 Ga0207650_10039032 3300025925 Bacteria 3470
317 Ga0207650_10056229 3300025925 Bacteria 2923
318 Ga0207650_10088927 3300025925 Bacteria 2356
319 Ga0207659_10034479 3300025926 Bacteria 3490
320 Ga0207659_10135103 3300025926 Bacteria 1908
321 Ga0207659_10305705 3300025926 Bacteria 1308
322 Ga0207687_10029491 3300025927 Bacteria 3691
323 Ga0207687_10222960 3300025927 Bacteria 1485
324 Ga0207644_10180645 3300025931 Bacteria 1653
325 Ga0207644_10231910 3300025931 Bacteria 1467
326 Ga0207644_10392987 3300025931 Bacteria 1132
327 Ga0207644_10424083 3300025931 Bacteria 1090
328 Ga0207690_10020192 3300025932 Bacteria 4112
329 Ga0207690_10152630 3300025932 Bacteria 1714
330 Ga0207706_10001145 3300025933 Bacteria 27011
331 Ga0207706_10006055 3300025933 Bacteria 11247
332 Ga0207706_10241215 3300025933 Bacteria 1580
333 Ga0207709_10000862 3300025935 Bacteria 23149
334 Ga0207709_10001617 3300025935 Bacteria 15323
335 Ga0207709_10559577 3300025935 Bacteria 900
336 Ga0207669_10003348 3300025937 Bacteria 6939
337 Ga0207669_10246924 3300025937 Bacteria 1326
338 Ga0207669_10417725 3300025937 Bacteria 1055
339 Ga0207704_10003536 3300025938 Bacteria 7109
340 Ga0207691_10004652 3300025940 Bacteria 13287
341 Ga0207691_10020019 3300025940 Bacteria 6330
342 Ga0207691_10035589 3300025940 Bacteria 4620
343 Ga0207691_10050926 3300025940 Bacteria 3789
344 Ga0207691_10097998 3300025940 Bacteria 2620
345 Ga0207691_10257533 3300025940 Bacteria 1504
346 Ga0207689_10008988 3300025942 Bacteria 8654
347 Ga0207689_10034649 3300025942 Bacteria 4192
348 Ga0207689_10102108 3300025942 Bacteria 2356
349 Ga0207661_10530061 3300025944 Bacteria 1078
350 Ga0207679_10096564 3300025945 Bacteria 2300
351 Ga0207679_10202328 3300025945 Bacteria 1660
352 Ga0207667_10056358 3300025949 Bacteria 4129
353 Ga0207667_10251006 3300025949 Bacteria 1810
354 Ga0207667_10435662 3300025949 Bacteria 1333
355 Ga0207667_10479848 3300025949 Bacteria 1262
356 Ga0207651_10003624 3300025960 Bacteria 7613
357 Ga0207651_10018765 3300025960 Bacteria 4127
358 Ga0207651_10033243 3300025960 Bacteria 3324
359 Ga0207651_10130636 3300025960 Bacteria 1922
360 Ga0207651_10174097 3300025960 Bacteria 1700
361 Ga0207712_10054174 3300025961 Bacteria 2816
362 Ga0207712_10335772 3300025961 Bacteria 1251
363 Ga0207668_10002813 3300025972 Bacteria 10173
364 Ga0207668_10005358 3300025972 Bacteria 7545
365 Ga0207668_10320422 3300025972 Bacteria 1286
366 Ga0207668_10333494 3300025972 Bacteria 1263
367 Ga0207668_10359258 3300025972 Bacteria 1220
368 Ga0207640_10001221 3300025981 Bacteria 14006
369 Ga0207640_10065113 3300025981 Bacteria 2430
370 Ga0207658_10002165 3300025986 Bacteria 14600
371 Ga0207658_10007223 3300025986 Bacteria 7574
372 Ga0207658_10459685 3300025986 Bacteria 1128
373 Ga0207677_10257222 3300026023 Bacteria 1421
374 Ga0207677_10325819 3300026023 Bacteria 1278
375 Ga0207703_10001182 3300026035 Bacteria 24519
376 Ga0207703_10040447 3300026035 Bacteria 3731
377 Ga0207639_10157565 3300026041 Bacteria 1909
378 Ga0207639_10334399 3300026041 Bacteria 1349
379 Ga0207639_10607978 3300026041 Bacteria 1009
380 Ga0207678_10000627 3300026067 Bacteria 32287
381 Ga0207708_10123004 3300026075 Bacteria 2023
382 Ga0207702_10000220 3300026078 Bacteria 66634
383 Ga0207641_10006430 3300026088 Bacteria 9903
384 Ga0207641_10150489 3300026088 Bacteria 2107
385 Ga0207641_10412381 3300026088 Bacteria 1299
386 Ga0207648_10000002 3300026089 Bacteria 307909
387 Ga0207648_10000319 3300026089 Bacteria 52621
388 Ga0207648_10054864 3300026089 Bacteria 3480
389 Ga0207648_10141183 3300026089 Bacteria 2122
390 Ga0207648_10268404 3300026089 Bacteria 1524
391 Ga0207648_10405891 3300026089 Bacteria 1235
392 Ga0207676_10008941 3300026095 Bacteria 7127
393 Ga0207676_10013833 3300026095 Bacteria 5792
394 Ga0207676_10022982 3300026095 Bacteria 4593
395 Ga0207676_10156662 3300026095 Bacteria 1968
396 Ga0207676_10428825 3300026095 Bacteria 1242
397 Ga0207674_10025156 3300026116 Bacteria 6352
398 Ga0207674_10044740 3300026116 Bacteria 4559
399 Ga0207674_10368215 3300026116 Bacteria 1389
400 Ga0207674_10527091 3300026116 Bacteria 1141
401 Ga0207675_100002653 3300026118 Bacteria 17651
402 Ga0207675_100006685 3300026118 Bacteria 10910
403 Ga0207675_100280535 3300026118 Bacteria 1619
404 Ga0207675_100330075 3300026118 Bacteria 1491
405 Ga0207683_10011415 3300026121 Bacteria 7580
406 Ga0207683_10194497 3300026121 Bacteria 1842
407 Ga0207683_10348136 3300026121 Bacteria 1360
408 Ga0207698_10012414 3300026142 Bacteria 5572
409 Ga0207698_10076974 3300026142 Bacteria 2673
410 Ga0207698_10081126 3300026142 Bacteria 2617
411 Ga0209281_1000002 3300027111 Bacteria 1924012
412 Ga0209281_1000023 3300027111 Bacteria 519955
413 Ga0209389_1015415 3300027296 Bacteria 6940
414 Ga0209970_1000107 3300027614 Bacteria 11851
415 Ga0209983_1007271 3300027665 Bacteria 2270
416 Ga0209282_1000077 3300027666 Bacteria 76850
417 Ga0209971_1001512 3300027682 Bacteria 5757
418 Ga0209813_10064775 3300027866 Bacteria 1175
419 Ga0209974_10029941 3300027876 Bacteria 1804
420 Ga0209974_10032983 3300027876 Bacteria 1717
421 Ga0207428_10096457 3300027907 Bacteria 2290
422 Ga0268266_10025164 3300028379 Bacteria 5066
423 Ga0268266_10405455 3300028379 Bacteria 1290
424 Ga0268266_10511042 3300028379 Bacteria 1148
425 Ga0268265_10004033 3300028380 Bacteria 10339
426 Ga0268264_10000629 3300028381 Bacteria 41961
427 Ga0268264_10073349 3300028381 Bacteria 2905
428 Ga0268264_10076734 3300028381 Bacteria 2844
429 Ga0268264_10096738 3300028381 Bacteria 2558
430 Ga0265336_10000008 3300028666 Bacteria 336082
431 Ga0307517_10011327 3300028786 Bacteria 12368
432 Ga0307517_10068387 3300028786 Bacteria 3237
433 Ga0307515_10000037 3300028794 Bacteria 331970
434 Ga0307515_10000152 3300028794 Bacteria 167305
435 Ga0307515_10002738 3300028794 Bacteria 37712
436 Ga0307515_10020939 3300028794 Bacteria 11624
437 Ga0307515_10022058 3300028794 Bacteria 11247
438 Ga0307515_10240368 3300028794 Bacteria 1583
439 Ga0307515_10361847 3300028794 Bacteria 1091
440 Ga0307515_10374583 3300028794 Bacteria 1059
441 Ga0307512_10065889 3300030522 Bacteria 2741
442 Ga0265330_10000012 3300031235 Bacteria 180837
443 Ga0265332_10000012 3300031238 Bacteria 272641
444 Ga0265325_10003186 3300031241 Bacteria 10790
445 Ga0307513_10000206 3300031456 Bacteria 85338
446 Ga0307513_10012651 3300031456 Bacteria 10400
447 Ga0307513_10016678 3300031456 Bacteria 8844
448 Ga0307513_10026122 3300031456 Bacteria 6741
449 Ga0307513_10123473 3300031456 Bacteria 2551
450 Ga0307513_10461226 3300031456 Bacteria 993
451 Ga0307509_10000293 3300031507 Bacteria 82770
452 Ga0307509_10009259 3300031507 Bacteria 12357
453 Ga0307509_10063369 3300031507 Bacteria 3892
454 Ga0307509_10091149 3300031507 Bacteria 3121
455 Ga0307509_10099784 3300031507 Bacteria 2944
456 Ga0307509_10114665 3300031507 Bacteria 2689
457 Ga0307509_10335806 3300031507 Bacteria 1241
458 Ga0307408_100001627 3300031548 Bacteria 16618
459 Ga0307408_100033711 3300031548 Bacteria 3580
460 Ga0307508_10000053 3300031616 Bacteria 128020
461 Ga0307508_10000273 3300031616 Bacteria 63550
462 Ga0307508_10012492 3300031616 Bacteria 7763
463 Ga0307508_10125508 3300031616 Bacteria 2169
464 Ga0307514_10000708 3300031649 Bacteria 57806
465 Ga0307514_10000722 3300031649 Bacteria 57107
466 Ga0307514_10012229 3300031649 Bacteria 7144
467 Ga0307514_10114496 3300031649 Bacteria 1901
468 Ga0265314_10000029 3300031711 Bacteria 272506
469 Ga0265342_10086283 3300031712 Bacteria 1805
470 Ga0307516_10000048 3300031730 Bacteria 130378
471 Ga0307516_10001622 3300031730 Bacteria 30969
472 Ga0307516_10006586 3300031730 Bacteria 13581
473 Ga0307516_10007859 3300031730 Bacteria 12156
474 Ga0307516_10045012 3300031730 Bacteria 4362
475 Ga0307516_10236404 3300031730 Bacteria 1528
476 Ga0307405_10058701 3300031731 Bacteria 2422
477 Ga0307413_10040487 3300031824 Bacteria 2719
478 Ga0307410_10124692 3300031852 Bacteria 1884
479 Ga0307406_10000046 3300031901 Bacteria 69556
480 Ga0307406_10118887 3300031901 Bacteria 1833
481 Ga0307407_10520461 3300031903 Bacteria 875
482 Ga0307409_100002839 3300031995 Bacteria 9162
483 Ga0307416_100216244 3300032002 Bacteria 1833
484 Ga0307416_100308727 3300032002 Bacteria 1577
485 Ga0307411_10000039 3300032005 Bacteria 40183
486 Ga0307411_10005988 3300032005 Bacteria 6042
487 Ga0307510_10009698 3300033180 Bacteria 11462
488 Ga0373928_0035244 3300035084 Bacteria 1127
489 Ga0373932_0111222 3300035112 Bacteria 903
490 Ga0373931_0030468 3300035691 Bacteria 2777
491 Ga0373927_0198246 3300035695 Bacteria 1318
492 Ga0373925_0004299 3300037068 Bacteria 10790
493 Ga0373925_0130572 3300037068 Bacteria 1958
494 Ga0373925_0218966 3300037068 Bacteria 1519
495 Ga0395899_0068971 3300037312 Bacteria 2591
496 Ga0395900_0000224 3300037418 Bacteria 89200
497 Ga0395900_0414052 3300037418 Bacteria 1310
498 Ga0395898_0001914 3300037466 Bacteria 26511
499 Ga0395898_0244235 3300037466 Bacteria 1712
500 Ga0395905_0009931 3300037471 Bacteria 9272
501 Ga0395905_0009992 3300037471 Bacteria 9250
502 Ga0395905_0024396 3300037471 Bacteria 5708
503 Ga0395905_0259191 3300037471 Bacteria 1623
504 Ga0395901_0077841 3300038443 Bacteria 3461
505 Ga0436361_0609716 3300039447 Bacteria 1821
506 Ga0439439_0059046 3300041406 Bacteria 1016
507 Ga0451789_0000666 3300041443 Bacteria 1802
508 Ga0451798_0453462 3300041458 Bacteria 1375
509 Ga0451802_0514930 3300041460 Bacteria 1897
510 Ga0451845_0101343 3300041501 Bacteria 1934
511 Ga0451853_1116926 3300041512 Bacteria 1189
512 Ga0439433_0035496 3300041999 Bacteria 1150
513 Ga0439445_0022749 3300042004 Bacteria 1583
514 Ga0439449_0078458 3300042007 Bacteria 1218
515 Ga0439450_024784 3300042008 Bacteria 1311
516 Ga0450911_000637 3300042115 Bacteria 10552
517 Ga0450919_001484 3300042121 Bacteria 3064
518 Ga0450898_001915 3300042134 Bacteria 2831
519 Ga0439459_0001693 3300042438 Bacteria 3287
520 Ga0450918_005336 3300042531 Bacteria 2313
521 Ga0451577_0006159 3300042876 Bacteria 12053
522 Ga0466969_0006082 3300044656 Bacteria 6421
523 Ga0466969_0033695 3300044656 Bacteria 2599
524 Ga0466972_0050188 3300044658 Bacteria 2014
525 Ga0466965_0007090 3300044683 Bacteria 5131
526 Ga0466965_0046340 3300044683 Bacteria 2152
527 Ga0466966_0073168 3300044684 Bacteria 2144
528 Ga0466966_0083969 3300044684 Bacteria 1981
529 Ga0466961_0013053 3300044693 Bacteria 5314
530 Ga0466961_0015682 3300044693 Bacteria 4861
531 Ga0466961_0183214 3300044693 Bacteria 1299
532 Ga0466963_0064274 3300044694 Bacteria 2458
533 Ga0466963_0277003 3300044694 Bacteria 1179
534 Ga0466964_0003754 3300044706 Bacteria 5565
535 Ga0466964_0056839 3300044706 Bacteria 1618
536 Ga0453684_0000511 3300044712 Bacteria 150804
537 Ga0453684_0000590 3300044712 Bacteria 134718
538 Ga0466971_0076846 3300044719 Bacteria 1519
539 Ga0466968_0019658 3300044735 Bacteria 2720
540 Ga0466970_0010621 3300044765 Bacteria 4676
541 Ga0466957_0013618 3300044842 Bacteria 4720
542 Ga0466957_0054345 3300044842 Bacteria 2444
543 Ga0466960_0081656 3300044901 Bacteria 1630
544 Ga0466960_0173190 3300044901 Bacteria 1166
545 Ga0466959_0005492 3300045049 Bacteria 8690
546 Ga0466959_0007973 3300045049 Bacteria 7460
547 Ga0466959_0166378 3300045049 Bacteria 1548
548 Ga0451576_0004219 3300045051 Bacteria 18885
549 Ga0451576_0021390 3300045051 Bacteria 7030
550 Ga0451576_1166139 3300045051 Bacteria 805
551 Ga0466958_0117412 3300045836 Bacteria 1663
552 Ga0466967_0039346 3300045976 Bacteria 4064
553 Ga0495592_0000836 3300046454 Bacteria 21408
554 Ga0495603_0237477 3300046455 Bacteria 1050
555 Ga0495638_0016525 3300046460 Bacteria 4941
556 Ga0495638_0077364 3300046460 Bacteria 2026
557 Ga0495650_0049886 3300046471 Bacteria 1735
558 Ga0495580_0028485 3300046472 Bacteria 4060
559 Ga0495605_0001886 3300046474 Bacteria 13402
560 Ga0495605_0048604 3300046474 Bacteria 2076
561 Ga0495639_0025324 3300046475 Bacteria 2616
562 Ga0495585_0021721 3300046492 Bacteria 3685
563 Ga0495596_0000210 3300046500 Bacteria 40119
564 Ga0495607_0016103 3300046501 Bacteria 4830
565 Ga0495583_0000444 3300046506 Bacteria 62022
566 Ga0495606_0005077 3300046507 Bacteria 12805
567 Ga0495606_0140663 3300046507 Bacteria 1426
568 Ga0495610_0000617 3300046512 Bacteria 35135
569 Ga0495616_0011909 3300046513 Bacteria 4956
570 Ga0495620_0042706 3300046515 Bacteria 1979
571 Ga0495620_0130700 3300046515 Bacteria 985
572 Ga0495631_0171917 3300046518 Bacteria 929
573 Ga0495632_0009219 3300046519 Bacteria 5964
574 Ga0495632_0045749 3300046519 Bacteria 2178
575 Ga0495632_0077514 3300046519 Bacteria 1589
576 Ga0495648_0103656 3300046524 Bacteria 1564
577 Ga0495648_0216440 3300046524 Bacteria 948
578 Ga0495652_0229543 3300046529 Bacteria 1389
579 Ga0495586_0231585 3300046535 Bacteria 1051
580 Ga0495598_0020939 3300046537 Bacteria 1733
581 Ga0495621_0008449 3300046539 Bacteria 3088
582 Ga0495597_0002181 3300046542 Bacteria 12852
583 Ga0495597_0002833 3300046542 Bacteria 10620
584 Ga0495625_0122151 3300046660 Bacteria 1771
585 Ga0495647_0144157 3300046681 Bacteria 1017
586 Ga0495624_0248428 3300046690 Bacteria 1076
587 Ga0495670_0110869 3300046691 Bacteria 1420
588 Ga0495671_0003500 3300046692 Bacteria 9629
589 Ga0495649_0000298 3300046694 Bacteria 43334
590 Ga0495649_0004208 3300046694 Bacteria 9438
591 Ga0495589_0008791 3300046794 Bacteria 5256
592 Ga0495660_0048169 3300046810 Bacteria 2331
593 Ga0495660_0087993 3300046810 Bacteria 1619
594 Ga0495636_0020166 3300047318 Bacteria 2685
595 Ga0495687_000664 3300047443 Bacteria 39326
596 Ga0495687_017937 3300047443 Bacteria 3512
597 Ga0495686_0215785 3300047472 Bacteria 1094
598 Ga0496100_0235590 3300048903 Bacteria 1349
599 Ga0496104_0080368 3300048907 Bacteria 3108
600 Ga0496104_0555256 3300048907 Bacteria 1059
601 Ga0496105_0059661 3300048908 Bacteria 3148
602 Ga0496106_0036381 3300048909 Bacteria 3683
603 Ga0496106_0326585 3300048909 Bacteria 1232
604 Ga0496108_0055469 3300048911 Bacteria 3327
605 Ga0496109_0506974 3300048912 Bacteria 1139
606 Ga0496109_0509549 3300048912 Bacteria 1136
607 Ga0496114_0013948 3300048917 Bacteria 6444
608 Ga0496115_0088616 3300048918 Bacteria 2527
609 Ga0496116_0009597 3300048919 Bacteria 8235
610 Ga0496116_0013306 3300048919 Bacteria 6646
611 Ga0496118_0125325 3300048921 Bacteria 1664
612 Ga0496119_0039985 3300048922 Bacteria 3006
613 Ga0496119_0115936 3300048922 Bacteria 1479
614 Ga0496121_0000211 3300048924 Bacteria 127602
615 Ga0496121_0017217 3300048924 Bacteria 7401
616 Ga0496121_0022344 3300048924 Bacteria 6144
617 Ga0496122_0006976 3300048925 Bacteria 12715
618 Ga0496122_0082181 3300048925 Bacteria 2239
619 Ga0496123_0002472 3300048926 Bacteria 22829
620 Ga0496123_0014023 3300048926 Bacteria 6672
621 Ga0496123_0064476 3300048926 Bacteria 2334
622 Ga0496124_0096768 3300048927 Bacteria 2397
623 Ga0496124_0117501 3300048927 Bacteria 2130
624 Ga0496125_0000005 3300048928 Bacteria 827598
625 Ga0496125_0000519 3300048928 Bacteria 66983
626 Ga0496125_0121657 3300048928 Bacteria 1860
627 Ga0496126_0127762 3300048929 Bacteria 2199
628 Ga0496126_0132720 3300048929 Bacteria 2150
629 Ga0496126_0172213 3300048929 Bacteria 1843
630 Ga0496126_0281100 3300048929 Bacteria 1379
631 Ga0501303_001201 3300049526 Bacteria 1933
632 Ga0501032_0207518 3300049569 Bacteria 1278
633 Ga0501034_0001049 3300049571 Bacteria 39330
634 Ga0501046_0000135 3300049580 Bacteria 79084
635 Ga0501047_0000173 3300049581 Bacteria 79071
636 Ga0501048_0003414 3300049582 Bacteria 12070
637 Ga0501067_0208409 3300049583 Bacteria 1089
638 Ga0501222_006867 3300049662 Bacteria 1525
639 Ga0501223_014376 3300049663 Bacteria 1570
640 Ga0501227_015271 3300049665 Bacteria 1715
641 Ga0501235_010516 3300049669 Bacteria 2022
642 Ga0501257_014261 3300049686 Bacteria 1826
643 Ga0501258_003011 3300049687 Bacteria 1521
644 Ga0501229_013241 3300049706 Bacteria 1058
645 Ga0501266_001219 3300049763 Bacteria 3282
646 Ga0501267_006977 3300049764 Bacteria 1092
647 Ga0501044_0002412 3300049823 Bacteria 21319
648 Ga0501045_0266032 3300049824 Bacteria 1277
649 nmdc:mga03683_205625_c1 3300050489 Bacteria 904
650 nmdc:mga03683_99884_c1 3300050489 Bacteria 1274
651 nmdc:mga0yw44_148673_c1 3300050492 Bacteria 1527
652 nmdc:mga0k408_10351_c1 3300050493 Bacteria 5043
653 nmdc:mga0k408_138911_c1 3300050493 Bacteria 1445
654 nmdc:mga0k408_14739_c1 3300050493 Bacteria 4313
655 nmdc:mga0k408_28093_c1 3300050493 Bacteria 3197
656 nmdc:mga0k408_49349_c1 3300050493 Bacteria 2436
657 nmdc:mga0k408_5365_c1 3300050493 Bacteria 6814
658 nmdc:mga0k408_5804_c1 3300050493 Bacteria 6575
659 nmdc:mga0k408_87422_c1 3300050493 Bacteria 1831
660 nmdc:mga06z11_22379_c1 3300050494 Bacteria 2951
661 nmdc:mga06z11_29818_c1 3300050494 Bacteria 2632
662 nmdc:mga04h51_77368_c1 3300050495 Bacteria 1174
663 nmdc:mga07m45_15731_c1 3300050496 Bacteria 4042
664 nmdc:mga07m45_258319_c1 3300050496 Bacteria 1013
665 nmdc:mga07m45_5434_c1 3300050496 Bacteria 6343
666 nmdc:mga07m45_8955_c1 3300050496 Bacteria 5169
667 nmdc:mga05p37_17544_c1 3300050507 Bacteria 8641
668 nmdc:mga0qj67_536207_c1 3300050509 Bacteria 939
669 nmdc:mga08y16_164124_c1 3300050511 Bacteria 2307
670 nmdc:mga08y16_509856_c1 3300050511 Bacteria 1221
671 nmdc:mga0a205_351453_c1 3300050515 Bacteria 1341
672 nmdc:mga0sz30_28630_c1 3300050516 Bacteria 2294
673 Ga0500635_0000003 3300053080 Bacteria 216927
674 Ga0500578_0000064 3300053086 Bacteria 117170
675 Ga0500578_0029617 3300053086 Bacteria 3517
676 Ga0500644_0006725 3300053088 Bacteria 2961
677 Ga0500644_0021135 3300053088 Bacteria 1945
678 Ga0500651_0086373 3300053093 Bacteria 1938
679 Ga0500562_021566 3300053108 Bacteria 1677
680 Ga0500594_0007813 3300053118 Bacteria 2424
681 Ga0500628_002254 3300053129 Bacteria 3215
682 Ga0500652_001396 3300053131 Bacteria 7524
683 Ga0500652_053138 3300053131 Bacteria 1657
684 Ga0500655_016491 3300053133 Bacteria 1361
685 Ga0500559_0001511 3300053136 Bacteria 13082
686 Ga0500559_0011929 3300053136 Bacteria 3703
687 Ga0500589_121365 3300053147 Bacteria 1106
688 Ga0500619_001351 3300053154 Bacteria 4306
689 Ga0500622_0000390 3300053156 Bacteria 42468
690 Ga0500622_0004316 3300053156 Bacteria 8993
691 Ga0500587_001916 3300053739 Bacteria 2967
692 Ga0590071_001666 3300059421 Bacteria 5792
693 Ga0590074_013896 3300059423 Bacteria 1361
694 Ga0501082_0660831 3300060353 Bacteria 915
695 Ga0466962_0015772 3300061719 Bacteria 3644
696 Ga0466962_0245282 3300061719 Bacteria 879
697 2643994479 2643221596 Bacteria 5006805
698 2990715395 2990710928 Bacteria 5002431
699 Ga0495650_0001576
700 JGI25164J39214_1002968
701 JGI25152J39213_1001983
702 JGI25151J46595_10018667
703 JGI25153J46596_10002706
704 JGI25153J46596_10004494
705 rootH1_10005582
706 rootH2_10036651
707 rootL2_10000012
708 rootH1_10001431
709 rootH1_10017763
710 rootH1_10024504
711 Ga0055539_1000702
712 Ga0055533_1000011
713 Ga0055525_1000644
714 Ga0055526_1005808
715 Ga0055526_1015974
716 Ga0055537_1011233
717 Ga0055524_1000292
718 Ga0055524_1012153
719 Ga0055536_1000077
720 Ga0055534_1001235
721 Ga0055534_1001449
722 Ga0055530_10003201
723 Ga0055540_1000007
724 Ga0055540_1013115
725 Ga0055540_1024915
726 Ga0055531_10015414
727 Ga0055531_10017511
728 Ga0055543_1004618
729 Ga0065165_1000086
730 Ga0065165_1000235
731 Ga0065165_1002164
732 Ga0070658_10180044
733 Ga0070676_10007395
734 Ga0070676_10012648
735 Ga0070676_10040718
736 Ga0070676_10221570
737 Ga0070676_10242809
738 Ga0070676_10285295
739 Ga0070690_100003513
740 Ga0070690_100499744
741 Ga0070670_100017476
742 Ga0070670_100018090
743 Ga0070670_100022546
744 Ga0070677_10095174
745 Ga0070677_10112259
746 Ga0068869_100010748
747 Ga0068869_100024271
748 Ga0070666_10023861
749 Ga0068868_100278619
750 Ga0068868_100418448
751 Ga0070660_100114234
752 Ga0070687_100004291
753 Ga0070687_100107217
754 Ga0070661_100250907
755 Ga0070668_100087971
756 Ga0070669_100001506
757 Ga0070669_100021586
758 Ga0070669_100119950
759 Ga0070675_100039054
760 Ga0070675_100062470
761 Ga0070675_100454099
762 Ga0070671_100025262
763 Ga0070674_100007372
764 Ga0070674_100078756
765 Ga0070673_100032997
766 Ga0070673_100050058
767 Ga0070673_100164526
768 Ga0070673_100369477
769 Ga0070659_100075406
770 Ga0070667_100000219
771 Ga0070667_100000636
772 Ga0070667_100047331
773 Ga0070667_100190906
774 Ga0070667_100480270
775 Ga0070700_100027238
776 Ga0070708_100318586
777 Ga0070678_100009309
778 Ga0070678_100014627
779 Ga0070678_100093588
780 Ga0070662_100290304
781 Ga0068867_100000297
782 Ga0068867_100006086
783 Ga0068867_100016200
784 Ga0068867_100039213
785 Ga0070706_100000727
786 Ga0070707_100040881
787 Ga0070698_100136610
788 Ga0068853_100153202
789 Ga0068853_100568012
790 Ga0070672_100002319
791 Ga0070672_100005971
792 Ga0070672_100006495
793 Ga0070672_100007059
794 Ga0070672_100008674
795 Ga0070672_100018056
796 Ga0070686_100379535
797 Ga0070665_100026192
798 Ga0070665_100504561
799 Ga0068855_100032642
800 Ga0068855_100715096
801 Ga0070664_100304144
802 Ga0070664_100425044
803 Ga0068857_100003123
804 Ga0068857_100017323
805 Ga0068854_100102899
806 Ga0068854_100286222
807 Ga0068856_100004904
808 Ga0068856_100052872
809 Ga0068852_100055958
810 Ga0068852_100176624
811 Ga0068852_100212372
812 Ga0068852_100251623
813 Ga0068852_100263808
814 Ga0068859_100022833
815 Ga0068859_100045986
816 Ga0068864_100020795
817 Ga0068864_100034617
818 Ga0068864_100090246
819 Ga0068864_100433312
820 Ga0068866_10002065
821 Ga0068861_100002507
822 Ga0068861_100004958
823 Ga0068861_100004994
824 Ga0068861_100186346
825 Ga0068851_10083273
826 Ga0068851_10142623
827 Ga0068870_10060241
828 Ga0068870_10125488
829 Ga0068863_100009450
830 Ga0068863_100034277
831 Ga0068863_100225642
832 Ga0068858_100002624
833 Ga0068858_100043671
834 Ga0068860_100003703
835 Ga0068860_100007254
836 Ga0068860_100011329
837 Ga0068860_100078010
838 Ga0068860_100170100
839 Ga0068860_100237110
840 Ga0068862_100031416
841 Ga0068862_100058975
842 Ga0068862_100058979
843 Ga0068862_100125108
844 Ga0075365_10185404
845 Ga0075368_10002952
846 Ga0075368_10124350
847 Ga0075363_100066455
848 Ga0075432_10000627
849 Ga0070715_10156084
850 Ga0075362_10007890
851 Ga0075362_10084011
852 Ga0075367_10007883
853 Ga0075367_10029219
854 Ga0075367_10035415
855 Ga0075367_10138316
856 Ga0075369_10085819
857 Ga0075366_10001182
858 Ga0075366_10001474
859 Ga0075366_10010270
860 Ga0075366_10042201
861 Ga0075366_10070471
862 Ga0075366_10075010
863 Ga0075366_10132534
864 Ga0097621_100099234
865 Ga0075370_10009151
866 Ga0075370_10013434
867 Ga0075370_10029886
868 Ga0075370_10045165
869 Ga0075370_10091479
870 Ga0075370_10151840
871 Ga0068871_100037767
872 Ga0068865_100007422
873 Ga0068865_100032838
874 Ga0097620_100022833
875 Ga0097620_100045984
876 Ga0099823_1000016
877 Ga0079104_1000009
878 Ga0079104_1000027
879 Ga0099826_10000029
880 Ga0105251_10146958
881 Ga0105250_10000154
882 Ga0111539_10526715
883 Ga0111539_10942171
884 Ga0111539_11062630
885 Ga0105245_10098561
886 Ga0105245_10141875
887 Ga0114129_10020593
888 Ga0105243_10003470
889 Ga0105242_10003491
890 Ga0105242_10094644
891 Ga0105237_10001445
892 Ga0105237_10005231
893 Ga0105249_10013356
894 Ga0105249_10078130
895 Ga0105249_10333303
896 Ga0105249_10414854
897 Ga0105239_10002359
898 Ga0105239_10130664
899 Ga0105246_10012737
900 Ga0157319_1000002
901 Ga0157369_10294890
902 Ga0157374_10235672
903 Ga0157378_10009410
904 Ga0157378_10400886
905 Ga0163162_10009904
906 Ga0163162_10162698
907 Ga0157372_10272658
908 Ga0157375_10006157
909 Ga0157375_10047653
910 Ga0157375_10080654
911 Ga0157380_10015513
912 Ga0157380_10088036
913 Ga0157380_10136757
914 Ga0157380_10236712
915 Ga0157380_10588045
916 Ga0157377_10000010
917 Ga0157379_10002725
918 Ga0157379_10009434
919 Ga0157379_10032264
920 Ga0157379_10082130
921 Ga0157376_10690385
922 Ga0163161_10029761
923 Ga0163161_10032861
924 Ga0163161_10318372
925 Ga0213872_10007448
926 Ga0209674_100003
927 Ga0209563_100010
928 Ga0207427_100729
929 Ga0207425_1000789
930 Ga0209646_1000066
931 Ga0209026_1000027
932 Ga0209677_100178
933 Ga0209677_100183
934 Ga0209677_102825
935 Ga0209759_1000131
936 Ga0209759_1001305
937 Ga0209759_1009027
938 Ga0209129_1000212
939 Ga0209565_1000084
940 Ga0209565_1006836
941 Ga0209565_1022700
942 Ga0209673_1007199
943 Ga0209673_1023529
944 Ga0209673_1042014
945 Ga0209675_1000141
946 Ga0209675_1000933
947 Ga0209676_1000012
948 Ga0209025_1000214
949 Ga0209025_1000438
950 Ga0209025_1002951
951 Ga0209025_1073094
952 Ga0209564_1000024
953 Ga0209564_1000229
954 Ga0209564_1000593
955 Ga0209564_1003205
956 Ga0209564_1003928
957 Ga0209564_1005647
958 Ga0209758_1000213
959 Ga0209758_1000558
960 Ga0209758_1015434
961 Ga0209050_1002504
962 Ga0209050_1002961
963 Ga0209050_1005060
964 Ga0209050_1012174
965 Ga0209256_1000019
966 Ga0209256_1000072
967 Ga0209256_1000233
968 Ga0209256_1000493
969 Ga0209256_1000620
970 Ga0209256_1016674
971 Ga0209051_1000004
972 Ga0209051_1000244
973 Ga0209051_1000934
974 Ga0209051_1001384
975 Ga0209051_1009534
976 Ga0209051_1009932
977 Ga0209051_1012746
978 Ga0209051_1040699
979 Ga0209257_1000038
980 Ga0209257_1000044
981 Ga0209257_1000144
982 Ga0209257_1000401
983 Ga0209257_1002710
984 Ga0207697_10049327
985 Ga0207697_10068189
986 Ga0207656_10008137
987 Ga0207656_10103754
988 Ga0207696_1000388
989 Ga0207682_10012448
990 Ga0207682_10015979
991 Ga0207682_10148378
992 Ga0207688_10032487
993 Ga0207680_10005532
994 Ga0207685_10097972
995 Ga0207645_10004851
996 Ga0207645_10007226
997 Ga0207645_10154816
998 Ga0207645_10292653
999 Ga0207705_10055214
1000 Ga0207705_10146359
1001 Ga0207684_10171834
1002 Ga0207695_10314403
1003 Ga0207695_10364679
1004 Ga0207671_10210521
1005 Ga0207662_10034488
1006 Ga0207662_10042242
1007 Ga0207657_10150905
1008 Ga0207646_10104383
1009 Ga0207681_10031863
1010 Ga0207681_10042747
1011 Ga0207681_10243989
1012 Ga0207650_10003617
1013 Ga0207650_10016952
1014 Ga0207650_10039032
1015 Ga0207650_10056229
1016 Ga0207650_10088927
1017 Ga0207659_10034479
1018 Ga0207659_10135103
1019 Ga0207659_10305705
1020 Ga0207687_10029491
1021 Ga0207687_10222960
1022 Ga0207644_10180645
1023 Ga0207644_10231910
1024 Ga0207644_10392987
1025 Ga0207644_10424083
1026 Ga0207690_10020192
1027 Ga0207690_10152630
1028 Ga0207706_10001145
1029 Ga0207706_10006055
1030 Ga0207706_10241215
1031 Ga0207709_10000862
1032 Ga0207709_10001617
1033 Ga0207709_10559577
1034 Ga0207669_10003348
1035 Ga0207669_10246924
1036 Ga0207669_10417725
1037 Ga0207704_10003536
1038 Ga0207691_10004652
1039 Ga0207691_10020019
1040 Ga0207691_10035589
1041 Ga0207691_10050926
1042 Ga0207691_10097998
1043 Ga0207691_10257533
1044 Ga0207689_10008988
1045 Ga0207689_10034649
1046 Ga0207689_10102108
1047 Ga0207661_10530061
1048 Ga0207679_10096564
1049 Ga0207679_10202328
1050 Ga0207667_10056358
1051 Ga0207667_10251006
1052 Ga0207667_10435662
1053 Ga0207667_10479848
1054 Ga0207651_10003624
1055 Ga0207651_10018765
1056 Ga0207651_10033243
1057 Ga0207651_10130636
1058 Ga0207651_10174097
1059 Ga0207712_10054174
1060 Ga0207712_10335772
1061 Ga0207668_10002813
1062 Ga0207668_10005358
1063 Ga0207668_10320422
1064 Ga0207668_10333494
1065 Ga0207668_10359258
1066 Ga0207640_10001221
1067 Ga0207640_10065113
1068 Ga0207658_10002165
1069 Ga0207658_10007223
1070 Ga0207658_10459685
1071 Ga0207677_10257222
1072 Ga0207677_10325819
1073 Ga0207703_10001182
1074 Ga0207703_10040447
1075 Ga0207639_10157565
1076 Ga0207639_10334399
1077 Ga0207639_10607978
1078 Ga0207678_10000627
1079 Ga0207708_10123004
1080 Ga0207702_10000220
1081 Ga0207641_10006430
1082 Ga0207641_10150489
1083 Ga0207641_10412381
1084 Ga0207648_10000002
1085 Ga0207648_10000319
1086 Ga0207648_10054864
1087 Ga0207648_10141183
1088 Ga0207648_10268404
1089 Ga0207648_10405891
1090 Ga0207676_10008941
1091 Ga0207676_10013833
1092 Ga0207676_10022982
1093 Ga0207676_10156662
1094 Ga0207676_10428825
1095 Ga0207674_10025156
1096 Ga0207674_10044740
1097 Ga0207674_10368215
1098 Ga0207674_10527091
1099 Ga0207675_100002653
1100 Ga0207675_100006685
1101 Ga0207675_100280535
1102 Ga0207675_100330075
1103 Ga0207683_10011415
1104 Ga0207683_10194497
1105 Ga0207683_10348136
1106 Ga0207698_10012414
1107 Ga0207698_10076974
1108 Ga0207698_10081126
1109 Ga0209281_1000002
1110 Ga0209281_1000023
1111 Ga0209389_1015415
1112 Ga0209970_1000107
1113 Ga0209983_1007271
1114 Ga0209282_1000077
1115 Ga0209971_1001512
1116 Ga0209813_10064775
1117 Ga0209974_10029941
1118 Ga0209974_10032983
1119 Ga0207428_10096457
1120 Ga0268266_10025164
1121 Ga0268266_10405455
1122 Ga0268266_10511042
1123 Ga0268265_10004033
1124 Ga0268264_10000629
1125 Ga0268264_10073349
1126 Ga0268264_10076734
1127 Ga0268264_10096738
1128 Ga0265336_10000008
1129 Ga0307517_10011327
1130 Ga0307517_10068387
1131 Ga0307515_10000037
1132 Ga0307515_10000152
1133 Ga0307515_10002738
1134 Ga0307515_10020939
1135 Ga0307515_10022058
1136 Ga0307515_10240368
1137 Ga0307515_10361847
1138 Ga0307515_10374583
1139 Ga0307512_10065889
1140 Ga0265330_10000012
1141 Ga0265332_10000012
1142 Ga0265325_10003186
1143 Ga0307513_10000206
1144 Ga0307513_10012651
1145 Ga0307513_10016678
1146 Ga0307513_10026122
1147 Ga0307513_10123473
1148 Ga0307513_10461226
1149 Ga0307509_10000293
1150 Ga0307509_10009259
1151 Ga0307509_10063369
1152 Ga0307509_10091149
1153 Ga0307509_10099784
1154 Ga0307509_10114665
1155 Ga0307509_10335806
1156 Ga0307408_100001627
1157 Ga0307408_100033711
1158 Ga0307508_10000053
1159 Ga0307508_10000273
1160 Ga0307508_10012492
1161 Ga0307508_10125508
1162 Ga0307514_10000708
1163 Ga0307514_10000722
1164 Ga0307514_10012229
1165 Ga0307514_10114496
1166 Ga0265314_10000029
1167 Ga0265342_10086283
1168 Ga0307516_10000048
1169 Ga0307516_10001622
1170 Ga0307516_10006586
1171 Ga0307516_10007859
1172 Ga0307516_10045012
1173 Ga0307516_10236404
1174 Ga0307405_10058701
1175 Ga0307413_10040487
1176 Ga0307410_10124692
1177 Ga0307406_10000046
1178 Ga0307406_10118887
1179 Ga0307407_10520461
1180 Ga0307409_100002839
1181 Ga0307416_100216244
1182 Ga0307416_100308727
1183 Ga0307411_10000039
1184 Ga0307411_10005988
1185 Ga0307510_10009698
1186 Ga0373928_0035244
1187 Ga0373932_0111222
1188 Ga0373931_0030468
1189 Ga0373927_0198246
1190 Ga0373925_0004299
1191 Ga0373925_0130572
1192 Ga0373925_0218966
1193 Ga0395899_0068971
1194 Ga0395900_0000224
1195 Ga0395900_0414052
1196 Ga0395898_0001914
1197 Ga0395898_0244235
1198 Ga0395905_0009931
1199 Ga0395905_0009992
1200 Ga0395905_0024396
1201 Ga0395905_0259191
1202 Ga0395901_0077841
1203 Ga0436361_0609716
1204 Ga0439439_0059046
1205 Ga0451789_0000666
1206 Ga0451798_0453462
1207 Ga0451802_0514930
1208 Ga0451845_0101343
1209 Ga0451853_1116926
1210 Ga0439433_0035496
1211 Ga0439445_0022749
1212 Ga0439449_0078458
1213 Ga0439450_024784
1214 Ga0450911_000637
1215 Ga0450919_001484
1216 Ga0450898_001915
1217 Ga0439459_0001693
1218 Ga0450918_005336
1219 Ga0451577_0006159
1220 Ga0466969_0006082
1221 Ga0466969_0033695
1222 Ga0466972_0050188
1223 Ga0466965_0007090
1224 Ga0466965_0046340
1225 Ga0466966_0073168
1226 Ga0466966_0083969
1227 Ga0466961_0013053
1228 Ga0466961_0015682
1229 Ga0466961_0183214
1230 Ga0466963_0064274
1231 Ga0466963_0277003
1232 Ga0466964_0003754
1233 Ga0466964_0056839
1234 Ga0453684_0000511
1235 Ga0453684_0000590
1236 Ga0466971_0076846
1237 Ga0466968_0019658
1238 Ga0466970_0010621
1239 Ga0466957_0013618
1240 Ga0466957_0054345
1241 Ga0466960_0081656
1242 Ga0466960_0173190
1243 Ga0466959_0005492
1244 Ga0466959_0007973
1245 Ga0466959_0166378
1246 Ga0451576_0004219
1247 Ga0451576_0021390
1248 Ga0451576_1166139
1249 Ga0466958_0117412
1250 Ga0466967_0039346
1251 Ga0495592_0000836
1252 Ga0495603_0237477
1253 Ga0495638_0016525
1254 Ga0495638_0077364
1255 Ga0495650_0049886
1256 Ga0495580_0028485
1257 Ga0495605_0001886
1258 Ga0495605_0048604
1259 Ga0495639_0025324
1260 Ga0495585_0021721
1261 Ga0495596_0000210
1262 Ga0495607_0016103
1263 Ga0495583_0000444
1264 Ga0495606_0005077
1265 Ga0495606_0140663
1266 Ga0495610_0000617
1267 Ga0495616_0011909
1268 Ga0495620_0042706
1269 Ga0495620_0130700
1270 Ga0495631_0171917
1271 Ga0495632_0009219
1272 Ga0495632_0045749
1273 Ga0495632_0077514
1274 Ga0495648_0103656
1275 Ga0495648_0216440
1276 Ga0495652_0229543
1277 Ga0495586_0231585
1278 Ga0495598_0020939
1279 Ga0495621_0008449
1280 Ga0495597_0002181
1281 Ga0495597_0002833
1282 Ga0495625_0122151
1283 Ga0495647_0144157
1284 Ga0495624_0248428
1285 Ga0495670_0110869
1286 Ga0495671_0003500
1287 Ga0495649_0000298
1288 Ga0495649_0004208
1289 Ga0495589_0008791
1290 Ga0495660_0048169
1291 Ga0495660_0087993
1292 Ga0495636_0020166
1293 Ga0495687_000664
1294 Ga0495687_017937
1295 Ga0495686_0215785
1296 Ga0496100_0235590
1297 Ga0496104_0080368
1298 Ga0496104_0555256
1299 Ga0496105_0059661
1300 Ga0496106_0036381
1301 Ga0496106_0326585
1302 Ga0496108_0055469
1303 Ga0496109_0506974
1304 Ga0496109_0509549
1305 Ga0496114_0013948
1306 Ga0496115_0088616
1307 Ga0496116_0009597
1308 Ga0496116_0013306
1309 Ga0496118_0125325
1310 Ga0496119_0039985
1311 Ga0496119_0115936
1312 Ga0496121_0000211
1313 Ga0496121_0017217
1314 Ga0496121_0022344
1315 Ga0496122_0006976
1316 Ga0496122_0082181
1317 Ga0496123_0002472
1318 Ga0496123_0014023
1319 Ga0496123_0064476
1320 Ga0496124_0096768
1321 Ga0496124_0117501
1322 Ga0496125_0000005
1323 Ga0496125_0000519
1324 Ga0496125_0121657
1325 Ga0496126_0127762
1326 Ga0496126_0132720
1327 Ga0496126_0172213
1328 Ga0496126_0281100
1329 Ga0501303_001201
1330 Ga0501032_0207518
1331 Ga0501034_0001049
1332 Ga0501046_0000135
1333 Ga0501047_0000173
1334 Ga0501048_0003414
1335 Ga0501067_0208409
1336 Ga0501222_006867
1337 Ga0501223_014376
1338 Ga0501227_015271
1339 Ga0501235_010516
1340 Ga0501257_014261
1341 Ga0501258_003011
1342 Ga0501229_013241
1343 Ga0501266_001219
1344 Ga0501267_006977
1345 Ga0501044_0002412
1346 Ga0501045_0266032
1347 nmdc:mga03683_205625_c1
1348 nmdc:mga03683_99884_c1
1349 nmdc:mga0yw44_148673_c1
1350 nmdc:mga0k408_10351_c1
1351 nmdc:mga0k408_138911_c1
1352 nmdc:mga0k408_14739_c1
1353 nmdc:mga0k408_28093_c1
1354 nmdc:mga0k408_49349_c1
1355 nmdc:mga0k408_5365_c1
1356 nmdc:mga0k408_5804_c1
1357 nmdc:mga0k408_87422_c1
1358 nmdc:mga06z11_22379_c1
1359 nmdc:mga06z11_29818_c1
1360 nmdc:mga04h51_77368_c1
1361 nmdc:mga07m45_15731_c1
1362 nmdc:mga07m45_258319_c1
1363 nmdc:mga07m45_5434_c1
1364 nmdc:mga07m45_8955_c1
1365 nmdc:mga05p37_17544_c1
1366 nmdc:mga0qj67_536207_c1
1367 nmdc:mga08y16_164124_c1
1368 nmdc:mga08y16_509856_c1
1369 nmdc:mga0a205_351453_c1
1370 nmdc:mga0sz30_28630_c1
1371 Ga0500635_0000003
1372 Ga0500578_0000064
1373 Ga0500578_0029617
1374 Ga0500644_0006725
1375 Ga0500644_0021135
1376 Ga0500651_0086373
1377 Ga0500562_021566
1378 Ga0500594_0007813
1379 Ga0500628_002254
1380 Ga0500652_001396
1381 Ga0500652_053138
1382 Ga0500655_016491
1383 Ga0500559_0001511
1384 Ga0500559_0011929
1385 Ga0500589_121365
1386 Ga0500619_001351
1387 Ga0500622_0000390
1388 Ga0500622_0004316
1389 Ga0500587_001916
1390 Ga0590071_001666
1391 Ga0590074_013896
1392 Ga0501082_0660831
1393 Ga0466962_0015772
1394 Ga0466962_0245282
1395 2643994479
1396 2990715395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00455

DeoRC

DeoR C terminal sensor domain

77

237

0.98

PF08220

HTH_DeoR

DeoR-like helix-turn-helix domain

9

65

0.97

PF12840

HTH_20

Helix-turn-helix domain

7

54

0.91

PF08279

HTH_11

HTH domain

9

58

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a3t-assembly1.cif.gz_T s. cerevisiae apc/c-cdh1 complex 0.9477 19 58
8a5y-assembly1.cif.gz_T s. cerevisiae apo unphosphorylated apc/c. 0.9476 19 58
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9466 7 58
3f72-assembly3.cif.gz_F crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant 0.9431 4 60
2qww-assembly3.cif.gz_F crystal structure of multiple antibiotic-resistance repressor (marr) (yp_013417.1) from listeria monocytogenes 4b f2365 at 2.07 a resolution 0.9415 6 58
ID Description Score Start End Superfamily
af_P32144_74_134_3.30.750.70 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;4-hydroxybutyrate coenzyme 1.003 71 130 3.30.750.70
af_P32144_11_67_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9853 7 60 1.10.10.10
af_P0ACL0_135_252_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9843 137 253 3.40.50.1360
af_P39361_78_236_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.972 78 233 3.40.50.1360
af_P0ACK2_88_247_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9717 75 233 3.40.50.1360
ID Description Score Start End GO Terms
AF-A0A4Q3YPD3-F1-model_v4 DeoR family transcriptional regulator 0.9961 78 253
AF-A0A520GZB1-F1-model_v4 DeoR family transcriptional regulator 0.9954 74 253
AF-A0A377D8G6-F1-model_v4 DNA-binding transcriptional repressor GlpR 0.9887 69 253 GO:0003677
AF-H5TD92-F1-model_v4 DeoR family transcriptional regulator, glycerol-3-phosphate regulon repressor 0.9869 77 252
AF-A0A379SBP7-F1-model_v4 DeoR family transcriptional regulator 0.9864 69 252

Map