F475400
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 689 | 409 | 654 | 194 |
Family's Representative Sequence
| Representative Sequence | 3300035691|Ga0373931_0014852|Ga0373931_0014852_1456_2145 |
| Length | 229 |
| Sequence | MLAIARAMAALCASIRRLLARCSATLKKLSASDPVNTMKTLIRPAVSLFVLLSLITGIVYPLAVTGVAKAAFPAQAAGSLILKDGQVVGSSLIGQNFSDPKYFWGRPSATSPMPYNGSGSSGSNQGPLNPALVDAVKGRVEALKAADPGNASPVPVDLVTASASGLDPHISVAAARYQAARVARVRGLATDALPTLIARHTEGRLFGLLGEARVNVLELNIELDQTARH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 3 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 4 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 5 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 6 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 7 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 8 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 9 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 10 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 11 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 12 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 13 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 14 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 15 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 16 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 17 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 18 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 19 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 20 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 21 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 22 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 23 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 24 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 25 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 26 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 27 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 28 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 29 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 30 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 31 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 32 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 33 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 34 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 35 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 36 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 37 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 38 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 39 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 40 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 41 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 42 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 43 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 44 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 45 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 46 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 47 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 48 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 49 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 50 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 51 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 52 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 53 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 54 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 55 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 56 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 57 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 58 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 62 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 64 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 65 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 66 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 67 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 68 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 69 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 70 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 71 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 72 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 75 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 77 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 88 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 91 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 99 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 100 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 103 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 104 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 105 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 106 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 109 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 114 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 115 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 118 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 119 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 131 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 148 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 149 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 160 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 218 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 219 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 225 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 226 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 227 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 228 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 229 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 230 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 231 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 232 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 233 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 234 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 237 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 239 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 240 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 241 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 242 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 243 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 244 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 246 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 248 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 249 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 250 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 251 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 252 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 253 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 254 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 258 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 259 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 264 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 265 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 266 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 267 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 268 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 269 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 270 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 271 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 272 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 273 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 274 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 275 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 276 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 277 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 278 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 279 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 280 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 281 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 282 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 283 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 284 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 285 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 286 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 287 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 288 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 289 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 290 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 291 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 292 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 293 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 294 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 295 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 296 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 297 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 340 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 341 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 342 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 345 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 346 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 347 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 348 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 349 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 350 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 351 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 352 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 353 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 354 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 355 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 356 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 357 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 358 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 371 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 372 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 373 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 376 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 377 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 378 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 379 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 380 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 381 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 382 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 384 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 385 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 386 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 387 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 388 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 389 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 390 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 391 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 392 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 394 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 395 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 397 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 398 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 399 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 400 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 401 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 402 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 403 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 404 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 406 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 407 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 408 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 409 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.63 |
| Metatranscriptomes | 0.15 |
| Isolates | 5.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 27.43 |
| Nodule | 1.02 |
| Rhizoplane | 1.89 |
| Rhizosphere | 55.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000225 | 3300002704 | Bacteria | 22198 |
| 2 | JGI25155J39150_1001321 | 3300002704 | Bacteria | 1920 |
| 3 | JGI25156J39149_1000738 | 3300002705 | Bacteria | 17321 |
| 4 | JGI25156J39149_1011592 | 3300002705 | Bacteria | 1984 |
| 5 | JGI25156J39149_1018021 | 3300002705 | Bacteria | 1318 |
| 6 | JGI25156J39149_1022037 | 3300002705 | Bacteria | 1090 |
| 7 | JGI25162J39368_1003126 | 3300002737 | Bacteria | 5235 |
| 8 | JGI25154J39366_1000437 | 3300002738 | Bacteria | 22180 |
| 9 | JGI25154J39366_1000599 | 3300002738 | Bacteria | 17321 |
| 10 | JGI25157J39369_1000740 | 3300002741 | Bacteria | 17317 |
| 11 | JGI25150J39212_1002782 | 3300002774 | Bacteria | 4246 |
| 12 | JGI25159J45721_1007736 | 3300002987 | Bacteria | 3041 |
| 13 | JGI25151J46595_10018059 | 3300003187 | Bacteria | 3041 |
| 14 | JGI25151J46595_10067258 | 3300003187 | Bacteria | 1105 |
| 15 | JGI25153J46596_10048351 | 3300003215 | Bacteria | 1243 |
| 16 | rootH1_10001191 | 3300003316 | Bacteria | 1103 |
| 17 | rootH1_10039640 | 3300003316 | Bacteria | 1588 |
| 18 | rootH1_10079138 | 3300003316 | Bacteria | 1091 |
| 19 | rootH2_10067589 | 3300003320 | Bacteria | 1250 |
| 20 | rootH2_10067590 | 3300003320 | Bacteria | 1016 |
| 21 | rootH2_10126651 | 3300003320 | Bacteria | 2135 |
| 22 | rootL2_10102190 | 3300003322 | Bacteria | 1382 |
| 23 | rootH1_10016198 | 3300003323 | Bacteria | 5961 |
| 24 | rootH1_10033732 | 3300003316 | Bacteria | 1987 |
| 25 | rootH1_10033732 | 3300003323 | Bacteria | 1356 |
| 26 | rootH1_10045732 | 3300003323 | Bacteria | 2456 |
| 27 | JGI25160J50197_1011974 | 3300003354 | Bacteria | 3041 |
| 28 | JGI25161J50226_1003016 | 3300003374 | Bacteria | 4049 |
| 29 | JGI25161J50226_1003985 | 3300003374 | Bacteria | 3203 |
| 30 | Ga0055539_1000042 | 3300003752 | Bacteria | 199725 |
| 31 | Ga0055533_1000006 | 3300003756 | Bacteria | 635559 |
| 32 | Ga0055532_1000497 | 3300003758 | Bacteria | 17325 |
| 33 | Ga0055525_1000004 | 3300003759 | Bacteria | 888039 |
| 34 | Ga0055525_1000832 | 3300003759 | Bacteria | 9357 |
| 35 | Ga0055527_1007509 | 3300003760 | Bacteria | 1329 |
| 36 | Ga0055535_1000052 | 3300003761 | Bacteria | 132513 |
| 37 | Ga0055535_1000895 | 3300003761 | Bacteria | 20395 |
| 38 | Ga0055542_1000317 | 3300003762 | Bacteria | 51979 |
| 39 | Ga0055529_1000053 | 3300003763 | Bacteria | 198996 |
| 40 | Ga0055526_1002769 | 3300003771 | Bacteria | 11622 |
| 41 | Ga0055526_1008783 | 3300003771 | Bacteria | 4976 |
| 42 | Ga0055526_1015598 | 3300003771 | Bacteria | 3041 |
| 43 | Ga0055537_1006285 | 3300003773 | Bacteria | 3041 |
| 44 | Ga0055537_1007110 | 3300003773 | Bacteria | 2745 |
| 45 | Ga0055524_1003190 | 3300003775 | Bacteria | 8051 |
| 46 | Ga0055524_1013722 | 3300003775 | Bacteria | 3041 |
| 47 | Ga0055524_1027361 | 3300003775 | Bacteria | 1732 |
| 48 | Ga0055536_1002561 | 3300003781 | Bacteria | 10143 |
| 49 | Ga0055534_1003433 | 3300003784 | Bacteria | 4976 |
| 50 | Ga0055534_1005234 | 3300003784 | Bacteria | 3530 |
| 51 | Ga0055528_1007637 | 3300003790 | Bacteria | 4750 |
| 52 | Ga0055528_1013779 | 3300003790 | Bacteria | 3041 |
| 53 | Ga0055530_10005424 | 3300003791 | Bacteria | 6072 |
| 54 | Ga0055540_1000019 | 3300003792 | Bacteria | 210593 |
| 55 | Ga0055540_1002304 | 3300003792 | Bacteria | 10264 |
| 56 | Ga0055540_1003725 | 3300003792 | Bacteria | 7207 |
| 57 | Ga0055531_10000944 | 3300003794 | Bacteria | 23360 |
| 58 | Ga0055531_10019796 | 3300003794 | Bacteria | 2701 |
| 59 | Ga0055531_10034866 | 3300003794 | Bacteria | 1587 |
| 60 | Ga0055543_1005744 | 3300004625 | Bacteria | 3119 |
| 61 | Ga0065165_1004905 | 3300005262 | Bacteria | 7902 |
| 62 | Ga0065707_10082399 | 3300005295 | Bacteria | 15652 |
| 63 | Ga0070658_10544943 | 3300005327 | Bacteria | 1004 |
| 64 | Ga0070676_10082414 | 3300005328 | Bacteria | 1954 |
| 65 | Ga0070676_10419252 | 3300005328 | Bacteria | 935 |
| 66 | Ga0070690_100003675 | 3300005330 | Bacteria | 8447 |
| 67 | Ga0070670_100090322 | 3300005331 | Bacteria | 2632 |
| 68 | Ga0070670_100099090 | 3300005331 | Bacteria | 2508 |
| 69 | Ga0068869_100774878 | 3300005334 | Bacteria | 823 |
| 70 | Ga0068869_101160092 | 3300005334 | Bacteria | 678 |
| 71 | Ga0070666_10252813 | 3300005335 | Bacteria | 1248 |
| 72 | Ga0070682_100000999 | 3300005337 | Bacteria | 16358 |
| 73 | Ga0070682_100034917 | 3300005337 | Bacteria | 3065 |
| 74 | Ga0070661_100003708 | 3300005344 | Bacteria | 10529 |
| 75 | Ga0070668_100543841 | 3300005347 | Bacteria | 1010 |
| 76 | Ga0070674_100057043 | 3300005356 | Bacteria | 2710 |
| 77 | Ga0070674_100289911 | 3300005356 | Bacteria | 1301 |
| 78 | Ga0070674_100613134 | 3300005356 | Bacteria | 921 |
| 79 | Ga0070673_100004777 | 3300005364 | Bacteria | 8606 |
| 80 | Ga0070673_100206823 | 3300005364 | Bacteria | 1693 |
| 81 | Ga0070673_100645904 | 3300005364 | Bacteria | 968 |
| 82 | Ga0070667_100000180 | 3300005367 | Bacteria | 77076 |
| 83 | Ga0070667_100033426 | 3300005367 | Bacteria | 4299 |
| 84 | Ga0070667_100033890 | 3300005367 | Bacteria | 4272 |
| 85 | Ga0070667_100142780 | 3300005367 | Bacteria | 2098 |
| 86 | Ga0070667_100349317 | 3300005367 | Bacteria | 1339 |
| 87 | Ga0070667_100910895 | 3300005367 | Bacteria | 819 |
| 88 | Ga0070710_10214390 | 3300005437 | Bacteria | 1222 |
| 89 | Ga0070663_100000137 | 3300005455 | Bacteria | 35329 |
| 90 | Ga0070678_100016136 | 3300005456 | Bacteria | 4767 |
| 91 | Ga0070678_100139232 | 3300005456 | Bacteria | 1939 |
| 92 | Ga0070678_100161368 | 3300005456 | Bacteria | 1816 |
| 93 | Ga0068867_100000072 | 3300005459 | Bacteria | 61663 |
| 94 | Ga0068867_100011710 | 3300005459 | Bacteria | 6193 |
| 95 | Ga0068867_100062170 | 3300005459 | Bacteria | 2774 |
| 96 | Ga0068867_100360928 | 3300005459 | Bacteria | 1215 |
| 97 | Ga0070706_100000822 | 3300005467 | Bacteria | 34270 |
| 98 | Ga0070707_100043084 | 3300005468 | Bacteria | 4321 |
| 99 | Ga0068853_100011214 | 3300005539 | Bacteria | 7274 |
| 100 | Ga0070672_100021219 | 3300005543 | Bacteria | 4749 |
| 101 | Ga0070672_100118182 | 3300005543 | Bacteria | 2168 |
| 102 | Ga0070665_100000172 | 3300005548 | Bacteria | 115040 |
| 103 | Ga0070665_100002315 | 3300005548 | Bacteria | 21145 |
| 104 | Ga0070665_100401018 | 3300005548 | Bacteria | 1379 |
| 105 | Ga0070665_100454978 | 3300005548 | Bacteria | 1290 |
| 106 | Ga0070665_100642591 | 3300005548 | Bacteria | 1074 |
| 107 | Ga0070665_101226226 | 3300005548 | Bacteria | 761 |
| 108 | Ga0068855_100139006 | 3300005563 | Bacteria | 2770 |
| 109 | Ga0068855_100262946 | 3300005563 | Bacteria | 1921 |
| 110 | Ga0068855_100476616 | 3300005563 | Bacteria | 1359 |
| 111 | Ga0068855_100491369 | 3300005563 | Bacteria | 1335 |
| 112 | Ga0068855_101524312 | 3300005563 | Bacteria | 686 |
| 113 | Ga0068857_100596695 | 3300005577 | Bacteria | 1044 |
| 114 | Ga0068856_100084854 | 3300005614 | Bacteria | 3146 |
| 115 | Ga0068856_100297322 | 3300005614 | Bacteria | 1632 |
| 116 | Ga0068852_100065011 | 3300005616 | Bacteria | 3182 |
| 117 | Ga0068859_100181480 | 3300005617 | Bacteria | 2188 |
| 118 | Ga0068864_100104726 | 3300005618 | Bacteria | 2514 |
| 119 | Ga0068861_100021835 | 3300005719 | Bacteria | 4604 |
| 120 | Ga0068851_10012444 | 3300005834 | Bacteria | 4011 |
| 121 | Ga0068863_100288668 | 3300005841 | Bacteria | 1590 |
| 122 | Ga0068860_100248176 | 3300005843 | Bacteria | 1733 |
| 123 | Ga0068860_100382322 | 3300005843 | Bacteria | 1390 |
| 124 | Ga0068862_100083940 | 3300005844 | Bacteria | 2767 |
| 125 | Ga0075365_10118671 | 3300006038 | Bacteria | 1823 |
| 126 | Ga0075368_10017321 | 3300006042 | Bacteria | 2696 |
| 127 | Ga0075368_10138109 | 3300006042 | Bacteria | 1015 |
| 128 | Ga0075363_100004024 | 3300006048 | Bacteria | 6359 |
| 129 | Ga0075363_100131520 | 3300006048 | Bacteria | 1404 |
| 130 | Ga0075363_100179333 | 3300006048 | Bacteria | 1204 |
| 131 | Ga0075364_10528314 | 3300006051 | Bacteria | 807 |
| 132 | Ga0075432_10028369 | 3300006058 | Bacteria | 1931 |
| 133 | Ga0075362_10101219 | 3300006177 | Bacteria | 1347 |
| 134 | Ga0075367_10027347 | 3300006178 | Bacteria | 3244 |
| 135 | Ga0075367_10099986 | 3300006178 | Bacteria | 1772 |
| 136 | Ga0075366_10005487 | 3300006195 | Bacteria | 6874 |
| 137 | Ga0075366_10019879 | 3300006195 | Bacteria | 3890 |
| 138 | Ga0075366_10020546 | 3300006195 | Bacteria | 3832 |
| 139 | Ga0075366_10023915 | 3300006195 | Bacteria | 3560 |
| 140 | Ga0075366_10025637 | 3300006195 | Bacteria | 3446 |
| 141 | Ga0075366_10171675 | 3300006195 | Bacteria | 1316 |
| 142 | Ga0075366_10182122 | 3300006195 | Bacteria | 1276 |
| 143 | Ga0075366_10230729 | 3300006195 | Bacteria | 1128 |
| 144 | Ga0097621_100124936 | 3300006237 | Bacteria | 2185 |
| 145 | Ga0075370_10002110 | 3300006353 | Bacteria | 9069 |
| 146 | Ga0075370_10022779 | 3300006353 | Bacteria | 3443 |
| 147 | Ga0075370_10128418 | 3300006353 | Bacteria | 1478 |
| 148 | Ga0075370_10205390 | 3300006353 | Bacteria | 1163 |
| 149 | Ga0075370_10232963 | 3300006353 | Bacteria | 1090 |
| 150 | Ga0068871_100220455 | 3300006358 | Bacteria | 1643 |
| 151 | Ga0075428_100517037 | 3300006844 | Bacteria | 1277 |
| 152 | Ga0097620_100181477 | 3300006931 | Bacteria | 2188 |
| 153 | Ga0099823_1004283 | 3300006944 | Bacteria | 13889 |
| 154 | Ga0099826_10000537 | 3300006948 | Bacteria | 18775 |
| 155 | Ga0105244_10248751 | 3300009036 | Bacteria | 829 |
| 156 | Ga0105240_10001730 | 3300009093 | Bacteria | 36844 |
| 157 | Ga0105240_10008348 | 3300009093 | Bacteria | 14823 |
| 158 | Ga0105240_10060102 | 3300009093 | Bacteria | 4739 |
| 159 | Ga0105240_10116147 | 3300009093 | Bacteria | 3229 |
| 160 | Ga0105247_10011745 | 3300009101 | Bacteria | 5268 |
| 161 | Ga0114129_11055586 | 3300009147 | Bacteria | 1020 |
| 162 | Ga0105242_10010793 | 3300009176 | Bacteria | 7014 |
| 163 | Ga0105248_10007938 | 3300009177 | Bacteria | 11664 |
| 164 | Ga0105248_10008743 | 3300009177 | Bacteria | 11124 |
| 165 | Ga0105237_10013820 | 3300009545 | Bacteria | 8451 |
| 166 | Ga0105237_10055015 | 3300009545 | Bacteria | 3986 |
| 167 | Ga0105238_10255265 | 3300009551 | Bacteria | 1732 |
| 168 | Ga0105249_10001174 | 3300009553 | Bacteria | 23197 |
| 169 | Ga0105239_10164968 | 3300010375 | Bacteria | 2477 |
| 170 | Ga0105246_10082697 | 3300011119 | Bacteria | 2292 |
| 171 | Ga0105246_10412963 | 3300011119 | Bacteria | 1124 |
| 172 | Ga0157347_1000155 | 3300012502 | Bacteria | 3625 |
| 173 | Ga0157371_10060401 | 3300013102 | Bacteria | 2688 |
| 174 | Ga0157370_10000627 | 3300013104 | Bacteria | 44044 |
| 175 | Ga0157370_10079155 | 3300013104 | Bacteria | 3095 |
| 176 | Ga0157370_10396227 | 3300013104 | Bacteria | 1271 |
| 177 | Ga0157369_10050241 | 3300013105 | Bacteria | 4517 |
| 178 | Ga0157374_10473695 | 3300013296 | Bacteria | 1255 |
| 179 | Ga0157374_11091487 | 3300013296 | Bacteria | 818 |
| 180 | Ga0157378_10071828 | 3300013297 | Bacteria | 3109 |
| 181 | Ga0157375_10041470 | 3300013308 | Bacteria | 4445 |
| 182 | Ga0157375_10208711 | 3300013308 | Bacteria | 2110 |
| 183 | Ga0157375_10400790 | 3300013308 | Bacteria | 1539 |
| 184 | Ga0163163_11493616 | 3300014325 | Bacteria | 737 |
| 185 | Ga0157380_10047395 | 3300014326 | Bacteria | 3380 |
| 186 | Ga0157380_10193860 | 3300014326 | Bacteria | 1796 |
| 187 | Ga0157380_10300839 | 3300014326 | Bacteria | 1478 |
| 188 | Ga0182008_10076601 | 3300014497 | Bacteria | 1645 |
| 189 | Ga0157377_10000075 | 3300014745 | Bacteria | 76405 |
| 190 | Ga0157377_10621682 | 3300014745 | Bacteria | 773 |
| 191 | Ga0157379_10195448 | 3300014968 | Bacteria | 1828 |
| 192 | Ga0157379_10412183 | 3300014968 | Bacteria | 1243 |
| 193 | Ga0157376_10024316 | 3300014969 | Bacteria | 4753 |
| 194 | Ga0157376_10132143 | 3300014969 | Bacteria | 2229 |
| 195 | Ga0157376_10374044 | 3300014969 | Bacteria | 1370 |
| 196 | Ga0157376_10465345 | 3300014969 | Bacteria | 1236 |
| 197 | Ga0157376_10885796 | 3300014969 | Bacteria | 910 |
| 198 | Ga0182006_1072205 | 3300015261 | Bacteria | 1277 |
| 199 | Ga0182006_1134028 | 3300015261 | Bacteria | 850 |
| 200 | Ga0182006_1138710 | 3300015261 | Bacteria | 832 |
| 201 | Ga0182007_10005187 | 3300015262 | Bacteria | 5760 |
| 202 | Ga0182007_10062613 | 3300015262 | Bacteria | 1219 |
| 203 | Ga0183362_10007 | 3300015683 | Bacteria | 240101 |
| 204 | Ga0163161_10042166 | 3300017792 | Bacteria | 3281 |
| 205 | Ga0163161_10102239 | 3300017792 | Bacteria | 2134 |
| 206 | Ga0163161_10242039 | 3300017792 | Bacteria | 1403 |
| 207 | Ga0163161_10581314 | 3300017792 | Bacteria | 921 |
| 208 | Ga0213872_10000025 | 3300021361 | Bacteria | 151688 |
| 209 | Ga0209435_100080 | 3300025206 | Bacteria | 49104 |
| 210 | Ga0209435_100255 | 3300025206 | Bacteria | 13512 |
| 211 | Ga0209436_100257 | 3300025208 | Bacteria | 24379 |
| 212 | Ga0209436_101113 | 3300025208 | Bacteria | 9964 |
| 213 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 214 | Ga0209672_100354 | 3300025228 | Bacteria | 29117 |
| 215 | Ga0209672_107938 | 3300025228 | Bacteria | 1604 |
| 216 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 217 | Ga0209147_102445 | 3300025229 | Bacteria | 4622 |
| 218 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 219 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 220 | Ga0207427_100368 | 3300025231 | Bacteria | 27652 |
| 221 | Ga0209437_100117 | 3300025233 | Bacteria | 209271 |
| 222 | Ga0209258_100015 | 3300025242 | Bacteria | 706310 |
| 223 | Ga0209258_100074 | 3300025242 | Bacteria | 271062 |
| 224 | Ga0209258_100807 | 3300025242 | Bacteria | 18278 |
| 225 | Ga0207425_1000062 | 3300025245 | Bacteria | 136118 |
| 226 | Ga0207425_1000514 | 3300025245 | Bacteria | 23629 |
| 227 | Ga0207425_1044902 | 3300025245 | Bacteria | 828 |
| 228 | Ga0209646_1000040 | 3300025246 | Bacteria | 347867 |
| 229 | Ga0209646_1000105 | 3300025246 | Bacteria | 163453 |
| 230 | Ga0209026_1000488 | 3300025250 | Bacteria | 29057 |
| 231 | Ga0209026_1005485 | 3300025250 | Bacteria | 3403 |
| 232 | Ga0209026_1017045 | 3300025250 | Bacteria | 1167 |
| 233 | Ga0209677_100026 | 3300025253 | Bacteria | 382520 |
| 234 | Ga0209148_1000183 | 3300025254 | Bacteria | 122620 |
| 235 | Ga0209759_1000283 | 3300025256 | Bacteria | 70895 |
| 236 | Ga0209759_1000440 | 3300025256 | Bacteria | 48778 |
| 237 | Ga0209759_1000983 | 3300025256 | Bacteria | 19685 |
| 238 | Ga0209759_1020165 | 3300025256 | Bacteria | 1557 |
| 239 | Ga0209129_1000049 | 3300025258 | Bacteria | 268086 |
| 240 | Ga0209129_1003746 | 3300025258 | Bacteria | 6421 |
| 241 | Ga0209129_1004947 | 3300025258 | Bacteria | 4949 |
| 242 | Ga0209233_1024906 | 3300025261 | Bacteria | 1489 |
| 243 | Ga0209565_1000622 | 3300025263 | Bacteria | 23367 |
| 244 | Ga0209565_1000784 | 3300025263 | Bacteria | 18444 |
| 245 | Ga0209565_1001080 | 3300025263 | Bacteria | 13621 |
| 246 | Ga0209455_1000066 | 3300025272 | Bacteria | 316811 |
| 247 | Ga0209673_1004605 | 3300025273 | Bacteria | 7310 |
| 248 | Ga0209673_1007711 | 3300025273 | Bacteria | 4901 |
| 249 | Ga0209130_1000200 | 3300025284 | Bacteria | 81072 |
| 250 | Ga0209130_1000927 | 3300025284 | Bacteria | 23469 |
| 251 | Ga0209675_1000280 | 3300025291 | Bacteria | 48644 |
| 252 | Ga0209675_1000320 | 3300025291 | Bacteria | 43027 |
| 253 | Ga0209675_1033941 | 3300025291 | Bacteria | 1178 |
| 254 | Ga0209676_1000416 | 3300025292 | Bacteria | 76249 |
| 255 | Ga0209676_1023447 | 3300025292 | Bacteria | 2020 |
| 256 | Ga0209025_1000049 | 3300025294 | Bacteria | 333459 |
| 257 | Ga0209025_1000290 | 3300025294 | Bacteria | 113067 |
| 258 | Ga0209025_1000481 | 3300025294 | Bacteria | 77405 |
| 259 | Ga0209025_1023819 | 3300025294 | Bacteria | 3184 |
| 260 | Ga0209025_1034232 | 3300025294 | Bacteria | 2325 |
| 261 | Ga0209564_1000005 | 3300025295 | Bacteria | 1147192 |
| 262 | Ga0209564_1000232 | 3300025295 | Bacteria | 122080 |
| 263 | Ga0209564_1001080 | 3300025295 | Bacteria | 32728 |
| 264 | Ga0209758_1000135 | 3300025297 | Bacteria | 177753 |
| 265 | Ga0209050_1000137 | 3300025298 | Bacteria | 178099 |
| 266 | Ga0209050_1001144 | 3300025298 | Bacteria | 31864 |
| 267 | Ga0209050_1002997 | 3300025298 | Bacteria | 13122 |
| 268 | Ga0209050_1014411 | 3300025298 | Bacteria | 3406 |
| 269 | Ga0209050_1016119 | 3300025298 | Bacteria | 3080 |
| 270 | Ga0209050_1033391 | 3300025298 | Bacteria | 1561 |
| 271 | Ga0209050_1044273 | 3300025298 | Bacteria | 1192 |
| 272 | Ga0209256_1000036 | 3300025299 | Bacteria | 386664 |
| 273 | Ga0209256_1000129 | 3300025299 | Bacteria | 163766 |
| 274 | Ga0209256_1000507 | 3300025299 | Bacteria | 57359 |
| 275 | Ga0209256_1001246 | 3300025299 | Bacteria | 28158 |
| 276 | Ga0209256_1001972 | 3300025299 | Bacteria | 18495 |
| 277 | Ga0207426_1000171 | 3300025302 | Bacteria | 163766 |
| 278 | Ga0207426_1001027 | 3300025302 | Bacteria | 26714 |
| 279 | Ga0209051_1000071 | 3300025303 | Bacteria | 210843 |
| 280 | Ga0209051_1000389 | 3300025303 | Bacteria | 61949 |
| 281 | Ga0209051_1000571 | 3300025303 | Bacteria | 44685 |
| 282 | Ga0209051_1001283 | 3300025303 | Bacteria | 22266 |
| 283 | Ga0209257_1000268 | 3300025304 | Bacteria | 119801 |
| 284 | Ga0209257_1003990 | 3300025304 | Bacteria | 11915 |
| 285 | Ga0209257_1004891 | 3300025304 | Bacteria | 9892 |
| 286 | Ga0209257_1005567 | 3300025304 | Bacteria | 8764 |
| 287 | Ga0207655_1121602 | 3300025728 | Bacteria | 864 |
| 288 | Ga0207713_1048626 | 3300025735 | Bacteria | 1706 |
| 289 | Ga0207682_10048792 | 3300025893 | Bacteria | 1746 |
| 290 | Ga0207680_10020853 | 3300025903 | Bacteria | 3538 |
| 291 | Ga0207680_10295275 | 3300025903 | Bacteria | 1129 |
| 292 | Ga0207645_10277674 | 3300025907 | Bacteria | 1112 |
| 293 | Ga0207645_10319488 | 3300025907 | Bacteria | 1035 |
| 294 | Ga0207645_10539997 | 3300025907 | Bacteria | 790 |
| 295 | Ga0207645_10652426 | 3300025907 | Bacteria | 715 |
| 296 | Ga0207684_10002530 | 3300025910 | Bacteria | 18373 |
| 297 | Ga0207684_10044354 | 3300025910 | Bacteria | 3770 |
| 298 | Ga0207695_10007069 | 3300025913 | Bacteria | 14392 |
| 299 | Ga0207695_10015960 | 3300025913 | Bacteria | 8816 |
| 300 | Ga0207695_10031887 | 3300025913 | Bacteria | 5772 |
| 301 | Ga0207695_10169880 | 3300025913 | Bacteria | 2106 |
| 302 | Ga0207671_10006244 | 3300025914 | Bacteria | 10680 |
| 303 | Ga0207662_10440970 | 3300025918 | Bacteria | 889 |
| 304 | Ga0207649_10002253 | 3300025920 | Bacteria | 10896 |
| 305 | Ga0207646_10027740 | 3300025922 | Bacteria | 5161 |
| 306 | Ga0207681_10671401 | 3300025923 | Bacteria | 860 |
| 307 | Ga0207650_10143168 | 3300025925 | Bacteria | 1881 |
| 308 | Ga0207687_10218081 | 3300025927 | Bacteria | 1500 |
| 309 | Ga0207644_10042813 | 3300025931 | Bacteria | 3211 |
| 310 | Ga0207706_10053271 | 3300025933 | Bacteria | 3572 |
| 311 | Ga0207686_10006598 | 3300025934 | Bacteria | 6253 |
| 312 | Ga0207709_10000195 | 3300025935 | Bacteria | 80988 |
| 313 | Ga0207709_10023265 | 3300025935 | Bacteria | 3525 |
| 314 | Ga0207669_10021238 | 3300025937 | Bacteria | 3423 |
| 315 | Ga0207665_10253054 | 3300025939 | Bacteria | 1302 |
| 316 | Ga0207691_10046723 | 3300025940 | Bacteria | 3976 |
| 317 | Ga0207691_10140728 | 3300025940 | Bacteria | 2127 |
| 318 | Ga0207711_10011294 | 3300025941 | Bacteria | 7419 |
| 319 | Ga0207689_10058844 | 3300025942 | Bacteria | 3161 |
| 320 | Ga0207689_10265032 | 3300025942 | Bacteria | 1422 |
| 321 | Ga0207667_10103274 | 3300025949 | Bacteria | 2940 |
| 322 | Ga0207667_10177901 | 3300025949 | Bacteria | 2185 |
| 323 | Ga0207667_10517830 | 3300025949 | Bacteria | 1208 |
| 324 | Ga0207651_10002249 | 3300025960 | Bacteria | 9163 |
| 325 | Ga0207651_10289247 | 3300025960 | Bacteria | 1358 |
| 326 | Ga0207712_10000336 | 3300025961 | Bacteria | 42617 |
| 327 | Ga0207658_10000050 | 3300025986 | Bacteria | 129714 |
| 328 | Ga0207658_10089205 | 3300025986 | Bacteria | 2386 |
| 329 | Ga0207658_10134382 | 3300025986 | Bacteria | 1992 |
| 330 | Ga0207658_11387799 | 3300025986 | Bacteria | 643 |
| 331 | Ga0207703_10176693 | 3300026035 | Bacteria | 1882 |
| 332 | Ga0207639_10007885 | 3300026041 | Bacteria | 7273 |
| 333 | Ga0207678_10000663 | 3300026067 | Bacteria | 31624 |
| 334 | Ga0207702_10045013 | 3300026078 | Bacteria | 3712 |
| 335 | Ga0207641_10130093 | 3300026088 | Bacteria | 2259 |
| 336 | Ga0207641_10217726 | 3300026088 | Bacteria | 1769 |
| 337 | Ga0207641_10627955 | 3300026088 | Bacteria | 1054 |
| 338 | Ga0207648_10000286 | 3300026089 | Bacteria | 54985 |
| 339 | Ga0207648_10063612 | 3300026089 | Bacteria | 3215 |
| 340 | Ga0207648_10192596 | 3300026089 | Bacteria | 1807 |
| 341 | Ga0207648_10682791 | 3300026089 | Bacteria | 951 |
| 342 | Ga0207676_10144634 | 3300026095 | Bacteria | 2040 |
| 343 | Ga0207674_10345251 | 3300026116 | Bacteria | 1439 |
| 344 | Ga0207674_10432355 | 3300026116 | Bacteria | 1272 |
| 345 | Ga0207675_100018813 | 3300026118 | Bacteria | 6446 |
| 346 | Ga0207683_10001622 | 3300026121 | Bacteria | 20162 |
| 347 | Ga0207683_10050968 | 3300026121 | Bacteria | 3626 |
| 348 | Ga0207683_10241433 | 3300026121 | Bacteria | 1648 |
| 349 | Ga0207683_10545867 | 3300026121 | Bacteria | 1071 |
| 350 | Ga0207698_10035255 | 3300026142 | Bacteria | 3658 |
| 351 | Ga0207698_10037499 | 3300026142 | Bacteria | 3571 |
| 352 | Ga0207698_11456249 | 3300026142 | Bacteria | 700 |
| 353 | Ga0209389_1003148 | 3300027296 | Bacteria | 13134 |
| 354 | Ga0209282_1000396 | 3300027666 | Bacteria | 21285 |
| 355 | Ga0209971_1008466 | 3300027682 | Bacteria | 2439 |
| 356 | Ga0209974_10001575 | 3300027876 | Bacteria | 8260 |
| 357 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 358 | Ga0268266_10011177 | 3300028379 | Bacteria | 7814 |
| 359 | Ga0268266_10376649 | 3300028379 | Bacteria | 1338 |
| 360 | Ga0268266_10785571 | 3300028379 | Bacteria | 919 |
| 361 | Ga0268265_10055037 | 3300028380 | Bacteria | 3021 |
| 362 | Ga0268264_10235878 | 3300028381 | Bacteria | 1692 |
| 363 | Ga0307517_10000122 | 3300028786 | Bacteria | 116429 |
| 364 | Ga0307517_10412521 | 3300028786 | Bacteria | 711 |
| 365 | Ga0307515_10000006 | 3300028794 | Bacteria | 725810 |
| 366 | Ga0307515_10000063 | 3300028794 | Bacteria | 245504 |
| 367 | Ga0307515_10000180 | 3300028794 | Bacteria | 156173 |
| 368 | Ga0307515_10048523 | 3300028794 | Bacteria | 6418 |
| 369 | Ga0307515_10440058 | 3300028794 | Bacteria | 921 |
| 370 | Ga0307512_10127849 | 3300030522 | Bacteria | 1606 |
| 371 | Ga0316176_1198574 | 3300030732 | Bacteria | 2575 |
| 372 | Ga0314311_1191027 | 3300030733 | Bacteria | 3572 |
| 373 | Ga0316178_1088868 | 3300030735 | Bacteria | 3622 |
| 374 | Ga0316180_1178293 | 3300030736 | Bacteria | 3373 |
| 375 | Ga0316183_1121522 | 3300030742 | Bacteria | 2531 |
| 376 | Ga0316181_1215410 | 3300030744 | Bacteria | 2408 |
| 377 | Ga0316182_1300217 | 3300030745 | Bacteria | 1777 |
| 378 | Ga0265762_1012385 | 3300030760 | Bacteria | 1530 |
| 379 | Ga0265332_10012972 | 3300031238 | Bacteria | 3695 |
| 380 | Ga0265328_10000099 | 3300031239 | Bacteria | 42676 |
| 381 | Ga0265328_10059498 | 3300031239 | Bacteria | 1402 |
| 382 | Ga0265331_10011136 | 3300031250 | Bacteria | 4933 |
| 383 | Ga0265331_10023444 | 3300031250 | Bacteria | 3135 |
| 384 | Ga0265331_10049747 | 3300031250 | Bacteria | 2012 |
| 385 | Ga0265327_10000761 | 3300031251 | Bacteria | 50014 |
| 386 | Ga0265327_10005592 | 3300031251 | Bacteria | 10418 |
| 387 | Ga0265316_10014876 | 3300031344 | Bacteria | 6825 |
| 388 | Ga0265316_10268753 | 3300031344 | Bacteria | 1248 |
| 389 | Ga0265316_10316629 | 3300031344 | Bacteria | 1134 |
| 390 | Ga0265316_10448470 | 3300031344 | Unclassified | 925 |
| 391 | Ga0307513_10000057 | 3300031456 | Bacteria | 146564 |
| 392 | Ga0307513_10001087 | 3300031456 | Bacteria | 39457 |
| 393 | Ga0307513_10108068 | 3300031456 | Bacteria | 2784 |
| 394 | Ga0307513_10204799 | 3300031456 | Bacteria | 1810 |
| 395 | Ga0307513_10207305 | 3300031456 | Bacteria | 1795 |
| 396 | Ga0307513_10228351 | 3300031456 | Bacteria | 1676 |
| 397 | Ga0307509_10102011 | 3300031507 | Bacteria | 2902 |
| 398 | Ga0307408_100001592 | 3300031548 | Bacteria | 16755 |
| 399 | Ga0307408_100018923 | 3300031548 | Bacteria | 4630 |
| 400 | Ga0307408_100093440 | 3300031548 | Bacteria | 2275 |
| 401 | Ga0307408_100301400 | 3300031548 | Bacteria | 1342 |
| 402 | Ga0307514_10006928 | 3300031649 | Bacteria | 9809 |
| 403 | Ga0265342_10021111 | 3300031712 | Bacteria | 4165 |
| 404 | Ga0307516_10007037 | 3300031730 | Bacteria | 13027 |
| 405 | Ga0307405_10056120 | 3300031731 | Bacteria | 2468 |
| 406 | Ga0307405_10058753 | 3300031731 | Bacteria | 2421 |
| 407 | Ga0307405_10200908 | 3300031731 | Bacteria | 1447 |
| 408 | Ga0307410_10097413 | 3300031852 | Bacteria | 2101 |
| 409 | Ga0307406_10008206 | 3300031901 | Bacteria | 5820 |
| 410 | Ga0307412_10019978 | 3300031911 | Bacteria | 4068 |
| 411 | Ga0307412_10130642 | 3300031911 | Bacteria | 1823 |
| 412 | Ga0307412_10262355 | 3300031911 | Bacteria | 1347 |
| 413 | Ga0307412_10705339 | 3300031911 | Bacteria | 866 |
| 414 | Ga0307416_100015615 | 3300032002 | Bacteria | 5251 |
| 415 | Ga0307416_100178069 | 3300032002 | Bacteria | 1989 |
| 416 | Ga0307416_100197801 | 3300032002 | Bacteria | 1903 |
| 417 | Ga0307414_10034622 | 3300032004 | Bacteria | 3351 |
| 418 | Ga0307414_10083041 | 3300032004 | Bacteria | 2351 |
| 419 | Ga0307411_10060570 | 3300032005 | Bacteria | 2514 |
| 420 | Ga0307411_11140172 | 3300032005 | Bacteria | 704 |
| 421 | Ga0307507_10065230 | 3300033179 | Bacteria | 3351 |
| 422 | Ga0373946_0189383 | 3300035171 | Bacteria | 980 |
| 423 | Ga0373931_0001406 | 3300035691 | Bacteria | 10299 |
| 424 | Ga0373931_0014852 | 3300035691 | Bacteria | 3814 |
| 425 | Ga0373935_0233026 | 3300035692 | Bacteria | 1283 |
| 426 | Ga0373927_0086739 | 3300035695 | Bacteria | 2031 |
| 427 | Ga0373927_0140272 | 3300035695 | Bacteria | 1581 |
| 428 | Ga0373933_0447381 | 3300035724 | Bacteria | 845 |
| 429 | Ga0373937_0454910 | 3300036401 | Bacteria | 1216 |
| 430 | Ga0373925_0002246 | 3300037068 | Bacteria | 15638 |
| 431 | Ga0373925_0213274 | 3300037068 | Bacteria | 1538 |
| 432 | Ga0395899_0143192 | 3300037312 | Bacteria | 1699 |
| 433 | Ga0395898_0002038 | 3300037466 | Bacteria | 25293 |
| 434 | Ga0395901_0032389 | 3300038443 | Bacteria | 5393 |
| 435 | Ga0436361_0916410 | 3300039447 | Bacteria | 83869 |
| 436 | Ga0439436_0004767 | 3300041404 | Bacteria | 4159 |
| 437 | Ga0439439_0004798 | 3300041406 | Bacteria | 3062 |
| 438 | Ga0439447_015746 | 3300041407 | Bacteria | 2092 |
| 439 | Ga0439466_0024549 | 3300041411 | Bacteria | 2111 |
| 440 | Ga0439466_0132660 | 3300041411 | Bacteria | 766 |
| 441 | Ga0439465_0012723 | 3300041413 | Bacteria | 2631 |
| 442 | Ga0439465_0102265 | 3300041413 | Bacteria | 990 |
| 443 | Ga0451833_0587766 | 3300041491 | Bacteria | 816 |
| 444 | Ga0439442_001053 | 3300042002 | Bacteria | 5558 |
| 445 | Ga0439442_010185 | 3300042002 | Bacteria | 1904 |
| 446 | Ga0439449_0017982 | 3300042007 | Bacteria | 2653 |
| 447 | Ga0439452_013087 | 3300042010 | Bacteria | 2338 |
| 448 | Ga0439457_012991 | 3300042014 | Bacteria | 1873 |
| 449 | Ga0439462_0012542 | 3300042015 | Bacteria | 2165 |
| 450 | Ga0450920_075857 | 3300042122 | Bacteria | 686 |
| 451 | Ga0450921_000114 | 3300042123 | Bacteria | 2662 |
| 452 | Ga0450898_014643 | 3300042134 | Bacteria | 1321 |
| 453 | Ga0450906_009974 | 3300042145 | Bacteria | 1803 |
| 454 | Ga0450906_015374 | 3300042145 | Bacteria | 1391 |
| 455 | Ga0439446_0029265 | 3300042156 | Bacteria | 1589 |
| 456 | Ga0439458_0055218 | 3300042157 | Bacteria | 985 |
| 457 | Ga0450908_014046 | 3300042184 | Bacteria | 1443 |
| 458 | Ga0450909_006857 | 3300042185 | Bacteria | 1641 |
| 459 | Ga0439434_0007660 | 3300042435 | Bacteria | 3164 |
| 460 | Ga0439434_0068655 | 3300042435 | Bacteria | 1114 |
| 461 | Ga0450918_002122 | 3300042531 | Bacteria | 3781 |
| 462 | Ga0450893_0055565 | 3300042532 | Bacteria | 748 |
| 463 | Ga0451577_0000058 | 3300042876 | Bacteria | 272673 |
| 464 | Ga0466969_0122226 | 3300044656 | Bacteria | 1211 |
| 465 | Ga0466965_0074158 | 3300044683 | Bacteria | 1714 |
| 466 | Ga0466961_0106999 | 3300044693 | Bacteria | 1760 |
| 467 | Ga0453684_0000279 | 3300044712 | Bacteria | 220016 |
| 468 | Ga0466971_0091547 | 3300044719 | Bacteria | 1393 |
| 469 | Ga0466957_0110593 | 3300044842 | Bacteria | 1742 |
| 470 | Ga0466960_0126627 | 3300044901 | Bacteria | 1343 |
| 471 | Ga0466959_0251207 | 3300045049 | Bacteria | 1219 |
| 472 | Ga0451576_0075529 | 3300045051 | Bacteria | 3507 |
| 473 | Ga0495617_114687 | 3300046452 | Bacteria | 870 |
| 474 | Ga0495627_009258 | 3300046453 | Bacteria | 3631 |
| 475 | Ga0495627_026206 | 3300046453 | Bacteria | 1882 |
| 476 | Ga0495592_0284051 | 3300046454 | Bacteria | 1081 |
| 477 | Ga0495592_0451537 | 3300046454 | Bacteria | 805 |
| 478 | Ga0495638_0004410 | 3300046460 | Bacteria | 10656 |
| 479 | Ga0495651_0197120 | 3300046462 | Bacteria | 1412 |
| 480 | Ga0495650_0005841 | 3300046471 | Bacteria | 7843 |
| 481 | Ga0495580_0015345 | 3300046472 | Bacteria | 5779 |
| 482 | Ga0495580_0063917 | 3300046472 | Bacteria | 2580 |
| 483 | Ga0495605_0001007 | 3300046474 | Bacteria | 19014 |
| 484 | Ga0495639_0018354 | 3300046475 | Bacteria | 3045 |
| 485 | Ga0495607_0015333 | 3300046501 | Bacteria | 4970 |
| 486 | Ga0495607_0083083 | 3300046501 | Bacteria | 1755 |
| 487 | Ga0495607_0290178 | 3300046501 | Bacteria | 773 |
| 488 | Ga0495616_0008603 | 3300046513 | Bacteria | 6027 |
| 489 | Ga0495620_0023977 | 3300046515 | Bacteria | 2908 |
| 490 | Ga0495630_0500612 | 3300046517 | Bacteria | 932 |
| 491 | Ga0495631_0026804 | 3300046518 | Bacteria | 2642 |
| 492 | Ga0495632_0001453 | 3300046519 | Bacteria | 19693 |
| 493 | Ga0495632_0056631 | 3300046519 | Bacteria | 1916 |
| 494 | Ga0495648_0011006 | 3300046524 | Bacteria | 6854 |
| 495 | Ga0495648_0173053 | 3300046524 | Bacteria | 1105 |
| 496 | Ga0495663_0033974 | 3300046525 | Bacteria | 1525 |
| 497 | Ga0495666_0001760 | 3300046526 | Bacteria | 10682 |
| 498 | Ga0495642_0112823 | 3300046528 | Bacteria | 1163 |
| 499 | Ga0495642_0296381 | 3300046528 | Bacteria | 708 |
| 500 | Ga0495654_0139830 | 3300046530 | Bacteria | 1080 |
| 501 | Ga0495654_0295488 | 3300046530 | Bacteria | 663 |
| 502 | Ga0495665_0004194 | 3300046531 | Bacteria | 7777 |
| 503 | Ga0495609_0046682 | 3300046538 | Bacteria | 1939 |
| 504 | Ga0495609_0049120 | 3300046538 | Bacteria | 1884 |
| 505 | Ga0495609_0061964 | 3300046538 | Bacteria | 1652 |
| 506 | Ga0495621_0004503 | 3300046539 | Bacteria | 3927 |
| 507 | Ga0495621_0034953 | 3300046539 | Bacteria | 1738 |
| 508 | Ga0495621_0323100 | 3300046539 | Bacteria | 643 |
| 509 | Ga0495645_0270063 | 3300046543 | Bacteria | 1123 |
| 510 | Ga0495622_0091663 | 3300046557 | Bacteria | 1396 |
| 511 | Ga0495625_0013068 | 3300046660 | Bacteria | 6691 |
| 512 | Ga0495625_0047954 | 3300046660 | Bacteria | 3078 |
| 513 | Ga0495625_0287510 | 3300046660 | Bacteria | 1056 |
| 514 | Ga0495635_0175417 | 3300046663 | Bacteria | 1457 |
| 515 | Ga0495659_0001216 | 3300046664 | Bacteria | 8912 |
| 516 | Ga0495588_0037069 | 3300046674 | Bacteria | 2476 |
| 517 | Ga0495588_0037534 | 3300046674 | Bacteria | 2462 |
| 518 | Ga0495588_0204013 | 3300046674 | Bacteria | 1044 |
| 519 | Ga0495588_0221591 | 3300046674 | Bacteria | 998 |
| 520 | Ga0495646_0129939 | 3300046680 | Bacteria | 1419 |
| 521 | Ga0495658_0109476 | 3300046683 | Bacteria | 1659 |
| 522 | Ga0495658_0145721 | 3300046683 | Bacteria | 1451 |
| 523 | Ga0495670_0045794 | 3300046691 | Bacteria | 2184 |
| 524 | Ga0495670_0144581 | 3300046691 | Bacteria | 1245 |
| 525 | Ga0495671_0007254 | 3300046692 | Bacteria | 6335 |
| 526 | Ga0495671_0210647 | 3300046692 | Bacteria | 942 |
| 527 | Ga0495660_0002148 | 3300046810 | Bacteria | 12712 |
| 528 | Ga0495581_0474490 | 3300047315 | Bacteria | 728 |
| 529 | Ga0495636_0150871 | 3300047318 | Bacteria | 1043 |
| 530 | Ga0495672_0001590 | 3300047320 | Bacteria | 22164 |
| 531 | Ga0495676_0023899 | 3300047321 | Bacteria | 5296 |
| 532 | Ga0495676_0143734 | 3300047321 | Bacteria | 1707 |
| 533 | Ga0495673_0002648 | 3300047469 | Bacteria | 12387 |
| 534 | Ga0495593_0024141 | 3300047673 | Bacteria | 3372 |
| 535 | Ga0495614_0416220 | 3300048089 | Bacteria | 633 |
| 536 | Ga0496101_0016100 | 3300048904 | Bacteria | 5048 |
| 537 | Ga0496104_0063130 | 3300048907 | Bacteria | 3512 |
| 538 | Ga0496104_0421736 | 3300048907 | Bacteria | 1246 |
| 539 | Ga0496105_0006802 | 3300048908 | Bacteria | 8796 |
| 540 | Ga0496106_0279524 | 3300048909 | Bacteria | 1337 |
| 541 | Ga0496108_0363015 | 3300048911 | Bacteria | 1264 |
| 542 | Ga0496109_0089602 | 3300048912 | Bacteria | 2844 |
| 543 | Ga0496109_0383735 | 3300048912 | Bacteria | 1327 |
| 544 | Ga0496110_0427471 | 3300048913 | Bacteria | 1207 |
| 545 | Ga0496112_0016952 | 3300048915 | Bacteria | 6837 |
| 546 | Ga0496113_0249084 | 3300048916 | Bacteria | 1418 |
| 547 | Ga0496114_0187903 | 3300048917 | Bacteria | 1806 |
| 548 | Ga0496114_0246025 | 3300048917 | Bacteria | 1573 |
| 549 | Ga0496116_0013376 | 3300048919 | Bacteria | 6623 |
| 550 | Ga0496116_0049945 | 3300048919 | Bacteria | 2791 |
| 551 | Ga0496117_0124523 | 3300048920 | Bacteria | 1576 |
| 552 | Ga0496117_0150078 | 3300048920 | Bacteria | 1381 |
| 553 | Ga0496118_0244615 | 3300048921 | Bacteria | 1024 |
| 554 | Ga0496119_0132096 | 3300048922 | Bacteria | 1359 |
| 555 | Ga0496121_0035132 | 3300048924 | Bacteria | 4497 |
| 556 | Ga0496121_0057695 | 3300048924 | Bacteria | 3215 |
| 557 | Ga0496121_0081252 | 3300048924 | Bacteria | 2566 |
| 558 | Ga0496121_0127439 | 3300048924 | Bacteria | 1911 |
| 559 | Ga0496121_0221605 | 3300048924 | Bacteria | 1332 |
| 560 | Ga0496121_0227503 | 3300048924 | Bacteria | 1309 |
| 561 | Ga0496122_0000272 | 3300048925 | Bacteria | 115666 |
| 562 | Ga0496122_0000677 | 3300048925 | Bacteria | 68515 |
| 563 | Ga0496122_0002573 | 3300048925 | Bacteria | 25486 |
| 564 | Ga0496122_0153051 | 3300048925 | Bacteria | 1420 |
| 565 | Ga0496123_0000221 | 3300048926 | Bacteria | 115688 |
| 566 | Ga0496123_0000230 | 3300048926 | Bacteria | 113513 |
| 567 | Ga0496123_0002577 | 3300048926 | Bacteria | 22061 |
| 568 | Ga0496123_0007096 | 3300048926 | Bacteria | 10646 |
| 569 | Ga0496123_0111524 | 3300048926 | Bacteria | 1562 |
| 570 | Ga0496123_0193640 | 3300048926 | Bacteria | 1049 |
| 571 | Ga0496124_0076553 | 3300048927 | Bacteria | 2761 |
| 572 | Ga0496125_0002327 | 3300048928 | Bacteria | 25024 |
| 573 | Ga0496125_0026487 | 3300048928 | Bacteria | 5281 |
| 574 | Ga0496125_0067527 | 3300048928 | Bacteria | 2817 |
| 575 | Ga0496125_0121855 | 3300048928 | Bacteria | 1858 |
| 576 | Ga0496125_0236899 | 3300048928 | Bacteria | 1162 |
| 577 | Ga0496126_0083680 | 3300048929 | Bacteria | 2816 |
| 578 | Ga0496126_0526484 | 3300048929 | Bacteria | 941 |
| 579 | Ga0495682_0000304 | 3300049460 | Bacteria | 37379 |
| 580 | Ga0501038_0211627 | 3300049574 | Bacteria | 1551 |
| 581 | Ga0501040_0637367 | 3300049576 | Bacteria | 770 |
| 582 | Ga0501041_0462910 | 3300049577 | Bacteria | 805 |
| 583 | Ga0501071_0056337 | 3300049587 | Bacteria | 2839 |
| 584 | Ga0501071_0251511 | 3300049587 | Bacteria | 1334 |
| 585 | Ga0501072_0002693 | 3300049588 | Bacteria | 13329 |
| 586 | Ga0501073_0103199 | 3300049589 | Bacteria | 1980 |
| 587 | Ga0501075_0038677 | 3300049591 | Bacteria | 3567 |
| 588 | Ga0501076_0023771 | 3300049592 | Bacteria | 4728 |
| 589 | Ga0501076_0315713 | 3300049592 | Bacteria | 1282 |
| 590 | Ga0501077_0007142 | 3300049593 | Bacteria | 6886 |
| 591 | Ga0501077_0116177 | 3300049593 | Bacteria | 1696 |
| 592 | Ga0501079_0011775 | 3300049741 | Bacteria | 6679 |
| 593 | Ga0501081_0231000 | 3300049743 | Bacteria | 1347 |
| 594 | nmdc:mga03683_110525_c1 | 3300050489 | Bacteria | 1215 |
| 595 | nmdc:mga0k408_168000_c1 | 3300050493 | Bacteria | 1307 |
| 596 | nmdc:mga0k408_18269_c1 | 3300050493 | Bacteria | 3913 |
| 597 | nmdc:mga0k408_26863_c1 | 3300050493 | Bacteria | 3265 |
| 598 | nmdc:mga0k408_271366_c1 | 3300050493 | Bacteria | 1013 |
| 599 | nmdc:mga0k408_36500_c1 | 3300050493 | Bacteria | 2821 |
| 600 | nmdc:mga0k408_367332_c1 | 3300050493 | Bacteria | 857 |
| 601 | nmdc:mga0k408_79_c1 | 3300050493 | Bacteria | 45658 |
| 602 | nmdc:mga06z11_408905_c1 | 3300050494 | Bacteria | 817 |
| 603 | nmdc:mga06z11_47765_c1 | 3300050494 | Bacteria | 2175 |
| 604 | nmdc:mga07m45_255087_c1 | 3300050496 | Bacteria | 1020 |
| 605 | nmdc:mga07m45_28475_c1 | 3300050496 | Bacteria | 3084 |
| 606 | nmdc:mga07m45_56704_c1 | 3300050496 | Bacteria | 2215 |
| 607 | nmdc:mga05p37_900498_c1 | 3300050507 | Bacteria | 954 |
| 608 | nmdc:mga0sz30_201919_c1 | 3300050516 | Bacteria | 883 |
| 609 | Ga0500610_0004379 | 3300053079 | Bacteria | 5596 |
| 610 | Ga0500610_0034892 | 3300053079 | Bacteria | 2576 |
| 611 | Ga0500610_0129588 | 3300053079 | Bacteria | 1284 |
| 612 | Ga0500643_004765 | 3300053087 | Bacteria | 6012 |
| 613 | Ga0500643_021459 | 3300053087 | Bacteria | 2092 |
| 614 | Ga0500651_0000395 | 3300053093 | Bacteria | 23711 |
| 615 | Ga0500651_0012504 | 3300053093 | Bacteria | 5148 |
| 616 | Ga0500566_0189442 | 3300053094 | Bacteria | 1048 |
| 617 | Ga0500641_0215027 | 3300053096 | Bacteria | 817 |
| 618 | Ga0500569_041330 | 3300053109 | Bacteria | 1352 |
| 619 | Ga0500571_000093 | 3300053110 | Bacteria | 29025 |
| 620 | Ga0500572_201879 | 3300053111 | Bacteria | 651 |
| 621 | Ga0500593_002392 | 3300053117 | Bacteria | 6869 |
| 622 | Ga0500594_0007706 | 3300053118 | Bacteria | 2441 |
| 623 | Ga0500597_000069 | 3300053120 | Bacteria | 20831 |
| 624 | Ga0500597_080628 | 3300053120 | Bacteria | 1412 |
| 625 | Ga0500607_000797 | 3300053121 | Bacteria | 30420 |
| 626 | Ga0500608_081583 | 3300053122 | Bacteria | 1525 |
| 627 | Ga0500626_100934 | 3300053128 | Bacteria | 1257 |
| 628 | Ga0500642_0225499 | 3300053130 | Bacteria | 867 |
| 629 | Ga0500642_0280447 | 3300053130 | Bacteria | 757 |
| 630 | Ga0500655_010341 | 3300053133 | Bacteria | 1684 |
| 631 | Ga0500658_0000934 | 3300053134 | Bacteria | 11917 |
| 632 | Ga0500658_0002439 | 3300053134 | Bacteria | 7192 |
| 633 | Ga0500559_0005005 | 3300053136 | Bacteria | 6152 |
| 634 | Ga0500559_0078584 | 3300053136 | Bacteria | 1496 |
| 635 | Ga0500561_0090888 | 3300053137 | Bacteria | 903 |
| 636 | Ga0500564_065888 | 3300053138 | Bacteria | 1638 |
| 637 | Ga0500568_0003759 | 3300053139 | Bacteria | 8312 |
| 638 | Ga0500568_0004611 | 3300053139 | Bacteria | 7336 |
| 639 | Ga0500574_011334 | 3300053141 | Bacteria | 2009 |
| 640 | Ga0500590_118604 | 3300053148 | Bacteria | 1243 |
| 641 | Ga0500616_0052295 | 3300053153 | Bacteria | 2148 |
| 642 | Ga0500622_0043499 | 3300053156 | Bacteria | 2329 |
| 643 | Ga0500624_003001 | 3300053157 | Bacteria | 2229 |
| 644 | Ga0500627_0004559 | 3300053158 | Bacteria | 4471 |
| 645 | Ga0500634_0042972 | 3300053161 | Bacteria | 2451 |
| 646 | Ga0500634_0055391 | 3300053161 | Bacteria | 2121 |
| 647 | Ga0500634_0223400 | 3300053161 | Bacteria | 806 |
| 648 | Ga0500636_0071747 | 3300053177 | Bacteria | 2008 |
| 649 | Ga0500625_036289 | 3300053729 | Bacteria | 2333 |
| 650 | Ga0500625_113089 | 3300053729 | Bacteria | 1109 |
| 651 | Ga0500645_011689 | 3300053730 | Bacteria | 2857 |
| 652 | Ga0500661_011630 | 3300055283 | Bacteria | 1590 |
| 653 | Ga0466962_0008155 | 3300061719 | Bacteria | 5022 |
| 654 | Ga0530510_0253022 | 3300061734 | Bacteria | 1313 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046519 | Ga0495632_0001453 | Ga0495632_0001453_17859_18452 | 178 |
| 2 | 3300053130 | Ga0500642_0225499 | Ga0500642_0225499_110_682 | 179 |
| 3 | 3300053139 | Ga0500568_0004611 | Ga0500568_0004611_1385_1978 | 180 |
| 4 | 3300046501 | Ga0495607_0083083 | Ga0495607_0083083_635_1222 | 181 |
| 5 | 3300046539 | Ga0495621_0323100 | Ga0495621_0323100_24_578 | 182 |
| 6 | iso_pu_bacteria | 2929520902 | 2929523709 | 184 |
| 7 | 3300005334 | Ga0068869_101160092 | Ga0068869_1011600921 | 185 |
| 8 | 3300005337 | Ga0070682_100000999 | Ga0070682_10000099913 | 185 |
| 9 | 3300005337 | Ga0070682_100034917 | Ga0070682_1000349172 | 185 |
| 10 | 3300014969 | Ga0157376_10885796 | Ga0157376_108857962 | 185 |
| 11 | iso_pu_bacteria | 2643221658 | 2644326938 | 185 |
| 12 | iso_pu_bacteria | 2643221683 | 2644466407 | 185 |
| 13 | iso_pu_bacteria | 2842733646 | 2842733669 | 185 |
| 14 | iso_pu_bacteria | 2842747753 | 2842752197 | 185 |
| 15 | iso_pu_bacteria | 2885192300 | 2885193827 | 185 |
| 16 | iso_pu_bacteria | 2904541872 | 2904542104 | 185 |
| 17 | iso_pu_bacteria | 2919462493 | 2919465775 | 185 |
| 18 | iso_pu_bacteria | 2928084124 | 2928088667 | 185 |
| 19 | iso_pu_bacteria | 2945909444 | 2945914896 | 185 |
| 20 | 3300030732 | Ga0316176_1198574 | Ga0316176_11985742 | 186 |
| 21 | 3300030733 | Ga0314311_1191027 | Ga0314311_11910272 | 186 |
| 22 | 3300030735 | Ga0316178_1088868 | Ga0316178_10888684 | 186 |
| 23 | 3300030736 | Ga0316180_1178293 | Ga0316180_11782934 | 186 |
| 24 | 3300030742 | Ga0316183_1121522 | Ga0316183_11215224 | 186 |
| 25 | 3300030744 | Ga0316181_1215410 | Ga0316181_12154101 | 186 |
| 26 | 3300030745 | Ga0316182_1300217 | Ga0316182_13002174 | 186 |
| 27 | 3300031548 | Ga0307408_100093440 | Ga0307408_1000934404 | 186 |
| 28 | 3300048926 | Ga0496123_0007096 | Ga0496123_0007096_8979_9608 | 186 |
| 29 | iso_pu_bacteria | 2511231002 | 2511243885 | 186 |
| 30 | iso_pu_bacteria | 2511231014 | 2511316912 | 186 |
| 31 | iso_pu_bacteria | 2643221644 | 2644248561 | 186 |
| 32 | iso_pu_bacteria | 2738543012 | 2739245943 | 186 |
| 33 | iso_pu_bacteria | 2816332133 | 2816471657 | 186 |
| 34 | iso_pu_bacteria | 2818991446 | 2819598086 | 186 |
| 35 | iso_pu_bacteria | 2899924645 | 2899929506 | 186 |
| 36 | iso_pu_bacteria | 2904550169 | 2904552548 | 186 |
| 37 | iso_pu_bacteria | 2928037797 | 2928040048 | 186 |
| 38 | iso_pu_bacteria | 2928044640 | 2928047203 | 186 |
| 39 | iso_pu_bacteria | 2928051484 | 2928057598 | 186 |
| 40 | iso_pu_bacteria | 2928064002 | 2928068020 | 186 |
| 41 | iso_pu_bacteria | 2945984333 | 2945989708 | 186 |
| 42 | 3300003187 | JGI25151J46595_10067258 | JGI25151J46595_100672581 | 187 |
| 43 | 3300005356 | Ga0070674_100289911 | Ga0070674_1002899112 | 187 |
| 44 | 3300005364 | Ga0070673_100206823 | Ga0070673_1002068232 | 187 |
| 45 | 3300005456 | Ga0070678_100161368 | Ga0070678_1001613682 | 187 |
| 46 | 3300005459 | Ga0068867_100360928 | Ga0068867_1003609282 | 187 |
| 47 | 3300049587 | Ga0501071_0251511 | Ga0501071_0251511_432_998 | 187 |
| 48 | iso_pu_bacteria | 2974320154 | 2974323055 | 187 |
| 49 | 3300003781 | Ga0055536_1002561 | Ga0055536_10025612 | 188 |
| 50 | 3300003792 | Ga0055540_1002304 | Ga0055540_10023042 | 188 |
| 51 | 3300003792 | Ga0055540_1003725 | Ga0055540_10037253 | 188 |
| 52 | 3300005844 | Ga0068862_100083940 | Ga0068862_1000839402 | 188 |
| 53 | 3300006058 | Ga0075432_10028369 | Ga0075432_100283692 | 188 |
| 54 | 3300006178 | Ga0075367_10099986 | Ga0075367_100999862 | 188 |
| 55 | 3300006195 | Ga0075366_10020546 | Ga0075366_100205464 | 188 |
| 56 | 3300006353 | Ga0075370_10022779 | Ga0075370_100227791 | 188 |
| 57 | 3300006353 | Ga0075370_10128418 | Ga0075370_101284182 | 188 |
| 58 | 3300006353 | Ga0075370_10232963 | Ga0075370_102329632 | 188 |
| 59 | 3300006948 | Ga0099826_10000537 | Ga0099826_1000053715 | 188 |
| 60 | 3300009036 | Ga0105244_10248751 | Ga0105244_102487512 | 188 |
| 61 | 3300011119 | Ga0105246_10412963 | Ga0105246_104129632 | 188 |
| 62 | 3300012502 | Ga0157347_1000155 | Ga0157347_10001552 | 188 |
| 63 | 3300013104 | Ga0157370_10000627 | Ga0157370_1000062739 | 188 |
| 64 | 3300015261 | Ga0182006_1072205 | Ga0182006_10722052 | 188 |
| 65 | 3300015262 | Ga0182007_10062613 | Ga0182007_100626132 | 188 |
| 66 | 3300017792 | Ga0163161_10042166 | Ga0163161_100421662 | 188 |
| 67 | 3300017792 | Ga0163161_10102239 | Ga0163161_101022392 | 188 |
| 68 | 3300025245 | Ga0207425_1044902 | Ga0207425_10449021 | 188 |
| 69 | 3300025258 | Ga0209129_1004947 | Ga0209129_10049474 | 188 |
| 70 | 3300025292 | Ga0209676_1000416 | Ga0209676_100041640 | 188 |
| 71 | 3300025294 | Ga0209025_1000049 | Ga0209025_1000049202 | 188 |
| 72 | 3300025294 | Ga0209025_1000290 | Ga0209025_1000290103 | 188 |
| 73 | 3300025294 | Ga0209025_1034232 | Ga0209025_10342322 | 188 |
| 74 | 3300025298 | Ga0209050_1002997 | Ga0209050_100299712 | 188 |
| 75 | 3300025298 | Ga0209050_1014411 | Ga0209050_10144112 | 188 |
| 76 | 3300025303 | Ga0209051_1000389 | Ga0209051_100038927 | 188 |
| 77 | 3300025303 | Ga0209051_1000571 | Ga0209051_100057139 | 188 |
| 78 | 3300025728 | Ga0207655_1121602 | Ga0207655_11216021 | 188 |
| 79 | 3300025933 | Ga0207706_10053271 | Ga0207706_100532712 | 188 |
| 80 | 3300025935 | Ga0207709_10000195 | Ga0207709_1000019543 | 188 |
| 81 | 3300025935 | Ga0207709_10023265 | Ga0207709_100232652 | 188 |
| 82 | 3300027666 | Ga0209282_1000396 | Ga0209282_100039616 | 188 |
| 83 | 3300028380 | Ga0268265_10055037 | Ga0268265_100550372 | 188 |
| 84 | 3300030522 | Ga0307512_10127849 | Ga0307512_101278492 | 188 |
| 85 | 3300031649 | Ga0307514_10006928 | Ga0307514_100069287 | 188 |
| 86 | 3300031731 | Ga0307405_10056120 | Ga0307405_100561202 | 188 |
| 87 | 3300031852 | Ga0307410_10097413 | Ga0307410_100974132 | 188 |
| 88 | 3300031901 | Ga0307406_10008206 | Ga0307406_100082062 | 188 |
| 89 | 3300031911 | Ga0307412_10019978 | Ga0307412_100199782 | 188 |
| 90 | 3300031911 | Ga0307412_10262355 | Ga0307412_102623553 | 188 |
| 91 | 3300032002 | Ga0307416_100015615 | Ga0307416_1000156156 | 188 |
| 92 | 3300032002 | Ga0307416_100178069 | Ga0307416_1001780692 | 188 |
| 93 | 3300032004 | Ga0307414_10034622 | Ga0307414_100346222 | 188 |
| 94 | 3300032004 | Ga0307414_10083041 | Ga0307414_100830413 | 188 |
| 95 | 3300032005 | Ga0307411_10060570 | Ga0307411_100605702 | 188 |
| 96 | 3300032005 | Ga0307411_11140172 | Ga0307411_111401722 | 188 |
| 97 | 3300041411 | Ga0439466_0132660 | Ga0439466_0132660_56_646 | 188 |
| 98 | 3300041413 | Ga0439465_0012723 | Ga0439465_0012723_1003_1593 | 188 |
| 99 | 3300042002 | Ga0439442_001053 | Ga0439442_001053_4716_5306 | 188 |
| 100 | 3300042122 | Ga0450920_075857 | Ga0450920_075857_80_670 | 188 |
| 101 | 3300042134 | Ga0450898_014643 | Ga0450898_014643_147_737 | 188 |
| 102 | 3300042145 | Ga0450906_015374 | Ga0450906_015374_196_786 | 188 |
| 103 | 3300042184 | Ga0450908_014046 | Ga0450908_014046_389_979 | 188 |
| 104 | 3300042435 | Ga0439434_0007660 | Ga0439434_0007660_1216_1806 | 188 |
| 105 | 3300042531 | Ga0450918_002122 | Ga0450918_002122_469_1059 | 188 |
| 106 | 3300046453 | Ga0495627_009258 | Ga0495627_009258_694_1278 | 188 |
| 107 | 3300046460 | Ga0495638_0004410 | Ga0495638_0004410_281_862 | 188 |
| 108 | 3300046472 | Ga0495580_0015345 | Ga0495580_0015345_554_1123 | 188 |
| 109 | 3300046472 | Ga0495580_0063917 | Ga0495580_0063917_548_1117 | 188 |
| 110 | 3300046513 | Ga0495616_0008603 | Ga0495616_0008603_1509_2090 | 188 |
| 111 | 3300046515 | Ga0495620_0023977 | Ga0495620_0023977_2244_2828 | 188 |
| 112 | 3300046518 | Ga0495631_0026804 | Ga0495631_0026804_1215_1796 | 188 |
| 113 | 3300046526 | Ga0495666_0001760 | Ga0495666_0001760_5063_5632 | 188 |
| 114 | 3300046531 | Ga0495665_0004194 | Ga0495665_0004194_1801_2370 | 188 |
| 115 | 3300046538 | Ga0495609_0046682 | Ga0495609_0046682_959_1555 | 188 |
| 116 | 3300046539 | Ga0495621_0034953 | Ga0495621_0034953_970_1551 | 188 |
| 117 | 3300046557 | Ga0495622_0091663 | Ga0495622_0091663_554_1135 | 188 |
| 118 | 3300046663 | Ga0495635_0175417 | Ga0495635_0175417_540_1121 | 188 |
| 119 | 3300046674 | Ga0495588_0037069 | Ga0495588_0037069_253_834 | 188 |
| 120 | 3300046674 | Ga0495588_0037534 | Ga0495588_0037534_1534_2124 | 188 |
| 121 | 3300046674 | Ga0495588_0204013 | Ga0495588_0204013_368_952 | 188 |
| 122 | 3300046674 | Ga0495588_0221591 | Ga0495588_0221591_346_942 | 188 |
| 123 | 3300046691 | Ga0495670_0144581 | Ga0495670_0144581_303_893 | 188 |
| 124 | 3300046692 | Ga0495671_0007254 | Ga0495671_0007254_5381_5965 | 188 |
| 125 | 3300047321 | Ga0495676_0023899 | Ga0495676_0023899_1194_1775 | 188 |
| 126 | 3300047673 | Ga0495593_0024141 | Ga0495593_0024141_1250_1831 | 188 |
| 127 | 3300048919 | Ga0496116_0049945 | Ga0496116_0049945_1764_2363 | 188 |
| 128 | 3300048920 | Ga0496117_0124523 | Ga0496117_0124523_412_1011 | 188 |
| 129 | 3300048921 | Ga0496118_0244615 | Ga0496118_0244615_21_620 | 188 |
| 130 | 3300048922 | Ga0496119_0132096 | Ga0496119_0132096_473_1054 | 188 |
| 131 | 3300048924 | Ga0496121_0035132 | Ga0496121_0035132_69_668 | 188 |
| 132 | 3300048924 | Ga0496121_0057695 | Ga0496121_0057695_336_917 | 188 |
| 133 | 3300048924 | Ga0496121_0127439 | Ga0496121_0127439_753_1334 | 188 |
| 134 | 3300048926 | Ga0496123_0111524 | Ga0496123_0111524_698_1279 | 188 |
| 135 | 3300048926 | Ga0496123_0193640 | Ga0496123_0193640_309_908 | 188 |
| 136 | 3300048928 | Ga0496125_0067527 | Ga0496125_0067527_480_1079 | 188 |
| 137 | 3300048928 | Ga0496125_0121855 | Ga0496125_0121855_494_1075 | 188 |
| 138 | 3300048929 | Ga0496126_0526484 | Ga0496126_0526484_37_618 | 188 |
| 139 | 3300050493 | nmdc:mga0k408_36500_c1 | nmdc:mga0k408_36500_c1_1661_2257 | 188 |
| 140 | 3300050496 | nmdc:mga07m45_56704_c1 | nmdc:mga07m45_56704_c1_165_761 | 188 |
| 141 | 3300050516 | nmdc:mga0sz30_201919_c1 | nmdc:mga0sz30_201919_c1_97_666 | 188 |
| 142 | 3300053079 | Ga0500610_0004379 | Ga0500610_0004379_2979_3569 | 188 |
| 143 | 3300053079 | Ga0500610_0034892 | Ga0500610_0034892_1834_2418 | 188 |
| 144 | 3300053079 | Ga0500610_0129588 | Ga0500610_0129588_595_1191 | 188 |
| 145 | 3300053087 | Ga0500643_021459 | Ga0500643_021459_1103_1684 | 188 |
| 146 | 3300053093 | Ga0500651_0000395 | Ga0500651_0000395_1212_1793 | 188 |
| 147 | 3300053094 | Ga0500566_0189442 | Ga0500566_0189442_402_983 | 188 |
| 148 | 3300053096 | Ga0500641_0215027 | Ga0500641_0215027_163_747 | 188 |
| 149 | 3300053109 | Ga0500569_041330 | Ga0500569_041330_56_643 | 188 |
| 150 | 3300053110 | Ga0500571_000093 | Ga0500571_000093_27117_27698 | 188 |
| 151 | 3300053111 | Ga0500572_201879 | Ga0500572_201879_11_592 | 188 |
| 152 | 3300053117 | Ga0500593_002392 | Ga0500593_002392_185_772 | 188 |
| 153 | 3300053118 | Ga0500594_0007706 | Ga0500594_0007706_1128_1709 | 188 |
| 154 | 3300053120 | Ga0500597_080628 | Ga0500597_080628_498_1079 | 188 |
| 155 | 3300053121 | Ga0500607_000797 | Ga0500607_000797_836_1420 | 188 |
| 156 | 3300053122 | Ga0500608_081583 | Ga0500608_081583_672_1253 | 188 |
| 157 | 3300053128 | Ga0500626_100934 | Ga0500626_100934_359_940 | 188 |
| 158 | 3300053133 | Ga0500655_010341 | Ga0500655_010341_458_1039 | 188 |
| 159 | 3300053134 | Ga0500658_0000934 | Ga0500658_0000934_419_1000 | 188 |
| 160 | 3300053134 | Ga0500658_0002439 | Ga0500658_0002439_2626_3207 | 188 |
| 161 | 3300053137 | Ga0500561_0090888 | Ga0500561_0090888_258_839 | 188 |
| 162 | 3300053138 | Ga0500564_065888 | Ga0500564_065888_867_1448 | 188 |
| 163 | 3300053139 | Ga0500568_0003759 | Ga0500568_0003759_3960_4541 | 188 |
| 164 | 3300053141 | Ga0500574_011334 | Ga0500574_011334_1230_1811 | 188 |
| 165 | 3300053153 | Ga0500616_0052295 | Ga0500616_0052295_820_1401 | 188 |
| 166 | 3300053157 | Ga0500624_003001 | Ga0500624_003001_527_1108 | 188 |
| 167 | 3300053158 | Ga0500627_0004559 | Ga0500627_0004559_485_1072 | 188 |
| 168 | 3300053161 | Ga0500634_0042972 | Ga0500634_0042972_90_677 | 188 |
| 169 | 3300053177 | Ga0500636_0071747 | Ga0500636_0071747_498_1079 | 188 |
| 170 | iso_pu_bacteria | 2511231003 | 2511251694 | 188 |
| 171 | iso_pu_bacteria | 2548876994 | 2550696569 | 188 |
| 172 | iso_pu_bacteria | 2643221645 | 2644249596 | 188 |
| 173 | iso_pu_bacteria | 2738541307 | 2738882154 | 188 |
| 174 | iso_pu_bacteria | 2818991445 | 2819595241 | 188 |
| 175 | iso_pu_bacteria | 2884811622 | 2884815346 | 188 |
| 176 | iso_pu_bacteria | 2884836552 | 2884841078 | 188 |
| 177 | iso_pu_bacteria | 2884852848 | 2884855953 | 188 |
| 178 | iso_pu_bacteria | 2896154374 | 2896157122 | 188 |
| 179 | iso_pu_bacteria | 2928115317 | 2928115789 | 188 |
| 180 | 3300002774 | JGI25150J39212_1002782 | JGI25150J39212_10027822 | 189 |
| 181 | 3300002987 | JGI25159J45721_1007736 | JGI25159J45721_10077364 | 189 |
| 182 | 3300003187 | JGI25151J46595_10018059 | JGI25151J46595_100180594 | 189 |
| 183 | 3300003215 | JGI25153J46596_10048351 | JGI25153J46596_100483512 | 189 |
| 184 | 3300003316 | rootH1_10079138 | rootH1_100791382 | 189 |
| 185 | 3300003320 | rootH2_10067589 | rootH2_100675893 | 189 |
| 186 | 3300003323 | rootH1_10045732 | rootH1_100457325 | 189 |
| 187 | 3300003354 | JGI25160J50197_1011974 | JGI25160J50197_10119744 | 189 |
| 188 | 3300003374 | JGI25161J50226_1003016 | JGI25161J50226_10030164 | 189 |
| 189 | 3300003760 | Ga0055527_1007509 | Ga0055527_10075092 | 189 |
| 190 | 3300003761 | Ga0055535_1000895 | Ga0055535_100089519 | 189 |
| 191 | 3300003762 | Ga0055542_1000317 | Ga0055542_100031711 | 189 |
| 192 | 3300003771 | Ga0055526_1015598 | Ga0055526_10155984 | 189 |
| 193 | 3300003773 | Ga0055537_1006285 | Ga0055537_10062854 | 189 |
| 194 | 3300003775 | Ga0055524_1013722 | Ga0055524_10137224 | 189 |
| 195 | 3300003784 | Ga0055534_1005234 | Ga0055534_10052344 | 189 |
| 196 | 3300003790 | Ga0055528_1013779 | Ga0055528_10137794 | 189 |
| 197 | 3300003794 | Ga0055531_10019796 | Ga0055531_100197964 | 189 |
| 198 | 3300004625 | Ga0055543_1005744 | Ga0055543_10057444 | 189 |
| 199 | 3300005262 | Ga0065165_1004905 | Ga0065165_10049052 | 189 |
| 200 | 3300005356 | Ga0070674_100613134 | Ga0070674_1006131342 | 189 |
| 201 | 3300005367 | Ga0070667_100033426 | Ga0070667_1000334262 | 189 |
| 202 | 3300005437 | Ga0070710_10214390 | Ga0070710_102143902 | 189 |
| 203 | 3300005456 | Ga0070678_100139232 | Ga0070678_1001392322 | 189 |
| 204 | 3300005548 | Ga0070665_100000172 | Ga0070665_1000001724 | 189 |
| 205 | 3300005548 | Ga0070665_100401018 | Ga0070665_1004010182 | 189 |
| 206 | 3300005548 | Ga0070665_101226226 | Ga0070665_1012262262 | 189 |
| 207 | 3300005563 | Ga0068855_100476616 | Ga0068855_1004766162 | 189 |
| 208 | 3300005577 | Ga0068857_100596695 | Ga0068857_1005966951 | 189 |
| 209 | 3300005614 | Ga0068856_100297322 | Ga0068856_1002973224 | 189 |
| 210 | 3300005834 | Ga0068851_10012444 | Ga0068851_100124444 | 189 |
| 211 | 3300006042 | Ga0075368_10138109 | Ga0075368_101381092 | 189 |
| 212 | 3300006051 | Ga0075364_10528314 | Ga0075364_105283142 | 189 |
| 213 | 3300006195 | Ga0075366_10230729 | Ga0075366_102307292 | 189 |
| 214 | 3300006844 | Ga0075428_100517037 | Ga0075428_1005170372 | 189 |
| 215 | 3300009147 | Ga0114129_11055586 | Ga0114129_110555862 | 189 |
| 216 | 3300009545 | Ga0105237_10055015 | Ga0105237_100550154 | 189 |
| 217 | 3300010375 | Ga0105239_10164968 | Ga0105239_101649682 | 189 |
| 218 | 3300013102 | Ga0157371_10060401 | Ga0157371_100604014 | 189 |
| 219 | 3300013104 | Ga0157370_10079155 | Ga0157370_100791554 | 189 |
| 220 | 3300013104 | Ga0157370_10396227 | Ga0157370_103962272 | 189 |
| 221 | 3300013105 | Ga0157369_10050241 | Ga0157369_100502412 | 189 |
| 222 | 3300013308 | Ga0157375_10208711 | Ga0157375_102087112 | 189 |
| 223 | 3300014326 | Ga0157380_10300839 | Ga0157380_103008392 | 189 |
| 224 | 3300014497 | Ga0182008_10076601 | Ga0182008_100766012 | 189 |
| 225 | 3300014968 | Ga0157379_10195448 | Ga0157379_101954482 | 189 |
| 226 | 3300014969 | Ga0157376_10132143 | Ga0157376_101321432 | 189 |
| 227 | 3300015261 | Ga0182006_1134028 | Ga0182006_11340281 | 189 |
| 228 | 3300015262 | Ga0182007_10005187 | Ga0182007_100051874 | 189 |
| 229 | 3300015683 | Ga0183362_10007 | Ga0183362_1000721 | 189 |
| 230 | 3300017792 | Ga0163161_10242039 | Ga0163161_102420392 | 189 |
| 231 | 3300017792 | Ga0163161_10581314 | Ga0163161_105813141 | 189 |
| 232 | 3300025228 | Ga0209672_100354 | Ga0209672_10035428 | 189 |
| 233 | 3300025229 | Ga0209147_102445 | Ga0209147_1024453 | 189 |
| 234 | 3300025242 | Ga0209258_100015 | Ga0209258_100015107 | 189 |
| 235 | 3300025245 | Ga0207425_1000514 | Ga0207425_100051417 | 189 |
| 236 | 3300025254 | Ga0209148_1000183 | Ga0209148_100018312 | 189 |
| 237 | 3300025258 | Ga0209129_1000049 | Ga0209129_1000049111 | 189 |
| 238 | 3300025284 | Ga0209130_1000200 | Ga0209130_10002003 | 189 |
| 239 | 3300025291 | Ga0209675_1000320 | Ga0209675_10003202 | 189 |
| 240 | 3300025294 | Ga0209025_1000481 | Ga0209025_10004819 | 189 |
| 241 | 3300025295 | Ga0209564_1000232 | Ga0209564_100023242 | 189 |
| 242 | 3300025297 | Ga0209758_1000135 | Ga0209758_100013566 | 189 |
| 243 | 3300025299 | Ga0209256_1000129 | Ga0209256_100012966 | 189 |
| 244 | 3300025302 | Ga0207426_1000171 | Ga0207426_100017166 | 189 |
| 245 | 3300025893 | Ga0207682_10048792 | Ga0207682_100487922 | 189 |
| 246 | 3300025907 | Ga0207645_10319488 | Ga0207645_103194882 | 189 |
| 247 | 3300025907 | Ga0207645_10652426 | Ga0207645_106524262 | 189 |
| 248 | 3300025910 | Ga0207684_10044354 | Ga0207684_100443546 | 189 |
| 249 | 3300025927 | Ga0207687_10218081 | Ga0207687_102180812 | 189 |
| 250 | 3300025960 | Ga0207651_10289247 | Ga0207651_102892472 | 189 |
| 251 | 3300025986 | Ga0207658_10134382 | Ga0207658_101343822 | 189 |
| 252 | 3300026116 | Ga0207674_10345251 | Ga0207674_103452512 | 189 |
| 253 | 3300026121 | Ga0207683_10050968 | Ga0207683_100509682 | 189 |
| 254 | 3300026121 | Ga0207683_10241433 | Ga0207683_102414332 | 189 |
| 255 | 3300026142 | Ga0207698_11456249 | Ga0207698_114562492 | 189 |
| 256 | 3300027682 | Ga0209971_1008466 | Ga0209971_10084662 | 189 |
| 257 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000011676 | 189 |
| 258 | 3300028379 | Ga0268266_10376649 | Ga0268266_103766492 | 189 |
| 259 | 3300031239 | Ga0265328_10000099 | Ga0265328_1000009949 | 189 |
| 260 | 3300031239 | Ga0265328_10059498 | Ga0265328_100594982 | 189 |
| 261 | 3300031250 | Ga0265331_10011136 | Ga0265331_100111362 | 189 |
| 262 | 3300031251 | Ga0265327_10005592 | Ga0265327_100055927 | 189 |
| 263 | 3300031344 | Ga0265316_10448470 | Ga0265316_104484701 | 189 |
| 264 | 3300046453 | Ga0495627_026206 | Ga0495627_026206_17_628 | 189 |
| 265 | 3300046454 | Ga0495592_0451537 | Ga0495592_0451537_102_680 | 189 |
| 266 | 3300046462 | Ga0495651_0197120 | Ga0495651_0197120_196_774 | 189 |
| 267 | 3300046517 | Ga0495630_0500612 | Ga0495630_0500612_128_706 | 189 |
| 268 | 3300046525 | Ga0495663_0033974 | Ga0495663_0033974_694_1272 | 189 |
| 269 | 3300046528 | Ga0495642_0112823 | Ga0495642_0112823_331_909 | 189 |
| 270 | 3300046530 | Ga0495654_0139830 | Ga0495654_0139830_276_848 | 189 |
| 271 | 3300046680 | Ga0495646_0129939 | Ga0495646_0129939_397_969 | 189 |
| 272 | 3300048904 | Ga0496101_0016100 | Ga0496101_0016100_210_788 | 189 |
| 273 | 3300048907 | Ga0496104_0063130 | Ga0496104_0063130_306_884 | 189 |
| 274 | 3300048908 | Ga0496105_0006802 | Ga0496105_0006802_3478_4056 | 189 |
| 275 | 3300048909 | Ga0496106_0279524 | Ga0496106_0279524_446_1024 | 189 |
| 276 | 3300048912 | Ga0496109_0089602 | Ga0496109_0089602_1528_2106 | 189 |
| 277 | 3300048912 | Ga0496109_0383735 | Ga0496109_0383735_311_925 | 189 |
| 278 | 3300048913 | Ga0496110_0427471 | Ga0496110_0427471_470_1048 | 189 |
| 279 | 3300048916 | Ga0496113_0249084 | Ga0496113_0249084_648_1226 | 189 |
| 280 | 3300048917 | Ga0496114_0246025 | Ga0496114_0246025_911_1489 | 189 |
| 281 | 3300048920 | Ga0496117_0150078 | Ga0496117_0150078_714_1286 | 189 |
| 282 | 3300048925 | Ga0496122_0000272 | Ga0496122_0000272_54618_55190 | 189 |
| 283 | 3300048925 | Ga0496122_0153051 | Ga0496122_0153051_14_628 | 189 |
| 284 | 3300048926 | Ga0496123_0000221 | Ga0496123_0000221_60477_61049 | 189 |
| 285 | 3300048928 | Ga0496125_0236899 | Ga0496125_0236899_31_651 | 189 |
| 286 | 3300049574 | Ga0501038_0211627 | Ga0501038_0211627_759_1328 | 189 |
| 287 | 3300049576 | Ga0501040_0637367 | Ga0501040_0637367_56_640 | 189 |
| 288 | 3300049577 | Ga0501041_0462910 | Ga0501041_0462910_214_783 | 189 |
| 289 | 3300049587 | Ga0501071_0056337 | Ga0501071_0056337_1176_1760 | 189 |
| 290 | 3300049588 | Ga0501072_0002693 | Ga0501072_0002693_3753_4337 | 189 |
| 291 | 3300049589 | Ga0501073_0103199 | Ga0501073_0103199_760_1335 | 189 |
| 292 | 3300049591 | Ga0501075_0038677 | Ga0501075_0038677_442_1026 | 189 |
| 293 | 3300049592 | Ga0501076_0023771 | Ga0501076_0023771_518_1102 | 189 |
| 294 | 3300049592 | Ga0501076_0315713 | Ga0501076_0315713_466_1035 | 189 |
| 295 | 3300049593 | Ga0501077_0007142 | Ga0501077_0007142_717_1301 | 189 |
| 296 | 3300049593 | Ga0501077_0116177 | Ga0501077_0116177_250_819 | 189 |
| 297 | 3300049741 | Ga0501079_0011775 | Ga0501079_0011775_2349_2933 | 189 |
| 298 | 3300049743 | Ga0501081_0231000 | Ga0501081_0231000_522_1106 | 189 |
| 299 | 3300050493 | nmdc:mga0k408_168000_c1 | nmdc:mga0k408_168000_c1_262_831 | 189 |
| 300 | 3300050507 | nmdc:mga05p37_900498_c1 | nmdc:mga05p37_900498_c1_104_673 | 189 |
| 301 | 3300053136 | Ga0500559_0005005 | Ga0500559_0005005_460_1032 | 189 |
| 302 | 3300053136 | Ga0500559_0078584 | Ga0500559_0078584_576_1148 | 189 |
| 303 | 3300061734 | Ga0530510_0253022 | Ga0530510_0253022_298_882 | 189 |
| 304 | 3300002705 | JGI25156J39149_1018021 | JGI25156J39149_10180212 | 190 |
| 305 | 3300002705 | JGI25156J39149_1022037 | JGI25156J39149_10220371 | 190 |
| 306 | 3300003316 | rootH1_10001191 | rootH1_100011912 | 190 |
| 307 | 3300003316 | rootH1_10039640 | rootH1_100396402 | 190 |
| 308 | 3300003320 | rootH2_10067590 | rootH2_100675902 | 190 |
| 309 | 3300003320 | rootH2_10126651 | rootH2_101266514 | 190 |
| 310 | 3300003322 | rootL2_10102190 | rootL2_101021901 | 190 |
| 311 | 3300003323 | rootH1_10016198 | rootH1_100161984 | 190 |
| 312 | 3300003323 | rootH1_10033732 | rootH1_100337322 | 190 |
| 313 | 3300003752 | Ga0055539_1000042 | Ga0055539_1000042137 | 190 |
| 314 | 3300003756 | Ga0055533_1000006 | Ga0055533_1000006309 | 190 |
| 315 | 3300003759 | Ga0055525_1000004 | Ga0055525_1000004609 | 190 |
| 316 | 3300003759 | Ga0055525_1000832 | Ga0055525_10008323 | 190 |
| 317 | 3300003761 | Ga0055535_1000052 | Ga0055535_100005239 | 190 |
| 318 | 3300003763 | Ga0055529_1000053 | Ga0055529_1000053184 | 190 |
| 319 | 3300003775 | Ga0055524_1027361 | Ga0055524_10273612 | 190 |
| 320 | 3300003792 | Ga0055540_1000019 | Ga0055540_1000019160 | 190 |
| 321 | 3300003794 | Ga0055531_10000944 | Ga0055531_1000094417 | 190 |
| 322 | 3300005295 | Ga0065707_10082399 | Ga0065707_1008239911 | 190 |
| 323 | 3300005327 | Ga0070658_10544943 | Ga0070658_105449431 | 190 |
| 324 | 3300005328 | Ga0070676_10082414 | Ga0070676_100824142 | 190 |
| 325 | 3300005328 | Ga0070676_10419252 | Ga0070676_104192521 | 190 |
| 326 | 3300005330 | Ga0070690_100003675 | Ga0070690_1000036752 | 190 |
| 327 | 3300005331 | Ga0070670_100099090 | Ga0070670_1000990902 | 190 |
| 328 | 3300005334 | Ga0068869_100774878 | Ga0068869_1007748781 | 190 |
| 329 | 3300005335 | Ga0070666_10252813 | Ga0070666_102528132 | 190 |
| 330 | 3300005344 | Ga0070661_100003708 | Ga0070661_1000037085 | 190 |
| 331 | 3300005347 | Ga0070668_100543841 | Ga0070668_1005438411 | 190 |
| 332 | 3300005356 | Ga0070674_100057043 | Ga0070674_1000570432 | 190 |
| 333 | 3300005364 | Ga0070673_100004777 | Ga0070673_1000047777 | 190 |
| 334 | 3300005364 | Ga0070673_100645904 | Ga0070673_1006459041 | 190 |
| 335 | 3300005367 | Ga0070667_100000180 | Ga0070667_10000018019 | 190 |
| 336 | 3300005367 | Ga0070667_100033890 | Ga0070667_1000338902 | 190 |
| 337 | 3300005367 | Ga0070667_100142780 | Ga0070667_1001427802 | 190 |
| 338 | 3300005367 | Ga0070667_100349317 | Ga0070667_1003493172 | 190 |
| 339 | 3300005367 | Ga0070667_100910895 | Ga0070667_1009108952 | 190 |
| 340 | 3300005455 | Ga0070663_100000137 | Ga0070663_1000001375 | 190 |
| 341 | 3300005456 | Ga0070678_100016136 | Ga0070678_1000161362 | 190 |
| 342 | 3300005459 | Ga0068867_100000072 | Ga0068867_10000007229 | 190 |
| 343 | 3300005459 | Ga0068867_100011710 | Ga0068867_1000117105 | 190 |
| 344 | 3300005459 | Ga0068867_100062170 | Ga0068867_1000621703 | 190 |
| 345 | 3300005467 | Ga0070706_100000822 | Ga0070706_10000082213 | 190 |
| 346 | 3300005468 | Ga0070707_100043084 | Ga0070707_1000430842 | 190 |
| 347 | 3300005539 | Ga0068853_100011214 | Ga0068853_1000112145 | 190 |
| 348 | 3300005543 | Ga0070672_100021219 | Ga0070672_1000212192 | 190 |
| 349 | 3300005543 | Ga0070672_100118182 | Ga0070672_1001181822 | 190 |
| 350 | 3300005548 | Ga0070665_100002315 | Ga0070665_10000231511 | 190 |
| 351 | 3300005548 | Ga0070665_100642591 | Ga0070665_1006425912 | 190 |
| 352 | 3300005563 | Ga0068855_100491369 | Ga0068855_1004913692 | 190 |
| 353 | 3300005563 | Ga0068855_101524312 | Ga0068855_1015243121 | 190 |
| 354 | 3300005617 | Ga0068859_100181480 | Ga0068859_1001814802 | 190 |
| 355 | 3300005618 | Ga0068864_100104726 | Ga0068864_1001047263 | 190 |
| 356 | 3300005719 | Ga0068861_100021835 | Ga0068861_1000218352 | 190 |
| 357 | 3300005841 | Ga0068863_100288668 | Ga0068863_1002886682 | 190 |
| 358 | 3300005843 | Ga0068860_100248176 | Ga0068860_1002481762 | 190 |
| 359 | 3300005843 | Ga0068860_100382322 | Ga0068860_1003823222 | 190 |
| 360 | 3300006038 | Ga0075365_10118671 | Ga0075365_101186712 | 190 |
| 361 | 3300006042 | Ga0075368_10017321 | Ga0075368_100173212 | 190 |
| 362 | 3300006048 | Ga0075363_100004024 | Ga0075363_1000040242 | 190 |
| 363 | 3300006048 | Ga0075363_100131520 | Ga0075363_1001315202 | 190 |
| 364 | 3300006048 | Ga0075363_100179333 | Ga0075363_1001793331 | 190 |
| 365 | 3300006177 | Ga0075362_10101219 | Ga0075362_101012192 | 190 |
| 366 | 3300006178 | Ga0075367_10027347 | Ga0075367_100273473 | 190 |
| 367 | 3300006195 | Ga0075366_10005487 | Ga0075366_100054872 | 190 |
| 368 | 3300006195 | Ga0075366_10019879 | Ga0075366_100198793 | 190 |
| 369 | 3300006195 | Ga0075366_10023915 | Ga0075366_100239152 | 190 |
| 370 | 3300006195 | Ga0075366_10025637 | Ga0075366_100256373 | 190 |
| 371 | 3300006195 | Ga0075366_10171675 | Ga0075366_101716752 | 190 |
| 372 | 3300006195 | Ga0075366_10182122 | Ga0075366_101821222 | 190 |
| 373 | 3300006237 | Ga0097621_100124936 | Ga0097621_1001249362 | 190 |
| 374 | 3300006353 | Ga0075370_10002110 | Ga0075370_100021102 | 190 |
| 375 | 3300006353 | Ga0075370_10205390 | Ga0075370_102053902 | 190 |
| 376 | 3300006358 | Ga0068871_100220455 | Ga0068871_1002204551 | 190 |
| 377 | 3300006931 | Ga0097620_100181477 | Ga0097620_1001814772 | 190 |
| 378 | 3300006944 | Ga0099823_1004283 | Ga0099823_100428312 | 190 |
| 379 | 3300009093 | Ga0105240_10001730 | Ga0105240_100017302 | 190 |
| 380 | 3300009093 | Ga0105240_10060102 | Ga0105240_100601023 | 190 |
| 381 | 3300009093 | Ga0105240_10116147 | Ga0105240_101161472 | 190 |
| 382 | 3300009101 | Ga0105247_10011745 | Ga0105247_100117452 | 190 |
| 383 | 3300009176 | Ga0105242_10010793 | Ga0105242_100107936 | 190 |
| 384 | 3300009177 | Ga0105248_10007938 | Ga0105248_100079389 | 190 |
| 385 | 3300009177 | Ga0105248_10008743 | Ga0105248_100087433 | 190 |
| 386 | 3300009545 | Ga0105237_10013820 | Ga0105237_100138205 | 190 |
| 387 | 3300009551 | Ga0105238_10255265 | Ga0105238_102552652 | 190 |
| 388 | 3300009553 | Ga0105249_10001174 | Ga0105249_100011745 | 190 |
| 389 | 3300011119 | Ga0105246_10082697 | Ga0105246_100826972 | 190 |
| 390 | 3300013296 | Ga0157374_10473695 | Ga0157374_104736952 | 190 |
| 391 | 3300013296 | Ga0157374_11091487 | Ga0157374_110914871 | 190 |
| 392 | 3300013297 | Ga0157378_10071828 | Ga0157378_100718282 | 190 |
| 393 | 3300013308 | Ga0157375_10041470 | Ga0157375_100414703 | 190 |
| 394 | 3300013308 | Ga0157375_10400790 | Ga0157375_104007902 | 190 |
| 395 | 3300014325 | Ga0163163_11493616 | Ga0163163_114936161 | 190 |
| 396 | 3300014326 | Ga0157380_10193860 | Ga0157380_101938601 | 190 |
| 397 | 3300014745 | Ga0157377_10000075 | Ga0157377_1000007532 | 190 |
| 398 | 3300014745 | Ga0157377_10621682 | Ga0157377_106216822 | 190 |
| 399 | 3300014968 | Ga0157379_10412183 | Ga0157379_104121832 | 190 |
| 400 | 3300014969 | Ga0157376_10024316 | Ga0157376_100243162 | 190 |
| 401 | 3300014969 | Ga0157376_10374044 | Ga0157376_103740442 | 190 |
| 402 | 3300014969 | Ga0157376_10465345 | Ga0157376_104653452 | 190 |
| 403 | 3300025226 | Ga0209674_100003 | Ga0209674_1000031025 | 190 |
| 404 | 3300025228 | Ga0209672_107938 | Ga0209672_1079383 | 190 |
| 405 | 3300025230 | Ga0209563_100010 | Ga0209563_100010754 | 190 |
| 406 | 3300025230 | Ga0209563_100013 | Ga0209563_100013610 | 190 |
| 407 | 3300025231 | Ga0207427_100368 | Ga0207427_10036821 | 190 |
| 408 | 3300025242 | Ga0209258_100074 | Ga0209258_100074148 | 190 |
| 409 | 3300025250 | Ga0209026_1017045 | Ga0209026_10170452 | 190 |
| 410 | 3300025253 | Ga0209677_100026 | Ga0209677_100026181 | 190 |
| 411 | 3300025256 | Ga0209759_1000283 | Ga0209759_100028310 | 190 |
| 412 | 3300025256 | Ga0209759_1020165 | Ga0209759_10201652 | 190 |
| 413 | 3300025272 | Ga0209455_1000066 | Ga0209455_1000066188 | 190 |
| 414 | 3300025273 | Ga0209673_1007711 | Ga0209673_10077113 | 190 |
| 415 | 3300025291 | Ga0209675_1033941 | Ga0209675_10339412 | 190 |
| 416 | 3300025292 | Ga0209676_1023447 | Ga0209676_10234472 | 190 |
| 417 | 3300025294 | Ga0209025_1023819 | Ga0209025_10238193 | 190 |
| 418 | 3300025298 | Ga0209050_1000137 | Ga0209050_1000137145 | 190 |
| 419 | 3300025298 | Ga0209050_1016119 | Ga0209050_10161192 | 190 |
| 420 | 3300025298 | Ga0209050_1033391 | Ga0209050_10333912 | 190 |
| 421 | 3300025298 | Ga0209050_1044273 | Ga0209050_10442732 | 190 |
| 422 | 3300025299 | Ga0209256_1000036 | Ga0209256_1000036288 | 190 |
| 423 | 3300025299 | Ga0209256_1001246 | Ga0209256_100124613 | 190 |
| 424 | 3300025303 | Ga0209051_1000071 | Ga0209051_100007120 | 190 |
| 425 | 3300025303 | Ga0209051_1001283 | Ga0209051_100128313 | 190 |
| 426 | 3300025304 | Ga0209257_1000268 | Ga0209257_100026820 | 190 |
| 427 | 3300025304 | Ga0209257_1004891 | Ga0209257_10048917 | 190 |
| 428 | 3300025304 | Ga0209257_1005567 | Ga0209257_10055673 | 190 |
| 429 | 3300025903 | Ga0207680_10020853 | Ga0207680_100208532 | 190 |
| 430 | 3300025903 | Ga0207680_10295275 | Ga0207680_102952752 | 190 |
| 431 | 3300025907 | Ga0207645_10277674 | Ga0207645_102776742 | 190 |
| 432 | 3300025907 | Ga0207645_10539997 | Ga0207645_105399971 | 190 |
| 433 | 3300025910 | Ga0207684_10002530 | Ga0207684_100025303 | 190 |
| 434 | 3300025913 | Ga0207695_10007069 | Ga0207695_1000706911 | 190 |
| 435 | 3300025913 | Ga0207695_10015960 | Ga0207695_100159603 | 190 |
| 436 | 3300025913 | Ga0207695_10169880 | Ga0207695_101698802 | 190 |
| 437 | 3300025914 | Ga0207671_10006244 | Ga0207671_100062445 | 190 |
| 438 | 3300025918 | Ga0207662_10440970 | Ga0207662_104409702 | 190 |
| 439 | 3300025920 | Ga0207649_10002253 | Ga0207649_100022536 | 190 |
| 440 | 3300025922 | Ga0207646_10027740 | Ga0207646_100277402 | 190 |
| 441 | 3300025925 | Ga0207650_10143168 | Ga0207650_101431682 | 190 |
| 442 | 3300025931 | Ga0207644_10042813 | Ga0207644_100428133 | 190 |
| 443 | 3300025934 | Ga0207686_10006598 | Ga0207686_100065985 | 190 |
| 444 | 3300025937 | Ga0207669_10021238 | Ga0207669_100212382 | 190 |
| 445 | 3300025939 | Ga0207665_10253054 | Ga0207665_102530541 | 190 |
| 446 | 3300025940 | Ga0207691_10046723 | Ga0207691_100467232 | 190 |
| 447 | 3300025940 | Ga0207691_10140728 | Ga0207691_101407282 | 190 |
| 448 | 3300025941 | Ga0207711_10011294 | Ga0207711_100112944 | 190 |
| 449 | 3300025942 | Ga0207689_10058844 | Ga0207689_100588442 | 190 |
| 450 | 3300025942 | Ga0207689_10265032 | Ga0207689_102650321 | 190 |
| 451 | 3300025949 | Ga0207667_10517830 | Ga0207667_105178302 | 190 |
| 452 | 3300025960 | Ga0207651_10002249 | Ga0207651_100022497 | 190 |
| 453 | 3300025961 | Ga0207712_10000336 | Ga0207712_1000033634 | 190 |
| 454 | 3300025986 | Ga0207658_10000050 | Ga0207658_1000005013 | 190 |
| 455 | 3300025986 | Ga0207658_10089205 | Ga0207658_100892052 | 190 |
| 456 | 3300025986 | Ga0207658_11387799 | Ga0207658_113877991 | 190 |
| 457 | 3300026035 | Ga0207703_10176693 | Ga0207703_101766932 | 190 |
| 458 | 3300026041 | Ga0207639_10007885 | Ga0207639_100078854 | 190 |
| 459 | 3300026067 | Ga0207678_10000663 | Ga0207678_1000066320 | 190 |
| 460 | 3300026088 | Ga0207641_10130093 | Ga0207641_101300933 | 190 |
| 461 | 3300026088 | Ga0207641_10217726 | Ga0207641_102177262 | 190 |
| 462 | 3300026088 | Ga0207641_10627955 | Ga0207641_106279551 | 190 |
| 463 | 3300026089 | Ga0207648_10000286 | Ga0207648_100002862 | 190 |
| 464 | 3300026089 | Ga0207648_10063612 | Ga0207648_100636123 | 190 |
| 465 | 3300026089 | Ga0207648_10192596 | Ga0207648_101925962 | 190 |
| 466 | 3300026089 | Ga0207648_10682791 | Ga0207648_106827911 | 190 |
| 467 | 3300026095 | Ga0207676_10144634 | Ga0207676_101446342 | 190 |
| 468 | 3300026118 | Ga0207675_100018813 | Ga0207675_1000188132 | 190 |
| 469 | 3300026121 | Ga0207683_10001622 | Ga0207683_1000162213 | 190 |
| 470 | 3300026121 | Ga0207683_10545867 | Ga0207683_105458672 | 190 |
| 471 | 3300026142 | Ga0207698_10037499 | Ga0207698_100374992 | 190 |
| 472 | 3300027296 | Ga0209389_1003148 | Ga0209389_100314812 | 190 |
| 473 | 3300027876 | Ga0209974_10001575 | Ga0209974_100015755 | 190 |
| 474 | 3300028379 | Ga0268266_10011177 | Ga0268266_100111775 | 190 |
| 475 | 3300028381 | Ga0268264_10235878 | Ga0268264_102358782 | 190 |
| 476 | 3300028786 | Ga0307517_10000122 | Ga0307517_1000012242 | 190 |
| 477 | 3300028786 | Ga0307517_10412521 | Ga0307517_104125211 | 190 |
| 478 | 3300028794 | Ga0307515_10000006 | Ga0307515_10000006122 | 190 |
| 479 | 3300028794 | Ga0307515_10000063 | Ga0307515_10000063150 | 190 |
| 480 | 3300028794 | Ga0307515_10048523 | Ga0307515_100485233 | 190 |
| 481 | 3300028794 | Ga0307515_10440058 | Ga0307515_104400582 | 190 |
| 482 | 3300031250 | Ga0265331_10049747 | Ga0265331_100497472 | 190 |
| 483 | 3300031251 | Ga0265327_10000761 | Ga0265327_1000076143 | 190 |
| 484 | 3300031344 | Ga0265316_10268753 | Ga0265316_102687532 | 190 |
| 485 | 3300031344 | Ga0265316_10316629 | Ga0265316_103166292 | 190 |
| 486 | 3300031456 | Ga0307513_10000057 | Ga0307513_1000005728 | 190 |
| 487 | 3300031456 | Ga0307513_10001087 | Ga0307513_100010878 | 190 |
| 488 | 3300031456 | Ga0307513_10108068 | Ga0307513_101080684 | 190 |
| 489 | 3300031456 | Ga0307513_10204799 | Ga0307513_102047993 | 190 |
| 490 | 3300031456 | Ga0307513_10207305 | Ga0307513_102073052 | 190 |
| 491 | 3300031507 | Ga0307509_10102011 | Ga0307509_101020112 | 190 |
| 492 | 3300031548 | Ga0307408_100301400 | Ga0307408_1003014002 | 190 |
| 493 | 3300031712 | Ga0265342_10021111 | Ga0265342_100211112 | 190 |
| 494 | 3300031730 | Ga0307516_10007037 | Ga0307516_1000703714 | 190 |
| 495 | 3300031731 | Ga0307405_10058753 | Ga0307405_100587532 | 190 |
| 496 | 3300031911 | Ga0307412_10705339 | Ga0307412_107053392 | 190 |
| 497 | 3300032002 | Ga0307416_100197801 | Ga0307416_1001978012 | 190 |
| 498 | 3300033179 | Ga0307507_10065230 | Ga0307507_100652302 | 190 |
| 499 | 3300035691 | Ga0373931_0001406 | Ga0373931_0001406_8537_9115 | 190 |
| 500 | 3300035691 | Ga0373931_0014852 | Ga0373931_0014852_1456_2145 | 190 |
| 501 | 3300035692 | Ga0373935_0233026 | Ga0373935_0233026_509_1087 | 190 |
| 502 | 3300035695 | Ga0373927_0086739 | Ga0373927_0086739_489_1067 | 190 |
| 503 | 3300035724 | Ga0373933_0447381 | Ga0373933_0447381_212_790 | 190 |
| 504 | 3300037068 | Ga0373925_0002246 | Ga0373925_0002246_13031_13609 | 190 |
| 505 | 3300041404 | Ga0439436_0004767 | Ga0439436_0004767_1241_1813 | 190 |
| 506 | 3300041406 | Ga0439439_0004798 | Ga0439439_0004798_1326_1898 | 190 |
| 507 | 3300041407 | Ga0439447_015746 | Ga0439447_015746_832_1404 | 190 |
| 508 | 3300041411 | Ga0439466_0024549 | Ga0439466_0024549_1328_1900 | 190 |
| 509 | 3300041413 | Ga0439465_0102265 | Ga0439465_0102265_261_833 | 190 |
| 510 | 3300041491 | Ga0451833_0587766 | Ga0451833_0587766_81_659 | 190 |
| 511 | 3300042002 | Ga0439442_010185 | Ga0439442_010185_1236_1808 | 190 |
| 512 | 3300042007 | Ga0439449_0017982 | Ga0439449_0017982_692_1264 | 190 |
| 513 | 3300042010 | Ga0439452_013087 | Ga0439452_013087_1466_2038 | 190 |
| 514 | 3300042014 | Ga0439457_012991 | Ga0439457_012991_784_1356 | 190 |
| 515 | 3300042015 | Ga0439462_0012542 | Ga0439462_0012542_377_949 | 190 |
| 516 | 3300042123 | Ga0450921_000114 | Ga0450921_000114_1395_1967 | 190 |
| 517 | 3300042145 | Ga0450906_009974 | Ga0450906_009974_710_1282 | 190 |
| 518 | 3300042156 | Ga0439446_0029265 | Ga0439446_0029265_425_997 | 190 |
| 519 | 3300042157 | Ga0439458_0055218 | Ga0439458_0055218_77_658 | 190 |
| 520 | 3300042185 | Ga0450909_006857 | Ga0450909_006857_421_993 | 190 |
| 521 | 3300042435 | Ga0439434_0068655 | Ga0439434_0068655_316_888 | 190 |
| 522 | 3300042532 | Ga0450893_0055565 | Ga0450893_0055565_140_712 | 190 |
| 523 | 3300044656 | Ga0466969_0122226 | Ga0466969_0122226_123_704 | 190 |
| 524 | 3300044683 | Ga0466965_0074158 | Ga0466965_0074158_1116_1691 | 190 |
| 525 | 3300044693 | Ga0466961_0106999 | Ga0466961_0106999_148_729 | 190 |
| 526 | 3300044719 | Ga0466971_0091547 | Ga0466971_0091547_474_1055 | 190 |
| 527 | 3300044842 | Ga0466957_0110593 | Ga0466957_0110593_926_1507 | 190 |
| 528 | 3300044901 | Ga0466960_0126627 | Ga0466960_0126627_508_1083 | 190 |
| 529 | 3300045049 | Ga0466959_0251207 | Ga0466959_0251207_386_967 | 190 |
| 530 | 3300046454 | Ga0495592_0284051 | Ga0495592_0284051_493_1071 | 190 |
| 531 | 3300046471 | Ga0495650_0005841 | Ga0495650_0005841_7182_7760 | 190 |
| 532 | 3300046474 | Ga0495605_0001007 | Ga0495605_0001007_8234_8806 | 190 |
| 533 | 3300046475 | Ga0495639_0018354 | Ga0495639_0018354_806_1384 | 190 |
| 534 | 3300046501 | Ga0495607_0290178 | Ga0495607_0290178_10_594 | 190 |
| 535 | 3300046519 | Ga0495632_0056631 | Ga0495632_0056631_137_715 | 190 |
| 536 | 3300046524 | Ga0495648_0011006 | Ga0495648_0011006_5499_6071 | 190 |
| 537 | 3300046524 | Ga0495648_0173053 | Ga0495648_0173053_179_769 | 190 |
| 538 | 3300046528 | Ga0495642_0296381 | Ga0495642_0296381_76_648 | 190 |
| 539 | 3300046538 | Ga0495609_0049120 | Ga0495609_0049120_772_1344 | 190 |
| 540 | 3300046539 | Ga0495621_0004503 | Ga0495621_0004503_1339_1935 | 190 |
| 541 | 3300046543 | Ga0495645_0270063 | Ga0495645_0270063_101_679 | 190 |
| 542 | 3300046660 | Ga0495625_0013068 | Ga0495625_0013068_4184_4756 | 190 |
| 543 | 3300046660 | Ga0495625_0287510 | Ga0495625_0287510_381_959 | 190 |
| 544 | 3300046664 | Ga0495659_0001216 | Ga0495659_0001216_4160_4732 | 190 |
| 545 | 3300046683 | Ga0495658_0109476 | Ga0495658_0109476_768_1346 | 190 |
| 546 | 3300046683 | Ga0495658_0145721 | Ga0495658_0145721_508_1086 | 190 |
| 547 | 3300046691 | Ga0495670_0045794 | Ga0495670_0045794_764_1483 | 190 |
| 548 | 3300046692 | Ga0495671_0210647 | Ga0495671_0210647_334_912 | 190 |
| 549 | 3300047315 | Ga0495581_0474490 | Ga0495581_0474490_28_606 | 190 |
| 550 | 3300047320 | Ga0495672_0001590 | Ga0495672_0001590_10231_10803 | 190 |
| 551 | 3300047321 | Ga0495676_0143734 | Ga0495676_0143734_775_1356 | 190 |
| 552 | 3300047469 | Ga0495673_0002648 | Ga0495673_0002648_7549_8121 | 190 |
| 553 | 3300048089 | Ga0495614_0416220 | Ga0495614_0416220_14_589 | 190 |
| 554 | 3300048907 | Ga0496104_0421736 | Ga0496104_0421736_184_765 | 190 |
| 555 | 3300048911 | Ga0496108_0363015 | Ga0496108_0363015_198_779 | 190 |
| 556 | 3300048915 | Ga0496112_0016952 | Ga0496112_0016952_1917_2498 | 190 |
| 557 | 3300048917 | Ga0496114_0187903 | Ga0496114_0187903_537_1154 | 190 |
| 558 | 3300048924 | Ga0496121_0227503 | Ga0496121_0227503_147_719 | 190 |
| 559 | 3300048925 | Ga0496122_0000677 | Ga0496122_0000677_24061_24633 | 190 |
| 560 | 3300048926 | Ga0496123_0000230 | Ga0496123_0000230_106449_107021 | 190 |
| 561 | 3300048927 | Ga0496124_0076553 | Ga0496124_0076553_1657_2271 | 190 |
| 562 | 3300048929 | Ga0496126_0083680 | Ga0496126_0083680_2167_2739 | 190 |
| 563 | 3300049460 | Ga0495682_0000304 | Ga0495682_0000304_26471_27043 | 190 |
| 564 | 3300050489 | nmdc:mga03683_110525_c1 | nmdc:mga03683_110525_c1_32_604 | 190 |
| 565 | 3300050493 | nmdc:mga0k408_18269_c1 | nmdc:mga0k408_18269_c1_493_1071 | 190 |
| 566 | 3300050493 | nmdc:mga0k408_26863_c1 | nmdc:mga0k408_26863_c1_226_804 | 190 |
| 567 | 3300050493 | nmdc:mga0k408_271366_c1 | nmdc:mga0k408_271366_c1_422_994 | 190 |
| 568 | 3300050493 | nmdc:mga0k408_367332_c1 | nmdc:mga0k408_367332_c1_47_622 | 190 |
| 569 | 3300050493 | nmdc:mga0k408_79_c1 | nmdc:mga0k408_79_c1_3174_3785 | 190 |
| 570 | 3300050494 | nmdc:mga06z11_408905_c1 | nmdc:mga06z11_408905_c1_30_602 | 190 |
| 571 | 3300050494 | nmdc:mga06z11_47765_c1 | nmdc:mga06z11_47765_c1_1310_1888 | 190 |
| 572 | 3300050496 | nmdc:mga07m45_255087_c1 | nmdc:mga07m45_255087_c1_169_741 | 190 |
| 573 | 3300050496 | nmdc:mga07m45_28475_c1 | nmdc:mga07m45_28475_c1_201_773 | 190 |
| 574 | 3300053087 | Ga0500643_004765 | Ga0500643_004765_3123_3695 | 190 |
| 575 | 3300053093 | Ga0500651_0012504 | Ga0500651_0012504_4328_4903 | 190 |
| 576 | 3300053120 | Ga0500597_000069 | Ga0500597_000069_17975_18547 | 190 |
| 577 | 3300053130 | Ga0500642_0280447 | Ga0500642_0280447_76_663 | 190 |
| 578 | 3300053148 | Ga0500590_118604 | Ga0500590_118604_131_709 | 190 |
| 579 | 3300053156 | Ga0500622_0043499 | Ga0500622_0043499_1136_1831 | 190 |
| 580 | 3300053161 | Ga0500634_0055391 | Ga0500634_0055391_1390_1968 | 190 |
| 581 | 3300053729 | Ga0500625_036289 | Ga0500625_036289_1728_2300 | 190 |
| 582 | 3300053729 | Ga0500625_113089 | Ga0500625_113089_240_812 | 190 |
| 583 | 3300053730 | Ga0500645_011689 | Ga0500645_011689_1805_2389 | 190 |
| 584 | 3300055283 | Ga0500661_011630 | Ga0500661_011630_516_1088 | 190 |
| 585 | 3300061719 | Ga0466962_0008155 | Ga0466962_0008155_865_1446 | 190 |
| 586 | iso_pu_bacteria | 2588253510 | 2588295457 | 190 |
| 587 | iso_pu_bacteria | 2834641062 | 2834641156 | 190 |
| 588 | 3300005548 | Ga0070665_100454978 | Ga0070665_1004549781 | 191 |
| 589 | 3300021361 | Ga0213872_10000025 | Ga0213872_1000002543 | 191 |
| 590 | 3300025923 | Ga0207681_10671401 | Ga0207681_106714012 | 191 |
| 591 | 3300028379 | Ga0268266_10785571 | Ga0268266_107855711 | 191 |
| 592 | 3300028794 | Ga0307515_10000180 | Ga0307515_1000018030 | 191 |
| 593 | 3300031238 | Ga0265332_10012972 | Ga0265332_100129725 | 191 |
| 594 | 3300031250 | Ga0265331_10023444 | Ga0265331_100234442 | 191 |
| 595 | 3300031344 | Ga0265316_10014876 | Ga0265316_100148762 | 191 |
| 596 | 3300031456 | Ga0307513_10228351 | Ga0307513_102283512 | 191 |
| 597 | 3300035171 | Ga0373946_0189383 | Ga0373946_0189383_141_716 | 191 |
| 598 | 3300035695 | Ga0373927_0140272 | Ga0373927_0140272_690_1265 | 191 |
| 599 | 3300036401 | Ga0373937_0454910 | Ga0373937_0454910_311_892 | 191 |
| 600 | 3300037068 | Ga0373925_0213274 | Ga0373925_0213274_525_1100 | 191 |
| 601 | 3300037312 | Ga0395899_0143192 | Ga0395899_0143192_270_848 | 191 |
| 602 | 3300037466 | Ga0395898_0002038 | Ga0395898_0002038_11643_12221 | 191 |
| 603 | 3300038443 | Ga0395901_0032389 | Ga0395901_0032389_3698_4276 | 191 |
| 604 | 3300039447 | Ga0436361_0916410 | Ga0436361_0916410_31273_31851 | 191 |
| 605 | 3300042876 | Ga0451577_0000058 | Ga0451577_0000058_33993_34568 | 191 |
| 606 | 3300044712 | Ga0453684_0000279 | Ga0453684_0000279_130650_131225 | 191 |
| 607 | 3300045051 | Ga0451576_0075529 | Ga0451576_0075529_2528_3103 | 191 |
| 608 | 3300046452 | Ga0495617_114687 | Ga0495617_114687_60_635 | 191 |
| 609 | 3300053161 | Ga0500634_0223400 | Ga0500634_0223400_215_790 | 191 |
| 610 | 3300002704 | JGI25155J39150_1000225 | JGI25155J39150_10002253 | 192 |
| 611 | 3300002704 | JGI25155J39150_1001321 | JGI25155J39150_10013212 | 192 |
| 612 | 3300002705 | JGI25156J39149_1000738 | JGI25156J39149_10007381 | 192 |
| 613 | 3300002705 | JGI25156J39149_1011592 | JGI25156J39149_10115921 | 192 |
| 614 | 3300002737 | JGI25162J39368_1003126 | JGI25162J39368_10031262 | 192 |
| 615 | 3300002738 | JGI25154J39366_1000437 | JGI25154J39366_100043716 | 192 |
| 616 | 3300002738 | JGI25154J39366_1000599 | JGI25154J39366_100059915 | 192 |
| 617 | 3300002741 | JGI25157J39369_1000740 | JGI25157J39369_100074015 | 192 |
| 618 | 3300003374 | JGI25161J50226_1003985 | JGI25161J50226_10039853 | 192 |
| 619 | 3300003758 | Ga0055532_1000497 | Ga0055532_10004971 | 192 |
| 620 | 3300003771 | Ga0055526_1002769 | Ga0055526_10027699 | 192 |
| 621 | 3300003771 | Ga0055526_1008783 | Ga0055526_10087831 | 192 |
| 622 | 3300003773 | Ga0055537_1007110 | Ga0055537_10071102 | 192 |
| 623 | 3300003775 | Ga0055524_1003190 | Ga0055524_10031901 | 192 |
| 624 | 3300003784 | Ga0055534_1003433 | Ga0055534_10034331 | 192 |
| 625 | 3300003790 | Ga0055528_1007637 | Ga0055528_10076374 | 192 |
| 626 | 3300003791 | Ga0055530_10005424 | Ga0055530_100054242 | 192 |
| 627 | 3300003794 | Ga0055531_10034866 | Ga0055531_100348662 | 192 |
| 628 | 3300005331 | Ga0070670_100090322 | Ga0070670_1000903222 | 192 |
| 629 | 3300005563 | Ga0068855_100139006 | Ga0068855_1001390062 | 192 |
| 630 | 3300005563 | Ga0068855_100262946 | Ga0068855_1002629462 | 192 |
| 631 | 3300005614 | Ga0068856_100084854 | Ga0068856_1000848541 | 192 |
| 632 | 3300005616 | Ga0068852_100065011 | Ga0068852_1000650112 | 192 |
| 633 | 3300009093 | Ga0105240_10008348 | Ga0105240_100083489 | 192 |
| 634 | 3300014326 | Ga0157380_10047395 | Ga0157380_100473952 | 192 |
| 635 | 3300015261 | Ga0182006_1138710 | Ga0182006_11387101 | 192 |
| 636 | 3300025206 | Ga0209435_100080 | Ga0209435_10008048 | 192 |
| 637 | 3300025206 | Ga0209435_100255 | Ga0209435_1002552 | 192 |
| 638 | 3300025208 | Ga0209436_100257 | Ga0209436_1002572 | 192 |
| 639 | 3300025208 | Ga0209436_101113 | Ga0209436_1011138 | 192 |
| 640 | 3300025229 | Ga0209147_100004 | Ga0209147_1000041227 | 192 |
| 641 | 3300025233 | Ga0209437_100117 | Ga0209437_100117142 | 192 |
| 642 | 3300025242 | Ga0209258_100807 | Ga0209258_1008072 | 192 |
| 643 | 3300025245 | Ga0207425_1000062 | Ga0207425_1000062123 | 192 |
| 644 | 3300025246 | Ga0209646_1000040 | Ga0209646_100004029 | 192 |
| 645 | 3300025246 | Ga0209646_1000105 | Ga0209646_100010549 | 192 |
| 646 | 3300025250 | Ga0209026_1000488 | Ga0209026_100048828 | 192 |
| 647 | 3300025250 | Ga0209026_1005485 | Ga0209026_10054852 | 192 |
| 648 | 3300025256 | Ga0209759_1000440 | Ga0209759_100044048 | 192 |
| 649 | 3300025256 | Ga0209759_1000983 | Ga0209759_10009832 | 192 |
| 650 | 3300025258 | Ga0209129_1003746 | Ga0209129_10037463 | 192 |
| 651 | 3300025261 | Ga0209233_1024906 | Ga0209233_10249062 | 192 |
| 652 | 3300025263 | Ga0209565_1000622 | Ga0209565_100062211 | 192 |
| 653 | 3300025263 | Ga0209565_1000784 | Ga0209565_10007849 | 192 |
| 654 | 3300025263 | Ga0209565_1001080 | Ga0209565_10010807 | 192 |
| 655 | 3300025273 | Ga0209673_1004605 | Ga0209673_10046056 | 192 |
| 656 | 3300025284 | Ga0209130_1000927 | Ga0209130_100092718 | 192 |
| 657 | 3300025291 | Ga0209675_1000280 | Ga0209675_100028030 | 192 |
| 658 | 3300025295 | Ga0209564_1000005 | Ga0209564_1000005602 | 192 |
| 659 | 3300025295 | Ga0209564_1001080 | Ga0209564_100108011 | 192 |
| 660 | 3300025298 | Ga0209050_1001144 | Ga0209050_10011447 | 192 |
| 661 | 3300025299 | Ga0209256_1000507 | Ga0209256_100050732 | 192 |
| 662 | 3300025299 | Ga0209256_1001972 | Ga0209256_10019729 | 192 |
| 663 | 3300025302 | Ga0207426_1001027 | Ga0207426_10010276 | 192 |
| 664 | 3300025304 | Ga0209257_1003990 | Ga0209257_10039907 | 192 |
| 665 | 3300025735 | Ga0207713_1048626 | Ga0207713_10486261 | 192 |
| 666 | 3300025913 | Ga0207695_10031887 | Ga0207695_100318876 | 192 |
| 667 | 3300025949 | Ga0207667_10103274 | Ga0207667_101032742 | 192 |
| 668 | 3300025949 | Ga0207667_10177901 | Ga0207667_101779012 | 192 |
| 669 | 3300026078 | Ga0207702_10045013 | Ga0207702_100450133 | 192 |
| 670 | 3300026116 | Ga0207674_10432355 | Ga0207674_104323552 | 192 |
| 671 | 3300026142 | Ga0207698_10035255 | Ga0207698_100352552 | 192 |
| 672 | 3300030760 | Ga0265762_1012385 | Ga0265762_10123852 | 192 |
| 673 | 3300031548 | Ga0307408_100001592 | Ga0307408_1000015927 | 192 |
| 674 | 3300031548 | Ga0307408_100018923 | Ga0307408_1000189234 | 192 |
| 675 | 3300031731 | Ga0307405_10200908 | Ga0307405_102009082 | 192 |
| 676 | 3300031911 | Ga0307412_10130642 | Ga0307412_101306422 | 192 |
| 677 | 3300046501 | Ga0495607_0015333 | Ga0495607_0015333_539_1144 | 192 |
| 678 | 3300046530 | Ga0495654_0295488 | Ga0495654_0295488_20_631 | 192 |
| 679 | 3300046538 | Ga0495609_0061964 | Ga0495609_0061964_638_1243 | 192 |
| 680 | 3300046660 | Ga0495625_0047954 | Ga0495625_0047954_2284_2895 | 192 |
| 681 | 3300046810 | Ga0495660_0002148 | Ga0495660_0002148_27_632 | 192 |
| 682 | 3300047318 | Ga0495636_0150871 | Ga0495636_0150871_302_886 | 192 |
| 683 | 3300048919 | Ga0496116_0013376 | Ga0496116_0013376_3468_4079 | 192 |
| 684 | 3300048924 | Ga0496121_0081252 | Ga0496121_0081252_1814_2425 | 192 |
| 685 | 3300048924 | Ga0496121_0221605 | Ga0496121_0221605_264_842 | 192 |
| 686 | 3300048925 | Ga0496122_0002573 | Ga0496122_0002573_2526_3137 | 192 |
| 687 | 3300048926 | Ga0496123_0002577 | Ga0496123_0002577_2470_3081 | 192 |
| 688 | 3300048928 | Ga0496125_0002327 | Ga0496125_0002327_15959_16537 | 192 |
| 689 | 3300048928 | Ga0496125_0026487 | Ga0496125_0026487_2366_2977 | 192 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6hra-assembly1.cif.gz_C | cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) | 0.8512 | 6 | 189 |
| 7bh2-assembly1.cif.gz_C | cryo-em structure of kdpfabc in e2pi state with bef3 and k+ | 0.8457 | 1 | 190 |
| 7bh2-assembly1.cif.gz_C | cryo-em structure of kdpfabc in e2pi state with bef3 and k+ | 0.8376 | 1 | 190 |
| 6hra-assembly1.cif.gz_C | cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) | 0.8344 | 6 | 189 |
| 4dq5-assembly2.cif.gz_B | structural investigation of bacteriophage phi6 lysin (wt) | 0.695 | 132 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jroD04 | Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain | 0.7172 | 136 | 159 | 3.30.365.10 |
| 4dqjA00 | Mainly Alpha;Orthogonal Bundle;Lysozyme;Peptidase U40 | 0.6853 | 132 | 176 | 1.10.530.50 |
| 2nsaA00 | Mainly Alpha;Orthogonal Bundle;Trigger factor, domain 2;Trigger factor, C-terminal domain | 0.6018 | 132 | 186 | 1.10.3120.10 |
| af_Q8I430_342_765_3.40.50.200 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain | 0.5866 | 137 | 189 | 3.40.50.200 |
| 4lvoA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain | 0.5548 | 136 | 188 | 3.40.50.200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-D5RTV0-F1-model_v4 | Potassium-transporting ATPase subunit C | 0.9768 | 144 | 188 |
GO:0005524
GO:0005886 GO:0008556 |
| AF-A0A5T2H3M9-F1-model_v4 | Potassium-transporting ATPase subunit KdpC | 0.9662 | 5 | 53 |
GO:0005524
GO:0005886 GO:0008556 |
| AF-A0A4Q3NCE3-F1-model_v4 | Potassium-transporting ATPase subunit C | 0.9633 | 129 | 189 |
GO:0005524
GO:0005886 GO:0008556 |
| AF-A0A6D0IM01-F1-model_v4 | Potassium-transporting ATPase subunit C | 0.9592 | 133 | 189 |
GO:0005524
GO:0005886 GO:0008556 |
| AF-A0A1V5QQT7-F1-model_v4 | Potassium-transporting ATPase C chain (EC 3.6.3.12) | 0.9579 | 111 | 189 |
GO:0005524
GO:0005886 GO:0008556 GO:0016787 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar