F475158
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 685 | 363 | 684 | 250 |
Family's Representative Sequence
| Representative Sequence | 3300049744|Ga0501083_0241352|Ga0501083_0241352_128_1015 |
| Length | 295 |
| Sequence | MAAGSGARPDPALNSAHGWLPARPRRQGVRQRLAANPEELFMSDYDRNVAAFPGATRTVAVDAGLRAHMIRVYNYMASAVALTGVLAYVTFQAAGGDAIRVAGNTITGLTPFGQTVMGGFAPIVLMLVTLGLVFFISFRINRLQYTTALGLFMLYAGLLGVALSTIFVAYTGASITRVFFISAASFGALSIYGYTTQRDLSPFGSFLIMGLFGIIIASLVNIFLASSALTFAISVIGVLVFAGLTAWDTQKIKEMYSPMDDGTVAGRKAVMGALSLYLDFINLFLMLLRLFGDRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 60 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 72 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 88 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 92 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 100 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 102 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 103 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 156 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 160 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 161 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 165 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 167 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 170 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 175 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 185 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 189 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 197 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 205 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 206 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 207 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 208 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 209 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 210 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 211 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 212 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 213 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 214 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 215 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 216 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 217 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 288 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 289 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 321 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 322 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 323 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 324 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 325 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 336 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 342 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 343 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 344 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 345 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 346 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 347 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 348 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 349 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 350 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 351 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 353 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 354 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 356 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 358 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.33 |
| Metatranscriptomes | 4.53 |
| Isolates | 0.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.76 |
| Nodule | 0 |
| Rhizoplane | 3.5 |
| Rhizosphere | 84.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10004988 | 3300002459 | Bacteria | 2705 |
| 2 | JGI25406J46586_10008857 | 3300003203 | Bacteria | 4531 |
| 3 | JGI25153J46596_10001402 | 3300003215 | Bacteria | 14442 |
| 4 | JGI25153J46596_10004909 | 3300003215 | Bacteria | 7109 |
| 5 | Ga0055527_1000348 | 3300003760 | Bacteria | 22982 |
| 6 | Ga0055535_1000137 | 3300003761 | Bacteria | 76845 |
| 7 | Ga0055542_1008635 | 3300003762 | Bacteria | 1979 |
| 8 | Ga0055529_1005228 | 3300003763 | Bacteria | 1897 |
| 9 | Ga0055529_1012897 | 3300003763 | Bacteria | 1066 |
| 10 | Ga0058859_11740191 | 3300004798 | Bacteria | 822 |
| 11 | Ga0058860_12182228 | 3300004801 | Bacteria | 1040 |
| 12 | Ga0058862_12589958 | 3300004803 | Bacteria | 922 |
| 13 | Ga0058862_12880575 | 3300004803 | Bacteria | 978 |
| 14 | Ga0065707_10217266 | 3300005295 | Bacteria | 1235 |
| 15 | Ga0070670_100073795 | 3300005331 | Bacteria | 2931 |
| 16 | Ga0068869_100257574 | 3300005334 | Bacteria | 1396 |
| 17 | Ga0068868_100176757 | 3300005338 | Bacteria | 1769 |
| 18 | Ga0070689_100243052 | 3300005340 | Bacteria | 1483 |
| 19 | Ga0070668_100136068 | 3300005347 | Bacteria | 1976 |
| 20 | Ga0070669_100100970 | 3300005353 | Bacteria | 2176 |
| 21 | Ga0070669_100145045 | 3300005353 | Bacteria | 1833 |
| 22 | Ga0070675_100026991 | 3300005354 | Bacteria | 4611 |
| 23 | Ga0070675_100133330 | 3300005354 | Bacteria | 2118 |
| 24 | Ga0070675_100370162 | 3300005354 | Bacteria | 1274 |
| 25 | Ga0070671_100005912 | 3300005355 | Bacteria | 9750 |
| 26 | Ga0070674_100021767 | 3300005356 | Bacteria | 4124 |
| 27 | Ga0070674_100835671 | 3300005356 | Bacteria | 798 |
| 28 | Ga0070673_100083880 | 3300005364 | Bacteria | 2590 |
| 29 | Ga0070688_100099172 | 3300005365 | Bacteria | 1917 |
| 30 | Ga0070667_100113718 | 3300005367 | Bacteria | 2349 |
| 31 | Ga0070667_100330999 | 3300005367 | Bacteria | 1376 |
| 32 | Ga0070709_10039119 | 3300005434 | Bacteria | 2909 |
| 33 | Ga0070709_10177453 | 3300005434 | Bacteria | 1493 |
| 34 | Ga0070714_100071523 | 3300005435 | Bacteria | 2999 |
| 35 | Ga0070714_100226570 | 3300005435 | Bacteria | 1720 |
| 36 | Ga0070713_100504625 | 3300005436 | Bacteria | 1142 |
| 37 | Ga0070710_10071096 | 3300005437 | Bacteria | 2006 |
| 38 | Ga0070701_10171535 | 3300005438 | Bacteria | 1264 |
| 39 | Ga0070701_10495026 | 3300005438 | Bacteria | 792 |
| 40 | Ga0070711_100141313 | 3300005439 | Bacteria | 1806 |
| 41 | Ga0070700_100254832 | 3300005441 | Bacteria | 1261 |
| 42 | Ga0070708_100084345 | 3300005445 | Bacteria | 2882 |
| 43 | Ga0070681_10059291 | 3300005458 | Bacteria | 3807 |
| 44 | Ga0068867_100050608 | 3300005459 | Bacteria | 3062 |
| 45 | Ga0070685_10018946 | 3300005466 | Bacteria | 3708 |
| 46 | Ga0070685_10300453 | 3300005466 | Bacteria | 1082 |
| 47 | Ga0070699_100309949 | 3300005518 | Bacteria | 1417 |
| 48 | Ga0070679_100048126 | 3300005530 | Bacteria | 4249 |
| 49 | Ga0070679_100218279 | 3300005530 | Bacteria | 1868 |
| 50 | Ga0070672_100075006 | 3300005543 | Bacteria | 2699 |
| 51 | Ga0070695_100249106 | 3300005545 | Bacteria | 1292 |
| 52 | Ga0070665_100383592 | 3300005548 | Bacteria | 1413 |
| 53 | Ga0070664_100075564 | 3300005564 | Bacteria | 2893 |
| 54 | Ga0070702_100130906 | 3300005615 | Bacteria | 1584 |
| 55 | Ga0068859_100027770 | 3300005617 | Bacteria | 5676 |
| 56 | Ga0068864_100007555 | 3300005618 | Bacteria | 8957 |
| 57 | Ga0068870_10397914 | 3300005840 | Bacteria | 896 |
| 58 | Ga0068858_100373962 | 3300005842 | Bacteria | 1367 |
| 59 | Ga0068860_100351676 | 3300005843 | Bacteria | 1450 |
| 60 | Ga0068862_100121391 | 3300005844 | Bacteria | 2304 |
| 61 | Ga0068862_100393608 | 3300005844 | Bacteria | 1295 |
| 62 | Ga0081538_10124878 | 3300005981 | Bacteria | 1226 |
| 63 | Ga0081540_1001109 | 3300005983 | Bacteria | 23852 |
| 64 | Ga0081539_10003227 | 3300005985 | Bacteria | 20568 |
| 65 | Ga0070717_10079339 | 3300006028 | Bacteria | 2752 |
| 66 | Ga0070717_10514261 | 3300006028 | Bacteria | 1083 |
| 67 | Ga0075365_10053864 | 3300006038 | Bacteria | 2666 |
| 68 | Ga0075365_10098968 | 3300006038 | Bacteria | 1995 |
| 69 | Ga0075368_10085825 | 3300006042 | Bacteria | 1284 |
| 70 | Ga0075363_100015573 | 3300006048 | Bacteria | 3739 |
| 71 | Ga0075364_10016731 | 3300006051 | Bacteria | 4567 |
| 72 | Ga0070715_10172002 | 3300006163 | Bacteria | 1080 |
| 73 | Ga0075367_10093438 | 3300006178 | Bacteria | 1832 |
| 74 | Ga0075367_10229203 | 3300006178 | Bacteria | 1163 |
| 75 | Ga0075367_10232165 | 3300006178 | Bacteria | 1155 |
| 76 | Ga0075369_10028288 | 3300006186 | Bacteria | 2349 |
| 77 | Ga0075369_10069978 | 3300006186 | Bacteria | 1543 |
| 78 | Ga0075369_10202646 | 3300006186 | Bacteria | 916 |
| 79 | Ga0075427_10000389 | 3300006194 | Bacteria | 4930 |
| 80 | Ga0075366_10010635 | 3300006195 | Bacteria | 5169 |
| 81 | Ga0075366_10152062 | 3300006195 | Bacteria | 1402 |
| 82 | Ga0075370_10012948 | 3300006353 | Bacteria | 4422 |
| 83 | Ga0075370_10046449 | 3300006353 | Bacteria | 2457 |
| 84 | Ga0075370_10294985 | 3300006353 | Bacteria | 964 |
| 85 | Ga0075428_100007998 | 3300006844 | Bacteria | 11727 |
| 86 | Ga0075428_100058970 | 3300006844 | Bacteria | 4203 |
| 87 | Ga0075428_100111881 | 3300006844 | Bacteria | 2974 |
| 88 | Ga0075430_100000032 | 3300006846 | Bacteria | 72679 |
| 89 | Ga0075430_100094433 | 3300006846 | Bacteria | 2500 |
| 90 | Ga0075431_100000903 | 3300006847 | Bacteria | 26158 |
| 91 | Ga0075431_100052467 | 3300006847 | Bacteria | 4206 |
| 92 | Ga0075431_100167999 | 3300006847 | Bacteria | 2255 |
| 93 | Ga0075431_100483701 | 3300006847 | Bacteria | 1230 |
| 94 | Ga0075433_10017192 | 3300006852 | Bacteria | 5984 |
| 95 | Ga0075433_10019599 | 3300006852 | Bacteria | 5639 |
| 96 | Ga0075434_100000271 | 3300006871 | Bacteria | 36857 |
| 97 | Ga0075434_100009740 | 3300006871 | Bacteria | 8981 |
| 98 | Ga0075434_100011424 | 3300006871 | Bacteria | 8377 |
| 99 | Ga0075434_100705248 | 3300006871 | Bacteria | 1027 |
| 100 | Ga0075429_100000561 | 3300006880 | Bacteria | 28469 |
| 101 | Ga0075429_100007528 | 3300006880 | Bacteria | 9453 |
| 102 | Ga0097620_100027770 | 3300006931 | Bacteria | 5676 |
| 103 | Ga0075435_100033962 | 3300007076 | Bacteria | 4038 |
| 104 | Ga0075435_100035256 | 3300007076 | Bacteria | 3970 |
| 105 | Ga0075435_100049397 | 3300007076 | Bacteria | 3383 |
| 106 | Ga0099794_10023255 | 3300007265 | Bacteria | 2832 |
| 107 | Ga0099795_10016161 | 3300007788 | Bacteria | 2354 |
| 108 | Ga0111539_10001270 | 3300009094 | Bacteria | 33682 |
| 109 | Ga0111539_10106024 | 3300009094 | Bacteria | 3297 |
| 110 | Ga0111539_10230550 | 3300009094 | Bacteria | 2156 |
| 111 | Ga0105245_10787318 | 3300009098 | Bacteria | 988 |
| 112 | Ga0105247_10345618 | 3300009101 | Bacteria | 1045 |
| 113 | Ga0114129_10001444 | 3300009147 | Bacteria | 32043 |
| 114 | Ga0114129_10395943 | 3300009147 | Bacteria | 1821 |
| 115 | Ga0114129_10488916 | 3300009147 | Bacteria | 1609 |
| 116 | Ga0105243_10622346 | 3300009148 | Bacteria | 1042 |
| 117 | Ga0105243_10798172 | 3300009148 | Bacteria | 930 |
| 118 | Ga0105248_10130763 | 3300009177 | Bacteria | 2832 |
| 119 | Ga0105238_10122440 | 3300009551 | Bacteria | 2580 |
| 120 | Ga0105238_10457467 | 3300009551 | Bacteria | 1274 |
| 121 | Ga0105249_10282604 | 3300009553 | Bacteria | 1658 |
| 122 | Ga0099796_10022382 | 3300010159 | Bacteria | 1960 |
| 123 | Ga0099796_10116269 | 3300010159 | Bacteria | 1023 |
| 124 | Ga0157370_10057496 | 3300013104 | Bacteria | 3698 |
| 125 | Ga0157370_10191953 | 3300013104 | Bacteria | 1896 |
| 126 | Ga0157370_10471142 | 3300013104 | Bacteria | 1154 |
| 127 | Ga0157374_10199033 | 3300013296 | Bacteria | 1961 |
| 128 | Ga0157374_10473994 | 3300013296 | Bacteria | 1254 |
| 129 | Ga0157375_10071761 | 3300013308 | Bacteria | 3477 |
| 130 | Ga0157375_10618559 | 3300013308 | Bacteria | 1241 |
| 131 | Ga0157375_11151307 | 3300013308 | Bacteria | 909 |
| 132 | Ga0157380_10316693 | 3300014326 | Bacteria | 1444 |
| 133 | Ga0163161_10219279 | 3300017792 | Bacteria | 1472 |
| 134 | Ga0184601_134529 | 3300019183 | Bacteria | 829 |
| 135 | Ga0197907_10241108 | 3300020069 | Bacteria | 952 |
| 136 | Ga0197907_11149821 | 3300020069 | Bacteria | 854 |
| 137 | Ga0206356_10058304 | 3300020070 | Bacteria | 1870 |
| 138 | Ga0206356_11190054 | 3300020070 | Bacteria | 804 |
| 139 | Ga0206349_1686143 | 3300020075 | Bacteria | 855 |
| 140 | Ga0206355_1367406 | 3300020076 | Bacteria | 1178 |
| 141 | Ga0206351_10671826 | 3300020077 | Bacteria | 937 |
| 142 | Ga0206351_10851183 | 3300020077 | Bacteria | 850 |
| 143 | Ga0206352_10130377 | 3300020078 | Bacteria | 868 |
| 144 | Ga0206352_10630827 | 3300020078 | Bacteria | 856 |
| 145 | Ga0206350_10136915 | 3300020080 | Bacteria | 960 |
| 146 | Ga0206350_11242039 | 3300020080 | Bacteria | 857 |
| 147 | Ga0206354_10364600 | 3300020081 | Bacteria | 950 |
| 148 | Ga0206353_10033645 | 3300020082 | Bacteria | 1858 |
| 149 | Ga0206353_10830196 | 3300020082 | Bacteria | 950 |
| 150 | Ga0213874_10073401 | 3300021377 | Bacteria | 1096 |
| 151 | Ga0213876_10005720 | 3300021384 | Bacteria | 6814 |
| 152 | Ga0213871_10042533 | 3300021441 | Bacteria | 1224 |
| 153 | Ga0224712_10182174 | 3300022467 | Bacteria | 947 |
| 154 | Ga0224572_1031817 | 3300024225 | Bacteria | 1006 |
| 155 | Ga0228598_1013306 | 3300024227 | Bacteria | 1630 |
| 156 | Ga0209672_100015 | 3300025228 | Bacteria | 529352 |
| 157 | Ga0209147_100016 | 3300025229 | Bacteria | 527606 |
| 158 | Ga0209258_100026 | 3300025242 | Bacteria | 527606 |
| 159 | Ga0209148_1000952 | 3300025254 | Bacteria | 18941 |
| 160 | Ga0209148_1006961 | 3300025254 | Bacteria | 2395 |
| 161 | Ga0209455_1000321 | 3300025272 | Bacteria | 47677 |
| 162 | Ga0209455_1000544 | 3300025272 | Bacteria | 26082 |
| 163 | Ga0209758_1000469 | 3300025297 | Bacteria | 66568 |
| 164 | Ga0209758_1088120 | 3300025297 | Bacteria | 917 |
| 165 | Ga0207682_10000722 | 3300025893 | Bacteria | 15329 |
| 166 | Ga0207692_10065966 | 3300025898 | Bacteria | 1891 |
| 167 | Ga0207692_10073172 | 3300025898 | Bacteria | 1812 |
| 168 | Ga0207688_10083701 | 3300025901 | Bacteria | 1825 |
| 169 | Ga0207685_10153223 | 3300025905 | Bacteria | 1045 |
| 170 | Ga0207699_10050154 | 3300025906 | Bacteria | 2459 |
| 171 | Ga0207645_10020586 | 3300025907 | Bacteria | 4316 |
| 172 | Ga0207645_10111527 | 3300025907 | Bacteria | 1771 |
| 173 | Ga0207654_10369880 | 3300025911 | Bacteria | 991 |
| 174 | Ga0207707_10116011 | 3300025912 | Bacteria | 2340 |
| 175 | Ga0207693_10017643 | 3300025915 | Bacteria | 5691 |
| 176 | Ga0207660_10084805 | 3300025917 | Bacteria | 2335 |
| 177 | Ga0207662_10026247 | 3300025918 | Bacteria | 3359 |
| 178 | Ga0207649_10328407 | 3300025920 | Bacteria | 1126 |
| 179 | Ga0207652_10248325 | 3300025921 | Bacteria | 1605 |
| 180 | Ga0207652_10631978 | 3300025921 | Bacteria | 958 |
| 181 | Ga0207681_10091132 | 3300025923 | Bacteria | 2177 |
| 182 | Ga0207681_10432867 | 3300025923 | Bacteria | 1067 |
| 183 | Ga0207650_10003045 | 3300025925 | Bacteria | 11539 |
| 184 | Ga0207659_10170772 | 3300025926 | Bacteria | 1715 |
| 185 | Ga0207659_10288923 | 3300025926 | Bacteria | 1343 |
| 186 | Ga0207659_10510969 | 3300025926 | Bacteria | 1018 |
| 187 | Ga0207687_10084817 | 3300025927 | Bacteria | 2297 |
| 188 | Ga0207687_10175773 | 3300025927 | Bacteria | 1655 |
| 189 | Ga0207700_10043617 | 3300025928 | Bacteria | 3295 |
| 190 | Ga0207700_10106049 | 3300025928 | Bacteria | 2252 |
| 191 | Ga0207664_10597058 | 3300025929 | Bacteria | 991 |
| 192 | Ga0207644_10003250 | 3300025931 | Bacteria | 10486 |
| 193 | Ga0207690_10140463 | 3300025932 | Bacteria | 1779 |
| 194 | Ga0207706_10575797 | 3300025933 | Bacteria | 968 |
| 195 | Ga0207669_10071094 | 3300025937 | Bacteria | 2184 |
| 196 | Ga0207669_10192897 | 3300025937 | Bacteria | 1471 |
| 197 | Ga0207665_10234830 | 3300025939 | Bacteria | 1349 |
| 198 | Ga0207691_10003529 | 3300025940 | Bacteria | 15210 |
| 199 | Ga0207691_10131990 | 3300025940 | Bacteria | 2205 |
| 200 | Ga0207691_10158744 | 3300025940 | Bacteria | 1985 |
| 201 | Ga0207689_10196599 | 3300025942 | Bacteria | 1664 |
| 202 | Ga0207689_10231147 | 3300025942 | Bacteria | 1528 |
| 203 | Ga0207679_10063581 | 3300025945 | Bacteria | 2755 |
| 204 | Ga0207651_10000859 | 3300025960 | Bacteria | 13273 |
| 205 | Ga0207712_10164602 | 3300025961 | Bacteria | 1727 |
| 206 | Ga0207668_10093724 | 3300025972 | Bacteria | 2213 |
| 207 | Ga0207658_10062401 | 3300025986 | Bacteria | 2789 |
| 208 | Ga0207658_10149656 | 3300025986 | Bacteria | 1900 |
| 209 | Ga0207703_10274460 | 3300026035 | Bacteria | 1529 |
| 210 | Ga0207678_10402337 | 3300026067 | Bacteria | 1186 |
| 211 | Ga0207708_10451360 | 3300026075 | Bacteria | 1071 |
| 212 | Ga0207708_10477546 | 3300026075 | Bacteria | 1042 |
| 213 | Ga0207648_10177525 | 3300026089 | Bacteria | 1884 |
| 214 | Ga0207676_10023059 | 3300026095 | Bacteria | 4585 |
| 215 | Ga0207674_10186439 | 3300026116 | Bacteria | 2025 |
| 216 | Ga0207675_100294924 | 3300026118 | Bacteria | 1578 |
| 217 | Ga0207683_10013489 | 3300026121 | Bacteria | 6972 |
| 218 | Ga0207683_10121660 | 3300026121 | Bacteria | 2344 |
| 219 | Ga0209179_1004914 | 3300027512 | Bacteria | 2055 |
| 220 | Ga0209588_1031078 | 3300027671 | Bacteria | 1707 |
| 221 | Ga0209813_10066764 | 3300027866 | Bacteria | 1161 |
| 222 | Ga0207428_10000082 | 3300027907 | Bacteria | 133684 |
| 223 | Ga0207428_10154679 | 3300027907 | Bacteria | 1744 |
| 224 | Ga0207428_10449065 | 3300027907 | Bacteria | 940 |
| 225 | Ga0268265_10357194 | 3300028380 | Bacteria | 1336 |
| 226 | Ga0268264_10411625 | 3300028381 | Bacteria | 1302 |
| 227 | Ga0268264_11084638 | 3300028381 | Bacteria | 809 |
| 228 | Ga0265334_10001877 | 3300028573 | Bacteria | 9974 |
| 229 | Ga0265318_10008385 | 3300028577 | Bacteria | 4603 |
| 230 | Ga0265338_10068313 | 3300028800 | Bacteria | 3062 |
| 231 | Ga0265338_10081565 | 3300028800 | Bacteria | 2712 |
| 232 | Ga0265330_10009843 | 3300031235 | Bacteria | 4524 |
| 233 | Ga0265332_10007464 | 3300031238 | Bacteria | 4943 |
| 234 | Ga0265325_10002531 | 3300031241 | Bacteria | 12306 |
| 235 | Ga0265325_10004291 | 3300031241 | Bacteria | 9036 |
| 236 | Ga0265325_10005464 | 3300031241 | Bacteria | 7838 |
| 237 | Ga0265325_10016732 | 3300031241 | Bacteria | 4093 |
| 238 | Ga0265325_10019267 | 3300031241 | Bacteria | 3776 |
| 239 | Ga0265325_10033863 | 3300031241 | Bacteria | 2722 |
| 240 | Ga0265340_10006803 | 3300031247 | Bacteria | 6257 |
| 241 | Ga0265340_10010861 | 3300031247 | Bacteria | 4859 |
| 242 | Ga0265340_10042659 | 3300031247 | Bacteria | 2226 |
| 243 | Ga0265340_10073607 | 3300031247 | Bacteria | 1616 |
| 244 | Ga0265339_10000126 | 3300031249 | Bacteria | 63942 |
| 245 | Ga0265339_10019847 | 3300031249 | Bacteria | 3935 |
| 246 | Ga0265331_10029658 | 3300031250 | Bacteria | 2728 |
| 247 | Ga0265331_10044220 | 3300031250 | Bacteria | 2155 |
| 248 | Ga0265316_10016618 | 3300031344 | Bacteria | 6379 |
| 249 | Ga0265316_10246298 | 3300031344 | Bacteria | 1313 |
| 250 | Ga0307513_10012476 | 3300031456 | Bacteria | 10485 |
| 251 | Ga0307513_10170943 | 3300031456 | Bacteria | 2051 |
| 252 | Ga0265313_10000054 | 3300031595 | Bacteria | 110199 |
| 253 | Ga0265313_10000593 | 3300031595 | Bacteria | 37608 |
| 254 | Ga0265313_10009618 | 3300031595 | Bacteria | 6253 |
| 255 | Ga0265313_10016449 | 3300031595 | Bacteria | 4251 |
| 256 | Ga0316575_10040077 | 3300031665 | Bacteria | 1850 |
| 257 | Ga0265314_10144700 | 3300031711 | Bacteria | 1465 |
| 258 | Ga0265342_10000034 | 3300031712 | Bacteria | 145074 |
| 259 | Ga0265342_10012408 | 3300031712 | Bacteria | 5774 |
| 260 | Ga0316576_10252323 | 3300031727 | Bacteria | 1324 |
| 261 | Ga0307516_10205444 | 3300031730 | Bacteria | 1687 |
| 262 | Ga0307405_10308451 | 3300031731 | Bacteria | 1204 |
| 263 | Ga0307413_10413909 | 3300031824 | Bacteria | 1060 |
| 264 | Ga0307416_100962018 | 3300032002 | Bacteria | 956 |
| 265 | Ga0316583_10002336 | 3300032133 | Bacteria | 6547 |
| 266 | Ga0316583_10034329 | 3300032133 | Bacteria | 1800 |
| 267 | Ga0316593_10186110 | 3300032168 | Bacteria | 764 |
| 268 | Ga0316592_1067264 | 3300033524 | Bacteria | 808 |
| 269 | Ga0316587_1035520 | 3300033529 | Bacteria | 891 |
| 270 | Ga0316596_1087836 | 3300033541 | Bacteria | 837 |
| 271 | Ga0316596_1107409 | 3300033541 | Bacteria | 756 |
| 272 | Ga0373923_0029554 | 3300035111 | Bacteria | 2199 |
| 273 | Ga0373923_0038540 | 3300035111 | Bacteria | 1959 |
| 274 | Ga0373923_0213495 | 3300035111 | Bacteria | 895 |
| 275 | Ga0373945_0015071 | 3300035116 | Bacteria | 2598 |
| 276 | Ga0373953_0003215 | 3300035117 | Bacteria | 5057 |
| 277 | Ga0373953_0020098 | 3300035117 | Bacteria | 2493 |
| 278 | Ga0373953_0052158 | 3300035117 | Bacteria | 1655 |
| 279 | Ga0373953_0147965 | 3300035117 | Bacteria | 1006 |
| 280 | Ga0373954_0000445 | 3300035118 | Bacteria | 15476 |
| 281 | Ga0373954_0016395 | 3300035118 | Bacteria | 3316 |
| 282 | Ga0373956_0015215 | 3300035119 | Bacteria | 3219 |
| 283 | Ga0373956_0034655 | 3300035119 | Bacteria | 2223 |
| 284 | Ga0373956_0039236 | 3300035119 | Bacteria | 2098 |
| 285 | Ga0373956_0044526 | 3300035119 | Bacteria | 1978 |
| 286 | Ga0373956_0123417 | 3300035119 | Bacteria | 1210 |
| 287 | Ga0373957_0001446 | 3300035120 | Bacteria | 6435 |
| 288 | Ga0373943_0001478 | 3300035170 | Bacteria | 10640 |
| 289 | Ga0373943_0006511 | 3300035170 | Bacteria | 5247 |
| 290 | Ga0373943_0035254 | 3300035170 | Bacteria | 2390 |
| 291 | Ga0373946_0024272 | 3300035171 | Bacteria | 2374 |
| 292 | Ga0373946_0101768 | 3300035171 | Bacteria | 1289 |
| 293 | Ga0373946_0141751 | 3300035171 | Bacteria | 1115 |
| 294 | Ga0373955_0000310 | 3300035172 | Bacteria | 20214 |
| 295 | Ga0373955_0000456 | 3300035172 | Bacteria | 17318 |
| 296 | Ga0373955_0004242 | 3300035172 | Bacteria | 6332 |
| 297 | Ga0316574_0000145 | 3300035398 | Bacteria | 22563 |
| 298 | Ga0373924_0099306 | 3300035410 | Bacteria | 1251 |
| 299 | Ga0373935_0000011 | 3300035692 | Bacteria | 89873 |
| 300 | Ga0373935_0117456 | 3300035692 | Bacteria | 1773 |
| 301 | Ga0373935_0173475 | 3300035692 | Bacteria | 1476 |
| 302 | Ga0373935_0210499 | 3300035692 | Bacteria | 1347 |
| 303 | Ga0373927_0018445 | 3300035695 | Bacteria | 4587 |
| 304 | Ga0373927_0022396 | 3300035695 | Bacteria | 4139 |
| 305 | Ga0373927_0032762 | 3300035695 | Bacteria | 3384 |
| 306 | Ga0373927_0053021 | 3300035695 | Bacteria | 2623 |
| 307 | Ga0373927_0114613 | 3300035695 | Bacteria | 1757 |
| 308 | Ga0373933_0000315 | 3300035724 | Bacteria | 31397 |
| 309 | Ga0373933_0001894 | 3300035724 | Bacteria | 12065 |
| 310 | Ga0373933_0004896 | 3300035724 | Bacteria | 7308 |
| 311 | Ga0373933_0009553 | 3300035724 | Bacteria | 5295 |
| 312 | Ga0373933_0068023 | 3300035724 | Bacteria | 2163 |
| 313 | Ga0373933_0229686 | 3300035724 | Bacteria | 1192 |
| 314 | Ga0373947_0002093 | 3300035725 | Bacteria | 12167 |
| 315 | Ga0373947_0027350 | 3300035725 | Bacteria | 3338 |
| 316 | Ga0373947_0040197 | 3300035725 | Bacteria | 2785 |
| 317 | Ga0373947_0207074 | 3300035725 | Bacteria | 1285 |
| 318 | Ga0373937_0000019 | 3300036401 | Bacteria | 138568 |
| 319 | Ga0373937_0001931 | 3300036401 | Bacteria | 17346 |
| 320 | Ga0373937_0005293 | 3300036401 | Bacteria | 11025 |
| 321 | Ga0373937_0041506 | 3300036401 | Bacteria | 4196 |
| 322 | Ga0373937_0043108 | 3300036401 | Bacteria | 4117 |
| 323 | Ga0373937_0050476 | 3300036401 | Bacteria | 3810 |
| 324 | Ga0373937_0057234 | 3300036401 | Bacteria | 3581 |
| 325 | Ga0373937_0145718 | 3300036401 | Bacteria | 2217 |
| 326 | Ga0373937_0339950 | 3300036401 | Bacteria | 1421 |
| 327 | Ga0265778_019593 | 3300036457 | Bacteria | 828 |
| 328 | Ga0316582_0062945 | 3300036647 | Bacteria | 2383 |
| 329 | Ga0316584_0043408 | 3300036712 | Bacteria | 3352 |
| 330 | Ga0373925_0000048 | 3300037068 | Bacteria | 129615 |
| 331 | Ga0373925_0012867 | 3300037068 | Bacteria | 6061 |
| 332 | Ga0373925_0396408 | 3300037068 | Bacteria | 1125 |
| 333 | Ga0395899_0009821 | 3300037312 | Bacteria | 7342 |
| 334 | Ga0395899_0013258 | 3300037312 | Bacteria | 6308 |
| 335 | Ga0395900_0028146 | 3300037418 | Bacteria | 5755 |
| 336 | Ga0395898_0104572 | 3300037466 | Bacteria | 2715 |
| 337 | Ga0436364_0305691 | 3300037853 | Bacteria | 1025 |
| 338 | Ga0436364_0548592 | 3300037853 | Bacteria | 946 |
| 339 | Ga0436364_1214892 | 3300037853 | Bacteria | 996 |
| 340 | Ga0395901_0051442 | 3300038443 | Bacteria | 4283 |
| 341 | Ga0395901_0111981 | 3300038443 | Bacteria | 2866 |
| 342 | Ga0395901_0320363 | 3300038443 | Bacteria | 1604 |
| 343 | Ga0395901_0441559 | 3300038443 | Bacteria | 1332 |
| 344 | Ga0436365_1410225 | 3300039437 | Bacteria | 2990 |
| 345 | Ga0436365_1620475 | 3300039437 | Bacteria | 1282 |
| 346 | Ga0436365_1855567 | 3300039437 | Bacteria | 16138 |
| 347 | Ga0436365_1890998 | 3300039437 | Bacteria | 3695 |
| 348 | Ga0436365_1910356 | 3300039437 | Bacteria | 2164 |
| 349 | Ga0436360_0440024 | 3300039438 | Bacteria | 1547 |
| 350 | Ga0436360_0832565 | 3300039438 | Bacteria | 8060 |
| 351 | Ga0436361_0360492 | 3300039447 | Bacteria | 1514 |
| 352 | Ga0436363_0008346 | 3300039450 | Bacteria | 1206 |
| 353 | Ga0436363_0611312 | 3300039450 | Bacteria | 947 |
| 354 | Ga0436363_1081647 | 3300039450 | Bacteria | 2557 |
| 355 | Ga0436363_1307539 | 3300039450 | Bacteria | 1380 |
| 356 | Ga0436362_0343721 | 3300039453 | Bacteria | 1597 |
| 357 | Ga0439439_0051495 | 3300041406 | Bacteria | 1080 |
| 358 | Ga0439453_0041658 | 3300041408 | Bacteria | 902 |
| 359 | Ga0451798_0309505 | 3300041458 | Bacteria | 1032 |
| 360 | Ga0439443_011511 | 3300042003 | Bacteria | 1297 |
| 361 | Ga0450923_013571 | 3300042125 | Bacteria | 1499 |
| 362 | Ga0439458_0053291 | 3300042157 | Bacteria | 1001 |
| 363 | Ga0439464_0025326 | 3300042439 | Bacteria | 1643 |
| 364 | Ga0450893_0013879 | 3300042532 | Bacteria | 1347 |
| 365 | Ga0466971_0078114 | 3300044719 | Bacteria | 1508 |
| 366 | Ga0466967_0081276 | 3300045976 | Bacteria | 2927 |
| 367 | Ga0495592_0000017 | 3300046454 | Bacteria | 142442 |
| 368 | Ga0495592_0001796 | 3300046454 | Bacteria | 15099 |
| 369 | Ga0495592_0003385 | 3300046454 | Bacteria | 11438 |
| 370 | Ga0495591_057922 | 3300046458 | Bacteria | 1037 |
| 371 | Ga0495629_0040146 | 3300046459 | Bacteria | 3292 |
| 372 | Ga0495638_0034696 | 3300046460 | Bacteria | 3221 |
| 373 | Ga0495641_0025187 | 3300046461 | Bacteria | 2922 |
| 374 | Ga0495641_0168293 | 3300046461 | Bacteria | 981 |
| 375 | Ga0495651_0000923 | 3300046462 | Bacteria | 22782 |
| 376 | Ga0495651_0006369 | 3300046462 | Bacteria | 9032 |
| 377 | Ga0495651_0054550 | 3300046462 | Bacteria | 3073 |
| 378 | Ga0495651_0107774 | 3300046462 | Bacteria | 2064 |
| 379 | Ga0495653_0000033 | 3300046463 | Bacteria | 131680 |
| 380 | Ga0495653_0000987 | 3300046463 | Bacteria | 21890 |
| 381 | Ga0495653_0001211 | 3300046463 | Bacteria | 19984 |
| 382 | Ga0495653_0385847 | 3300046463 | Bacteria | 894 |
| 383 | Ga0495582_0069408 | 3300046473 | Bacteria | 1948 |
| 384 | Ga0495639_0018119 | 3300046475 | Bacteria | 3062 |
| 385 | Ga0495639_0050651 | 3300046475 | Bacteria | 1887 |
| 386 | Ga0495662_0037857 | 3300046476 | Bacteria | 2330 |
| 387 | Ga0495664_0000008 | 3300046477 | Bacteria | 307158 |
| 388 | Ga0495664_0046218 | 3300046477 | Bacteria | 2583 |
| 389 | Ga0495664_0072946 | 3300046477 | Bacteria | 2052 |
| 390 | Ga0495664_0196334 | 3300046477 | Bacteria | 1223 |
| 391 | Ga0495585_0000389 | 3300046492 | Bacteria | 42431 |
| 392 | Ga0495608_0000014 | 3300046511 | Bacteria | 221042 |
| 393 | Ga0495608_0033393 | 3300046511 | Bacteria | 3478 |
| 394 | Ga0495618_0000013 | 3300046514 | Bacteria | 168671 |
| 395 | Ga0495618_0040055 | 3300046514 | Bacteria | 2947 |
| 396 | Ga0495628_0000008 | 3300046516 | Bacteria | 284313 |
| 397 | Ga0495628_0003849 | 3300046516 | Bacteria | 13361 |
| 398 | Ga0495628_0054508 | 3300046516 | Bacteria | 3152 |
| 399 | Ga0495628_0152051 | 3300046516 | Bacteria | 1762 |
| 400 | Ga0495628_0243599 | 3300046516 | Bacteria | 1344 |
| 401 | Ga0495630_0000797 | 3300046517 | Bacteria | 22206 |
| 402 | Ga0495630_0051135 | 3300046517 | Bacteria | 3092 |
| 403 | Ga0495637_0154191 | 3300046520 | Bacteria | 865 |
| 404 | Ga0495644_0000373 | 3300046523 | Bacteria | 20312 |
| 405 | Ga0495663_0046982 | 3300046525 | Bacteria | 1328 |
| 406 | Ga0495666_0033440 | 3300046526 | Bacteria | 2511 |
| 407 | Ga0495652_0000005 | 3300046529 | Bacteria | 524368 |
| 408 | Ga0495652_0006346 | 3300046529 | Bacteria | 11012 |
| 409 | Ga0495652_0032454 | 3300046529 | Bacteria | 4566 |
| 410 | Ga0495652_0439637 | 3300046529 | Bacteria | 915 |
| 411 | Ga0495665_0151267 | 3300046531 | Bacteria | 1211 |
| 412 | Ga0495640_0000017 | 3300046533 | Bacteria | 138688 |
| 413 | Ga0495640_0002174 | 3300046533 | Bacteria | 15677 |
| 414 | Ga0495640_0048679 | 3300046533 | Bacteria | 2927 |
| 415 | Ga0495640_0156194 | 3300046533 | Bacteria | 1464 |
| 416 | Ga0495640_0332859 | 3300046533 | Bacteria | 939 |
| 417 | Ga0495586_0312196 | 3300046535 | Bacteria | 901 |
| 418 | Ga0495587_0000005 | 3300046536 | Bacteria | 358412 |
| 419 | Ga0495587_0001202 | 3300046536 | Bacteria | 17146 |
| 420 | Ga0495587_0035484 | 3300046536 | Bacteria | 3003 |
| 421 | Ga0495587_0121730 | 3300046536 | Bacteria | 1494 |
| 422 | Ga0495587_0233941 | 3300046536 | Bacteria | 1035 |
| 423 | Ga0495598_0087651 | 3300046537 | Bacteria | 1009 |
| 424 | Ga0495645_0000007 | 3300046543 | Bacteria | 376299 |
| 425 | Ga0495645_0001074 | 3300046543 | Bacteria | 18551 |
| 426 | Ga0495645_0042155 | 3300046543 | Bacteria | 3328 |
| 427 | Ga0495645_0268809 | 3300046543 | Bacteria | 1126 |
| 428 | Ga0495633_0006655 | 3300046558 | Bacteria | 6809 |
| 429 | Ga0495667_0000012 | 3300046559 | Bacteria | 220967 |
| 430 | Ga0495667_0000905 | 3300046559 | Bacteria | 19136 |
| 431 | Ga0495667_0004405 | 3300046559 | Bacteria | 9495 |
| 432 | Ga0495667_0014158 | 3300046559 | Bacteria | 5384 |
| 433 | Ga0495667_0242628 | 3300046559 | Bacteria | 1147 |
| 434 | Ga0495656_0002104 | 3300046615 | Bacteria | 6575 |
| 435 | Ga0495634_0000070 | 3300046642 | Bacteria | 79664 |
| 436 | Ga0495634_0019551 | 3300046642 | Bacteria | 4811 |
| 437 | Ga0495634_0037227 | 3300046642 | Bacteria | 3325 |
| 438 | Ga0495634_0265951 | 3300046642 | Bacteria | 1045 |
| 439 | Ga0495635_0000010 | 3300046663 | Bacteria | 246385 |
| 440 | Ga0495635_0003590 | 3300046663 | Bacteria | 10738 |
| 441 | Ga0495659_0003751 | 3300046664 | Bacteria | 4831 |
| 442 | Ga0495588_0015269 | 3300046674 | Bacteria | 3692 |
| 443 | Ga0495657_0000178 | 3300046675 | Bacteria | 57139 |
| 444 | Ga0495657_0020484 | 3300046675 | Bacteria | 4753 |
| 445 | Ga0495657_0140535 | 3300046675 | Bacteria | 1505 |
| 446 | Ga0495599_0000015 | 3300046678 | Bacteria | 175055 |
| 447 | Ga0495599_0012323 | 3300046678 | Bacteria | 5266 |
| 448 | Ga0495599_0054864 | 3300046678 | Bacteria | 2496 |
| 449 | Ga0495599_0203610 | 3300046678 | Bacteria | 1215 |
| 450 | Ga0495623_0000054 | 3300046679 | Bacteria | 70217 |
| 451 | Ga0495623_0024201 | 3300046679 | Bacteria | 3916 |
| 452 | Ga0495646_0000012 | 3300046680 | Bacteria | 185805 |
| 453 | Ga0495646_0083868 | 3300046680 | Bacteria | 1851 |
| 454 | Ga0495647_0080003 | 3300046681 | Bacteria | 1324 |
| 455 | Ga0495647_0101405 | 3300046681 | Bacteria | 1192 |
| 456 | Ga0495658_0024037 | 3300046683 | Bacteria | 3240 |
| 457 | Ga0495658_0121856 | 3300046683 | Bacteria | 1578 |
| 458 | Ga0495658_0137699 | 3300046683 | Bacteria | 1491 |
| 459 | Ga0495613_0010812 | 3300046689 | Bacteria | 6771 |
| 460 | Ga0495613_0011807 | 3300046689 | Bacteria | 6488 |
| 461 | Ga0495624_0018068 | 3300046690 | Bacteria | 4721 |
| 462 | Ga0495670_0000106 | 3300046691 | Bacteria | 37100 |
| 463 | Ga0495600_0000031 | 3300046809 | Bacteria | 85535 |
| 464 | Ga0495600_0000293 | 3300046809 | Bacteria | 26819 |
| 465 | Ga0495600_0008849 | 3300046809 | Bacteria | 6200 |
| 466 | Ga0495581_0019786 | 3300047315 | Bacteria | 3909 |
| 467 | Ga0495581_0030496 | 3300047315 | Bacteria | 3124 |
| 468 | Ga0495581_0179917 | 3300047315 | Bacteria | 1236 |
| 469 | Ga0495604_0000001 | 3300047317 | Bacteria | 708627 |
| 470 | Ga0495604_0003139 | 3300047317 | Bacteria | 13208 |
| 471 | Ga0495604_0021273 | 3300047317 | Bacteria | 5178 |
| 472 | Ga0495604_0058002 | 3300047317 | Bacteria | 2974 |
| 473 | Ga0495604_0092509 | 3300047317 | Bacteria | 2240 |
| 474 | Ga0495604_0215288 | 3300047317 | Bacteria | 1325 |
| 475 | Ga0495604_0239232 | 3300047317 | Bacteria | 1242 |
| 476 | Ga0495674_0000012 | 3300047319 | Bacteria | 270651 |
| 477 | Ga0495674_0036514 | 3300047319 | Bacteria | 4422 |
| 478 | Ga0495674_0056041 | 3300047319 | Bacteria | 3454 |
| 479 | Ga0495674_0136213 | 3300047319 | Bacteria | 2066 |
| 480 | Ga0495674_0383770 | 3300047319 | Bacteria | 1136 |
| 481 | Ga0495676_0077187 | 3300047321 | Bacteria | 2541 |
| 482 | Ga0495676_0111879 | 3300047321 | Bacteria | 2002 |
| 483 | Ga0495680_0000483 | 3300047322 | Bacteria | 44818 |
| 484 | Ga0495680_0011330 | 3300047322 | Bacteria | 7903 |
| 485 | Ga0495680_0040789 | 3300047322 | Bacteria | 3696 |
| 486 | Ga0495680_0079071 | 3300047322 | Bacteria | 2487 |
| 487 | Ga0495675_0000500 | 3300047444 | Bacteria | 25407 |
| 488 | Ga0495675_0009488 | 3300047444 | Bacteria | 6058 |
| 489 | Ga0495679_044624 | 3300047446 | Bacteria | 1357 |
| 490 | Ga0495685_069074 | 3300047447 | Bacteria | 1185 |
| 491 | Ga0495684_0000021 | 3300047471 | Bacteria | 144901 |
| 492 | Ga0495684_0117918 | 3300047471 | Bacteria | 2000 |
| 493 | Ga0495684_0268751 | 3300047471 | Bacteria | 1234 |
| 494 | Ga0495593_0000387 | 3300047673 | Bacteria | 24410 |
| 495 | Ga0495593_0040640 | 3300047673 | Bacteria | 2503 |
| 496 | Ga0495602_0000031 | 3300048088 | Bacteria | 141518 |
| 497 | Ga0495602_0014374 | 3300048088 | Bacteria | 8039 |
| 498 | Ga0495602_0031070 | 3300048088 | Bacteria | 5055 |
| 499 | Ga0495602_0108292 | 3300048088 | Bacteria | 2263 |
| 500 | Ga0495602_0282037 | 3300048088 | Bacteria | 1223 |
| 501 | Ga0495614_0005015 | 3300048089 | Bacteria | 5973 |
| 502 | Ga0495614_0076720 | 3300048089 | Bacteria | 1445 |
| 503 | Ga0495615_0049002 | 3300048090 | Bacteria | 1081 |
| 504 | Ga0496100_0007708 | 3300048903 | Bacteria | 5959 |
| 505 | Ga0496100_0100101 | 3300048903 | Bacteria | 1996 |
| 506 | Ga0496100_0158715 | 3300048903 | Bacteria | 1620 |
| 507 | Ga0496101_0368609 | 3300048904 | Bacteria | 1129 |
| 508 | Ga0496101_0610585 | 3300048904 | Bacteria | 862 |
| 509 | Ga0496104_0006199 | 3300048907 | Bacteria | 10503 |
| 510 | Ga0496104_0124558 | 3300048907 | Bacteria | 2474 |
| 511 | Ga0496105_0246905 | 3300048908 | Bacteria | 1447 |
| 512 | Ga0496106_0385086 | 3300048909 | Bacteria | 1127 |
| 513 | Ga0496106_0444866 | 3300048909 | Bacteria | 1041 |
| 514 | Ga0496107_0283282 | 3300048910 | Bacteria | 1233 |
| 515 | Ga0496107_0394978 | 3300048910 | Bacteria | 1029 |
| 516 | Ga0496109_0070082 | 3300048912 | Bacteria | 3217 |
| 517 | Ga0496110_0050779 | 3300048913 | Bacteria | 3643 |
| 518 | Ga0496112_0051251 | 3300048915 | Bacteria | 4048 |
| 519 | Ga0496112_0250944 | 3300048915 | Bacteria | 1720 |
| 520 | Ga0496112_0397824 | 3300048915 | Bacteria | 1317 |
| 521 | Ga0496113_0043582 | 3300048916 | Bacteria | 3321 |
| 522 | Ga0496114_0068181 | 3300048917 | Bacteria | 2986 |
| 523 | Ga0496114_0083899 | 3300048917 | Bacteria | 2697 |
| 524 | Ga0496114_0109828 | 3300048917 | Bacteria | 2362 |
| 525 | Ga0496115_0121428 | 3300048918 | Bacteria | 2150 |
| 526 | Ga0496115_0190556 | 3300048918 | Bacteria | 1694 |
| 527 | Ga0496126_0015811 | 3300048929 | Bacteria | 7580 |
| 528 | Ga0496126_0042509 | 3300048929 | Bacteria | 4197 |
| 529 | Ga0501031_0002913 | 3300049568 | Bacteria | 10943 |
| 530 | Ga0501032_0001960 | 3300049569 | Bacteria | 16196 |
| 531 | Ga0501032_0129048 | 3300049569 | Bacteria | 1669 |
| 532 | Ga0501033_0014226 | 3300049570 | Bacteria | 6048 |
| 533 | Ga0501033_0021483 | 3300049570 | Bacteria | 4869 |
| 534 | Ga0501034_0003727 | 3300049571 | Bacteria | 17214 |
| 535 | Ga0501034_0487980 | 3300049571 | Bacteria | 1147 |
| 536 | Ga0501036_0015848 | 3300049572 | Bacteria | 6294 |
| 537 | Ga0501036_0279009 | 3300049572 | Bacteria | 1399 |
| 538 | Ga0501037_0010686 | 3300049573 | Bacteria | 6745 |
| 539 | Ga0501037_0287712 | 3300049573 | Bacteria | 1144 |
| 540 | Ga0501038_0008913 | 3300049574 | Bacteria | 9204 |
| 541 | Ga0501038_0205971 | 3300049574 | Bacteria | 1576 |
| 542 | Ga0501039_0001032 | 3300049575 | Bacteria | 20355 |
| 543 | Ga0501042_0102050 | 3300049578 | Bacteria | 2063 |
| 544 | Ga0501043_0022908 | 3300049579 | Bacteria | 4897 |
| 545 | Ga0501043_0047745 | 3300049579 | Bacteria | 3366 |
| 546 | Ga0501043_0328019 | 3300049579 | Bacteria | 1166 |
| 547 | Ga0501046_0000897 | 3300049580 | Bacteria | 29016 |
| 548 | Ga0501046_0314087 | 3300049580 | Bacteria | 1143 |
| 549 | Ga0501047_0023976 | 3300049581 | Bacteria | 5859 |
| 550 | Ga0501047_0036900 | 3300049581 | Bacteria | 4724 |
| 551 | Ga0501047_0091531 | 3300049581 | Bacteria | 2920 |
| 552 | Ga0501047_0352092 | 3300049581 | Bacteria | 1309 |
| 553 | Ga0501047_0559659 | 3300049581 | Bacteria | 967 |
| 554 | Ga0501048_0006504 | 3300049582 | Bacteria | 8882 |
| 555 | Ga0501067_0032125 | 3300049583 | Bacteria | 2913 |
| 556 | Ga0501068_0001271 | 3300049584 | Bacteria | 13384 |
| 557 | Ga0501068_0109336 | 3300049584 | Bacteria | 1718 |
| 558 | Ga0501069_0000490 | 3300049585 | Bacteria | 18056 |
| 559 | Ga0501070_0012403 | 3300049586 | Bacteria | 7188 |
| 560 | Ga0501070_0023540 | 3300049586 | Bacteria | 5159 |
| 561 | Ga0501070_0067905 | 3300049586 | Bacteria | 2952 |
| 562 | Ga0501071_0012141 | 3300049587 | Bacteria | 5829 |
| 563 | Ga0501071_0169366 | 3300049587 | Bacteria | 1635 |
| 564 | Ga0501072_0003460 | 3300049588 | Bacteria | 11898 |
| 565 | Ga0501072_0004379 | 3300049588 | Bacteria | 10721 |
| 566 | Ga0501072_0210737 | 3300049588 | Bacteria | 1548 |
| 567 | Ga0501072_0589670 | 3300049588 | Bacteria | 877 |
| 568 | Ga0501073_0001330 | 3300049589 | Bacteria | 18204 |
| 569 | Ga0501073_0059989 | 3300049589 | Bacteria | 2655 |
| 570 | Ga0501074_0001714 | 3300049590 | Bacteria | 14964 |
| 571 | Ga0501074_0115632 | 3300049590 | Bacteria | 1919 |
| 572 | Ga0501075_0027955 | 3300049591 | Bacteria | 4159 |
| 573 | Ga0501075_0110810 | 3300049591 | Bacteria | 2087 |
| 574 | Ga0501076_0397553 | 3300049592 | Bacteria | 1133 |
| 575 | Ga0501076_0474424 | 3300049592 | Bacteria | 1031 |
| 576 | Ga0501076_0659582 | 3300049592 | Bacteria | 863 |
| 577 | Ga0501077_0013421 | 3300049593 | Bacteria | 5138 |
| 578 | Ga0501077_0037268 | 3300049593 | Bacteria | 3098 |
| 579 | Ga0501079_0017343 | 3300049741 | Bacteria | 5499 |
| 580 | Ga0501079_0114417 | 3300049741 | Bacteria | 2097 |
| 581 | Ga0501080_0005290 | 3300049742 | Bacteria | 11492 |
| 582 | Ga0501080_0049606 | 3300049742 | Bacteria | 3907 |
| 583 | Ga0501080_0129312 | 3300049742 | Bacteria | 2338 |
| 584 | Ga0501080_0259571 | 3300049742 | Bacteria | 1583 |
| 585 | Ga0501081_0120944 | 3300049743 | Bacteria | 1865 |
| 586 | Ga0501081_0344456 | 3300049743 | Bacteria | 1098 |
| 587 | Ga0501083_0006952 | 3300049744 | Bacteria | 8028 |
| 588 | Ga0501083_0033311 | 3300049744 | Bacteria | 3529 |
| 589 | Ga0501083_0058798 | 3300049744 | Bacteria | 2572 |
| 590 | Ga0501083_0071562 | 3300049744 | Bacteria | 2305 |
| 591 | Ga0501083_0241352 | 3300049744 | Bacteria | 1176 |
| 592 | Ga0501035_0016898 | 3300049822 | Bacteria | 6727 |
| 593 | Ga0501035_0040812 | 3300049822 | Bacteria | 4192 |
| 594 | Ga0501035_0094431 | 3300049822 | Bacteria | 2630 |
| 595 | Ga0501044_0004609 | 3300049823 | Bacteria | 15418 |
| 596 | Ga0501044_0030415 | 3300049823 | Bacteria | 5691 |
| 597 | Ga0501044_0086053 | 3300049823 | Bacteria | 3176 |
| 598 | Ga0501044_0594138 | 3300049823 | Bacteria | 1000 |
| 599 | Ga0501045_0014635 | 3300049824 | Bacteria | 5562 |
| 600 | Ga0501045_0374458 | 3300049824 | Bacteria | 1060 |
| 601 | nmdc:mga03683_96864_c1 | 3300050489 | Bacteria | 1293 |
| 602 | nmdc:mga03n38_55175_c1 | 3300050490 | Bacteria | 1789 |
| 603 | nmdc:mga00v17_70140_c1 | 3300050491 | Bacteria | 2170 |
| 604 | nmdc:mga0yw44_49170_c1 | 3300050492 | Bacteria | 2544 |
| 605 | nmdc:mga0k408_145779_c1 | 3300050493 | Bacteria | 1409 |
| 606 | nmdc:mga0k408_95583_c1 | 3300050493 | Bacteria | 1748 |
| 607 | nmdc:mga06z11_9341_c1 | 3300050494 | Bacteria | 4129 |
| 608 | nmdc:mga07m45_423703_c1 | 3300050496 | Bacteria | 772 |
| 609 | nmdc:mga07m45_53357_c1 | 3300050496 | Bacteria | 2284 |
| 610 | nmdc:mga05p37_19_c2 | 3300050507 | Bacteria | 99994 |
| 611 | nmdc:mga05p37_397809_c1 | 3300050507 | Bacteria | 1609 |
| 612 | nmdc:mga05p37_4690_c1 | 3300050507 | Bacteria | 15966 |
| 613 | nmdc:mga05p37_714414_c1 | 3300050507 | Bacteria | 1111 |
| 614 | nmdc:mga05p37_8335_c1 | 3300050507 | Bacteria | 12261 |
| 615 | nmdc:mga09592_123530_c1 | 3300050508 | Bacteria | 2224 |
| 616 | nmdc:mga09592_1297_c1 | 3300050508 | Bacteria | 20091 |
| 617 | nmdc:mga0qj67_187623_c1 | 3300050509 | Bacteria | 1680 |
| 618 | nmdc:mga0qj67_20786_c1 | 3300050509 | Bacteria | 5026 |
| 619 | nmdc:mga0qj67_259_c1 | 3300050509 | Bacteria | 36242 |
| 620 | nmdc:mga06r32_1133_c1 | 3300050510 | Bacteria | 23910 |
| 621 | nmdc:mga06r32_20691_c1 | 3300050510 | Bacteria | 6061 |
| 622 | nmdc:mga06r32_304636_c1 | 3300050510 | Bacteria | 1579 |
| 623 | nmdc:mga08y16_221041_c1 | 3300050511 | Bacteria | 1961 |
| 624 | nmdc:mga08y16_354_c1 | 3300050511 | Bacteria | 41427 |
| 625 | nmdc:mga08y16_87928_c1 | 3300050511 | Bacteria | 3238 |
| 626 | nmdc:mga08y16_917950_c1 | 3300050511 | Bacteria | 861 |
| 627 | nmdc:mga0n895_114398_c1 | 3300050512 | Bacteria | 2716 |
| 628 | nmdc:mga0n895_31979_c1 | 3300050512 | Bacteria | 5045 |
| 629 | nmdc:mga0n895_58419_c1 | 3300050512 | Bacteria | 3803 |
| 630 | nmdc:mga0n895_701_c1 | 3300050512 | Bacteria | 23539 |
| 631 | nmdc:mga0rr50_10515_c1 | 3300050513 | Bacteria | 5875 |
| 632 | nmdc:mga0rr50_35347_c1 | 3300050513 | Bacteria | 3588 |
| 633 | nmdc:mga0a205_21253_c1 | 3300050515 | Bacteria | 6138 |
| 634 | nmdc:mga0a205_249_c1 | 3300050515 | Bacteria | 38472 |
| 635 | nmdc:mga0sz30_1915_c1 | 3300050516 | Bacteria | 7430 |
| 636 | nmdc:mga0sz30_45391_c1 | 3300050516 | Bacteria | 1853 |
| 637 | Ga0495601_0000011 | 3300053077 | Bacteria | 264937 |
| 638 | Ga0495601_0015267 | 3300053077 | Bacteria | 4641 |
| 639 | Ga0495601_0042986 | 3300053077 | Bacteria | 2837 |
| 640 | Ga0495601_0065052 | 3300053077 | Bacteria | 2320 |
| 641 | Ga0495601_0066178 | 3300053077 | Bacteria | 2300 |
| 642 | Ga0495601_0085934 | 3300053077 | Bacteria | 2021 |
| 643 | Ga0495612_0000006 | 3300053078 | Bacteria | 269278 |
| 644 | Ga0495612_0000089 | 3300053078 | Bacteria | 40250 |
| 645 | Ga0495612_0005230 | 3300053078 | Bacteria | 5360 |
| 646 | Ga0495612_0043377 | 3300053078 | Bacteria | 1837 |
| 647 | Ga0495612_0050167 | 3300053078 | Bacteria | 1713 |
| 648 | Ga0495655_0002001 | 3300053083 | Bacteria | 3188 |
| 649 | Ga0495595_0000021 | 3300053084 | Bacteria | 115921 |
| 650 | Ga0495595_0018109 | 3300053084 | Bacteria | 3039 |
| 651 | Ga0495595_0068379 | 3300053084 | Bacteria | 1675 |
| 652 | Ga0495595_0223661 | 3300053084 | Bacteria | 939 |
| 653 | Ga0495619_0000013 | 3300053085 | Bacteria | 264865 |
| 654 | Ga0495619_0001549 | 3300053085 | Bacteria | 15135 |
| 655 | Ga0495619_0020373 | 3300053085 | Bacteria | 4222 |
| 656 | Ga0500646_0142164 | 3300053090 | Bacteria | 788 |
| 657 | Ga0500583_0208224 | 3300053092 | Bacteria | 971 |
| 658 | Ga0500651_0087411 | 3300053093 | Bacteria | 1924 |
| 659 | Ga0500651_0117410 | 3300053093 | Bacteria | 1618 |
| 660 | Ga0500641_0159619 | 3300053096 | Bacteria | 972 |
| 661 | Ga0500555_020690 | 3300053103 | Bacteria | 1895 |
| 662 | Ga0500562_027598 | 3300053108 | Bacteria | 1490 |
| 663 | Ga0500593_002685 | 3300053117 | Bacteria | 6578 |
| 664 | Ga0500594_0086433 | 3300053118 | Bacteria | 946 |
| 665 | Ga0500642_0026283 | 3300053130 | Bacteria | 2375 |
| 666 | Ga0500577_0236081 | 3300053142 | Bacteria | 793 |
| 667 | Ga0500604_0113132 | 3300053151 | Bacteria | 902 |
| 668 | Ga0500616_0002635 | 3300053153 | Bacteria | 14631 |
| 669 | Ga0500620_129648 | 3300053155 | Bacteria | 883 |
| 670 | Ga0500627_0060635 | 3300053158 | Bacteria | 1664 |
| 671 | Ga0500611_043870 | 3300053727 | Bacteria | 995 |
| 672 | Ga0501084_0030212 | 3300054114 | Bacteria | 4531 |
| 673 | Ga0501084_0422951 | 3300054114 | Bacteria | 1126 |
| 674 | Ga0501084_0488303 | 3300054114 | Bacteria | 1041 |
| 675 | Ga0590071_058722 | 3300059421 | Bacteria | 938 |
| 676 | Ga0587092_033054 | 3300059512 | Bacteria | 866 |
| 677 | Ga0587106_020398 | 3300059605 | Bacteria | 978 |
| 678 | Ga0587108_005203 | 3300059653 | Bacteria | 974 |
| 679 | Ga0587111_0007632 | 3300060346 | Bacteria | 1764 |
| 680 | Ga0501082_0043600 | 3300060353 | Bacteria | 3868 |
| 681 | Ga0501082_0065082 | 3300060353 | Bacteria | 3139 |
| 682 | Ga0501082_0249051 | 3300060353 | Bacteria | 1546 |
| 683 | Ga0501082_0501108 | 3300060353 | Bacteria | 1061 |
| 684 | Ga0530510_0031863 | 3300061734 | Bacteria | 3791 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005983 | Ga0081540_1001109 | Ga0081540_100110919 | 203 |
| 2 | 3300009148 | Ga0105243_10798172 | Ga0105243_107981721 | 207 |
| 3 | 3300026075 | Ga0207708_10477546 | Ga0207708_104775461 | 212 |
| 4 | 3300053103 | Ga0500555_020690 | Ga0500555_020690_374_1030 | 214 |
| 5 | 3300036647 | Ga0316582_0062945 | Ga0316582_0062945_1134_1823 | 223 |
| 6 | 3300004803 | Ga0058862_12589958 | Ga0058862_125899581 | 225 |
| 7 | 3300020077 | Ga0206351_10671826 | Ga0206351_106718261 | 225 |
| 8 | 3300053090 | Ga0500646_0142164 | Ga0500646_0142164_57_752 | 227 |
| 9 | 3300006048 | Ga0075363_100015573 | Ga0075363_1000155732 | 231 |
| 10 | 3300006178 | Ga0075367_10093438 | Ga0075367_100934382 | 231 |
| 11 | 3300006195 | Ga0075366_10152062 | Ga0075366_101520622 | 231 |
| 12 | 3300014326 | Ga0157380_10316693 | Ga0157380_103166932 | 231 |
| 13 | 3300027866 | Ga0209813_10066764 | Ga0209813_100667641 | 231 |
| 14 | 3300032168 | Ga0316593_10186110 | Ga0316593_101861101 | 231 |
| 15 | 3300033541 | Ga0316596_1107409 | Ga0316596_11074091 | 231 |
| 16 | 3300050490 | nmdc:mga03n38_55175_c1 | nmdc:mga03n38_55175_c1_726_1499 | 231 |
| 17 | 3300050493 | nmdc:mga0k408_95583_c1 | nmdc:mga0k408_95583_c1_675_1448 | 231 |
| 18 | 3300053108 | Ga0500562_027598 | Ga0500562_027598_254_994 | 231 |
| 19 | 3300005354 | Ga0070675_100133330 | Ga0070675_1001333301 | 232 |
| 20 | 3300005356 | Ga0070674_100021767 | Ga0070674_1000217673 | 232 |
| 21 | 3300005840 | Ga0068870_10397914 | Ga0068870_103979141 | 232 |
| 22 | 3300013308 | Ga0157375_10071761 | Ga0157375_100717616 | 232 |
| 23 | 3300025901 | Ga0207688_10083701 | Ga0207688_100837012 | 232 |
| 24 | 3300025926 | Ga0207659_10288923 | Ga0207659_102889232 | 232 |
| 25 | 3300025940 | Ga0207691_10158744 | Ga0207691_101587443 | 232 |
| 26 | 3300003760 | Ga0055527_1000348 | Ga0055527_100034813 | 233 |
| 27 | 3300003761 | Ga0055535_1000137 | Ga0055535_100013713 | 233 |
| 28 | 3300003763 | Ga0055529_1005228 | Ga0055529_10052282 | 233 |
| 29 | 3300005844 | Ga0068862_100393608 | Ga0068862_1003936082 | 233 |
| 30 | 3300025228 | Ga0209672_100015 | Ga0209672_100015397 | 233 |
| 31 | 3300025229 | Ga0209147_100016 | Ga0209147_10001666 | 233 |
| 32 | 3300025242 | Ga0209258_100026 | Ga0209258_100026397 | 233 |
| 33 | 3300025254 | Ga0209148_1000952 | Ga0209148_100095216 | 233 |
| 34 | 3300025272 | Ga0209455_1000321 | Ga0209455_100032114 | 233 |
| 35 | 3300025937 | Ga0207669_10192897 | Ga0207669_101928971 | 233 |
| 36 | 3300048910 | Ga0496107_0283282 | Ga0496107_0283282_105_920 | 234 |
| 37 | 3300050507 | nmdc:mga05p37_4690_c1 | nmdc:mga05p37_4690_c1_10938_11714 | 234 |
| 38 | 3300059653 | Ga0587108_005203 | Ga0587108_005203_172_912 | 234 |
| 39 | 3300003203 | JGI25406J46586_10008857 | JGI25406J46586_100088573 | 235 |
| 40 | 3300005295 | Ga0065707_10217266 | Ga0065707_102172662 | 235 |
| 41 | 3300005356 | Ga0070674_100835671 | Ga0070674_1008356711 | 235 |
| 42 | 3300005844 | Ga0068862_100121391 | Ga0068862_1001213912 | 235 |
| 43 | 3300005985 | Ga0081539_10003227 | Ga0081539_1000322717 | 235 |
| 44 | 3300025961 | Ga0207712_10164602 | Ga0207712_101646022 | 235 |
| 45 | 3300028380 | Ga0268265_10357194 | Ga0268265_103571942 | 235 |
| 46 | 3300031241 | Ga0265325_10019267 | Ga0265325_100192673 | 235 |
| 47 | 3300039437 | Ga0436365_1410225 | Ga0436365_1410225_1213_1923 | 235 |
| 48 | 3300041406 | Ga0439439_0051495 | Ga0439439_0051495_42_752 | 235 |
| 49 | 3300042532 | Ga0450893_0013879 | Ga0450893_0013879_341_1090 | 235 |
| 50 | 3300048090 | Ga0495615_0049002 | Ga0495615_0049002_132_842 | 235 |
| 51 | 3300059512 | Ga0587092_033054 | Ga0587092_033054_11_766 | 235 |
| 52 | 3300004798 | Ga0058859_11740191 | Ga0058859_117401911 | 236 |
| 53 | 3300004801 | Ga0058860_12182228 | Ga0058860_121822281 | 236 |
| 54 | 3300005354 | Ga0070675_100026991 | Ga0070675_1000269913 | 236 |
| 55 | 3300005355 | Ga0070671_100005912 | Ga0070671_10000591210 | 236 |
| 56 | 3300005364 | Ga0070673_100083880 | Ga0070673_1000838802 | 236 |
| 57 | 3300005367 | Ga0070667_100330999 | Ga0070667_1003309991 | 236 |
| 58 | 3300005434 | Ga0070709_10039119 | Ga0070709_100391191 | 236 |
| 59 | 3300005435 | Ga0070714_100071523 | Ga0070714_1000715232 | 236 |
| 60 | 3300005436 | Ga0070713_100504625 | Ga0070713_1005046251 | 236 |
| 61 | 3300005437 | Ga0070710_10071096 | Ga0070710_100710961 | 236 |
| 62 | 3300005439 | Ga0070711_100141313 | Ga0070711_1001413132 | 236 |
| 63 | 3300005564 | Ga0070664_100075564 | Ga0070664_1000755643 | 236 |
| 64 | 3300006028 | Ga0070717_10079339 | Ga0070717_100793392 | 236 |
| 65 | 3300006847 | Ga0075431_100167999 | Ga0075431_1001679992 | 236 |
| 66 | 3300009177 | Ga0105248_10130763 | Ga0105248_101307632 | 236 |
| 67 | 3300009551 | Ga0105238_10457467 | Ga0105238_104574671 | 236 |
| 68 | 3300013296 | Ga0157374_10473994 | Ga0157374_104739942 | 236 |
| 69 | 3300021384 | Ga0213876_10005720 | Ga0213876_100057206 | 236 |
| 70 | 3300025898 | Ga0207692_10065966 | Ga0207692_100659661 | 236 |
| 71 | 3300025906 | Ga0207699_10050154 | Ga0207699_100501542 | 236 |
| 72 | 3300025915 | Ga0207693_10017643 | Ga0207693_100176434 | 236 |
| 73 | 3300025925 | Ga0207650_10003045 | Ga0207650_100030453 | 236 |
| 74 | 3300025926 | Ga0207659_10170772 | Ga0207659_101707722 | 236 |
| 75 | 3300025927 | Ga0207687_10175773 | Ga0207687_101757733 | 236 |
| 76 | 3300025928 | Ga0207700_10043617 | Ga0207700_100436172 | 236 |
| 77 | 3300025931 | Ga0207644_10003250 | Ga0207644_100032505 | 236 |
| 78 | 3300025933 | Ga0207706_10575797 | Ga0207706_105757971 | 236 |
| 79 | 3300025940 | Ga0207691_10131990 | Ga0207691_101319902 | 236 |
| 80 | 3300025945 | Ga0207679_10063581 | Ga0207679_100635814 | 236 |
| 81 | 3300025960 | Ga0207651_10000859 | Ga0207651_100008595 | 236 |
| 82 | 3300025986 | Ga0207658_10062401 | Ga0207658_100624012 | 236 |
| 83 | 3300026121 | Ga0207683_10121660 | Ga0207683_101216602 | 236 |
| 84 | 3300028381 | Ga0268264_11084638 | Ga0268264_110846381 | 236 |
| 85 | 3300028573 | Ga0265334_10001877 | Ga0265334_100018776 | 236 |
| 86 | 3300039437 | Ga0436365_1855567 | Ga0436365_1855567_6513_7283 | 236 |
| 87 | 3300048903 | Ga0496100_0007708 | Ga0496100_0007708_585_1352 | 236 |
| 88 | 3300048904 | Ga0496101_0368609 | Ga0496101_0368609_321_1088 | 236 |
| 89 | 3300048908 | Ga0496105_0246905 | Ga0496105_0246905_164_931 | 236 |
| 90 | 3300048912 | Ga0496109_0070082 | Ga0496109_0070082_2213_2980 | 236 |
| 91 | 3300048913 | Ga0496110_0050779 | Ga0496110_0050779_499_1266 | 236 |
| 92 | 3300048915 | Ga0496112_0250944 | Ga0496112_0250944_481_1248 | 236 |
| 93 | 3300048916 | Ga0496113_0043582 | Ga0496113_0043582_1373_2140 | 236 |
| 94 | 3300048918 | Ga0496115_0190556 | Ga0496115_0190556_259_1026 | 236 |
| 95 | 3300050510 | nmdc:mga06r32_20691_c1 | nmdc:mga06r32_20691_c1_1173_1961 | 236 |
| 96 | 3300006844 | Ga0075428_100111881 | Ga0075428_1001118815 | 237 |
| 97 | 3300009148 | Ga0105243_10622346 | Ga0105243_106223461 | 237 |
| 98 | 3300031238 | Ga0265332_10007464 | Ga0265332_100074642 | 237 |
| 99 | 3300031247 | Ga0265340_10073607 | Ga0265340_100736071 | 237 |
| 100 | 3300031249 | Ga0265339_10019847 | Ga0265339_100198473 | 237 |
| 101 | 3300031250 | Ga0265331_10029658 | Ga0265331_100296585 | 237 |
| 102 | 3300031712 | Ga0265342_10000034 | Ga0265342_10000034131 | 237 |
| 103 | 3300031730 | Ga0307516_10205444 | Ga0307516_102054441 | 237 |
| 104 | 3300042003 | Ga0439443_011511 | Ga0439443_011511_161_880 | 237 |
| 105 | 3300045976 | Ga0466967_0081276 | Ga0466967_0081276_766_1536 | 237 |
| 106 | 3300003762 | Ga0055542_1008635 | Ga0055542_10086351 | 238 |
| 107 | 3300003763 | Ga0055529_1012897 | Ga0055529_10128971 | 238 |
| 108 | 3300005347 | Ga0070668_100136068 | Ga0070668_1001360681 | 238 |
| 109 | 3300005353 | Ga0070669_100100970 | Ga0070669_1001009702 | 238 |
| 110 | 3300005843 | Ga0068860_100351676 | Ga0068860_1003516762 | 238 |
| 111 | 3300009553 | Ga0105249_10282604 | Ga0105249_102826043 | 238 |
| 112 | 3300024227 | Ga0228598_1013306 | Ga0228598_10133062 | 238 |
| 113 | 3300025254 | Ga0209148_1006961 | Ga0209148_10069611 | 238 |
| 114 | 3300025272 | Ga0209455_1000544 | Ga0209455_100054412 | 238 |
| 115 | 3300025923 | Ga0207681_10091132 | Ga0207681_100911323 | 238 |
| 116 | 3300025926 | Ga0207659_10510969 | Ga0207659_105109691 | 238 |
| 117 | 3300025932 | Ga0207690_10140463 | Ga0207690_101404632 | 238 |
| 118 | 3300025972 | Ga0207668_10093724 | Ga0207668_100937243 | 238 |
| 119 | 3300027907 | Ga0207428_10154679 | Ga0207428_101546791 | 238 |
| 120 | 3300028381 | Ga0268264_10411625 | Ga0268264_104116252 | 238 |
| 121 | 3300031241 | Ga0265325_10005464 | Ga0265325_100054646 | 238 |
| 122 | 3300031595 | Ga0265313_10009618 | Ga0265313_100096185 | 238 |
| 123 | 3300035117 | Ga0373953_0052158 | Ga0373953_0052158_490_1248 | 238 |
| 124 | 3300035119 | Ga0373956_0015215 | Ga0373956_0015215_1639_2397 | 238 |
| 125 | 3300035171 | Ga0373946_0101768 | Ga0373946_0101768_346_1104 | 238 |
| 126 | 3300035695 | Ga0373927_0114613 | Ga0373927_0114613_15_773 | 238 |
| 127 | 3300035724 | Ga0373933_0004896 | Ga0373933_0004896_5500_6258 | 238 |
| 128 | 3300035725 | Ga0373947_0207074 | Ga0373947_0207074_40_798 | 238 |
| 129 | 3300036401 | Ga0373937_0043108 | Ga0373937_0043108_2704_3462 | 238 |
| 130 | 3300037068 | Ga0373925_0012867 | Ga0373925_0012867_3694_4452 | 238 |
| 131 | 3300041458 | Ga0451798_0309505 | Ga0451798_0309505_186_920 | 238 |
| 132 | 3300046454 | Ga0495592_0001796 | Ga0495592_0001796_3885_4643 | 238 |
| 133 | 3300046463 | Ga0495653_0385847 | Ga0495653_0385847_38_796 | 238 |
| 134 | 3300046516 | Ga0495628_0003849 | Ga0495628_0003849_11186_11944 | 238 |
| 135 | 3300046529 | Ga0495652_0006346 | Ga0495652_0006346_4327_5085 | 238 |
| 136 | 3300046533 | Ga0495640_0156194 | Ga0495640_0156194_377_1135 | 238 |
| 137 | 3300046536 | Ga0495587_0035484 | Ga0495587_0035484_2222_2980 | 238 |
| 138 | 3300046543 | Ga0495645_0001074 | Ga0495645_0001074_653_1411 | 238 |
| 139 | 3300046559 | Ga0495667_0014158 | Ga0495667_0014158_649_1407 | 238 |
| 140 | 3300046675 | Ga0495657_0140535 | Ga0495657_0140535_289_1047 | 238 |
| 141 | 3300046678 | Ga0495599_0012323 | Ga0495599_0012323_277_1035 | 238 |
| 142 | 3300047317 | Ga0495604_0058002 | Ga0495604_0058002_1654_2412 | 238 |
| 143 | 3300047322 | Ga0495680_0011330 | Ga0495680_0011330_1854_2612 | 238 |
| 144 | 3300048088 | Ga0495602_0014374 | Ga0495602_0014374_4232_4990 | 238 |
| 145 | 3300048909 | Ga0496106_0385086 | Ga0496106_0385086_97_867 | 238 |
| 146 | 3300050511 | nmdc:mga08y16_221041_c1 | nmdc:mga08y16_221041_c1_115_912 | 238 |
| 147 | 3300053077 | Ga0495601_0042986 | Ga0495601_0042986_564_1322 | 238 |
| 148 | 3300053078 | Ga0495612_0000089 | Ga0495612_0000089_14181_14939 | 238 |
| 149 | 3300053084 | Ga0495595_0018109 | Ga0495595_0018109_1168_1926 | 238 |
| 150 | 3300053085 | Ga0495619_0001549 | Ga0495619_0001549_8333_9091 | 238 |
| 151 | 3300060346 | Ga0587111_0007632 | Ga0587111_0007632_708_1448 | 238 |
| 152 | 3300035111 | Ga0373923_0038540 | Ga0373923_0038540_301_1059 | 239 |
| 153 | 3300035119 | Ga0373956_0034655 | Ga0373956_0034655_1075_1833 | 239 |
| 154 | 3300035120 | Ga0373957_0001446 | Ga0373957_0001446_3938_4696 | 239 |
| 155 | 3300035172 | Ga0373955_0000310 | Ga0373955_0000310_17181_17939 | 239 |
| 156 | 3300035724 | Ga0373933_0000315 | Ga0373933_0000315_21817_22575 | 239 |
| 157 | 3300036401 | Ga0373937_0050476 | Ga0373937_0050476_2280_3038 | 239 |
| 158 | 3300036401 | Ga0373937_0057234 | Ga0373937_0057234_405_1163 | 239 |
| 159 | 3300046462 | Ga0495651_0054550 | Ga0495651_0054550_2100_2858 | 239 |
| 160 | 3300047317 | Ga0495604_0092509 | Ga0495604_0092509_1211_1969 | 239 |
| 161 | 3300047322 | Ga0495680_0040789 | Ga0495680_0040789_931_1689 | 239 |
| 162 | 3300048088 | Ga0495602_0282037 | Ga0495602_0282037_200_958 | 239 |
| 163 | 3300053077 | Ga0495601_0066178 | Ga0495601_0066178_403_1161 | 239 |
| 164 | 3300053078 | Ga0495612_0005230 | Ga0495612_0005230_210_968 | 239 |
| 165 | 3300053084 | Ga0495595_0068379 | Ga0495595_0068379_614_1372 | 239 |
| 166 | 3300005445 | Ga0070708_100084345 | Ga0070708_1000843453 | 240 |
| 167 | 3300005518 | Ga0070699_100309949 | Ga0070699_1003099492 | 240 |
| 168 | 3300005981 | Ga0081538_10124878 | Ga0081538_101248782 | 240 |
| 169 | 3300020070 | Ga0206356_11190054 | Ga0206356_111900541 | 240 |
| 170 | 3300049822 | Ga0501035_0094431 | Ga0501035_0094431_1289_2134 | 240 |
| 171 | 3300049823 | Ga0501044_0004609 | Ga0501044_0004609_7124_7969 | 240 |
| 172 | 3300005340 | Ga0070689_100243052 | Ga0070689_1002430522 | 241 |
| 173 | 3300006038 | Ga0075365_10053864 | Ga0075365_100538642 | 241 |
| 174 | 3300006038 | Ga0075365_10098968 | Ga0075365_100989683 | 241 |
| 175 | 3300006178 | Ga0075367_10232165 | Ga0075367_102321652 | 241 |
| 176 | 3300006186 | Ga0075369_10069978 | Ga0075369_100699783 | 241 |
| 177 | 3300006353 | Ga0075370_10046449 | Ga0075370_100464493 | 241 |
| 178 | 3300010159 | Ga0099796_10116269 | Ga0099796_101162691 | 241 |
| 179 | 3300026118 | Ga0207675_100294924 | Ga0207675_1002949242 | 241 |
| 180 | 3300031731 | Ga0307405_10308451 | Ga0307405_103084512 | 241 |
| 181 | 3300031824 | Ga0307413_10413909 | Ga0307413_104139091 | 241 |
| 182 | 3300037853 | Ga0436364_0548592 | Ga0436364_0548592_59_787 | 241 |
| 183 | 3300042157 | Ga0439458_0053291 | Ga0439458_0053291_164_913 | 241 |
| 184 | 3300042439 | Ga0439464_0025326 | Ga0439464_0025326_477_1226 | 241 |
| 185 | 3300046681 | Ga0495647_0080003 | Ga0495647_0080003_375_1124 | 241 |
| 186 | 3300046683 | Ga0495658_0137699 | Ga0495658_0137699_69_830 | 241 |
| 187 | 3300048929 | Ga0496126_0015811 | Ga0496126_0015811_6185_7063 | 241 |
| 188 | 3300048929 | Ga0496126_0042509 | Ga0496126_0042509_997_1746 | 241 |
| 189 | 3300050489 | nmdc:mga03683_96864_c1 | nmdc:mga03683_96864_c1_450_1199 | 241 |
| 190 | 3300050493 | nmdc:mga0k408_145779_c1 | nmdc:mga0k408_145779_c1_568_1314 | 241 |
| 191 | 3300050494 | nmdc:mga06z11_9341_c1 | nmdc:mga06z11_9341_c1_2142_2888 | 241 |
| 192 | 3300050496 | nmdc:mga07m45_423703_c1 | nmdc:mga07m45_423703_c1_12_761 | 241 |
| 193 | 3300050516 | nmdc:mga0sz30_1915_c1 | nmdc:mga0sz30_1915_c1_3640_4386 | 241 |
| 194 | 3300053093 | Ga0500651_0117410 | Ga0500651_0117410_454_1203 | 241 |
| 195 | 3300053153 | Ga0500616_0002635 | Ga0500616_0002635_9850_10596 | 241 |
| 196 | 3300053155 | Ga0500620_129648 | Ga0500620_129648_98_844 | 241 |
| 197 | 3300006871 | Ga0075434_100705248 | Ga0075434_1007052481 | 242 |
| 198 | 3300007076 | Ga0075435_100035256 | Ga0075435_1000352562 | 242 |
| 199 | 3300007788 | Ga0099795_10016161 | Ga0099795_100161612 | 242 |
| 200 | 3300010159 | Ga0099796_10022382 | Ga0099796_100223821 | 242 |
| 201 | 3300027512 | Ga0209179_1004914 | Ga0209179_10049141 | 242 |
| 202 | 3300027671 | Ga0209588_1031078 | Ga0209588_10310781 | 242 |
| 203 | 3300035170 | Ga0373943_0035254 | Ga0373943_0035254_676_1509 | 242 |
| 204 | 3300035398 | Ga0316574_0000145 | Ga0316574_0000145_2709_3440 | 242 |
| 205 | 3300036712 | Ga0316584_0043408 | Ga0316584_0043408_583_1314 | 242 |
| 206 | 3300037853 | Ga0436364_1214892 | Ga0436364_1214892_246_977 | 242 |
| 207 | 3300050512 | nmdc:mga0n895_114398_c1 | nmdc:mga0n895_114398_c1_1147_1881 | 242 |
| 208 | 3300013104 | Ga0157370_10471142 | Ga0157370_104711421 | 243 |
| 209 | 3300031344 | Ga0265316_10016618 | Ga0265316_100166189 | 243 |
| 210 | 3300031711 | Ga0265314_10144700 | Ga0265314_101447002 | 243 |
| 211 | 3300044719 | Ga0466971_0078114 | Ga0466971_0078114_360_1121 | 243 |
| 212 | 3300007265 | Ga0099794_10023255 | Ga0099794_100232551 | 244 |
| 213 | 3300049578 | Ga0501042_0102050 | Ga0501042_0102050_1089_1862 | 244 |
| 214 | 3300049580 | Ga0501046_0314087 | Ga0501046_0314087_57_827 | 244 |
| 215 | 3300049581 | Ga0501047_0352092 | Ga0501047_0352092_11_781 | 244 |
| 216 | 3300049584 | Ga0501068_0109336 | Ga0501068_0109336_817_1590 | 244 |
| 217 | 3300049587 | Ga0501071_0012141 | Ga0501071_0012141_4017_4790 | 244 |
| 218 | 3300049588 | Ga0501072_0004379 | Ga0501072_0004379_3920_4693 | 244 |
| 219 | 3300049591 | Ga0501075_0027955 | Ga0501075_0027955_1820_2593 | 244 |
| 220 | 3300049593 | Ga0501077_0037268 | Ga0501077_0037268_149_922 | 244 |
| 221 | 3300049741 | Ga0501079_0114417 | Ga0501079_0114417_173_946 | 244 |
| 222 | 3300049742 | Ga0501080_0129312 | Ga0501080_0129312_981_1754 | 244 |
| 223 | 3300049743 | Ga0501081_0120944 | Ga0501081_0120944_957_1730 | 244 |
| 224 | 3300060353 | Ga0501082_0501108 | Ga0501082_0501108_52_798 | 244 |
| 225 | 3300061734 | Ga0530510_0031863 | Ga0530510_0031863_2989_3762 | 244 |
| 226 | 3300049571 | Ga0501034_0487980 | Ga0501034_0487980_346_1104 | 245 |
| 227 | 3300049583 | Ga0501067_0032125 | Ga0501067_0032125_2007_2762 | 245 |
| 228 | 3300049589 | Ga0501073_0059989 | Ga0501073_0059989_1505_2260 | 245 |
| 229 | 3300049590 | Ga0501074_0115632 | Ga0501074_0115632_803_1558 | 245 |
| 230 | 3300049592 | Ga0501076_0474424 | Ga0501076_0474424_22_774 | 245 |
| 231 | 3300049744 | Ga0501083_0071562 | Ga0501083_0071562_1311_2066 | 245 |
| 232 | 3300060353 | Ga0501082_0249051 | Ga0501082_0249051_328_1083 | 245 |
| 233 | 3300048903 | Ga0496100_0158715 | Ga0496100_0158715_636_1391 | 246 |
| 234 | 3300006195 | Ga0075366_10010635 | Ga0075366_100106355 | 248 |
| 235 | 3300006353 | Ga0075370_10294985 | Ga0075370_102949851 | 248 |
| 236 | 3300003215 | JGI25153J46596_10001402 | JGI25153J46596_100014023 | 249 |
| 237 | 3300003215 | JGI25153J46596_10004909 | JGI25153J46596_100049093 | 249 |
| 238 | 3300025297 | Ga0209758_1000469 | Ga0209758_100046925 | 249 |
| 239 | 3300028577 | Ga0265318_10008385 | Ga0265318_100083854 | 249 |
| 240 | 3300031241 | Ga0265325_10004291 | Ga0265325_100042919 | 249 |
| 241 | 3300031247 | Ga0265340_10006803 | Ga0265340_100068033 | 249 |
| 242 | 3300031250 | Ga0265331_10044220 | Ga0265331_100442203 | 249 |
| 243 | 3300031344 | Ga0265316_10246298 | Ga0265316_102462982 | 249 |
| 244 | 3300031595 | Ga0265313_10016449 | Ga0265313_100164495 | 249 |
| 245 | 3300031712 | Ga0265342_10012408 | Ga0265342_100124086 | 249 |
| 246 | 3300049588 | Ga0501072_0210737 | Ga0501072_0210737_115_867 | 249 |
| 247 | 3300049593 | Ga0501077_0013421 | Ga0501077_0013421_3936_4706 | 249 |
| 248 | 3300049742 | Ga0501080_0259571 | Ga0501080_0259571_472_1224 | 249 |
| 249 | 3300049744 | Ga0501083_0033311 | Ga0501083_0033311_2552_3304 | 249 |
| 250 | 3300053092 | Ga0500583_0208224 | Ga0500583_0208224_50_820 | 249 |
| 251 | 3300054114 | Ga0501084_0422951 | Ga0501084_0422951_101_853 | 249 |
| 252 | 3300059605 | Ga0587106_020398 | Ga0587106_020398_128_895 | 249 |
| 253 | 3300060353 | Ga0501082_0065082 | Ga0501082_0065082_2104_2856 | 249 |
| 254 | 3300005434 | Ga0070709_10177453 | Ga0070709_101774532 | 250 |
| 255 | 3300005435 | Ga0070714_100226570 | Ga0070714_1002265703 | 250 |
| 256 | 3300005458 | Ga0070681_10059291 | Ga0070681_100592911 | 250 |
| 257 | 3300005530 | Ga0070679_100048126 | Ga0070679_1000481263 | 250 |
| 258 | 3300006042 | Ga0075368_10085825 | Ga0075368_100858251 | 250 |
| 259 | 3300006163 | Ga0070715_10172002 | Ga0070715_101720021 | 250 |
| 260 | 3300006186 | Ga0075369_10202646 | Ga0075369_102026461 | 250 |
| 261 | 3300006844 | Ga0075428_100058970 | Ga0075428_1000589705 | 250 |
| 262 | 3300006880 | Ga0075429_100007528 | Ga0075429_1000075283 | 250 |
| 263 | 3300025297 | Ga0209758_1088120 | Ga0209758_10881201 | 250 |
| 264 | 3300025898 | Ga0207692_10073172 | Ga0207692_100731722 | 250 |
| 265 | 3300025905 | Ga0207685_10153223 | Ga0207685_101532231 | 250 |
| 266 | 3300025917 | Ga0207660_10084805 | Ga0207660_100848053 | 250 |
| 267 | 3300025921 | Ga0207652_10631978 | Ga0207652_106319781 | 250 |
| 268 | 3300025929 | Ga0207664_10597058 | Ga0207664_105970581 | 250 |
| 269 | 3300025939 | Ga0207665_10234830 | Ga0207665_102348301 | 250 |
| 270 | 3300027907 | Ga0207428_10449065 | Ga0207428_104490651 | 250 |
| 271 | 3300031235 | Ga0265330_10009843 | Ga0265330_100098433 | 250 |
| 272 | 3300031241 | Ga0265325_10016732 | Ga0265325_100167322 | 250 |
| 273 | 3300035119 | Ga0373956_0123417 | Ga0373956_0123417_323_1078 | 250 |
| 274 | 3300035170 | Ga0373943_0006511 | Ga0373943_0006511_4477_5232 | 250 |
| 275 | 3300035171 | Ga0373946_0024272 | Ga0373946_0024272_1605_2360 | 250 |
| 276 | 3300035172 | Ga0373955_0004242 | Ga0373955_0004242_1316_2071 | 250 |
| 277 | 3300035695 | Ga0373927_0022396 | Ga0373927_0022396_2299_3054 | 250 |
| 278 | 3300035724 | Ga0373933_0068023 | Ga0373933_0068023_297_1052 | 250 |
| 279 | 3300036401 | Ga0373937_0041506 | Ga0373937_0041506_516_1271 | 250 |
| 280 | 3300039437 | Ga0436365_1910356 | Ga0436365_1910356_927_1679 | 250 |
| 281 | 3300042125 | Ga0450923_013571 | Ga0450923_013571_382_1140 | 250 |
| 282 | 3300046458 | Ga0495591_057922 | Ga0495591_057922_197_952 | 250 |
| 283 | 3300046459 | Ga0495629_0040146 | Ga0495629_0040146_1236_1991 | 250 |
| 284 | 3300046461 | Ga0495641_0025187 | Ga0495641_0025187_310_1065 | 250 |
| 285 | 3300046463 | Ga0495653_0000987 | Ga0495653_0000987_122_877 | 250 |
| 286 | 3300046473 | Ga0495582_0069408 | Ga0495582_0069408_81_836 | 250 |
| 287 | 3300046475 | Ga0495639_0018119 | Ga0495639_0018119_1443_2198 | 250 |
| 288 | 3300046477 | Ga0495664_0046218 | Ga0495664_0046218_1730_2485 | 250 |
| 289 | 3300046492 | Ga0495585_0000389 | Ga0495585_0000389_31535_32290 | 250 |
| 290 | 3300046516 | Ga0495628_0054508 | Ga0495628_0054508_2207_2962 | 250 |
| 291 | 3300046517 | Ga0495630_0051135 | Ga0495630_0051135_1408_2163 | 250 |
| 292 | 3300046520 | Ga0495637_0154191 | Ga0495637_0154191_16_771 | 250 |
| 293 | 3300046523 | Ga0495644_0000373 | Ga0495644_0000373_9654_10409 | 250 |
| 294 | 3300046526 | Ga0495666_0033440 | Ga0495666_0033440_1445_2200 | 250 |
| 295 | 3300046531 | Ga0495665_0151267 | Ga0495665_0151267_272_1027 | 250 |
| 296 | 3300046533 | Ga0495640_0048679 | Ga0495640_0048679_1087_1842 | 250 |
| 297 | 3300046535 | Ga0495586_0312196 | Ga0495586_0312196_16_771 | 250 |
| 298 | 3300046536 | Ga0495587_0121730 | Ga0495587_0121730_573_1328 | 250 |
| 299 | 3300046537 | Ga0495598_0087651 | Ga0495598_0087651_170_925 | 250 |
| 300 | 3300046558 | Ga0495633_0006655 | Ga0495633_0006655_555_1310 | 250 |
| 301 | 3300046559 | Ga0495667_0004405 | Ga0495667_0004405_2279_3034 | 250 |
| 302 | 3300046615 | Ga0495656_0002104 | Ga0495656_0002104_388_1143 | 250 |
| 303 | 3300046642 | Ga0495634_0037227 | Ga0495634_0037227_1703_2458 | 250 |
| 304 | 3300046664 | Ga0495659_0003751 | Ga0495659_0003751_3750_4505 | 250 |
| 305 | 3300046674 | Ga0495588_0015269 | Ga0495588_0015269_1431_2186 | 250 |
| 306 | 3300046681 | Ga0495647_0101405 | Ga0495647_0101405_312_1067 | 250 |
| 307 | 3300046683 | Ga0495658_0024037 | Ga0495658_0024037_2199_2954 | 250 |
| 308 | 3300046689 | Ga0495613_0011807 | Ga0495613_0011807_3256_4011 | 250 |
| 309 | 3300046690 | Ga0495624_0018068 | Ga0495624_0018068_1550_2305 | 250 |
| 310 | 3300046691 | Ga0495670_0000106 | Ga0495670_0000106_27654_28409 | 250 |
| 311 | 3300046809 | Ga0495600_0000293 | Ga0495600_0000293_23413_24168 | 250 |
| 312 | 3300047315 | Ga0495581_0030496 | Ga0495581_0030496_111_866 | 250 |
| 313 | 3300047317 | Ga0495604_0021273 | Ga0495604_0021273_2931_3686 | 250 |
| 314 | 3300047319 | Ga0495674_0056041 | Ga0495674_0056041_868_1623 | 250 |
| 315 | 3300047321 | Ga0495676_0077187 | Ga0495676_0077187_57_812 | 250 |
| 316 | 3300047322 | Ga0495680_0079071 | Ga0495680_0079071_868_1623 | 250 |
| 317 | 3300047446 | Ga0495679_044624 | Ga0495679_044624_383_1138 | 250 |
| 318 | 3300047471 | Ga0495684_0117918 | Ga0495684_0117918_506_1261 | 250 |
| 319 | 3300047673 | Ga0495593_0040640 | Ga0495593_0040640_1343_2098 | 250 |
| 320 | 3300048089 | Ga0495614_0005015 | Ga0495614_0005015_1263_2018 | 250 |
| 321 | 3300048915 | Ga0496112_0051251 | Ga0496112_0051251_2423_3178 | 250 |
| 322 | 3300049581 | Ga0501047_0559659 | Ga0501047_0559659_104_859 | 250 |
| 323 | 3300049592 | Ga0501076_0397553 | Ga0501076_0397553_184_939 | 250 |
| 324 | 3300050508 | nmdc:mga09592_123530_c1 | nmdc:mga09592_123530_c1_680_1435 | 250 |
| 325 | 3300050511 | nmdc:mga08y16_917950_c1 | nmdc:mga08y16_917950_c1_45_803 | 250 |
| 326 | 3300050516 | nmdc:mga0sz30_45391_c1 | nmdc:mga0sz30_45391_c1_519_1277 | 250 |
| 327 | 3300053077 | Ga0495601_0085934 | Ga0495601_0085934_865_1620 | 250 |
| 328 | 3300053078 | Ga0495612_0050167 | Ga0495612_0050167_296_1051 | 250 |
| 329 | 3300053085 | Ga0495619_0020373 | Ga0495619_0020373_1213_1968 | 250 |
| 330 | 3300053130 | Ga0500642_0026283 | Ga0500642_0026283_667_1425 | 250 |
| 331 | iso_pu_bacteria | 2643221547 | 2643758246 | 250 |
| 332 | 3300005438 | Ga0070701_10495026 | Ga0070701_104950261 | 251 |
| 333 | 3300005530 | Ga0070679_100218279 | Ga0070679_1002182792 | 251 |
| 334 | 3300006194 | Ga0075427_10000389 | Ga0075427_100003894 | 251 |
| 335 | 3300006844 | Ga0075428_100007998 | Ga0075428_1000079983 | 251 |
| 336 | 3300006846 | Ga0075430_100000032 | Ga0075430_10000003215 | 251 |
| 337 | 3300006847 | Ga0075431_100000903 | Ga0075431_10000090320 | 251 |
| 338 | 3300006852 | Ga0075433_10019599 | Ga0075433_100195993 | 251 |
| 339 | 3300006871 | Ga0075434_100000271 | Ga0075434_10000027134 | 251 |
| 340 | 3300006880 | Ga0075429_100000561 | Ga0075429_10000056124 | 251 |
| 341 | 3300007076 | Ga0075435_100049397 | Ga0075435_1000493974 | 251 |
| 342 | 3300009094 | Ga0111539_10001270 | Ga0111539_1000127026 | 251 |
| 343 | 3300009094 | Ga0111539_10230550 | Ga0111539_102305502 | 251 |
| 344 | 3300009147 | Ga0114129_10395943 | Ga0114129_103959432 | 251 |
| 345 | 3300013104 | Ga0157370_10057496 | Ga0157370_100574962 | 251 |
| 346 | 3300013308 | Ga0157375_11151307 | Ga0157375_111513071 | 251 |
| 347 | 3300020069 | Ga0197907_10241108 | Ga0197907_102411081 | 251 |
| 348 | 3300020069 | Ga0197907_11149821 | Ga0197907_111498211 | 251 |
| 349 | 3300020076 | Ga0206355_1367406 | Ga0206355_13674062 | 251 |
| 350 | 3300020078 | Ga0206352_10130377 | Ga0206352_101303771 | 251 |
| 351 | 3300020080 | Ga0206350_10136915 | Ga0206350_101369151 | 251 |
| 352 | 3300020081 | Ga0206354_10364600 | Ga0206354_103646001 | 251 |
| 353 | 3300020082 | Ga0206353_10830196 | Ga0206353_108301961 | 251 |
| 354 | 3300021377 | Ga0213874_10073401 | Ga0213874_100734011 | 251 |
| 355 | 3300021441 | Ga0213871_10042533 | Ga0213871_100425332 | 251 |
| 356 | 3300022467 | Ga0224712_10182174 | Ga0224712_101821741 | 251 |
| 357 | 3300025907 | Ga0207645_10111527 | Ga0207645_101115271 | 251 |
| 358 | 3300025912 | Ga0207707_10116011 | Ga0207707_101160111 | 251 |
| 359 | 3300025920 | Ga0207649_10328407 | Ga0207649_103284072 | 251 |
| 360 | 3300025921 | Ga0207652_10248325 | Ga0207652_102483252 | 251 |
| 361 | 3300026075 | Ga0207708_10451360 | Ga0207708_104513601 | 251 |
| 362 | 3300027907 | Ga0207428_10000082 | Ga0207428_1000008270 | 251 |
| 363 | 3300031247 | Ga0265340_10042659 | Ga0265340_100426592 | 251 |
| 364 | 3300031456 | Ga0307513_10012476 | Ga0307513_100124763 | 251 |
| 365 | 3300031665 | Ga0316575_10040077 | Ga0316575_100400772 | 251 |
| 366 | 3300031727 | Ga0316576_10252323 | Ga0316576_102523232 | 251 |
| 367 | 3300032002 | Ga0307416_100962018 | Ga0307416_1009620181 | 251 |
| 368 | 3300032133 | Ga0316583_10002336 | Ga0316583_100023361 | 251 |
| 369 | 3300032133 | Ga0316583_10034329 | Ga0316583_100343291 | 251 |
| 370 | 3300033524 | Ga0316592_1067264 | Ga0316592_10672641 | 251 |
| 371 | 3300033529 | Ga0316587_1035520 | Ga0316587_10355201 | 251 |
| 372 | 3300033541 | Ga0316596_1087836 | Ga0316596_10878361 | 251 |
| 373 | 3300035111 | Ga0373923_0213495 | Ga0373923_0213495_92_850 | 251 |
| 374 | 3300035117 | Ga0373953_0147965 | Ga0373953_0147965_65_823 | 251 |
| 375 | 3300035692 | Ga0373935_0117456 | Ga0373935_0117456_684_1442 | 251 |
| 376 | 3300035695 | Ga0373927_0053021 | Ga0373927_0053021_338_1096 | 251 |
| 377 | 3300036401 | Ga0373937_0145718 | Ga0373937_0145718_30_791 | 251 |
| 378 | 3300036401 | Ga0373937_0339950 | Ga0373937_0339950_520_1278 | 251 |
| 379 | 3300037312 | Ga0395899_0013258 | Ga0395899_0013258_2166_2924 | 251 |
| 380 | 3300037466 | Ga0395898_0104572 | Ga0395898_0104572_1375_2133 | 251 |
| 381 | 3300038443 | Ga0395901_0111981 | Ga0395901_0111981_720_1478 | 251 |
| 382 | 3300038443 | Ga0395901_0320363 | Ga0395901_0320363_63_860 | 251 |
| 383 | 3300038443 | Ga0395901_0441559 | Ga0395901_0441559_313_1110 | 251 |
| 384 | 3300039438 | Ga0436360_0832565 | Ga0436360_0832565_3648_4409 | 251 |
| 385 | 3300039447 | Ga0436361_0360492 | Ga0436361_0360492_98_859 | 251 |
| 386 | 3300039450 | Ga0436363_1307539 | Ga0436363_1307539_435_1196 | 251 |
| 387 | 3300041408 | Ga0439453_0041658 | Ga0439453_0041658_14_772 | 251 |
| 388 | 3300046462 | Ga0495651_0107774 | Ga0495651_0107774_974_1732 | 251 |
| 389 | 3300046477 | Ga0495664_0196334 | Ga0495664_0196334_432_1190 | 251 |
| 390 | 3300046516 | Ga0495628_0243599 | Ga0495628_0243599_356_1114 | 251 |
| 391 | 3300046529 | Ga0495652_0439637 | Ga0495652_0439637_68_826 | 251 |
| 392 | 3300046533 | Ga0495640_0332859 | Ga0495640_0332859_21_782 | 251 |
| 393 | 3300046536 | Ga0495587_0233941 | Ga0495587_0233941_167_925 | 251 |
| 394 | 3300046543 | Ga0495645_0268809 | Ga0495645_0268809_193_951 | 251 |
| 395 | 3300046559 | Ga0495667_0242628 | Ga0495667_0242628_274_1032 | 251 |
| 396 | 3300046642 | Ga0495634_0265951 | Ga0495634_0265951_15_773 | 251 |
| 397 | 3300046678 | Ga0495599_0203610 | Ga0495599_0203610_325_1083 | 251 |
| 398 | 3300047317 | Ga0495604_0239232 | Ga0495604_0239232_416_1174 | 251 |
| 399 | 3300047319 | Ga0495674_0383770 | Ga0495674_0383770_127_885 | 251 |
| 400 | 3300048088 | Ga0495602_0108292 | Ga0495602_0108292_530_1288 | 251 |
| 401 | 3300048089 | Ga0495614_0076720 | Ga0495614_0076720_297_1055 | 251 |
| 402 | 3300048904 | Ga0496101_0610585 | Ga0496101_0610585_28_789 | 251 |
| 403 | 3300048907 | Ga0496104_0124558 | Ga0496104_0124558_876_1637 | 251 |
| 404 | 3300048910 | Ga0496107_0394978 | Ga0496107_0394978_139_900 | 251 |
| 405 | 3300048915 | Ga0496112_0397824 | Ga0496112_0397824_53_814 | 251 |
| 406 | 3300048917 | Ga0496114_0068181 | Ga0496114_0068181_835_1596 | 251 |
| 407 | 3300048917 | Ga0496114_0109828 | Ga0496114_0109828_1352_2113 | 251 |
| 408 | 3300049568 | Ga0501031_0002913 | Ga0501031_0002913_7258_8016 | 251 |
| 409 | 3300049569 | Ga0501032_0001960 | Ga0501032_0001960_11542_12300 | 251 |
| 410 | 3300049570 | Ga0501033_0021483 | Ga0501033_0021483_615_1373 | 251 |
| 411 | 3300049571 | Ga0501034_0003727 | Ga0501034_0003727_11672_12430 | 251 |
| 412 | 3300049572 | Ga0501036_0015848 | Ga0501036_0015848_933_1691 | 251 |
| 413 | 3300049573 | Ga0501037_0010686 | Ga0501037_0010686_3503_4261 | 251 |
| 414 | 3300049573 | Ga0501037_0287712 | Ga0501037_0287712_357_1115 | 251 |
| 415 | 3300049574 | Ga0501038_0008913 | Ga0501038_0008913_7429_8187 | 251 |
| 416 | 3300049575 | Ga0501039_0001032 | Ga0501039_0001032_2918_3676 | 251 |
| 417 | 3300049579 | Ga0501043_0022908 | Ga0501043_0022908_615_1373 | 251 |
| 418 | 3300049579 | Ga0501043_0328019 | Ga0501043_0328019_84_842 | 251 |
| 419 | 3300049580 | Ga0501046_0000897 | Ga0501046_0000897_27241_27999 | 251 |
| 420 | 3300049581 | Ga0501047_0023976 | Ga0501047_0023976_1577_2335 | 251 |
| 421 | 3300049581 | Ga0501047_0091531 | Ga0501047_0091531_353_1111 | 251 |
| 422 | 3300049582 | Ga0501048_0006504 | Ga0501048_0006504_3701_4459 | 251 |
| 423 | 3300049584 | Ga0501068_0001271 | Ga0501068_0001271_829_1587 | 251 |
| 424 | 3300049585 | Ga0501069_0000490 | Ga0501069_0000490_12927_13685 | 251 |
| 425 | 3300049586 | Ga0501070_0012403 | Ga0501070_0012403_5914_6672 | 251 |
| 426 | 3300049586 | Ga0501070_0023540 | Ga0501070_0023540_83_841 | 251 |
| 427 | 3300049587 | Ga0501071_0169366 | Ga0501071_0169366_617_1375 | 251 |
| 428 | 3300049589 | Ga0501073_0001330 | Ga0501073_0001330_1449_2207 | 251 |
| 429 | 3300049590 | Ga0501074_0001714 | Ga0501074_0001714_11947_12705 | 251 |
| 430 | 3300049741 | Ga0501079_0017343 | Ga0501079_0017343_3884_4642 | 251 |
| 431 | 3300049742 | Ga0501080_0005290 | Ga0501080_0005290_3378_4136 | 251 |
| 432 | 3300049742 | Ga0501080_0049606 | Ga0501080_0049606_2848_3609 | 251 |
| 433 | 3300049744 | Ga0501083_0006952 | Ga0501083_0006952_6863_7621 | 251 |
| 434 | 3300049744 | Ga0501083_0058798 | Ga0501083_0058798_1076_1852 | 251 |
| 435 | 3300049822 | Ga0501035_0016898 | Ga0501035_0016898_615_1373 | 251 |
| 436 | 3300049823 | Ga0501044_0030415 | Ga0501044_0030415_4319_5077 | 251 |
| 437 | 3300049823 | Ga0501044_0086053 | Ga0501044_0086053_57_815 | 251 |
| 438 | 3300049824 | Ga0501045_0014635 | Ga0501045_0014635_3994_4752 | 251 |
| 439 | 3300050507 | nmdc:mga05p37_19_c2 | nmdc:mga05p37_19_c2_65642_66418 | 251 |
| 440 | 3300050507 | nmdc:mga05p37_714414_c1 | nmdc:mga05p37_714414_c1_28_786 | 251 |
| 441 | 3300050508 | nmdc:mga09592_1297_c1 | nmdc:mga09592_1297_c1_2562_3338 | 251 |
| 442 | 3300050509 | nmdc:mga0qj67_259_c1 | nmdc:mga0qj67_259_c1_1979_2755 | 251 |
| 443 | 3300050510 | nmdc:mga06r32_1133_c1 | nmdc:mga06r32_1133_c1_16754_17530 | 251 |
| 444 | 3300050511 | nmdc:mga08y16_354_c1 | nmdc:mga08y16_354_c1_11523_12299 | 251 |
| 445 | 3300050512 | nmdc:mga0n895_701_c1 | nmdc:mga0n895_701_c1_15172_15948 | 251 |
| 446 | 3300050513 | nmdc:mga0rr50_35347_c1 | nmdc:mga0rr50_35347_c1_396_1172 | 251 |
| 447 | 3300050515 | nmdc:mga0a205_249_c1 | nmdc:mga0a205_249_c1_4209_4985 | 251 |
| 448 | 3300053077 | Ga0495601_0065052 | Ga0495601_0065052_322_1080 | 251 |
| 449 | 3300053083 | Ga0495655_0002001 | Ga0495655_0002001_298_1056 | 251 |
| 450 | 3300053084 | Ga0495595_0223661 | Ga0495595_0223661_81_839 | 251 |
| 451 | 3300053093 | Ga0500651_0087411 | Ga0500651_0087411_311_1084 | 251 |
| 452 | 3300053117 | Ga0500593_002685 | Ga0500593_002685_3032_3790 | 251 |
| 453 | 3300054114 | Ga0501084_0488303 | Ga0501084_0488303_35_793 | 251 |
| 454 | 3300060353 | Ga0501082_0043600 | Ga0501082_0043600_615_1373 | 251 |
| 455 | 3300004803 | Ga0058862_12880575 | Ga0058862_128805751 | 252 |
| 456 | 3300005334 | Ga0068869_100257574 | Ga0068869_1002575741 | 252 |
| 457 | 3300006028 | Ga0070717_10514261 | Ga0070717_105142611 | 252 |
| 458 | 3300006051 | Ga0075364_10016731 | Ga0075364_100167313 | 252 |
| 459 | 3300006178 | Ga0075367_10229203 | Ga0075367_102292032 | 252 |
| 460 | 3300006186 | Ga0075369_10028288 | Ga0075369_100282881 | 252 |
| 461 | 3300006353 | Ga0075370_10012948 | Ga0075370_100129483 | 252 |
| 462 | 3300009101 | Ga0105247_10345618 | Ga0105247_103456181 | 252 |
| 463 | 3300019183 | Ga0184601_134529 | Ga0184601_1345291 | 252 |
| 464 | 3300025942 | Ga0207689_10231147 | Ga0207689_102311472 | 252 |
| 465 | 3300035692 | Ga0373935_0210499 | Ga0373935_0210499_374_1135 | 252 |
| 466 | 3300035695 | Ga0373927_0018445 | Ga0373927_0018445_1949_2710 | 252 |
| 467 | 3300035725 | Ga0373947_0027350 | Ga0373947_0027350_2031_2792 | 252 |
| 468 | 3300036457 | Ga0265778_019593 | Ga0265778_019593_13_774 | 252 |
| 469 | 3300039437 | Ga0436365_1890998 | Ga0436365_1890998_2778_3539 | 252 |
| 470 | 3300039438 | Ga0436360_0440024 | Ga0436360_0440024_291_1067 | 252 |
| 471 | 3300039450 | Ga0436363_0611312 | Ga0436363_0611312_66_830 | 252 |
| 472 | 3300039453 | Ga0436362_0343721 | Ga0436362_0343721_724_1500 | 252 |
| 473 | 3300047319 | Ga0495674_0136213 | Ga0495674_0136213_1181_1942 | 252 |
| 474 | 3300048903 | Ga0496100_0100101 | Ga0496100_0100101_1195_1956 | 252 |
| 475 | 3300048907 | Ga0496104_0006199 | Ga0496104_0006199_1500_2261 | 252 |
| 476 | 3300048909 | Ga0496106_0444866 | Ga0496106_0444866_193_954 | 252 |
| 477 | 3300048917 | Ga0496114_0083899 | Ga0496114_0083899_1887_2648 | 252 |
| 478 | 3300048918 | Ga0496115_0121428 | Ga0496115_0121428_1156_1917 | 252 |
| 479 | 3300049569 | Ga0501032_0129048 | Ga0501032_0129048_709_1470 | 252 |
| 480 | 3300049570 | Ga0501033_0014226 | Ga0501033_0014226_1796_2557 | 252 |
| 481 | 3300049574 | Ga0501038_0205971 | Ga0501038_0205971_360_1121 | 252 |
| 482 | 3300049579 | Ga0501043_0047745 | Ga0501043_0047745_1768_2529 | 252 |
| 483 | 3300049581 | Ga0501047_0036900 | Ga0501047_0036900_919_1680 | 252 |
| 484 | 3300049586 | Ga0501070_0067905 | Ga0501070_0067905_1259_2020 | 252 |
| 485 | 3300049822 | Ga0501035_0040812 | Ga0501035_0040812_2531_3292 | 252 |
| 486 | 3300049823 | Ga0501044_0594138 | Ga0501044_0594138_33_794 | 252 |
| 487 | 3300050491 | nmdc:mga00v17_70140_c1 | nmdc:mga00v17_70140_c1_533_1294 | 252 |
| 488 | 3300050496 | nmdc:mga07m45_53357_c1 | nmdc:mga07m45_53357_c1_276_1037 | 252 |
| 489 | 3300053118 | Ga0500594_0086433 | Ga0500594_0086433_11_772 | 252 |
| 490 | 3300053142 | Ga0500577_0236081 | Ga0500577_0236081_22_783 | 252 |
| 491 | 3300059421 | Ga0590071_058722 | Ga0590071_058722_141_902 | 252 |
| 492 | 3300020077 | Ga0206351_10851183 | Ga0206351_108511831 | 253 |
| 493 | 3300031241 | Ga0265325_10002531 | Ga0265325_100025316 | 253 |
| 494 | 3300031595 | Ga0265313_10000593 | Ga0265313_100005935 | 253 |
| 495 | 3300039450 | Ga0436363_1081647 | Ga0436363_1081647_1652_2416 | 253 |
| 496 | 3300005545 | Ga0070695_100249106 | Ga0070695_1002491062 | 254 |
| 497 | 3300009147 | Ga0114129_10001444 | Ga0114129_1000144415 | 254 |
| 498 | 3300009551 | Ga0105238_10122440 | Ga0105238_101224401 | 254 |
| 499 | 3300013104 | Ga0157370_10191953 | Ga0157370_101919532 | 254 |
| 500 | 3300024225 | Ga0224572_1031817 | Ga0224572_10318171 | 254 |
| 501 | 3300025911 | Ga0207654_10369880 | Ga0207654_103698801 | 254 |
| 502 | 3300025928 | Ga0207700_10106049 | Ga0207700_101060492 | 254 |
| 503 | 3300028800 | Ga0265338_10068313 | Ga0265338_100683132 | 254 |
| 504 | 3300028800 | Ga0265338_10081565 | Ga0265338_100815651 | 254 |
| 505 | 3300031241 | Ga0265325_10033863 | Ga0265325_100338632 | 254 |
| 506 | 3300031247 | Ga0265340_10010861 | Ga0265340_100108614 | 254 |
| 507 | 3300031249 | Ga0265339_10000126 | Ga0265339_1000012658 | 254 |
| 508 | 3300031595 | Ga0265313_10000054 | Ga0265313_100000548 | 254 |
| 509 | 3300035410 | Ga0373924_0099306 | Ga0373924_0099306_19_792 | 254 |
| 510 | 3300035724 | Ga0373933_0229686 | Ga0373933_0229686_63_836 | 254 |
| 511 | 3300036401 | Ga0373937_0001931 | Ga0373937_0001931_118_891 | 254 |
| 512 | 3300037312 | Ga0395899_0009821 | Ga0395899_0009821_6460_7227 | 254 |
| 513 | 3300037418 | Ga0395900_0028146 | Ga0395900_0028146_119_886 | 254 |
| 514 | 3300038443 | Ga0395901_0051442 | Ga0395901_0051442_98_865 | 254 |
| 515 | 3300049588 | Ga0501072_0003460 | Ga0501072_0003460_9374_10138 | 254 |
| 516 | 3300049744 | Ga0501083_0241352 | Ga0501083_0241352_128_1015 | 254 |
| 517 | 3300050507 | nmdc:mga05p37_8335_c1 | nmdc:mga05p37_8335_c1_5448_6233 | 254 |
| 518 | 3300054114 | Ga0501084_0030212 | Ga0501084_0030212_3024_3788 | 254 |
| 519 | 3300006847 | Ga0075431_100052467 | Ga0075431_1000524673 | 255 |
| 520 | 3300006852 | Ga0075433_10017192 | Ga0075433_100171924 | 255 |
| 521 | 3300006871 | Ga0075434_100009740 | Ga0075434_1000097405 | 255 |
| 522 | 3300006871 | Ga0075434_100011424 | Ga0075434_1000114245 | 255 |
| 523 | 3300007076 | Ga0075435_100033962 | Ga0075435_1000339624 | 255 |
| 524 | 3300009094 | Ga0111539_10106024 | Ga0111539_101060242 | 255 |
| 525 | 3300009147 | Ga0114129_10488916 | Ga0114129_104889162 | 255 |
| 526 | 3300020070 | Ga0206356_10058304 | Ga0206356_100583042 | 255 |
| 527 | 3300020075 | Ga0206349_1686143 | Ga0206349_16861431 | 255 |
| 528 | 3300020078 | Ga0206352_10630827 | Ga0206352_106308271 | 255 |
| 529 | 3300020080 | Ga0206350_11242039 | Ga0206350_112420391 | 255 |
| 530 | 3300020082 | Ga0206353_10033645 | Ga0206353_100336453 | 255 |
| 531 | 3300035117 | Ga0373953_0003215 | Ga0373953_0003215_3878_4648 | 255 |
| 532 | 3300035118 | Ga0373954_0000445 | Ga0373954_0000445_10652_11422 | 255 |
| 533 | 3300035119 | Ga0373956_0044526 | Ga0373956_0044526_911_1681 | 255 |
| 534 | 3300035170 | Ga0373943_0001478 | Ga0373943_0001478_697_1467 | 255 |
| 535 | 3300035172 | Ga0373955_0000456 | Ga0373955_0000456_11857_12627 | 255 |
| 536 | 3300035692 | Ga0373935_0000011 | Ga0373935_0000011_40498_41268 | 255 |
| 537 | 3300035724 | Ga0373933_0001894 | Ga0373933_0001894_4356_5126 | 255 |
| 538 | 3300035725 | Ga0373947_0002093 | Ga0373947_0002093_7917_8687 | 255 |
| 539 | 3300036401 | Ga0373937_0000019 | Ga0373937_0000019_112514_113284 | 255 |
| 540 | 3300037068 | Ga0373925_0000048 | Ga0373925_0000048_122498_123268 | 255 |
| 541 | 3300046454 | Ga0495592_0000017 | Ga0495592_0000017_33955_34725 | 255 |
| 542 | 3300046461 | Ga0495641_0168293 | Ga0495641_0168293_146_916 | 255 |
| 543 | 3300046462 | Ga0495651_0000923 | Ga0495651_0000923_17483_18253 | 255 |
| 544 | 3300046463 | Ga0495653_0000033 | Ga0495653_0000033_97518_98288 | 255 |
| 545 | 3300046476 | Ga0495662_0037857 | Ga0495662_0037857_134_904 | 255 |
| 546 | 3300046477 | Ga0495664_0000008 | Ga0495664_0000008_160799_161569 | 255 |
| 547 | 3300046511 | Ga0495608_0000014 | Ga0495608_0000014_97526_98296 | 255 |
| 548 | 3300046514 | Ga0495618_0000013 | Ga0495618_0000013_45278_46048 | 255 |
| 549 | 3300046516 | Ga0495628_0000008 | Ga0495628_0000008_160784_161554 | 255 |
| 550 | 3300046517 | Ga0495630_0000797 | Ga0495630_0000797_3592_4362 | 255 |
| 551 | 3300046529 | Ga0495652_0000005 | Ga0495652_0000005_160799_161569 | 255 |
| 552 | 3300046533 | Ga0495640_0000017 | Ga0495640_0000017_25398_26168 | 255 |
| 553 | 3300046536 | Ga0495587_0000005 | Ga0495587_0000005_196830_197600 | 255 |
| 554 | 3300046543 | Ga0495645_0000007 | Ga0495645_0000007_174976_175746 | 255 |
| 555 | 3300046559 | Ga0495667_0000012 | Ga0495667_0000012_122666_123436 | 255 |
| 556 | 3300046642 | Ga0495634_0000070 | Ga0495634_0000070_16530_17300 | 255 |
| 557 | 3300046663 | Ga0495635_0000010 | Ga0495635_0000010_97552_98322 | 255 |
| 558 | 3300046675 | Ga0495657_0000178 | Ga0495657_0000178_23126_23896 | 255 |
| 559 | 3300046678 | Ga0495599_0000015 | Ga0495599_0000015_161013_161783 | 255 |
| 560 | 3300046679 | Ga0495623_0000054 | Ga0495623_0000054_32806_33576 | 255 |
| 561 | 3300046680 | Ga0495646_0000012 | Ga0495646_0000012_62370_63140 | 255 |
| 562 | 3300046683 | Ga0495658_0121856 | Ga0495658_0121856_639_1409 | 255 |
| 563 | 3300046689 | Ga0495613_0010812 | Ga0495613_0010812_4639_5409 | 255 |
| 564 | 3300046809 | Ga0495600_0000031 | Ga0495600_0000031_33385_34155 | 255 |
| 565 | 3300047315 | Ga0495581_0019786 | Ga0495581_0019786_1743_2513 | 255 |
| 566 | 3300047317 | Ga0495604_0000001 | Ga0495604_0000001_122667_123437 | 255 |
| 567 | 3300047317 | Ga0495604_0215288 | Ga0495604_0215288_102_872 | 255 |
| 568 | 3300047319 | Ga0495674_0000012 | Ga0495674_0000012_157398_158168 | 255 |
| 569 | 3300047444 | Ga0495675_0000500 | Ga0495675_0000500_10478_11248 | 255 |
| 570 | 3300047471 | Ga0495684_0000021 | Ga0495684_0000021_21324_22094 | 255 |
| 571 | 3300047673 | Ga0495593_0000387 | Ga0495593_0000387_20478_21248 | 255 |
| 572 | 3300048088 | Ga0495602_0000031 | Ga0495602_0000031_122796_123566 | 255 |
| 573 | 3300049588 | Ga0501072_0589670 | Ga0501072_0589670_82_849 | 255 |
| 574 | 3300050507 | nmdc:mga05p37_397809_c1 | nmdc:mga05p37_397809_c1_398_1201 | 255 |
| 575 | 3300050509 | nmdc:mga0qj67_187623_c1 | nmdc:mga0qj67_187623_c1_854_1624 | 255 |
| 576 | 3300050510 | nmdc:mga06r32_304636_c1 | nmdc:mga06r32_304636_c1_59_829 | 255 |
| 577 | 3300050511 | nmdc:mga08y16_87928_c1 | nmdc:mga08y16_87928_c1_2284_3087 | 255 |
| 578 | 3300050512 | nmdc:mga0n895_31979_c1 | nmdc:mga0n895_31979_c1_1060_1863 | 255 |
| 579 | 3300050512 | nmdc:mga0n895_58419_c1 | nmdc:mga0n895_58419_c1_1673_2443 | 255 |
| 580 | 3300050513 | nmdc:mga0rr50_10515_c1 | nmdc:mga0rr50_10515_c1_2913_3716 | 255 |
| 581 | 3300050515 | nmdc:mga0a205_21253_c1 | nmdc:mga0a205_21253_c1_1293_2096 | 255 |
| 582 | 3300053077 | Ga0495601_0000011 | Ga0495601_0000011_151681_152451 | 255 |
| 583 | 3300053078 | Ga0495612_0000006 | Ga0495612_0000006_134441_135211 | 255 |
| 584 | 3300053084 | Ga0495595_0000021 | Ga0495595_0000021_17633_18403 | 255 |
| 585 | 3300053085 | Ga0495619_0000013 | Ga0495619_0000013_151602_152372 | 255 |
| 586 | 3300002459 | JGI24751J29686_10004988 | JGI24751J29686_100049881 | 256 |
| 587 | 3300005331 | Ga0070670_100073795 | Ga0070670_1000737952 | 256 |
| 588 | 3300005338 | Ga0068868_100176757 | Ga0068868_1001767571 | 256 |
| 589 | 3300005353 | Ga0070669_100145045 | Ga0070669_1001450451 | 256 |
| 590 | 3300005354 | Ga0070675_100370162 | Ga0070675_1003701622 | 256 |
| 591 | 3300005365 | Ga0070688_100099172 | Ga0070688_1000991722 | 256 |
| 592 | 3300005367 | Ga0070667_100113718 | Ga0070667_1001137182 | 256 |
| 593 | 3300005438 | Ga0070701_10171535 | Ga0070701_101715351 | 256 |
| 594 | 3300005441 | Ga0070700_100254832 | Ga0070700_1002548322 | 256 |
| 595 | 3300005459 | Ga0068867_100050608 | Ga0068867_1000506083 | 256 |
| 596 | 3300005466 | Ga0070685_10018946 | Ga0070685_100189462 | 256 |
| 597 | 3300005466 | Ga0070685_10300453 | Ga0070685_103004531 | 256 |
| 598 | 3300005543 | Ga0070672_100075006 | Ga0070672_1000750062 | 256 |
| 599 | 3300005548 | Ga0070665_100383592 | Ga0070665_1003835921 | 256 |
| 600 | 3300005615 | Ga0070702_100130906 | Ga0070702_1001309061 | 256 |
| 601 | 3300005617 | Ga0068859_100027770 | Ga0068859_1000277703 | 256 |
| 602 | 3300005618 | Ga0068864_100007555 | Ga0068864_1000075555 | 256 |
| 603 | 3300005842 | Ga0068858_100373962 | Ga0068858_1003739622 | 256 |
| 604 | 3300006846 | Ga0075430_100094433 | Ga0075430_1000944333 | 256 |
| 605 | 3300006847 | Ga0075431_100483701 | Ga0075431_1004837012 | 256 |
| 606 | 3300006931 | Ga0097620_100027770 | Ga0097620_1000277703 | 256 |
| 607 | 3300009098 | Ga0105245_10787318 | Ga0105245_107873181 | 256 |
| 608 | 3300013296 | Ga0157374_10199033 | Ga0157374_101990332 | 256 |
| 609 | 3300013308 | Ga0157375_10618559 | Ga0157375_106185591 | 256 |
| 610 | 3300017792 | Ga0163161_10219279 | Ga0163161_102192792 | 256 |
| 611 | 3300025893 | Ga0207682_10000722 | Ga0207682_1000072212 | 256 |
| 612 | 3300025907 | Ga0207645_10020586 | Ga0207645_100205863 | 256 |
| 613 | 3300025918 | Ga0207662_10026247 | Ga0207662_100262473 | 256 |
| 614 | 3300025923 | Ga0207681_10432867 | Ga0207681_104328671 | 256 |
| 615 | 3300025927 | Ga0207687_10084817 | Ga0207687_100848171 | 256 |
| 616 | 3300025937 | Ga0207669_10071094 | Ga0207669_100710942 | 256 |
| 617 | 3300025940 | Ga0207691_10003529 | Ga0207691_1000352912 | 256 |
| 618 | 3300025942 | Ga0207689_10196599 | Ga0207689_101965991 | 256 |
| 619 | 3300025986 | Ga0207658_10149656 | Ga0207658_101496563 | 256 |
| 620 | 3300026035 | Ga0207703_10274460 | Ga0207703_102744602 | 256 |
| 621 | 3300026067 | Ga0207678_10402337 | Ga0207678_104023371 | 256 |
| 622 | 3300026089 | Ga0207648_10177525 | Ga0207648_101775252 | 256 |
| 623 | 3300026095 | Ga0207676_10023059 | Ga0207676_100230593 | 256 |
| 624 | 3300026116 | Ga0207674_10186439 | Ga0207674_101864391 | 256 |
| 625 | 3300026121 | Ga0207683_10013489 | Ga0207683_100134895 | 256 |
| 626 | 3300031456 | Ga0307513_10170943 | Ga0307513_101709432 | 256 |
| 627 | 3300035111 | Ga0373923_0029554 | Ga0373923_0029554_1256_2026 | 256 |
| 628 | 3300035116 | Ga0373945_0015071 | Ga0373945_0015071_377_1147 | 256 |
| 629 | 3300035117 | Ga0373953_0020098 | Ga0373953_0020098_1638_2408 | 256 |
| 630 | 3300035118 | Ga0373954_0016395 | Ga0373954_0016395_129_899 | 256 |
| 631 | 3300035119 | Ga0373956_0039236 | Ga0373956_0039236_312_1082 | 256 |
| 632 | 3300035171 | Ga0373946_0141751 | Ga0373946_0141751_89_859 | 256 |
| 633 | 3300035692 | Ga0373935_0173475 | Ga0373935_0173475_492_1262 | 256 |
| 634 | 3300035695 | Ga0373927_0032762 | Ga0373927_0032762_2540_3310 | 256 |
| 635 | 3300035724 | Ga0373933_0009553 | Ga0373933_0009553_3429_4199 | 256 |
| 636 | 3300035725 | Ga0373947_0040197 | Ga0373947_0040197_1818_2588 | 256 |
| 637 | 3300036401 | Ga0373937_0005293 | Ga0373937_0005293_4765_5535 | 256 |
| 638 | 3300037068 | Ga0373925_0396408 | Ga0373925_0396408_159_929 | 256 |
| 639 | 3300037853 | Ga0436364_0305691 | Ga0436364_0305691_200_970 | 256 |
| 640 | 3300039437 | Ga0436365_1620475 | Ga0436365_1620475_169_939 | 256 |
| 641 | 3300039450 | Ga0436363_0008346 | Ga0436363_0008346_224_994 | 256 |
| 642 | 3300046454 | Ga0495592_0003385 | Ga0495592_0003385_6660_7430 | 256 |
| 643 | 3300046460 | Ga0495638_0034696 | Ga0495638_0034696_2313_3083 | 256 |
| 644 | 3300046462 | Ga0495651_0006369 | Ga0495651_0006369_190_960 | 256 |
| 645 | 3300046463 | Ga0495653_0001211 | Ga0495653_0001211_18751_19521 | 256 |
| 646 | 3300046475 | Ga0495639_0050651 | Ga0495639_0050651_1086_1856 | 256 |
| 647 | 3300046477 | Ga0495664_0072946 | Ga0495664_0072946_971_1741 | 256 |
| 648 | 3300046511 | Ga0495608_0033393 | Ga0495608_0033393_2618_3388 | 256 |
| 649 | 3300046514 | Ga0495618_0040055 | Ga0495618_0040055_175_945 | 256 |
| 650 | 3300046516 | Ga0495628_0152051 | Ga0495628_0152051_648_1418 | 256 |
| 651 | 3300046525 | Ga0495663_0046982 | Ga0495663_0046982_238_1008 | 256 |
| 652 | 3300046529 | Ga0495652_0032454 | Ga0495652_0032454_3090_3860 | 256 |
| 653 | 3300046533 | Ga0495640_0002174 | Ga0495640_0002174_11081_11851 | 256 |
| 654 | 3300046536 | Ga0495587_0001202 | Ga0495587_0001202_4841_5611 | 256 |
| 655 | 3300046543 | Ga0495645_0042155 | Ga0495645_0042155_85_855 | 256 |
| 656 | 3300046559 | Ga0495667_0000905 | Ga0495667_0000905_9480_10250 | 256 |
| 657 | 3300046642 | Ga0495634_0019551 | Ga0495634_0019551_4010_4780 | 256 |
| 658 | 3300046663 | Ga0495635_0003590 | Ga0495635_0003590_2050_2820 | 256 |
| 659 | 3300046675 | Ga0495657_0020484 | Ga0495657_0020484_2831_3601 | 256 |
| 660 | 3300046678 | Ga0495599_0054864 | Ga0495599_0054864_70_840 | 256 |
| 661 | 3300046679 | Ga0495623_0024201 | Ga0495623_0024201_2317_3087 | 256 |
| 662 | 3300046680 | Ga0495646_0083868 | Ga0495646_0083868_418_1188 | 256 |
| 663 | 3300046809 | Ga0495600_0008849 | Ga0495600_0008849_5297_6067 | 256 |
| 664 | 3300047315 | Ga0495581_0179917 | Ga0495581_0179917_276_1046 | 256 |
| 665 | 3300047317 | Ga0495604_0003139 | Ga0495604_0003139_8302_9072 | 256 |
| 666 | 3300047319 | Ga0495674_0036514 | Ga0495674_0036514_1825_2595 | 256 |
| 667 | 3300047321 | Ga0495676_0111879 | Ga0495676_0111879_326_1096 | 256 |
| 668 | 3300047322 | Ga0495680_0000483 | Ga0495680_0000483_2368_3138 | 256 |
| 669 | 3300047444 | Ga0495675_0009488 | Ga0495675_0009488_83_853 | 256 |
| 670 | 3300047447 | Ga0495685_069074 | Ga0495685_069074_69_839 | 256 |
| 671 | 3300047471 | Ga0495684_0268751 | Ga0495684_0268751_268_1038 | 256 |
| 672 | 3300048088 | Ga0495602_0031070 | Ga0495602_0031070_220_990 | 256 |
| 673 | 3300049572 | Ga0501036_0279009 | Ga0501036_0279009_43_813 | 256 |
| 674 | 3300049591 | Ga0501075_0110810 | Ga0501075_0110810_1263_2033 | 256 |
| 675 | 3300049592 | Ga0501076_0659582 | Ga0501076_0659582_69_839 | 256 |
| 676 | 3300049743 | Ga0501081_0344456 | Ga0501081_0344456_70_840 | 256 |
| 677 | 3300049824 | Ga0501045_0374458 | Ga0501045_0374458_123_893 | 256 |
| 678 | 3300050492 | nmdc:mga0yw44_49170_c1 | nmdc:mga0yw44_49170_c1_1621_2391 | 256 |
| 679 | 3300050509 | nmdc:mga0qj67_20786_c1 | nmdc:mga0qj67_20786_c1_879_1718 | 256 |
| 680 | 3300053077 | Ga0495601_0015267 | Ga0495601_0015267_3510_4280 | 256 |
| 681 | 3300053078 | Ga0495612_0043377 | Ga0495612_0043377_873_1643 | 256 |
| 682 | 3300053096 | Ga0500641_0159619 | Ga0500641_0159619_160_930 | 256 |
| 683 | 3300053151 | Ga0500604_0113132 | Ga0500604_0113132_86_856 | 256 |
| 684 | 3300053158 | Ga0500627_0060635 | Ga0500627_0060635_134_904 | 256 |
| 685 | 3300053727 | Ga0500611_043870 | Ga0500611_043870_159_929 | 256 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6nq8-assembly2.cif.gz_B | crystal structure of yetj mutant from bacillus subtilis - d171e | 0.8584 | 29 | 252 |
| 4pgw-assembly1.cif.gz_A | crystal structure of yetj from bacillus subtilis at ph 6 by pt-sad | 0.8541 | 29 | 252 |
| 6nq9-assembly3.cif.gz_C | crystal structure of yetj mutant from bacillus subtilis - d195e | 0.8393 | 29 | 254 |
| 4pgw-assembly1.cif.gz_A | crystal structure of yetj from bacillus subtilis at ph 6 by pt-sad | 0.8337 | 29 | 252 |
| 6nq9-assembly3.cif.gz_C | crystal structure of yetj mutant from bacillus subtilis - d195e | 0.8315 | 29 | 254 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAC4_18_230_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9246 | 29 | 252 | 1.20.1250.20 |
| af_P0AAC4_18_230_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9121 | 29 | 252 | 1.20.1250.20 |
| af_Q4DZH5_101_300_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8818 | 29 | 248 | 1.20.1250.20 |
| af_O74888_1_266_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8811 | 26 | 253 | 1.20.1250.20 |
| af_P0AAC6_18_213_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8773 | 29 | 250 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A435NBU8-F1-model_v4 | deleted | 0.9913 | 116 | 256 |
|
| AF-A0A2D5WXY5-F1-model_v4 | BAX inhibitor (BI)-1/YccA family protein | 0.9797 | 115 | 256 |
GO:0005886
|
| AF-A0A435NBU8-F1-model_v4 | deleted | 0.9775 | 116 | 256 |
|
| AF-A0A1F3AYZ5-F1-model_v4 | SecY protein | 0.9745 | 90 | 256 |
GO:0005886
|
| AF-A0A3A0EYU3-F1-model_v4 | BAX inhibitor (BI)-1/YccA family protein | 0.9718 | 14 | 256 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar