F475694

General Info

Members Datasets Scaffolds Average Seq Length
694 349 656 322

Family's Representative Sequence

Representative Sequence 3300002459|JGI24751J29686_10000251|JGI24751J29686_100002512
Length 347
Sequence MTPFDEAQDVLRQASGRPGIGVVGAGAWGTALAQAMASDGSEVLIWAREPELVTEINQQRTNSLFLPGASLAPTIRATGDLAELXXXXVLLVVVPAQFLASVVGGLPHGERDLVLCAKGIEAGTGRLMADVARDAAPEATLAVLSGPTFAHEVAAGLPTAVTLACGGGETQWARLAPAISRPMLRPYYSDDVIGAEIGGSVKNVLAIACGVVDGLKLGQNARAALIARGYAEMLRFGAARGARAETLAGLCGLGDLVLTCSSTSSRNFSLGKALGEGLSAAEALAGKSSVAEGAHTAPVLAELAEKAGIAMPIVAAVNRLLKGEASAGAMVAELLARPLRAEQGNSP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
5 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
6 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
7 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
8 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
9 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
10 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
11 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
12 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
13 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
14 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
15 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
16 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
17 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
18 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
19 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
20 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
21 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
22 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
23 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
24 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
25 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
26 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
27 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
28 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
29 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
30 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
31 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
32 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
33 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
34 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
35 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
36 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
37 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
38 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
39 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
40 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
41 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
42 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
43 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
44 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
45 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
46 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
47 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
48 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
51 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
52 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
73 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
108 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
208 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
211 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
214 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
215 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
216 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
217 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
218 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
219 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
220 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
221 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
228 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
229 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
230 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
231 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
235 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
238 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
239 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
240 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
243 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
244 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
245 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
246 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
247 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
248 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
249 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
250 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
251 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
252 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
253 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
254 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
255 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
258 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
259 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
262 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
263 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
264 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
265 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
266 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
267 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
268 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
286 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
287 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
288 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
289 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
292 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
293 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
294 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
295 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
296 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
307 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
308 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
309 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
310 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
315 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
316 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
317 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
318 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
319 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
320 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
323 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
324 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
325 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
326 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
327 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
328 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
329 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
330 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
331 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
332 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
333 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
334 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
335 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
336 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
337 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
338 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
339 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
340 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
341 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
342 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
343 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
344 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
345 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
346 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
347 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
348 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
349 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.09
Metatranscriptomes 0.43
Isolates 5.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 14.7
Nodule 0.14
Rhizoplane 4.18
Rhizosphere 69.88
Stem 0
Stem Tuber 0
Unclassified 10.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2665226 2162886007 Bacteria 37318
2 JGI24741J21665_1006549 3300001915 Bacteria 2330
3 JGI24752J21851_1001195 3300001976 Bacteria 3523
4 JGI24737J22298_10003866 3300001990 Bacteria 5266
5 JGI24737J22298_10045823 3300001990 Bacteria 1335
6 JGI24034J26672_10003557 3300002239 Bacteria 2179
7 JGI24751J29686_10000251 3300002459 Bacteria 21182
8 JGI24751J29686_10012926 3300002459 Bacteria 1723
9 JGI25150J39212_1000189 3300002774 Bacteria 34828
10 JGI25153J46596_10000125 3300003215 Bacteria 86065
11 Ga0055536_1000358 3300003781 Bacteria 33927
12 Ga0055536_1000785 3300003781 Bacteria 21171
13 Ga0055536_1001881 3300003781 Bacteria 12207
14 Ga0055536_1004888 3300003781 Bacteria 6689
15 Ga0055536_1027487 3300003781 Bacteria 1571
16 Ga0055530_10000054 3300003791 Bacteria 102159
17 Ga0055530_10006284 3300003791 Bacteria 5343
18 Ga0055530_10008250 3300003791 Bacteria 4208
19 Ga0055530_10016343 3300003791 Bacteria 2376
20 Ga0055540_1004110 3300003792 Bacteria 6737
21 Ga0055531_10000492 3300003794 Bacteria 36203
22 Ga0055531_10002269 3300003794 Bacteria 13015
23 Ga0055531_10003200 3300003794 Bacteria 10516
24 Ga0055531_10010446 3300003794 Bacteria 4611
25 Ga0055531_10014634 3300003794 Bacteria 3519
26 Ga0055531_10014636 3300003794 Bacteria 3519
27 Ga0055531_10043756 3300003794 Bacteria 1264
28 Ga0065704_10070228 3300005289 Bacteria 56935
29 Ga0065704_10095011 3300005289 Bacteria 2511
30 Ga0065712_10074966 3300005290 Bacteria 3967
31 Ga0065707_10133605 3300005295 Bacteria 1878
32 Ga0070658_10000003 3300005327 Bacteria 465963
33 Ga0070658_10029030 3300005327 Bacteria 4442
34 Ga0070658_10090437 3300005327 Bacteria 2522
35 Ga0070683_100095498 3300005329 Bacteria 2795
36 Ga0070690_100022933 3300005330 Bacteria 3823
37 Ga0070670_100043018 3300005331 Bacteria 3884
38 Ga0070670_100057555 3300005331 Bacteria 3337
39 Ga0070670_100082303 3300005331 Bacteria 2766
40 Ga0070670_100251458 3300005331 Bacteria 1540
41 Ga0070670_100456444 3300005331 Bacteria 1133
42 Ga0070677_10001169 3300005333 Bacteria 8423
43 Ga0070666_10053003 3300005335 Bacteria 2735
44 Ga0070680_100010757 3300005336 Bacteria 7062
45 Ga0070660_100000348 3300005339 Bacteria 30900
46 Ga0070660_100030302 3300005339 Bacteria 4058
47 Ga0070661_100000003 3300005344 Bacteria 254653
48 Ga0070661_100132126 3300005344 Bacteria 1876
49 Ga0070668_100091686 3300005347 Bacteria 2396
50 Ga0070668_100131383 3300005347 Bacteria 2010
51 Ga0070668_100331185 3300005347 Bacteria 1284
52 Ga0070669_100000080 3300005353 Bacteria 92960
53 Ga0070669_100000213 3300005353 Bacteria 48609
54 Ga0070669_100000799 3300005353 Bacteria 22862
55 Ga0070669_100027094 3300005353 Bacteria 4125
56 Ga0070669_100108800 3300005353 Bacteria 2101
57 Ga0070675_100095502 3300005354 Bacteria 2496
58 Ga0070671_100000003 3300005355 Bacteria 270186
59 Ga0070671_100002229 3300005355 Bacteria 14965
60 Ga0070671_100007726 3300005355 Bacteria 8592
61 Ga0070671_100016176 3300005355 Bacteria 6033
62 Ga0070671_100034930 3300005355 Bacteria 4163
63 Ga0070671_100048717 3300005355 Bacteria 3524
64 Ga0070674_100269432 3300005356 Bacteria 1345
65 Ga0070659_100000790 3300005366 Bacteria 23055
66 Ga0070659_100009534 3300005366 Bacteria 7135
67 Ga0070667_100000098 3300005367 Bacteria 108706
68 Ga0070667_100003111 3300005367 Bacteria 14270
69 Ga0070667_100005092 3300005367 Bacteria 11004
70 Ga0070667_100241650 3300005367 Bacteria 1612
71 Ga0070709_10009356 3300005434 Bacteria 5402
72 Ga0070714_100000291 3300005435 Bacteria 38289
73 Ga0070714_100003701 3300005435 Bacteria 11449
74 Ga0070714_100013819 3300005435 Bacteria 6473
75 Ga0070713_100042029 3300005436 Bacteria 3727
76 Ga0070710_10000958 3300005437 Bacteria 13673
77 Ga0070705_100142265 3300005440 Bacteria 1580
78 Ga0070694_100057785 3300005444 Bacteria 2638
79 Ga0070663_100006846 3300005455 Bacteria 6896
80 Ga0070663_100020995 3300005455 Bacteria 4334
81 Ga0070662_100003086 3300005457 Bacteria 10338
82 Ga0070662_100090392 3300005457 Bacteria 2298
83 Ga0070662_100136764 3300005457 Bacteria 1895
84 Ga0070679_100000001 3300005530 Bacteria 764811
85 Ga0070679_100024739 3300005530 Bacteria 5885
86 Ga0070679_100117226 3300005530 Bacteria 2648
87 Ga0070679_100154450 3300005530 Bacteria 2271
88 Ga0070679_100182635 3300005530 Bacteria 2070
89 Ga0068853_100009279 3300005539 Bacteria 7933
90 Ga0068853_100089814 3300005539 Bacteria 2699
91 Ga0068853_100138544 3300005539 Bacteria 2183
92 Ga0068853_100218510 3300005539 Bacteria 1740
93 Ga0070695_100127152 3300005545 Bacteria 1751
94 Ga0070696_100000325 3300005546 Bacteria 28995
95 Ga0070693_100056116 3300005547 Bacteria 2272
96 Ga0070665_100000070 3300005548 Bacteria 200681
97 Ga0070665_100007023 3300005548 Bacteria 11441
98 Ga0070665_100039812 3300005548 Bacteria 4725
99 Ga0070665_100042179 3300005548 Bacteria 4586
100 Ga0070665_100054556 3300005548 Bacteria 4008
101 Ga0070704_100363138 3300005549 Bacteria 1225
102 Ga0068855_100001523 3300005563 Bacteria 29042
103 Ga0068855_100226884 3300005563 Bacteria 2093
104 Ga0068855_100311135 3300005563 Bacteria 1743
105 Ga0070664_100005465 3300005564 Bacteria 10201
106 Ga0070664_100181604 3300005564 Bacteria 1870
107 Ga0070664_100209377 3300005564 Bacteria 1742
108 Ga0068854_100001419 3300005578 Bacteria 14478
109 Ga0068854_100224046 3300005578 Bacteria 1489
110 Ga0068852_100123369 3300005616 Bacteria 2375
111 Ga0068859_100025512 3300005617 Bacteria 5929
112 Ga0068864_100003096 3300005618 Bacteria 13743
113 Ga0068864_100014967 3300005618 Bacteria 6446
114 Ga0068864_100017649 3300005618 Bacteria 5951
115 Ga0068864_100032103 3300005618 Bacteria 4460
116 Ga0068863_100000081 3300005841 Bacteria 106186
117 Ga0068863_100030180 3300005841 Bacteria 5179
118 Ga0068863_100040042 3300005841 Bacteria 4456
119 Ga0068858_100000723 3300005842 Bacteria 34436
120 Ga0068858_100017428 3300005842 Bacteria 6737
121 Ga0068858_100024766 3300005842 Bacteria 5589
122 Ga0068858_100039905 3300005842 Bacteria 4352
123 Ga0068858_100062894 3300005842 Bacteria 3433
124 Ga0068858_100079107 3300005842 Bacteria 3055
125 Ga0068860_100000108 3300005843 Bacteria 132230
126 Ga0068860_100000164 3300005843 Bacteria 108706
127 Ga0068860_100004656 3300005843 Bacteria 14008
128 Ga0068860_100028825 3300005843 Bacteria 5342
129 Ga0068860_100034974 3300005843 Bacteria 4820
130 Ga0068860_100065405 3300005843 Bacteria 3453
131 Ga0068860_100210296 3300005843 Bacteria 1887
132 Ga0068862_100027216 3300005844 Bacteria 4812
133 Ga0068862_100048465 3300005844 Bacteria 3627
134 Ga0081455_10000088 3300005937 Bacteria 98815
135 Ga0081455_10002477 3300005937 Bacteria 21952
136 Ga0081455_10042235 3300005937 Bacteria 4002
137 Ga0075368_10008957 3300006042 Bacteria 3589
138 Ga0075368_10016620 3300006042 Bacteria 2744
139 Ga0075363_100061679 3300006048 Bacteria 2021
140 Ga0075364_10131989 3300006051 Bacteria 1677
141 Ga0075432_10004893 3300006058 Bacteria 4562
142 Ga0070712_100008055 3300006175 Bacteria 6612
143 Ga0075362_10000167 3300006177 Bacteria 17986
144 Ga0075367_10012146 3300006178 Bacteria 4581
145 Ga0075366_10015348 3300006195 Bacteria 4388
146 Ga0075366_10053492 3300006195 Bacteria 2398
147 Ga0075370_10014378 3300006353 Bacteria 4221
148 Ga0075428_100120369 3300006844 Bacteria 2858
149 Ga0075428_100272269 3300006844 Bacteria 1822
150 Ga0075431_100004319 3300006847 Bacteria 13927
151 Ga0097620_100025512 3300006931 Bacteria 5929
152 Ga0079104_1020607 3300006946 Bacteria 1813
153 Ga0105251_10000334 3300009011 Bacteria 47275
154 Ga0105251_10011293 3300009011 Bacteria 5110
155 Ga0111539_10166398 3300009094 Bacteria 2578
156 Ga0105245_10121461 3300009098 Bacteria 2441
157 Ga0105242_10089297 3300009176 Bacteria 2590
158 Ga0105248_10000626 3300009177 Bacteria 40130
159 Ga0105248_10023914 3300009177 Bacteria 6792
160 Ga0105248_10065721 3300009177 Bacteria 4072
161 Ga0105248_10067601 3300009177 Bacteria 4012
162 Ga0105248_10107466 3300009177 Bacteria 3146
163 Ga0105248_10201351 3300009177 Bacteria 2243
164 Ga0105248_10211680 3300009177 Bacteria 2184
165 Ga0105238_10029528 3300009551 Bacteria 5585
166 Ga0105238_10378625 3300009551 Bacteria 1406
167 Ga0105249_10017211 3300009553 Bacteria 6418
168 Ga0105246_10000847 3300011119 Bacteria 17492
169 Ga0157373_10049060 3300013100 Bacteria 3009
170 Ga0157371_10020876 3300013102 Bacteria 4817
171 Ga0157371_10152227 3300013102 Bacteria 1650
172 Ga0157369_10004697 3300013105 Bacteria 16061
173 Ga0157378_10005257 3300013297 Bacteria 11373
174 Ga0163162_10014044 3300013306 Bacteria 7827
175 Ga0163162_10029740 3300013306 Bacteria 5407
176 Ga0163162_10087572 3300013306 Bacteria 3193
177 Ga0163163_10168627 3300014325 Bacteria 2236
178 Ga0163163_10251818 3300014325 Bacteria 1817
179 Ga0157380_10012559 3300014326 Bacteria 6146
180 Ga0163161_10002367 3300017792 Bacteria 13509
181 Ga0163161_10013528 3300017792 Bacteria 5682
182 Ga0163161_10056425 3300017792 Bacteria 2852
183 Ga0163161_10472333 3300017792 Bacteria 1017
184 Ga0206356_10400983 3300020070 Bacteria 1447
185 Ga0206354_10564923 3300020081 Bacteria 6741
186 Ga0206353_10226904 3300020082 Bacteria 16427
187 Ga0213876_10000250 3300021384 Bacteria 51059
188 Ga0213875_10000636 3300021388 Bacteria 28040
189 Ga0209147_102039 3300025229 Bacteria 5791
190 Ga0207425_1000005 3300025245 Bacteria 900502
191 Ga0209129_1000345 3300025258 Bacteria 39677
192 Ga0209675_1000131 3300025291 Bacteria 102409
193 Ga0209676_1000084 3300025292 Bacteria 274330
194 Ga0209676_1000563 3300025292 Bacteria 55979
195 Ga0209676_1000729 3300025292 Bacteria 45044
196 Ga0209676_1000746 3300025292 Bacteria 44094
197 Ga0209676_1003606 3300025292 Bacteria 9320
198 Ga0209676_1005902 3300025292 Bacteria 6217
199 Ga0209676_1007451 3300025292 Bacteria 5135
200 Ga0209676_1024915 3300025292 Bacteria 1928
201 Ga0209025_1000855 3300025294 Bacteria 48253
202 Ga0209025_1006315 3300025294 Bacteria 9254
203 Ga0209758_1000002 3300025297 Bacteria 1400310
204 Ga0209050_1000001 3300025298 Bacteria 3563507
205 Ga0209050_1000113 3300025298 Bacteria 209222
206 Ga0209050_1000127 3300025298 Bacteria 187951
207 Ga0209050_1001889 3300025298 Bacteria 20097
208 Ga0209050_1017377 3300025298 Bacteria 2873
209 Ga0209051_1000297 3300025303 Bacteria 79062
210 Ga0209257_1000083 3300025304 Bacteria 296207
211 Ga0209257_1000090 3300025304 Bacteria 274746
212 Ga0209257_1000126 3300025304 Bacteria 215705
213 Ga0209257_1000330 3300025304 Bacteria 99167
214 Ga0209257_1002675 3300025304 Bacteria 17088
215 Ga0209257_1002709 3300025304 Bacteria 16888
216 Ga0209257_1011185 3300025304 Bacteria 4365
217 Ga0207697_10044592 3300025315 Bacteria 1825
218 Ga0207713_1000987 3300025735 Bacteria 24987
219 Ga0207692_10003524 3300025898 Bacteria 6122
220 Ga0207688_10312704 3300025901 Bacteria 962
221 Ga0207647_10105058 3300025904 Bacteria 1673
222 Ga0207699_10001263 3300025906 Bacteria 12028
223 Ga0207705_10000005 3300025909 Bacteria 673478
224 Ga0207705_10000009 3300025909 Bacteria 576128
225 Ga0207705_10002096 3300025909 Bacteria 15503
226 Ga0207705_10035024 3300025909 Bacteria 3591
227 Ga0207705_10041008 3300025909 Bacteria 3321
228 Ga0207707_10022373 3300025912 Bacteria 5527
229 Ga0207693_10000563 3300025915 Bacteria 33538
230 Ga0207660_10074130 3300025917 Bacteria 2483
231 Ga0207657_10003426 3300025919 Bacteria 16933
232 Ga0207657_10128246 3300025919 Bacteria 2081
233 Ga0207649_10000016 3300025920 Bacteria 243843
234 Ga0207652_10000002 3300025921 Bacteria 878035
235 Ga0207652_10042502 3300025921 Bacteria 3869
236 Ga0207652_10108590 3300025921 Bacteria 2459
237 Ga0207652_10115415 3300025921 Bacteria 2385
238 Ga0207646_10280474 3300025922 Bacteria 1506
239 Ga0207681_10000037 3300025923 Bacteria 154417
240 Ga0207681_10000049 3300025923 Bacteria 120296
241 Ga0207681_10000490 3300025923 Bacteria 27651
242 Ga0207681_10161455 3300025923 Bacteria 1690
243 Ga0207681_10360815 3300025923 Bacteria 1165
244 Ga0207694_10057217 3300025924 Bacteria 3031
245 Ga0207650_10055502 3300025925 Bacteria 2941
246 Ga0207650_10129271 3300025925 Bacteria 1975
247 Ga0207664_10000306 3300025929 Bacteria 36504
248 Ga0207664_10017649 3300025929 Bacteria 5237
249 Ga0207664_10077257 3300025929 Bacteria 2697
250 Ga0207644_10000004 3300025931 Bacteria 566613
251 Ga0207644_10000052 3300025931 Bacteria 91473
252 Ga0207644_10000327 3300025931 Bacteria 30858
253 Ga0207644_10019022 3300025931 Bacteria 4656
254 Ga0207644_10135939 3300025931 Bacteria 1887
255 Ga0207690_10003688 3300025932 Bacteria 9113
256 Ga0207690_10056969 3300025932 Bacteria 2639
257 Ga0207706_10003818 3300025933 Bacteria 14362
258 Ga0207706_10109535 3300025933 Bacteria 2430
259 Ga0207686_10100089 3300025934 Bacteria 1933
260 Ga0207670_10095231 3300025936 Bacteria 2114
261 Ga0207665_10069002 3300025939 Bacteria 2409
262 Ga0207711_10002900 3300025941 Bacteria 15023
263 Ga0207711_10011668 3300025941 Bacteria 7300
264 Ga0207711_10159687 3300025941 Bacteria 2039
265 Ga0207711_10176355 3300025941 Bacteria 1942
266 Ga0207679_10023064 3300025945 Bacteria 4249
267 Ga0207679_10143572 3300025945 Bacteria 1933
268 Ga0207679_10146155 3300025945 Bacteria 1918
269 Ga0207667_10001114 3300025949 Bacteria 33871
270 Ga0207667_10176845 3300025949 Bacteria 2192
271 Ga0207667_10181945 3300025949 Bacteria 2158
272 Ga0207667_10205597 3300025949 Bacteria 2019
273 Ga0207712_10074955 3300025961 Bacteria 2444
274 Ga0207668_10301368 3300025972 Bacteria 1323
275 Ga0207640_10010814 3300025981 Bacteria 5151
276 Ga0207640_10161344 3300025981 Bacteria 1659
277 Ga0207658_10000359 3300025986 Bacteria 44920
278 Ga0207658_10008019 3300025986 Bacteria 7194
279 Ga0207658_10016310 3300025986 Bacteria 5109
280 Ga0207658_10017616 3300025986 Bacteria 4925
281 Ga0207658_10252926 3300025986 Bacteria 1498
282 Ga0207703_10004091 3300026035 Bacteria 12030
283 Ga0207703_10017501 3300026035 Bacteria 5593
284 Ga0207703_10035845 3300026035 Bacteria 3945
285 Ga0207703_10060315 3300026035 Bacteria 3102
286 Ga0207639_10067320 3300026041 Bacteria 2786
287 Ga0207639_10292338 3300026041 Bacteria 1437
288 Ga0207678_10121781 3300026067 Bacteria 2226
289 Ga0207641_10000182 3300026088 Bacteria 87316
290 Ga0207641_10004589 3300026088 Bacteria 11931
291 Ga0207641_10004606 3300026088 Bacteria 11904
292 Ga0207641_10018961 3300026088 Bacteria 5644
293 Ga0207641_10051708 3300026088 Bacteria 3479
294 Ga0207676_10001834 3300026095 Bacteria 15561
295 Ga0207676_10006981 3300026095 Bacteria 8003
296 Ga0207676_10030235 3300026095 Bacteria 4063
297 Ga0207676_10093111 3300026095 Bacteria 2480
298 Ga0207674_10333943 3300026116 Bacteria 1466
299 Ga0207675_100217217 3300026118 Bacteria 1841
300 Ga0207683_10373898 3300026121 Bacteria 1309
301 Ga0207698_10252813 3300026142 Bacteria 1614
302 Ga0209983_1021833 3300027665 Bacteria 1340
303 Ga0209813_10000014 3300027866 Bacteria 87712
304 Ga0209974_10002253 3300027876 Bacteria 7016
305 Ga0268266_10002260 3300028379 Bacteria 20954
306 Ga0268266_10003129 3300028379 Bacteria 16835
307 Ga0268266_10072060 3300028379 Bacteria 2995
308 Ga0268265_10029030 3300028380 Bacteria 3966
309 Ga0268264_10000126 3300028381 Bacteria 186138
310 Ga0268264_10000228 3300028381 Bacteria 108722
311 Ga0268264_10008642 3300028381 Bacteria 8461
312 Ga0268264_10086744 3300028381 Bacteria 2690
313 Ga0268264_10144596 3300028381 Bacteria 2125
314 Ga0268264_10169872 3300028381 Bacteria 1971
315 Ga0265327_10021805 3300031251 Bacteria 3854
316 Ga0307513_10021142 3300031456 Bacteria 7688
317 Ga0307513_10363304 3300031456 Bacteria 1192
318 Ga0307408_100038304 3300031548 Bacteria 3382
319 Ga0307408_100210822 3300031548 Bacteria 1579
320 Ga0265314_10071008 3300031711 Bacteria 2331
321 Ga0307405_10059522 3300031731 Bacteria 2407
322 Ga0307413_10002717 3300031824 Bacteria 7258
323 Ga0307413_10027374 3300031824 Bacteria 3158
324 Ga0307413_10080056 3300031824 Bacteria 2090
325 Ga0307413_10201270 3300031824 Bacteria 1438
326 Ga0307410_10013851 3300031852 Bacteria 4721
327 Ga0307410_10069597 3300031852 Bacteria 2435
328 Ga0307406_10002460 3300031901 Bacteria 10086
329 Ga0307406_10067956 3300031901 Bacteria 2325
330 Ga0307406_10104692 3300031901 Bacteria 1935
331 Ga0307406_10193563 3300031901 Bacteria 1491
332 Ga0307412_10001006 3300031911 Bacteria 16124
333 Ga0307412_10003087 3300031911 Bacteria 9240
334 Ga0307412_10005482 3300031911 Bacteria 7125
335 Ga0307412_10006239 3300031911 Bacteria 6729
336 Ga0307412_10008763 3300031911 Bacteria 5790
337 Ga0307412_10013499 3300031911 Bacteria 4792
338 Ga0307412_10122392 3300031911 Bacteria 1875
339 Ga0307409_100003480 3300031995 Bacteria 8560
340 Ga0307409_100042233 3300031995 Bacteria 3413
341 Ga0307409_100050221 3300031995 Bacteria 3184
342 Ga0307409_100122051 3300031995 Bacteria 2209
343 Ga0307416_100009876 3300032002 Bacteria 6276
344 Ga0307416_100119210 3300032002 Bacteria 2347
345 Ga0307416_100284140 3300032002 Bacteria 1633
346 Ga0307414_10000212 3300032004 Bacteria 38895
347 Ga0307414_10000463 3300032004 Bacteria 21300
348 Ga0307414_10000704 3300032004 Bacteria 17134
349 Ga0307414_10013269 3300032004 Bacteria 4902
350 Ga0307414_10039212 3300032004 Bacteria 3189
351 Ga0307414_10041487 3300032004 Bacteria 3118
352 Ga0307414_10053962 3300032004 Bacteria 2806
353 Ga0307414_10189068 3300032004 Bacteria 1664
354 Ga0307414_10220676 3300032004 Bacteria 1556
355 Ga0307414_10414689 3300032004 Bacteria 1173
356 Ga0307411_10010239 3300032005 Bacteria 4985
357 Ga0307411_10011224 3300032005 Bacteria 4822
358 Ga0307411_10432026 3300032005 Bacteria 1097
359 Ga0307415_100037173 3300032126 Bacteria 3198
360 Ga0307415_100056249 3300032126 Bacteria 2696
361 Ga0307415_100142495 3300032126 Bacteria 1833
362 Ga0307510_10000248 3300033180 Bacteria 48764
363 Ga0307510_10183926 3300033180 Bacteria 1648
364 Ga0395899_0028519 3300037312 Bacteria 4203
365 Ga0395899_0043223 3300037312 Bacteria 3362
366 Ga0395899_0084496 3300037312 Bacteria 2307
367 Ga0395900_0000731 3300037418 Bacteria 43691
368 Ga0395900_0011469 3300037418 Bacteria 9071
369 Ga0395900_0069109 3300037418 Bacteria 3630
370 Ga0395900_0076589 3300037418 Bacteria 3437
371 Ga0395900_0102837 3300037418 Bacteria 2935
372 Ga0395900_0237892 3300037418 Bacteria 1828
373 Ga0395898_0081109 3300037466 Bacteria 3128
374 Ga0395898_0102815 3300037466 Bacteria 2742
375 Ga0395905_0000383 3300037471 Bacteria 63049
376 Ga0395905_0001767 3300037471 Bacteria 25119
377 Ga0395905_0008418 3300037471 Bacteria 10172
378 Ga0395905_0030404 3300037471 Bacteria 5088
379 Ga0395905_0042471 3300037471 Bacteria 4267
380 Ga0395905_0092502 3300037471 Bacteria 2836
381 Ga0395905_0136742 3300037471 Bacteria 2305
382 Ga0395905_0372652 3300037471 Bacteria 1321
383 Ga0436364_0762641 3300037853 Bacteria 4483
384 Ga0395901_0000677 3300038443 Bacteria 39201
385 Ga0395901_0009378 3300038443 Bacteria 9929
386 Ga0395901_0019875 3300038443 Bacteria 6871
387 Ga0395901_0034177 3300038443 Bacteria 5250
388 Ga0395901_0189112 3300038443 Bacteria 2159
389 Ga0436365_0062931 3300039437 Bacteria 52276
390 Ga0436365_1930349 3300039437 Bacteria 1877
391 Ga0436360_1073470 3300039438 Bacteria 1198
392 Ga0436361_0104300 3300039447 Bacteria 1850
393 Ga0436361_0948160 3300039447 Bacteria 2283
394 Ga0436363_0952301 3300039450 Bacteria 1863
395 Ga0436363_1380449 3300039450 Bacteria 2250
396 Ga0436362_1100432 3300039453 Bacteria 3053
397 Ga0439439_0015276 3300041406 Bacteria 1873
398 Ga0439465_0001389 3300041413 Bacteria 7815
399 Ga0439431_0029890 3300041997 Bacteria 1347
400 Ga0439443_009042 3300042003 Bacteria 1420
401 Ga0439462_0000040 3300042015 Bacteria 18378
402 Ga0450912_000279 3300042116 Bacteria 2298
403 Ga0450890_002346 3300042127 Bacteria 2612
404 Ga0450905_001489 3300042142 Bacteria 2984
405 Ga0450889_000118 3300042144 Bacteria 7702
406 Ga0439458_0039404 3300042157 Bacteria 1143
407 Ga0450916_014631 3300042530 Bacteria 1024
408 Ga0451577_0563933 3300042876 Bacteria 1034
409 Ga0466969_0048896 3300044656 Bacteria 2089
410 Ga0466966_0050738 3300044684 Bacteria 2638
411 Ga0466966_0058910 3300044684 Bacteria 2426
412 Ga0466961_0060231 3300044693 Bacteria 2414
413 Ga0466963_0036969 3300044694 Bacteria 3187
414 Ga0466964_0016713 3300044706 Bacteria 2803
415 Ga0453684_0095603 3300044712 Bacteria 3651
416 Ga0466968_0037641 3300044735 Bacteria 2030
417 Ga0466960_0009474 3300044901 Bacteria 4015
418 Ga0466959_0097897 3300045049 Bacteria 2101
419 Ga0466959_0161958 3300045049 Bacteria 1572
420 Ga0451576_0000165 3300045051 Bacteria 168085
421 Ga0466967_0152540 3300045976 Bacteria 2161
422 Ga0466967_0173868 3300045976 Bacteria 2028
423 Ga0495617_009535 3300046452 Bacteria 3334
424 Ga0495627_000343 3300046453 Bacteria 43819
425 Ga0495627_000758 3300046453 Bacteria 24030
426 Ga0495627_000866 3300046453 Bacteria 21479
427 Ga0495638_0071013 3300046460 Bacteria 2130
428 Ga0495638_0161132 3300046460 Bacteria 1294
429 Ga0495650_0001475 3300046471 Bacteria 22567
430 Ga0495585_0015400 3300046492 Bacteria 4445
431 Ga0495585_0046074 3300046492 Bacteria 2433
432 Ga0495596_0000008 3300046500 Bacteria 150860
433 Ga0495596_0000327 3300046500 Bacteria 31040
434 Ga0495583_0006140 3300046506 Bacteria 7920
435 Ga0495583_0012582 3300046506 Bacteria 4778
436 Ga0495606_0004417 3300046507 Bacteria 14070
437 Ga0495606_0063080 3300046507 Bacteria 2363
438 Ga0495610_0000033 3300046512 Bacteria 204151
439 Ga0495610_0000102 3300046512 Bacteria 98985
440 Ga0495610_0003683 3300046512 Bacteria 11767
441 Ga0495610_0030999 3300046512 Bacteria 2794
442 Ga0495610_0042164 3300046512 Bacteria 2285
443 Ga0495620_0003606 3300046515 Bacteria 8843
444 Ga0495620_0004429 3300046515 Bacteria 7921
445 Ga0495632_0000013 3300046519 Bacteria 247879
446 Ga0495632_0000309 3300046519 Bacteria 47211
447 Ga0495632_0019364 3300046519 Bacteria 3710
448 Ga0495632_0030860 3300046519 Bacteria 2777
449 Ga0495637_0000336 3300046520 Bacteria 36345
450 Ga0495643_0000010 3300046522 Bacteria 341431
451 Ga0495643_0036528 3300046522 Bacteria 2698
452 Ga0495648_0001966 3300046524 Bacteria 19538
453 Ga0495648_0115966 3300046524 Bacteria 1448
454 Ga0495663_0000004 3300046525 Bacteria 355166
455 Ga0495663_0001279 3300046525 Bacteria 7996
456 Ga0495663_0076834 3300046525 Bacteria 1070
457 Ga0495663_0081609 3300046525 Bacteria 1042
458 Ga0495642_0020513 3300046528 Bacteria 2596
459 Ga0495654_0000338 3300046530 Bacteria 40946
460 Ga0495654_0013829 3300046530 Bacteria 4308
461 Ga0495598_0000389 3300046537 Bacteria 7879
462 Ga0495609_0001350 3300046538 Bacteria 16547
463 Ga0495621_0000046 3300046539 Bacteria 24616
464 Ga0495621_0000155 3300046539 Bacteria 15073
465 Ga0495622_0004163 3300046557 Bacteria 6749
466 Ga0495633_0000092 3300046558 Bacteria 121446
467 Ga0495633_0001239 3300046558 Bacteria 20410
468 Ga0495633_0036004 3300046558 Bacteria 2373
469 Ga0495633_0040131 3300046558 Bacteria 2232
470 Ga0495633_0040597 3300046558 Bacteria 2216
471 Ga0495633_0041511 3300046558 Bacteria 2187
472 Ga0495668_0000234 3300046616 Bacteria 79147
473 Ga0495668_0034103 3300046616 Bacteria 2857
474 Ga0495668_0067204 3300046616 Bacteria 1972
475 Ga0495668_0101325 3300046616 Bacteria 1575
476 Ga0495625_0000195 3300046660 Bacteria 96493
477 Ga0495625_0003997 3300046660 Bacteria 14120
478 Ga0495625_0089771 3300046660 Bacteria 2127
479 Ga0495625_0116751 3300046660 Bacteria 1820
480 Ga0495625_0234944 3300046660 Bacteria 1196
481 Ga0495661_0057940 3300046665 Bacteria 2310
482 Ga0495661_0099521 3300046665 Bacteria 1639
483 Ga0495669_0001507 3300046684 Bacteria 9603
484 Ga0495669_0012075 3300046684 Bacteria 3671
485 Ga0495670_0001100 3300046691 Bacteria 13127
486 Ga0495670_0001709 3300046691 Bacteria 10800
487 Ga0495671_0000014 3300046692 Bacteria 341431
488 Ga0495649_0000048 3300046694 Bacteria 118180
489 Ga0495672_0038836 3300047320 Bacteria 2900
490 Ga0495677_0000666 3300047445 Bacteria 13874
491 Ga0495677_0002552 3300047445 Bacteria 7121
492 Ga0495677_0017188 3300047445 Bacteria 2622
493 Ga0495673_0015339 3300047469 Bacteria 3950
494 Ga0495673_0015686 3300047469 Bacteria 3897
495 Ga0495681_0000046 3300047470 Bacteria 111547
496 Ga0495681_0000822 3300047470 Bacteria 23924
497 Ga0495681_0001754 3300047470 Bacteria 15983
498 Ga0495686_0000074 3300047472 Bacteria 208094
499 Ga0495686_0000209 3300047472 Bacteria 108972
500 Ga0495686_0000300 3300047472 Bacteria 85146
501 Ga0495615_0000232 3300048090 Bacteria 11661
502 Ga0496100_0291857 3300048903 Bacteria 1218
503 Ga0496101_0073764 3300048904 Bacteria 2507
504 Ga0496102_0000372 3300048905 Bacteria 53776
505 Ga0496102_0166786 3300048905 Bacteria 2072
506 Ga0496102_0224540 3300048905 Bacteria 1771
507 Ga0496103_0000021 3300048906 Bacteria 229062
508 Ga0496103_0018538 3300048906 Bacteria 4175
509 Ga0496104_0000128 3300048907 Bacteria 70094
510 Ga0496104_0016430 3300048907 Bacteria 6723
511 Ga0496105_0000064 3300048908 Bacteria 83935
512 Ga0496105_0002811 3300048908 Bacteria 12727
513 Ga0496105_0103444 3300048908 Bacteria 2352
514 Ga0496106_0005351 3300048909 Bacteria 9498
515 Ga0496107_0016462 3300048910 Bacteria 5193
516 Ga0496107_0046884 3300048910 Bacteria 3111
517 Ga0496108_0013648 3300048911 Bacteria 6632
518 Ga0496109_0012198 3300048912 Bacteria 7413
519 Ga0496110_0069594 3300048913 Bacteria 3117
520 Ga0496110_0183383 3300048913 Bacteria 1900
521 Ga0496111_0021321 3300048914 Bacteria 4523
522 Ga0496112_0011063 3300048915 Bacteria 8223
523 Ga0496112_0024945 3300048915 Bacteria 5736
524 Ga0496112_0087781 3300048915 Bacteria 3077
525 Ga0496113_0000044 3300048916 Bacteria 51909
526 Ga0496113_0001381 3300048916 Bacteria 13469
527 Ga0496113_0001779 3300048916 Bacteria 12227
528 Ga0496114_0010243 3300048917 Bacteria 7460
529 Ga0496115_0062107 3300048918 Bacteria 3013
530 Ga0496116_0000311 3300048919 Bacteria 81431
531 Ga0496116_0011397 3300048919 Bacteria 7365
532 Ga0496116_0036796 3300048919 Bacteria 3420
533 Ga0496117_0001310 3300048920 Bacteria 36602
534 Ga0496117_0034689 3300048920 Bacteria 3798
535 Ga0496117_0072197 3300048920 Bacteria 2309
536 Ga0496118_0003241 3300048921 Bacteria 20752
537 Ga0496118_0039534 3300048921 Bacteria 3762
538 Ga0496118_0057392 3300048921 Bacteria 2918
539 Ga0496119_0000077 3300048922 Bacteria 143108
540 Ga0496119_0061470 3300048922 Bacteria 2243
541 Ga0496120_0001955 3300048923 Bacteria 22562
542 Ga0496120_0009136 3300048923 Bacteria 7069
543 Ga0496120_0108118 3300048923 Bacteria 1457
544 Ga0496121_0000070 3300048924 Bacteria 249187
545 Ga0496121_0000163 3300048924 Bacteria 145648
546 Ga0496121_0000579 3300048924 Bacteria 68757
547 Ga0496121_0001761 3300048924 Bacteria 35249
548 Ga0496121_0004878 3300048924 Bacteria 17616
549 Ga0496121_0044311 3300048924 Bacteria 3839
550 Ga0496122_0001376 3300048925 Bacteria 39555
551 Ga0496122_0004055 3300048925 Bacteria 18593
552 Ga0496122_0008233 3300048925 Bacteria 11319
553 Ga0496122_0047242 3300048925 Bacteria 3325
554 Ga0496123_0000159 3300048926 Bacteria 136014
555 Ga0496123_0001103 3300048926 Bacteria 40498
556 Ga0496123_0007702 3300048926 Bacteria 10058
557 Ga0496123_0014924 3300048926 Bacteria 6404
558 Ga0496123_0038354 3300048926 Bacteria 3369
559 Ga0496124_0001269 3300048927 Bacteria 38422
560 Ga0496124_0002565 3300048927 Bacteria 23554
561 Ga0496124_0004409 3300048927 Bacteria 16420
562 Ga0496124_0006112 3300048927 Bacteria 13232
563 Ga0496124_0098161 3300048927 Bacteria 2377
564 Ga0496125_0001135 3300048928 Bacteria 40511
565 Ga0496125_0023808 3300048928 Bacteria 5644
566 Ga0496125_0028226 3300048928 Bacteria 5074
567 Ga0496125_0031544 3300048928 Bacteria 4721
568 Ga0496125_0039372 3300048928 Bacteria 4072
569 Ga0496125_0220746 3300048928 Bacteria 1222
570 Ga0496126_0000077 3300048929 Bacteria 231592
571 Ga0496126_0000175 3300048929 Bacteria 146389
572 Ga0496126_0008934 3300048929 Bacteria 10730
573 Ga0496126_0091122 3300048929 Bacteria 2681
574 Ga0496126_0422819 3300048929 Bacteria 1077
575 Ga0501031_0011757 3300049568 Bacteria 5710
576 Ga0501031_0040798 3300049568 Bacteria 3030
577 Ga0501032_0001597 3300049569 Bacteria 18067
578 Ga0501033_0001163 3300049570 Bacteria 23809
579 Ga0501034_0014162 3300049571 Bacteria 8220
580 Ga0501034_0025872 3300049571 Bacteria 5976
581 Ga0501034_0092581 3300049571 Bacteria 3020
582 Ga0501034_0155601 3300049571 Bacteria 2260
583 Ga0501036_0003242 3300049572 Bacteria 12968
584 Ga0501036_0008683 3300049572 Bacteria 8337
585 Ga0501037_0001626 3300049573 Bacteria 16328
586 Ga0501037_0041271 3300049573 Bacteria 3393
587 Ga0501038_0000515 3300049574 Bacteria 33962
588 Ga0501038_0067296 3300049574 Bacteria 3048
589 Ga0501039_0011288 3300049575 Bacteria 6806
590 Ga0501039_0110356 3300049575 Bacteria 2150
591 Ga0501043_0009654 3300049579 Bacteria 7564
592 Ga0501043_0104281 3300049579 Bacteria 2228
593 Ga0501047_0001382 3300049581 Bacteria 23829
594 Ga0501047_0055898 3300049581 Bacteria 3816
595 Ga0501047_0056089 3300049581 Bacteria 3809
596 Ga0501047_0533600 3300049581 Bacteria 999
597 Ga0501223_000111 3300049663 Bacteria 23444
598 Ga0501224_000024 3300049664 Bacteria 61321
599 Ga0501233_000668 3300049668 Bacteria 5622
600 Ga0501225_0000017 3300049705 Bacteria 61517
601 Ga0501225_0006380 3300049705 Bacteria 3442
602 Ga0501234_001620 3300049707 Bacteria 3518
603 Ga0501035_0002229 3300049822 Bacteria 19222
604 Ga0501035_0031345 3300049822 Bacteria 4842
605 Ga0501044_0001187 3300049823 Bacteria 30876
606 Ga0501044_0003356 3300049823 Bacteria 18054
607 Ga0501044_0018017 3300049823 Bacteria 7572
608 Ga0501044_0148934 3300049823 Bacteria 2323
609 Ga0501045_0031297 3300049824 Bacteria 3854
610 Ga0501226_000072 3300049853 Bacteria 31259
611 nmdc:mga03683_1556_c1 3300050489 Bacteria 6842
612 nmdc:mga03683_2_c1 3300050489 Bacteria 289140
613 nmdc:mga03n38_1398_c1 3300050490 Bacteria 6870
614 nmdc:mga0k408_2794_c1 3300050493 Bacteria 9273
615 nmdc:mga06z11_139_c1 3300050494 Bacteria 28685
616 nmdc:mga06z11_47_c1 3300050494 Bacteria 51206
617 nmdc:mga04h51_18_c1 3300050495 Bacteria 74460
618 nmdc:mga04h51_457_c1 3300050495 Bacteria 9829
619 nmdc:mga07m45_29_c1 3300050496 Bacteria 85597
620 nmdc:mga08y16_44274_c1 3300050511 Bacteria 4663
621 nmdc:mga0sz30_1416_c1 3300050516 Bacteria 7429
622 nmdc:mga0sz30_23210_c1 3300050516 Bacteria 2522
623 nmdc:mga0sz30_25665_c1 3300050516 Bacteria 2410
624 Ga0500643_001548 3300053087 Bacteria 13030
625 Ga0500643_001703 3300053087 Bacteria 12216
626 Ga0500643_048207 3300053087 Bacteria 1226
627 Ga0500644_0004795 3300053088 Bacteria 3397
628 Ga0500646_0030201 3300053090 Bacteria 1486
629 Ga0500641_0002791 3300053096 Bacteria 6185
630 Ga0500592_006826 3300053116 Bacteria 1817
631 Ga0500594_0002629 3300053118 Bacteria 3902
632 Ga0500595_001869 3300053119 Bacteria 10863
633 Ga0500607_000009 3300053121 Bacteria 125590
634 Ga0500607_000183 3300053121 Bacteria 55765
635 Ga0500608_000156 3300053122 Bacteria 28195
636 Ga0500614_018666 3300053123 Bacteria 1580
637 Ga0500618_005438 3300053125 Bacteria 3874
638 Ga0500652_119345 3300053131 Bacteria 1102
639 Ga0500559_0000831 3300053136 Bacteria 20004
640 Ga0500559_0005849 3300053136 Bacteria 5607
641 Ga0500559_0026122 3300053136 Bacteria 2486
642 Ga0500564_000699 3300053138 Bacteria 10473
643 Ga0500568_0002081 3300053139 Bacteria 12128
644 Ga0500577_0029757 3300053142 Bacteria 1894
645 Ga0500590_018774 3300053148 Bacteria 3581
646 Ga0500604_0000583 3300053151 Bacteria 10047
647 Ga0500622_0014826 3300053156 Bacteria 4178
648 Ga0500622_0032680 3300053156 Bacteria 2728
649 Ga0500624_000005 3300053157 Bacteria 187122
650 Ga0500627_0000070 3300053158 Bacteria 41863
651 Ga0500630_065682 3300053159 Bacteria 1726
652 Ga0500637_0000610 3300053178 Bacteria 14099
653 Ga0500567_043247 3300053723 Bacteria 2091
654 Ga0500625_000021 3300053729 Bacteria 83503
655 Ga0500645_001022 3300053730 Bacteria 15681
656 Ga0500645_007475 3300053730 Bacteria 3802

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0063080 Ga0495606_0063080_1448_2233 243
2 3300042530 Ga0450916_014631 Ga0450916_014631_222_1013 247
3 3300042876 Ga0451577_0563933 Ga0451577_0563933_205_996 247
4 3300039438 Ga0436360_1073470 Ga0436360_1073470_349_1167 252
5 3300025901 Ga0207688_10312704 Ga0207688_103127041 257
6 3300042157 Ga0439458_0039404 Ga0439458_0039404_110_937 259
7 3300053158 Ga0500627_0000070 Ga0500627_0000070_40479_41474 263
8 3300031911 Ga0307412_10008763 Ga0307412_100087635 264
9 3300049581 Ga0501047_0533600 Ga0501047_0533600_53_964 265
10 3300053087 Ga0500643_048207 Ga0500643_048207_353_1201 265
11 3300046558 Ga0495633_0041511 Ga0495633_0041511_1030_2001 270
12 3300005434 Ga0070709_10009356 Ga0070709_100093564 272
13 3300005435 Ga0070714_100003701 Ga0070714_1000037014 272
14 3300005437 Ga0070710_10000958 Ga0070710_100009587 272
15 3300006175 Ga0070712_100008055 Ga0070712_1000080554 272
16 3300025898 Ga0207692_10003524 Ga0207692_100035243 272
17 3300025906 Ga0207699_10001263 Ga0207699_100012635 272
18 3300025915 Ga0207693_10000563 Ga0207693_1000056328 272
19 3300025929 Ga0207664_10017649 Ga0207664_100176494 272
20 3300003781 Ga0055536_1000358 Ga0055536_100035815 273
21 3300025292 Ga0209676_1000084 Ga0209676_1000084161 273
22 3300025298 Ga0209050_1017377 Ga0209050_10173773 273
23 3300006946 Ga0079104_1020607 Ga0079104_10206072 275
24 3300014325 Ga0163163_10251818 Ga0163163_102518181 275
25 3300020081 Ga0206354_10564923 Ga0206354_105649232 276
26 3300020082 Ga0206353_10226904 Ga0206353_102269047 276
27 3300025923 Ga0207681_10161455 Ga0207681_101614552 277
28 3300025922 Ga0207646_10280474 Ga0207646_102804742 278
29 3300046557 Ga0495622_0004163 Ga0495622_0004163_3594_4580 278
30 3300003794 Ga0055531_10003200 Ga0055531_100032001 279
31 3300025304 Ga0209257_1000330 Ga0209257_100033039 279
32 3300025298 Ga0209050_1001889 Ga0209050_100188917 281
33 3300032004 Ga0307414_10039212 Ga0307414_100392123 281
34 3300046660 Ga0495625_0000195 Ga0495625_0000195_54633_55625 281
35 3300003781 Ga0055536_1004888 Ga0055536_10048884 282
36 3300006042 Ga0075368_10008957 Ga0075368_100089572 282
37 3300006178 Ga0075367_10012146 Ga0075367_100121462 282
38 3300025292 Ga0209676_1000729 Ga0209676_10007294 282
39 3300027866 Ga0209813_10000014 Ga0209813_1000001433 282
40 3300037466 Ga0395898_0081109 Ga0395898_0081109_1637_2692 282
41 3300048929 Ga0496126_0422819 Ga0496126_0422819_69_1064 282
42 3300050494 nmdc:mga06z11_47_c1 nmdc:mga06z11_47_c1_32238_33209 282
43 3300050495 nmdc:mga04h51_18_c1 nmdc:mga04h51_18_c1_917_1888 282
44 3300053139 Ga0500568_0002081 Ga0500568_0002081_5489_6499 283
45 3300053156 Ga0500622_0032680 Ga0500622_0032680_93_1094 284
46 3300025939 Ga0207665_10069002 Ga0207665_100690023 285
47 3300046507 Ga0495606_0004417 Ga0495606_0004417_9078_10064 285
48 3300049568 Ga0501031_0040798 Ga0501031_0040798_166_1158 285
49 3300049571 Ga0501034_0025872 Ga0501034_0025872_315_1307 285
50 3300049572 Ga0501036_0008683 Ga0501036_0008683_351_1343 285
51 3300049573 Ga0501037_0041271 Ga0501037_0041271_1711_2703 285
52 3300049575 Ga0501039_0110356 Ga0501039_0110356_425_1417 285
53 3300049581 Ga0501047_0055898 Ga0501047_0055898_1322_2314 285
54 3300049822 Ga0501035_0031345 Ga0501035_0031345_601_1593 285
55 3300049823 Ga0501044_0018017 Ga0501044_0018017_6190_7182 285
56 3300005937 Ga0081455_10000088 Ga0081455_1000008858 286
57 3300031456 Ga0307513_10363304 Ga0307513_103633041 286
58 3300002774 JGI25150J39212_1000189 JGI25150J39212_100018931 288
59 3300003215 JGI25153J46596_10000125 JGI25153J46596_1000012545 288
60 3300003781 Ga0055536_1027487 Ga0055536_10274872 288
61 3300003791 Ga0055530_10006284 Ga0055530_100062841 288
62 3300003791 Ga0055530_10008250 Ga0055530_100082506 288
63 3300003792 Ga0055540_1004110 Ga0055540_10041107 288
64 3300003794 Ga0055531_10014634 Ga0055531_100146341 288
65 3300003794 Ga0055531_10014636 Ga0055531_100146361 288
66 3300025245 Ga0207425_1000005 Ga0207425_1000005868 288
67 3300025258 Ga0209129_1000345 Ga0209129_100034531 288
68 3300025292 Ga0209676_1005902 Ga0209676_10059025 288
69 3300025292 Ga0209676_1007451 Ga0209676_10074516 288
70 3300025294 Ga0209025_1000855 Ga0209025_100085521 288
71 3300025297 Ga0209758_1000002 Ga0209758_1000002477 288
72 3300025298 Ga0209050_1000001 Ga0209050_1000001429 288
73 3300025303 Ga0209051_1000297 Ga0209051_10002975 288
74 3300025304 Ga0209257_1002675 Ga0209257_10026756 288
75 3300025304 Ga0209257_1002709 Ga0209257_10027096 288
76 3300050516 nmdc:mga0sz30_25665_c1 nmdc:mga0sz30_25665_c1_932_1942 288
77 3300009551 Ga0105238_10029528 Ga0105238_100295286 289
78 3300025924 Ga0207694_10057217 Ga0207694_100572174 289
79 3300032126 Ga0307415_100037173 Ga0307415_1000371732 289
80 3300053116 Ga0500592_006826 Ga0500592_006826_749_1741 289
81 3300053178 Ga0500637_0000610 Ga0500637_0000610_1470_2492 289
82 3300003781 Ga0055536_1000785 Ga0055536_100078515 290
83 3300003791 Ga0055530_10000054 Ga0055530_1000005432 290
84 3300003794 Ga0055531_10000492 Ga0055531_1000049235 290
85 3300003794 Ga0055531_10002269 Ga0055531_100022691 290
86 3300009011 Ga0105251_10011293 Ga0105251_100112932 290
87 3300009553 Ga0105249_10017211 Ga0105249_100172113 290
88 3300017792 Ga0163161_10056425 Ga0163161_100564252 290
89 3300025291 Ga0209675_1000131 Ga0209675_100013179 290
90 3300025292 Ga0209676_1000746 Ga0209676_100074623 290
91 3300025294 Ga0209025_1006315 Ga0209025_10063152 290
92 3300025298 Ga0209050_1000113 Ga0209050_100011340 290
93 3300025304 Ga0209257_1000083 Ga0209257_100008349 290
94 3300025304 Ga0209257_1000126 Ga0209257_100012623 290
95 3300025961 Ga0207712_10074955 Ga0207712_100749552 290
96 3300032004 Ga0307414_10000212 Ga0307414_1000021231 290
97 3300048926 Ga0496123_0007702 Ga0496123_0007702_1128_2099 290
98 3300048927 Ga0496124_0006112 Ga0496124_0006112_5696_6667 290
99 iso_pu_bacteria 2895880812 2895885857 290
100 3300003794 Ga0055531_10043756 Ga0055531_100437562 291
101 3300025292 Ga0209676_1024915 Ga0209676_10249152 291
102 3300025304 Ga0209257_1011185 Ga0209257_10111851 291
103 3300044735 Ga0466968_0037641 Ga0466968_0037641_898_1878 292
104 3300046616 Ga0495668_0000234 Ga0495668_0000234_48946_49938 292
105 3300049823 Ga0501044_0148934 Ga0501044_0148934_1246_2238 292
106 3300009094 Ga0111539_10166398 Ga0111539_101663982 294
107 3300038443 Ga0395901_0189112 Ga0395901_0189112_305_1360 294
108 3300039453 Ga0436362_1100432 Ga0436362_1100432_1503_2450 294
109 3300042003 Ga0439443_009042 Ga0439443_009042_41_976 294
110 3300044712 Ga0453684_0095603 Ga0453684_0095603_1458_2480 294
111 3300048905 Ga0496102_0224540 Ga0496102_0224540_761_1738 294
112 3300049568 Ga0501031_0011757 Ga0501031_0011757_1786_2718 294
113 3300049569 Ga0501032_0001597 Ga0501032_0001597_16792_17724 294
114 3300049570 Ga0501033_0001163 Ga0501033_0001163_6122_7054 294
115 3300049571 Ga0501034_0155601 Ga0501034_0155601_345_1277 294
116 3300049572 Ga0501036_0003242 Ga0501036_0003242_11846_12778 294
117 3300049573 Ga0501037_0001626 Ga0501037_0001626_4229_5161 294
118 3300049574 Ga0501038_0000515 Ga0501038_0000515_32695_33627 294
119 3300049575 Ga0501039_0011288 Ga0501039_0011288_5556_6488 294
120 3300049579 Ga0501043_0009654 Ga0501043_0009654_327_1259 294
121 3300049581 Ga0501047_0001382 Ga0501047_0001382_16776_17708 294
122 3300049822 Ga0501035_0002229 Ga0501035_0002229_16770_17702 294
123 3300049823 Ga0501044_0003356 Ga0501044_0003356_16777_17709 294
124 3300049824 Ga0501045_0031297 Ga0501045_0031297_2752_3684 294
125 3300005367 Ga0070667_100003111 Ga0070667_10000311112 295
126 3300005548 Ga0070665_100042179 Ga0070665_1000421794 295
127 3300005618 Ga0068864_100014967 Ga0068864_1000149674 295
128 3300005842 Ga0068858_100017428 Ga0068858_1000174286 295
129 3300005843 Ga0068860_100000108 Ga0068860_10000010892 295
130 3300009177 Ga0105248_10201351 Ga0105248_102013512 295
131 3300009177 Ga0105248_10211680 Ga0105248_102116802 295
132 3300025972 Ga0207668_10301368 Ga0207668_103013682 295
133 3300025986 Ga0207658_10017616 Ga0207658_100176162 295
134 3300026035 Ga0207703_10035845 Ga0207703_100358452 295
135 3300026095 Ga0207676_10030235 Ga0207676_100302353 295
136 3300028379 Ga0268266_10002260 Ga0268266_100022604 295
137 3300028381 Ga0268264_10000126 Ga0268264_1000012692 295
138 3300048907 Ga0496104_0016430 Ga0496104_0016430_1309_2313 295
139 3300048908 Ga0496105_0002811 Ga0496105_0002811_7008_8012 295
140 3300031711 Ga0265314_10071008 Ga0265314_100710082 296
141 3300053087 Ga0500643_001548 Ga0500643_001548_667_1656 296
142 iso_pu_bacteria 2510917021 2511129171 296
143 3300006844 Ga0075428_100120369 Ga0075428_1001203692 297
144 3300009177 Ga0105248_10107466 Ga0105248_101074665 297
145 3300048927 Ga0496124_0004409 Ga0496124_0004409_11322_12326 297
146 3300048924 Ga0496121_0000579 Ga0496121_0000579_62480_63484 298
147 3300049579 Ga0501043_0104281 Ga0501043_0104281_1096_2073 298
148 3300021388 Ga0213875_10000636 Ga0213875_100006369 299
149 3300037853 Ga0436364_0762641 Ga0436364_0762641_1257_2237 299
150 3300047469 Ga0495673_0015686 Ga0495673_0015686_1430_2407 299
151 3300053122 Ga0500608_000156 Ga0500608_000156_709_1707 299
152 3300053123 Ga0500614_018666 Ga0500614_018666_428_1426 299
153 3300053136 Ga0500559_0026122 Ga0500559_0026122_638_1636 299
154 3300053138 Ga0500564_000699 Ga0500564_000699_8395_9393 299
155 3300053159 Ga0500630_065682 Ga0500630_065682_229_1227 299
156 3300053723 Ga0500567_043247 Ga0500567_043247_128_1126 299
157 3300053729 Ga0500625_000021 Ga0500625_000021_77107_78105 299
158 3300003791 Ga0055530_10016343 Ga0055530_100163432 300
159 3300005353 Ga0070669_100027094 Ga0070669_1000270942 300
160 3300005354 Ga0070675_100095502 Ga0070675_1000955023 300
161 3300005435 Ga0070714_100000291 Ga0070714_1000002914 300
162 3300005841 Ga0068863_100000081 Ga0068863_10000008139 300
163 3300005844 Ga0068862_100048465 Ga0068862_1000484653 300
164 3300009176 Ga0105242_10089297 Ga0105242_100892972 300
165 3300025298 Ga0209050_1000127 Ga0209050_100012782 300
166 3300025929 Ga0207664_10000306 Ga0207664_1000030636 300
167 3300025934 Ga0207686_10100089 Ga0207686_101000892 300
168 3300031548 Ga0307408_100210822 Ga0307408_1002108222 300
169 3300031824 Ga0307413_10201270 Ga0307413_102012702 300
170 3300032004 Ga0307414_10414689 Ga0307414_104146892 300
171 3300044694 Ga0466963_0036969 Ga0466963_0036969_651_1631 300
172 3300001915 JGI24741J21665_1006549 JGI24741J21665_10065493 301
173 3300026088 Ga0207641_10000182 Ga0207641_1000018275 301
174 3300028380 Ga0268265_10029030 Ga0268265_100290302 301
175 3300041406 Ga0439439_0015276 Ga0439439_0015276_571_1548 301
176 3300041413 Ga0439465_0001389 Ga0439465_0001389_2189_3166 301
177 3300041997 Ga0439431_0029890 Ga0439431_0029890_312_1289 301
178 3300045051 Ga0451576_0000165 Ga0451576_0000165_70003_71004 301
179 3300048921 Ga0496118_0057392 Ga0496118_0057392_318_1313 301
180 3300053090 Ga0500646_0030201 Ga0500646_0030201_24_1004 301
181 3300053151 Ga0500604_0000583 Ga0500604_0000583_3520_4500 301
182 3300005327 Ga0070658_10090437 Ga0070658_100904372 302
183 3300005366 Ga0070659_100009534 Ga0070659_1000095342 302
184 3300025909 Ga0207705_10041008 Ga0207705_100410083 302
185 3300025949 Ga0207667_10176845 Ga0207667_101768452 302
186 3300044901 Ga0466960_0009474 Ga0466960_0009474_2545_3525 302
187 3300046616 Ga0495668_0034103 Ga0495668_0034103_1799_2788 302
188 3300046691 Ga0495670_0001709 Ga0495670_0001709_9074_10048 302
189 3300025932 Ga0207690_10056969 Ga0207690_100569693 303
190 iso_pu_bacteria 2775507255 2778125836 303
191 iso_pu_bacteria 2919709256 2919712997 303
192 iso_pu_bacteria 8057101203 8057105115 303
193 3300027665 Ga0209983_1021833 Ga0209983_10218332 304
194 3300046460 Ga0495638_0071013 Ga0495638_0071013_609_1586 304
195 3300047472 Ga0495686_0000300 Ga0495686_0000300_57449_58426 304
196 iso_pu_bacteria 2885429604 2885432232 304
197 3300005330 Ga0070690_100022933 Ga0070690_1000229332 305
198 3300005336 Ga0070680_100010757 Ga0070680_1000107572 305
199 3300005353 Ga0070669_100000799 Ga0070669_1000007991 305
200 3300005355 Ga0070671_100000003 Ga0070671_100000003183 305
201 3300005530 Ga0070679_100000001 Ga0070679_100000001270 305
202 3300005548 Ga0070665_100054556 Ga0070665_1000545564 305
203 3300005618 Ga0068864_100032103 Ga0068864_1000321035 305
204 3300005842 Ga0068858_100039905 Ga0068858_1000399053 305
205 3300005842 Ga0068858_100079107 Ga0068858_1000791072 305
206 3300005843 Ga0068860_100028825 Ga0068860_1000288252 305
207 3300013306 Ga0163162_10029740 Ga0163162_100297402 305
208 3300014325 Ga0163163_10168627 Ga0163163_101686272 305
209 3300025315 Ga0207697_10044592 Ga0207697_100445922 305
210 3300025912 Ga0207707_10022373 Ga0207707_100223734 305
211 3300025917 Ga0207660_10074130 Ga0207660_100741302 305
212 3300025921 Ga0207652_10000002 Ga0207652_10000002832 305
213 3300025923 Ga0207681_10000037 Ga0207681_1000003713 305
214 3300025931 Ga0207644_10000004 Ga0207644_10000004283 305
215 3300025941 Ga0207711_10159687 Ga0207711_101596872 305
216 3300025986 Ga0207658_10252926 Ga0207658_102529261 305
217 3300026035 Ga0207703_10060315 Ga0207703_100603153 305
218 3300026095 Ga0207676_10093111 Ga0207676_100931112 305
219 3300028379 Ga0268266_10072060 Ga0268266_100720603 305
220 3300028381 Ga0268264_10169872 Ga0268264_101698721 305
221 3300031911 Ga0307412_10006239 Ga0307412_100062395 305
222 3300032004 Ga0307414_10041487 Ga0307414_100414873 305
223 3300048903 Ga0496100_0291857 Ga0496100_0291857_41_1036 305
224 3300048904 Ga0496101_0073764 Ga0496101_0073764_1225_2220 305
225 3300048905 Ga0496102_0166786 Ga0496102_0166786_601_1596 305
226 3300048909 Ga0496106_0005351 Ga0496106_0005351_3453_4448 305
227 3300048910 Ga0496107_0016462 Ga0496107_0016462_3256_4251 305
228 3300048913 Ga0496110_0183383 Ga0496110_0183383_890_1885 305
229 3300048915 Ga0496112_0087781 Ga0496112_0087781_2005_3000 305
230 3300048916 Ga0496113_0001381 Ga0496113_0001381_8503_9498 305
231 3300048917 Ga0496114_0010243 Ga0496114_0010243_1066_2070 305
232 3300048920 Ga0496117_0034689 Ga0496117_0034689_2220_3197 305
233 3300048921 Ga0496118_0039534 Ga0496118_0039534_2154_3131 305
234 3300048923 Ga0496120_0009136 Ga0496120_0009136_724_1701 305
235 3300048923 Ga0496120_0108118 Ga0496120_0108118_265_1242 305
236 3300048924 Ga0496121_0044311 Ga0496121_0044311_699_1676 305
237 3300048925 Ga0496122_0047242 Ga0496122_0047242_2214_3191 305
238 3300048926 Ga0496123_0038354 Ga0496123_0038354_2011_2988 305
239 3300048928 Ga0496125_0028226 Ga0496125_0028226_812_1789 305
240 3300048929 Ga0496126_0008934 Ga0496126_0008934_4331_5335 305
241 iso_pu_bacteria 2599185354 2600203223 305
242 iso_pu_bacteria 2751185897 2753766750 305
243 iso_pu_bacteria 2928027323 2928029407 305
244 iso_pu_bacteria 2984555340 2984556604 305
245 iso_pu_bacteria 2984564862 2984565223 305
246 iso_pu_bacteria 2993356040 2993356299 305
247 3300005295 Ga0065707_10133605 Ga0065707_101336052 306
248 3300017792 Ga0163161_10013528 Ga0163161_100135282 306
249 3300025229 Ga0209147_102039 Ga0209147_1020395 306
250 3300039437 Ga0436365_1930349 Ga0436365_1930349_198_1178 306
251 3300046452 Ga0495617_009535 Ga0495617_009535_1871_2842 306
252 3300046453 Ga0495627_000343 Ga0495627_000343_37453_38424 306
253 3300046453 Ga0495627_000866 Ga0495627_000866_18793_19764 306
254 3300046512 Ga0495610_0000102 Ga0495610_0000102_36627_37598 306
255 3300046512 Ga0495610_0030999 Ga0495610_0030999_762_1733 306
256 3300046519 Ga0495632_0000013 Ga0495632_0000013_79208_80179 306
257 3300046519 Ga0495632_0030860 Ga0495632_0030860_1586_2557 306
258 3300046520 Ga0495637_0000336 Ga0495637_0000336_18236_19207 306
259 3300046522 Ga0495643_0000010 Ga0495643_0000010_217864_218835 306
260 3300046524 Ga0495648_0001966 Ga0495648_0001966_13035_14006 306
261 3300046525 Ga0495663_0000004 Ga0495663_0000004_186472_187443 306
262 3300046525 Ga0495663_0081609 Ga0495663_0081609_15_986 306
263 3300046558 Ga0495633_0000092 Ga0495633_0000092_59585_60556 306
264 3300046558 Ga0495633_0001239 Ga0495633_0001239_15971_16942 306
265 3300046558 Ga0495633_0040131 Ga0495633_0040131_756_1727 306
266 3300046558 Ga0495633_0040597 Ga0495633_0040597_891_1862 306
267 3300046660 Ga0495625_0089771 Ga0495625_0089771_391_1362 306
268 3300046665 Ga0495661_0057940 Ga0495661_0057940_608_1579 306
269 3300046692 Ga0495671_0000014 Ga0495671_0000014_217864_218835 306
270 3300047320 Ga0495672_0038836 Ga0495672_0038836_492_1463 306
271 3300047469 Ga0495673_0015339 Ga0495673_0015339_1547_2518 306
272 3300047470 Ga0495681_0000046 Ga0495681_0000046_88426_89397 306
273 3300047470 Ga0495681_0001754 Ga0495681_0001754_3452_4423 306
274 3300048928 Ga0496125_0220746 Ga0496125_0220746_222_1193 306
275 3300049705 Ga0501225_0006380 Ga0501225_0006380_2210_3181 306
276 3300053142 Ga0500577_0029757 Ga0500577_0029757_402_1376 306
277 3300053157 Ga0500624_000005 Ga0500624_000005_57903_58874 306
278 iso_pu_bacteria 2808606401 2809063356 306
279 iso_pu_bacteria 2808606404 2809079208 306
280 iso_pu_bacteria 2808606405 2809083418 306
281 iso_pu_bacteria 2880518877 2880520626 306
282 iso_pu_bacteria 2896253425 2896255805 306
283 3300005549 Ga0070704_100363138 Ga0070704_1003631382 307
284 3300013297 Ga0157378_10005257 Ga0157378_100052575 307
285 3300025936 Ga0207670_10095231 Ga0207670_100952314 307
286 3300039447 Ga0436361_0104300 Ga0436361_0104300_489_1475 307
287 3300039447 Ga0436361_0948160 Ga0436361_0948160_1235_2224 307
288 3300046530 Ga0495654_0000338 Ga0495654_0000338_9644_10618 307
289 3300048928 Ga0496125_0039372 Ga0496125_0039372_2491_3477 307
290 3300049574 Ga0501038_0067296 Ga0501038_0067296_1222_2196 307
291 3300053119 Ga0500595_001869 Ga0500595_001869_3253_4230 307
292 3300005327 Ga0070658_10000003 Ga0070658_10000003157 308
293 3300005339 Ga0070660_100000348 Ga0070660_10000034818 308
294 3300005344 Ga0070661_100000003 Ga0070661_100000003209 308
295 3300005435 Ga0070714_100013819 Ga0070714_1000138196 308
296 3300005436 Ga0070713_100042029 Ga0070713_1000420293 308
297 3300005618 Ga0068864_100017649 Ga0068864_1000176492 308
298 3300005842 Ga0068858_100000723 Ga0068858_10000072311 308
299 3300009177 Ga0105248_10065721 Ga0105248_100657215 308
300 3300013105 Ga0157369_10004697 Ga0157369_100046976 308
301 3300013306 Ga0163162_10014044 Ga0163162_100140444 308
302 3300017792 Ga0163161_10472333 Ga0163161_104723331 308
303 3300021384 Ga0213876_10000250 Ga0213876_1000025010 308
304 3300025909 Ga0207705_10000005 Ga0207705_10000005160 308
305 3300025919 Ga0207657_10003426 Ga0207657_1000342614 308
306 3300025920 Ga0207649_10000016 Ga0207649_10000016114 308
307 3300025929 Ga0207664_10077257 Ga0207664_100772572 308
308 3300025941 Ga0207711_10176355 Ga0207711_101763552 308
309 3300026035 Ga0207703_10004091 Ga0207703_1000409112 308
310 3300026095 Ga0207676_10001834 Ga0207676_100018349 308
311 3300026118 Ga0207675_100217217 Ga0207675_1002172172 308
312 3300031456 Ga0307513_10021142 Ga0307513_100211424 308
313 3300031852 Ga0307410_10069597 Ga0307410_100695973 308
314 3300031995 Ga0307409_100042233 Ga0307409_1000422333 308
315 3300033180 Ga0307510_10000248 Ga0307510_1000024823 308
316 3300039437 Ga0436365_0062931 Ga0436365_0062931_21055_22032 308
317 3300039450 Ga0436363_0952301 Ga0436363_0952301_352_1329 308
318 3300039450 Ga0436363_1380449 Ga0436363_1380449_1211_2188 308
319 3300046460 Ga0495638_0161132 Ga0495638_0161132_121_1098 308
320 3300046506 Ga0495583_0012582 Ga0495583_0012582_2213_3190 308
321 3300046522 Ga0495643_0036528 Ga0495643_0036528_508_1485 308
322 3300046524 Ga0495648_0115966 Ga0495648_0115966_292_1269 308
323 3300046616 Ga0495668_0101325 Ga0495668_0101325_247_1224 308
324 3300046660 Ga0495625_0116751 Ga0495625_0116751_626_1603 308
325 3300047445 Ga0495677_0017188 Ga0495677_0017188_577_1554 308
326 3300047472 Ga0495686_0000209 Ga0495686_0000209_93780_94757 308
327 3300048924 Ga0496121_0000163 Ga0496121_0000163_4558_5535 308
328 3300053087 Ga0500643_001703 Ga0500643_001703_6153_7130 308
329 3300053096 Ga0500641_0002791 Ga0500641_0002791_995_1972 308
330 3300053131 Ga0500652_119345 Ga0500652_119345_23_1000 308
331 iso_pu_bacteria 2512564014 2512645139 308
332 iso_pu_bacteria 2643221563 2643835116 308
333 iso_pu_bacteria 2643221608 2644056043 308
334 iso_pu_bacteria 2848297114 2848297598 308
335 3300001976 JGI24752J21851_1001195 JGI24752J21851_10011953 309
336 3300001990 JGI24737J22298_10003866 JGI24737J22298_100038666 309
337 3300001990 JGI24737J22298_10045823 JGI24737J22298_100458231 309
338 3300003781 Ga0055536_1001881 Ga0055536_10018813 309
339 3300003794 Ga0055531_10010446 Ga0055531_100104466 309
340 3300005329 Ga0070683_100095498 Ga0070683_1000954982 309
341 3300005331 Ga0070670_100057555 Ga0070670_1000575553 309
342 3300005333 Ga0070677_10001169 Ga0070677_100011693 309
343 3300005344 Ga0070661_100132126 Ga0070661_1001321262 309
344 3300005347 Ga0070668_100131383 Ga0070668_1001313831 309
345 3300005353 Ga0070669_100108800 Ga0070669_1001088002 309
346 3300005355 Ga0070671_100002229 Ga0070671_1000022294 309
347 3300005355 Ga0070671_100034930 Ga0070671_1000349303 309
348 3300005356 Ga0070674_100269432 Ga0070674_1002694322 309
349 3300005366 Ga0070659_100000790 Ga0070659_10000079021 309
350 3300005367 Ga0070667_100241650 Ga0070667_1002416502 309
351 3300005444 Ga0070694_100057785 Ga0070694_1000577852 309
352 3300005457 Ga0070662_100136764 Ga0070662_1001367643 309
353 3300005530 Ga0070679_100154450 Ga0070679_1001544502 309
354 3300005539 Ga0068853_100009279 Ga0068853_1000092796 309
355 3300005539 Ga0068853_100089814 Ga0068853_1000898142 309
356 3300005539 Ga0068853_100138544 Ga0068853_1001385442 309
357 3300005545 Ga0070695_100127152 Ga0070695_1001271522 309
358 3300005546 Ga0070696_100000325 Ga0070696_10000032511 309
359 3300005547 Ga0070693_100056116 Ga0070693_1000561162 309
360 3300005563 Ga0068855_100311135 Ga0068855_1003111352 309
361 3300005564 Ga0070664_100005465 Ga0070664_1000054654 309
362 3300005564 Ga0070664_100181604 Ga0070664_1001816042 309
363 3300005564 Ga0070664_100209377 Ga0070664_1002093773 309
364 3300005616 Ga0068852_100123369 Ga0068852_1001233692 309
365 3300005618 Ga0068864_100003096 Ga0068864_1000030969 309
366 3300005841 Ga0068863_100040042 Ga0068863_1000400424 309
367 3300005843 Ga0068860_100210296 Ga0068860_1002102961 309
368 3300009098 Ga0105245_10121461 Ga0105245_101214611 309
369 3300009177 Ga0105248_10000626 Ga0105248_100006268 309
370 3300009551 Ga0105238_10378625 Ga0105238_103786253 309
371 3300020070 Ga0206356_10400983 Ga0206356_104009832 309
372 3300025292 Ga0209676_1000563 Ga0209676_100056346 309
373 3300025292 Ga0209676_1003606 Ga0209676_10036066 309
374 3300025304 Ga0209257_1000090 Ga0209257_1000090203 309
375 3300025904 Ga0207647_10105058 Ga0207647_101050582 309
376 3300025925 Ga0207650_10129271 Ga0207650_101292712 309
377 3300025931 Ga0207644_10000052 Ga0207644_10000052102 309
378 3300025932 Ga0207690_10003688 Ga0207690_100036882 309
379 3300025933 Ga0207706_10109535 Ga0207706_101095353 309
380 3300025941 Ga0207711_10011668 Ga0207711_100116685 309
381 3300025945 Ga0207679_10143572 Ga0207679_101435722 309
382 3300025945 Ga0207679_10146155 Ga0207679_101461552 309
383 3300025949 Ga0207667_10181945 Ga0207667_101819452 309
384 3300025981 Ga0207640_10161344 Ga0207640_101613442 309
385 3300026041 Ga0207639_10067320 Ga0207639_100673202 309
386 3300026088 Ga0207641_10004589 Ga0207641_100045895 309
387 3300026095 Ga0207676_10006981 Ga0207676_100069814 309
388 3300026121 Ga0207683_10373898 Ga0207683_103738982 309
389 3300026142 Ga0207698_10252813 Ga0207698_102528133 309
390 3300031901 Ga0307406_10002460 Ga0307406_1000246010 309
391 3300031911 Ga0307412_10001006 Ga0307412_100010066 309
392 3300031911 Ga0307412_10003087 Ga0307412_1000308712 309
393 3300032002 Ga0307416_100119210 Ga0307416_1001192102 309
394 3300032004 Ga0307414_10000463 Ga0307414_1000046312 309
395 3300032004 Ga0307414_10189068 Ga0307414_101890682 309
396 3300037312 Ga0395899_0028519 Ga0395899_0028519_777_1757 309
397 3300037312 Ga0395899_0084496 Ga0395899_0084496_929_1909 309
398 3300037418 Ga0395900_0069109 Ga0395900_0069109_43_1023 309
399 3300037418 Ga0395900_0076589 Ga0395900_0076589_174_1154 309
400 3300037418 Ga0395900_0102837 Ga0395900_0102837_793_1773 309
401 3300037418 Ga0395900_0237892 Ga0395900_0237892_119_1099 309
402 3300037466 Ga0395898_0102815 Ga0395898_0102815_98_1078 309
403 3300037471 Ga0395905_0001767 Ga0395905_0001767_11123_12103 309
404 3300037471 Ga0395905_0008418 Ga0395905_0008418_7747_8727 309
405 3300037471 Ga0395905_0030404 Ga0395905_0030404_1651_2631 309
406 3300037471 Ga0395905_0042471 Ga0395905_0042471_2100_3080 309
407 3300037471 Ga0395905_0092502 Ga0395905_0092502_984_1964 309
408 3300037471 Ga0395905_0136742 Ga0395905_0136742_759_1739 309
409 3300037471 Ga0395905_0372652 Ga0395905_0372652_174_1154 309
410 3300038443 Ga0395901_0009378 Ga0395901_0009378_3052_4032 309
411 3300038443 Ga0395901_0019875 Ga0395901_0019875_1609_2589 309
412 3300038443 Ga0395901_0034177 Ga0395901_0034177_1555_2535 309
413 3300042127 Ga0450890_002346 Ga0450890_002346_670_1650 309
414 3300042142 Ga0450905_001489 Ga0450905_001489_232_1212 309
415 3300042144 Ga0450889_000118 Ga0450889_000118_6546_7526 309
416 3300044656 Ga0466969_0048896 Ga0466969_0048896_307_1287 309
417 3300044684 Ga0466966_0050738 Ga0466966_0050738_267_1247 309
418 3300044684 Ga0466966_0058910 Ga0466966_0058910_1195_2175 309
419 3300044693 Ga0466961_0060231 Ga0466961_0060231_669_1649 309
420 3300044706 Ga0466964_0016713 Ga0466964_0016713_886_1866 309
421 3300045049 Ga0466959_0097897 Ga0466959_0097897_552_1532 309
422 3300045049 Ga0466959_0161958 Ga0466959_0161958_277_1257 309
423 3300045976 Ga0466967_0152540 Ga0466967_0152540_851_1831 309
424 3300045976 Ga0466967_0173868 Ga0466967_0173868_967_1947 309
425 3300046512 Ga0495610_0042164 Ga0495610_0042164_322_1320 309
426 3300046525 Ga0495663_0076834 Ga0495663_0076834_70_1050 309
427 3300046528 Ga0495642_0020513 Ga0495642_0020513_1410_2390 309
428 3300046539 Ga0495621_0000046 Ga0495621_0000046_15536_16516 309
429 3300046684 Ga0495669_0012075 Ga0495669_0012075_880_1860 309
430 3300046691 Ga0495670_0001100 Ga0495670_0001100_11157_12137 309
431 3300046694 Ga0495649_0000048 Ga0495649_0000048_17369_18367 309
432 3300047445 Ga0495677_0002552 Ga0495677_0002552_3924_4904 309
433 3300048911 Ga0496108_0013648 Ga0496108_0013648_2452_3432 309
434 3300048912 Ga0496109_0012198 Ga0496109_0012198_2526_3506 309
435 3300048915 Ga0496112_0024945 Ga0496112_0024945_3378_4358 309
436 3300048916 Ga0496113_0001779 Ga0496113_0001779_3377_4357 309
437 3300048918 Ga0496115_0062107 Ga0496115_0062107_1416_2414 309
438 3300049571 Ga0501034_0014162 Ga0501034_0014162_4426_5409 309
439 3300049663 Ga0501223_000111 Ga0501223_000111_18398_19381 309
440 3300049664 Ga0501224_000024 Ga0501224_000024_4104_5087 309
441 3300049668 Ga0501233_000668 Ga0501233_000668_4188_5171 309
442 3300049705 Ga0501225_0000017 Ga0501225_0000017_4371_5354 309
443 3300049707 Ga0501234_001620 Ga0501234_001620_1243_2226 309
444 3300049853 Ga0501226_000072 Ga0501226_000072_4412_5395 309
445 3300050511 nmdc:mga08y16_44274_c1 nmdc:mga08y16_44274_c1_643_1623 309
446 3300053088 Ga0500644_0004795 Ga0500644_0004795_1857_2855 309
447 3300053118 Ga0500594_0002629 Ga0500594_0002629_703_1689 309
448 iso_pu_bacteria 2852653556 2852655930 309
449 iso_pu_bacteria 2852680915 2852683018 309
450 iso_pu_bacteria 2896184354 2896185405 309
451 3300031901 Ga0307406_10104692 Ga0307406_101046922 310
452 3300032005 Ga0307411_10432026 Ga0307411_104320261 310
453 3300042116 Ga0450912_000279 Ga0450912_000279_193_1176 310
454 3300047472 Ga0495686_0000074 Ga0495686_0000074_45029_46054 310
455 3300053136 Ga0500559_0005849 Ga0500559_0005849_1089_2117 310
456 iso_pu_bacteria 2882806704 2882807188 310
457 3300002239 JGI24034J26672_10003557 JGI24034J26672_100035573 311
458 3300002459 JGI24751J29686_10012926 JGI24751J29686_100129261 311
459 3300005290 Ga0065712_10074966 Ga0065712_100749664 311
460 3300005331 Ga0070670_100043018 Ga0070670_1000430183 311
461 3300005331 Ga0070670_100251458 Ga0070670_1002514581 311
462 3300005347 Ga0070668_100331185 Ga0070668_1003311852 311
463 3300005367 Ga0070667_100000098 Ga0070667_100000098108 311
464 3300005548 Ga0070665_100039812 Ga0070665_1000398125 311
465 3300005843 Ga0068860_100000164 Ga0068860_100000164110 311
466 3300006844 Ga0075428_100272269 Ga0075428_1002722692 311
467 3300006847 Ga0075431_100004319 Ga0075431_1000043193 311
468 3300013102 Ga0157371_10020876 Ga0157371_100208764 311
469 3300014326 Ga0157380_10012559 Ga0157380_100125592 311
470 3300025919 Ga0207657_10128246 Ga0207657_101282462 311
471 3300025986 Ga0207658_10000359 Ga0207658_100003598 311
472 3300026088 Ga0207641_10004606 Ga0207641_100046067 311
473 3300027876 Ga0209974_10002253 Ga0209974_100022536 311
474 3300028381 Ga0268264_10000228 Ga0268264_100002288 311
475 3300031548 Ga0307408_100038304 Ga0307408_1000383041 311
476 3300031731 Ga0307405_10059522 Ga0307405_100595222 311
477 3300031824 Ga0307413_10002717 Ga0307413_100027175 311
478 3300031901 Ga0307406_10193563 Ga0307406_101935632 311
479 3300031911 Ga0307412_10005482 Ga0307412_100054822 311
480 3300031911 Ga0307412_10122392 Ga0307412_101223922 311
481 3300031995 Ga0307409_100003480 Ga0307409_1000034806 311
482 3300032002 Ga0307416_100009876 Ga0307416_1000098764 311
483 3300032004 Ga0307414_10000704 Ga0307414_1000070413 311
484 3300032004 Ga0307414_10013269 Ga0307414_100132693 311
485 3300032005 Ga0307411_10010239 Ga0307411_100102395 311
486 3300037312 Ga0395899_0043223 Ga0395899_0043223_2154_3143 311
487 3300037418 Ga0395900_0000731 Ga0395900_0000731_31366_32355 311
488 3300037418 Ga0395900_0011469 Ga0395900_0011469_3207_4196 311
489 3300037471 Ga0395905_0000383 Ga0395905_0000383_12582_13571 311
490 3300038443 Ga0395901_0000677 Ga0395901_0000677_17243_18232 311
491 3300046492 Ga0495585_0015400 Ga0495585_0015400_1817_2806 311
492 3300046492 Ga0495585_0046074 Ga0495585_0046074_231_1220 311
493 3300046525 Ga0495663_0001279 Ga0495663_0001279_625_1614 311
494 3300046537 Ga0495598_0000389 Ga0495598_0000389_2819_3808 311
495 3300046539 Ga0495621_0000155 Ga0495621_0000155_6240_7229 311
496 3300046558 Ga0495633_0036004 Ga0495633_0036004_849_1838 311
497 3300046665 Ga0495661_0099521 Ga0495661_0099521_474_1463 311
498 3300046684 Ga0495669_0001507 Ga0495669_0001507_7216_8205 311
499 3300047445 Ga0495677_0000666 Ga0495677_0000666_5869_6858 311
500 3300049581 Ga0501047_0056089 Ga0501047_0056089_2254_3240 311
501 3300053148 Ga0500590_018774 Ga0500590_018774_2418_3410 311
502 iso_pu_bacteria 2643221560 2643819254 311
503 iso_pu_bacteria 2739367664 2739649155 311
504 iso_pu_bacteria 2739367865 2740027628 311
505 3300005455 Ga0070663_100006846 Ga0070663_1000068461 312
506 3300005457 Ga0070662_100003086 Ga0070662_1000030867 312
507 3300005457 Ga0070662_100090392 Ga0070662_1000903922 312
508 3300005563 Ga0068855_100226884 Ga0068855_1002268842 312
509 3300005843 Ga0068860_100004656 Ga0068860_10000465613 312
510 3300011119 Ga0105246_10000847 Ga0105246_100008475 312
511 3300013100 Ga0157373_10049060 Ga0157373_100490602 312
512 3300025933 Ga0207706_10003818 Ga0207706_100038187 312
513 3300025945 Ga0207679_10023064 Ga0207679_100230642 312
514 3300025949 Ga0207667_10205597 Ga0207667_102055972 312
515 3300028381 Ga0268264_10008642 Ga0268264_100086427 312
516 3300046453 Ga0495627_000758 Ga0495627_000758_10306_11292 312
517 3300046471 Ga0495650_0001475 Ga0495650_0001475_8970_9956 312
518 3300046660 Ga0495625_0234944 Ga0495625_0234944_141_1136 312
519 3300047470 Ga0495681_0000822 Ga0495681_0000822_10330_11316 312
520 3300053121 Ga0500607_000183 Ga0500607_000183_2145_3140 312
521 3300053156 Ga0500622_0014826 Ga0500622_0014826_1495_2490 312
522 iso_pu_bacteria 2643221588 2643948596 312
523 iso_pu_bacteria 2818991438 2819552145 312
524 iso_pu_bacteria 3000865235 3000866938 312
525 3300005327 Ga0070658_10029030 Ga0070658_100290304 313
526 3300005339 Ga0070660_100030302 Ga0070660_1000303024 313
527 3300005455 Ga0070663_100020995 Ga0070663_1000209952 313
528 3300005530 Ga0070679_100024739 Ga0070679_1000247396 313
529 3300005530 Ga0070679_100117226 Ga0070679_1001172262 313
530 3300005530 Ga0070679_100182635 Ga0070679_1001826352 313
531 3300005578 Ga0068854_100224046 Ga0068854_1002240462 313
532 3300005937 Ga0081455_10002477 Ga0081455_1000247714 313
533 3300005937 Ga0081455_10042235 Ga0081455_100422352 313
534 3300006353 Ga0075370_10014378 Ga0075370_100143782 313
535 3300013102 Ga0157371_10152227 Ga0157371_101522272 313
536 3300025909 Ga0207705_10002096 Ga0207705_1000209613 313
537 3300025909 Ga0207705_10035024 Ga0207705_100350242 313
538 3300025921 Ga0207652_10042502 Ga0207652_100425022 313
539 3300025921 Ga0207652_10108590 Ga0207652_101085902 313
540 3300025921 Ga0207652_10115415 Ga0207652_101154152 313
541 3300026067 Ga0207678_10121781 Ga0207678_101217812 313
542 3300031824 Ga0307413_10080056 Ga0307413_100800562 313
543 3300031901 Ga0307406_10067956 Ga0307406_100679562 313
544 3300031911 Ga0307412_10013499 Ga0307412_100134996 313
545 3300031995 Ga0307409_100122051 Ga0307409_1001220512 313
546 3300032004 Ga0307414_10053962 Ga0307414_100539622 313
547 3300032004 Ga0307414_10220676 Ga0307414_102206762 313
548 3300032126 Ga0307415_100142495 Ga0307415_1001424952 313
549 3300033180 Ga0307510_10183926 Ga0307510_101839262 313
550 3300042015 Ga0439462_0000040 Ga0439462_0000040_3073_4077 313
551 3300048908 Ga0496105_0103444 Ga0496105_0103444_1061_2056 313
552 3300005289 Ga0065704_10095011 Ga0065704_100950112 314
553 3300005331 Ga0070670_100082303 Ga0070670_1000823032 314
554 3300005331 Ga0070670_100456444 Ga0070670_1004564441 314
555 3300005347 Ga0070668_100091686 Ga0070668_1000916862 314
556 3300005353 Ga0070669_100000080 Ga0070669_10000008011 314
557 3300005355 Ga0070671_100048717 Ga0070671_1000487172 314
558 3300005367 Ga0070667_100005092 Ga0070667_1000050929 314
559 3300005548 Ga0070665_100007023 Ga0070665_1000070233 314
560 3300005578 Ga0068854_100001419 Ga0068854_1000014196 314
561 3300006042 Ga0075368_10016620 Ga0075368_100166203 314
562 3300006048 Ga0075363_100061679 Ga0075363_1000616792 314
563 3300006195 Ga0075366_10015348 Ga0075366_100153485 314
564 3300006195 Ga0075366_10053492 Ga0075366_100534922 314
565 3300013306 Ga0163162_10087572 Ga0163162_100875722 314
566 3300017792 Ga0163161_10002367 Ga0163161_100023678 314
567 3300025923 Ga0207681_10000049 Ga0207681_1000004931 314
568 3300025925 Ga0207650_10055502 Ga0207650_100555022 314
569 3300025931 Ga0207644_10135939 Ga0207644_101359392 314
570 3300025981 Ga0207640_10010814 Ga0207640_100108143 314
571 3300025986 Ga0207658_10016310 Ga0207658_100163105 314
572 3300028381 Ga0268264_10086744 Ga0268264_100867442 314
573 3300031251 Ga0265327_10021805 Ga0265327_100218052 314
574 3300031824 Ga0307413_10027374 Ga0307413_100273742 314
575 3300031852 Ga0307410_10013851 Ga0307410_100138514 314
576 3300031995 Ga0307409_100050221 Ga0307409_1000502212 314
577 3300032002 Ga0307416_100284140 Ga0307416_1002841402 314
578 3300032005 Ga0307411_10011224 Ga0307411_100112242 314
579 3300032126 Ga0307415_100056249 Ga0307415_1000562492 314
580 3300048905 Ga0496102_0000372 Ga0496102_0000372_32302_33300 314
581 3300048906 Ga0496103_0000021 Ga0496103_0000021_190100_191098 314
582 3300048907 Ga0496104_0000128 Ga0496104_0000128_3574_4572 314
583 3300048908 Ga0496105_0000064 Ga0496105_0000064_64472_65470 314
584 3300048910 Ga0496107_0046884 Ga0496107_0046884_662_1660 314
585 3300048913 Ga0496110_0069594 Ga0496110_0069594_775_1773 314
586 3300048914 Ga0496111_0021321 Ga0496111_0021321_168_1166 314
587 3300048915 Ga0496112_0011063 Ga0496112_0011063_4402_5400 314
588 3300048916 Ga0496113_0000044 Ga0496113_0000044_4241_5239 314
589 3300048919 Ga0496116_0036796 Ga0496116_0036796_1353_2351 314
590 3300048920 Ga0496117_0001310 Ga0496117_0001310_25816_26814 314
591 3300048921 Ga0496118_0003241 Ga0496118_0003241_7695_8693 314
592 3300048922 Ga0496119_0000077 Ga0496119_0000077_71081_72079 314
593 3300048923 Ga0496120_0001955 Ga0496120_0001955_14099_15097 314
594 3300048925 Ga0496122_0004055 Ga0496122_0004055_11037_12035 314
595 3300048926 Ga0496123_0001103 Ga0496123_0001103_1378_2376 314
596 3300048927 Ga0496124_0001269 Ga0496124_0001269_18364_19362 314
597 3300048928 Ga0496125_0001135 Ga0496125_0001135_2590_3588 314
598 3300048929 Ga0496126_0000175 Ga0496126_0000175_38016_39014 314
599 3300048929 Ga0496126_0091122 Ga0496126_0091122_1257_2249 314
600 3300049823 Ga0501044_0001187 Ga0501044_0001187_13061_14077 314
601 3300050489 nmdc:mga03683_1556_c1 nmdc:mga03683_1556_c1_296_1306 314
602 3300050493 nmdc:mga0k408_2794_c1 nmdc:mga0k408_2794_c1_2711_3718 314
603 3300050494 nmdc:mga06z11_139_c1 nmdc:mga06z11_139_c1_24311_25321 314
604 3300050495 nmdc:mga04h51_457_c1 nmdc:mga04h51_457_c1_6875_7885 314
605 3300050496 nmdc:mga07m45_29_c1 nmdc:mga07m45_29_c1_24185_25195 314
606 3300050516 nmdc:mga0sz30_23210_c1 nmdc:mga0sz30_23210_c1_1049_2059 314
607 3300053121 Ga0500607_000009 Ga0500607_000009_113136_114158 314
608 3300053136 Ga0500559_0000831 Ga0500559_0000831_7309_8331 314
609 3300053730 Ga0500645_001022 Ga0500645_001022_6643_7665 314
610 iso_pu_bacteria 2738541275 2738711046 314
611 iso_pu_bacteria 2738541301 2738849471 314
612 iso_pu_bacteria 2738541304 2738865200 314
613 iso_pu_bacteria 2738543022 2739297718 314
614 iso_pu_bacteria 2738543033 2739359396 314
615 iso_pu_bacteria 2928100450 2928103659 314
616 iso_pu_bacteria 2928959182 2928961328 314
617 3300005539 Ga0068853_100218510 Ga0068853_1002185102 315
618 3300005843 Ga0068860_100034974 Ga0068860_1000349742 315
619 3300025909 Ga0207705_10000009 Ga0207705_1000000966 315
620 3300025986 Ga0207658_10008019 Ga0207658_100080196 315
621 3300026041 Ga0207639_10292338 Ga0207639_102923382 315
622 3300026088 Ga0207641_10018961 Ga0207641_100189613 315
623 3300026116 Ga0207674_10333943 Ga0207674_103339432 315
624 3300046616 Ga0495668_0067204 Ga0495668_0067204_39_1034 315
625 3300048924 Ga0496121_0000070 Ga0496121_0000070_39741_40766 315
626 3300053125 Ga0500618_005438 Ga0500618_005438_1605_2636 315
627 3300053730 Ga0500645_007475 Ga0500645_007475_2103_3131 315
628 3300005355 Ga0070671_100016176 Ga0070671_1000161763 316
629 3300005440 Ga0070705_100142265 Ga0070705_1001422652 316
630 3300005563 Ga0068855_100001523 Ga0068855_10000152333 316
631 3300005617 Ga0068859_100025512 Ga0068859_1000255125 316
632 3300005842 Ga0068858_100024766 Ga0068858_1000247662 316
633 3300005843 Ga0068860_100065405 Ga0068860_1000654052 316
634 3300005844 Ga0068862_100027216 Ga0068862_1000272164 316
635 3300006058 Ga0075432_10004893 Ga0075432_100048932 316
636 3300006177 Ga0075362_10000167 Ga0075362_1000016716 316
637 3300006931 Ga0097620_100025512 Ga0097620_1000255125 316
638 3300009177 Ga0105248_10067601 Ga0105248_100676012 316
639 3300025923 Ga0207681_10360815 Ga0207681_103608152 316
640 3300025931 Ga0207644_10019022 Ga0207644_100190223 316
641 3300025949 Ga0207667_10001114 Ga0207667_100011147 316
642 3300026035 Ga0207703_10017501 Ga0207703_100175012 316
643 3300028381 Ga0268264_10144596 Ga0268264_101445962 316
644 3300046500 Ga0495596_0000008 Ga0495596_0000008_54299_55300 316
645 3300046500 Ga0495596_0000327 Ga0495596_0000327_12297_13313 316
646 3300046506 Ga0495583_0006140 Ga0495583_0006140_238_1239 316
647 3300046512 Ga0495610_0000033 Ga0495610_0000033_172767_173765 316
648 3300046512 Ga0495610_0003683 Ga0495610_0003683_4158_5174 316
649 3300046515 Ga0495620_0003606 Ga0495620_0003606_6805_7803 316
650 3300046515 Ga0495620_0004429 Ga0495620_0004429_171_1169 316
651 3300046519 Ga0495632_0000309 Ga0495632_0000309_3917_4915 316
652 3300046519 Ga0495632_0019364 Ga0495632_0019364_2131_3132 316
653 3300046530 Ga0495654_0013829 Ga0495654_0013829_2520_3518 316
654 3300046538 Ga0495609_0001350 Ga0495609_0001350_9568_10569 316
655 3300046660 Ga0495625_0003997 Ga0495625_0003997_1472_2473 316
656 3300048090 Ga0495615_0000232 Ga0495615_0000232_6803_7801 316
657 3300048906 Ga0496103_0018538 Ga0496103_0018538_753_1763 316
658 3300048919 Ga0496116_0000311 Ga0496116_0000311_34134_35138 316
659 3300048924 Ga0496121_0001761 Ga0496121_0001761_19833_20837 316
660 3300048925 Ga0496122_0001376 Ga0496122_0001376_632_1636 316
661 3300048925 Ga0496122_0008233 Ga0496122_0008233_3527_4525 316
662 3300048926 Ga0496123_0000159 Ga0496123_0000159_5318_6322 316
663 3300048926 Ga0496123_0014924 Ga0496123_0014924_2124_3122 316
664 3300048927 Ga0496124_0002565 Ga0496124_0002565_18589_19593 316
665 3300048927 Ga0496124_0098161 Ga0496124_0098161_23_1021 316
666 3300048928 Ga0496125_0023808 Ga0496125_0023808_3675_4679 316
667 3300048929 Ga0496126_0000077 Ga0496126_0000077_182459_183463 316
668 3300049571 Ga0501034_0092581 Ga0501034_0092581_1508_2518 316
669 3300050489 nmdc:mga03683_2_c1 nmdc:mga03683_2_c1_125949_126965 316
670 3300050490 nmdc:mga03n38_1398_c1 nmdc:mga03n38_1398_c1_4128_5144 316
671 3300050516 nmdc:mga0sz30_1416_c1 nmdc:mga0sz30_1416_c1_5493_6509 316
672 2162886007 SwRhRL2b_contig_2665226 SwRhRL2b_0903.00004110 317
673 3300002459 JGI24751J29686_10000251 JGI24751J29686_100002512 317
674 3300005289 Ga0065704_10070228 Ga0065704_1007022848 317
675 3300005335 Ga0070666_10053003 Ga0070666_100530032 317
676 3300005353 Ga0070669_100000213 Ga0070669_10000021312 317
677 3300005355 Ga0070671_100007726 Ga0070671_1000077265 317
678 3300005548 Ga0070665_100000070 Ga0070665_10000007025 317
679 3300005841 Ga0068863_100030180 Ga0068863_1000301803 317
680 3300005842 Ga0068858_100062894 Ga0068858_1000628943 317
681 3300006051 Ga0075364_10131989 Ga0075364_101319892 317
682 3300009011 Ga0105251_10000334 Ga0105251_1000033413 317
683 3300009177 Ga0105248_10023914 Ga0105248_100239143 317
684 3300025735 Ga0207713_1000987 Ga0207713_100098710 317
685 3300025923 Ga0207681_10000490 Ga0207681_100004907 317
686 3300025931 Ga0207644_10000327 Ga0207644_100003275 317
687 3300025941 Ga0207711_10002900 Ga0207711_100029006 317
688 3300026088 Ga0207641_10051708 Ga0207641_100517082 317
689 3300028379 Ga0268266_10003129 Ga0268266_1000312913 317
690 3300048919 Ga0496116_0011397 Ga0496116_0011397_5009_6025 317
691 3300048920 Ga0496117_0072197 Ga0496117_0072197_329_1345 317
692 3300048922 Ga0496119_0061470 Ga0496119_0061470_885_1901 317
693 3300048924 Ga0496121_0004878 Ga0496121_0004878_8227_9243 317
694 3300048928 Ga0496125_0031544 Ga0496125_0031544_1049_2065 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07479

NAD_Gly3P_dh_C

NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus

191

332

0.98

PF01210

NAD_Gly3P_dh_N

NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus

19

171

0.95

PF20618

GPD_NAD_C_bact

Bacterial GPD, NAD-dependent C-terminal

251

317

0.89

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

19

116

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k96-assembly1.cif.gz_B 2.1 angstrom resolution crystal structure of glycerol-3-phosphate dehydrogenase (gpsa) from coxiella burnetii 0.9403 5 307
1z82-assembly1.cif.gz_B crystal structure of glycerol-3-phosphate dehydrogenase (tm0378) from thermotoga maritima at 2.00 a resolution 0.9247 5 307
1n1e-assembly1.cif.gz_B crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase complexed with dhap and nad 0.9235 3 317
1n1e-assembly1.cif.gz_B crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase complexed with dhap and nad 0.9151 3 317
2q6u-assembly1.cif.gz_A semet-substituted form of nikd 0.9089 4 34
ID Description Score Start End Superfamily
af_P9WN75_188_329_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9561 181 305 1.10.1040.10
af_Q2FYG1_190_332_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.952 185 311 1.10.1040.10
3k96B02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9379 185 307 1.10.1040.10
af_Q949Q0_74_275_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9335 5 181 3.40.50.720
af_Q2FYG1_1_188_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9311 5 181 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3D2ECY1-F1-model_v4 deleted 0.9834 75 273
AF-A0A845AUG6-F1-model_v4 Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94) (NAD(P)(+)-dependent glycerol-3-phosphate dehydrogenase) (NAD(P)H-dependent dihydroxyacetone-phosphate reductase) 0.9821 1 317 GO:0005829
GO:0005975
GO:0006650
GO:0008654
GO:0046167
GO:0046168
GO:0047952
GO:0051287
AF-A0A845AUG6-F1-model_v4 Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94) (NAD(P)(+)-dependent glycerol-3-phosphate dehydrogenase) (NAD(P)H-dependent dihydroxyacetone-phosphate reductase) 0.9791 1 317 GO:0005829
GO:0005975
GO:0006650
GO:0008654
GO:0046167
GO:0046168
GO:0047952
GO:0051287
AF-A0A4Q5T7B4-F1-model_v4 Glycerol-3-phosphate dehydrogenase 0.9786 4 177 GO:0005829
GO:0046168
GO:0047952
GO:0051287
AF-A0A161GKJ7-F1-model_v4 NADH-dependent glycerol-3-phosphate dehydrogenase 0.9778 118 311 GO:0005829
GO:0005975
GO:0006072
GO:0008654
GO:0047952

Feature Viewer

pLDDT pTM Quality
92.11 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map