F475158

General Info

Members Datasets Scaffolds Average Seq Length
685 363 684 250

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0241352|Ga0501083_0241352_128_1015
Length 295
Sequence MAAGSGARPDPALNSAHGWLPARPRRQGVRQRLAANPEELFMSDYDRNVAAFPGATRTVAVDAGLRAHMIRVYNYMASAVALTGVLAYVTFQAAGGDAIRVAGNTITGLTPFGQTVMGGFAPIVLMLVTLGLVFFISFRINRLQYTTALGLFMLYAGLLGVALSTIFVAYTGASITRVFFISAASFGALSIYGYTTQRDLSPFGSFLIMGLFGIIIASLVNIFLASSALTFAISVIGVLVFAGLTAWDTQKIKEMYSPMDDGTVAGRKAVMGALSLYLDFINLFLMLLRLFGDRR

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
92 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
102 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
103 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
155 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
175 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
197 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
209 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
210 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
211 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
212 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
213 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
214 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
215 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
216 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
236 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
237 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
270 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
272 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
275 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
320 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
321 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
322 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
323 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
329 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
330 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
335 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
336 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
337 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
338 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
339 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
340 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
341 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
342 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
343 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
344 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
345 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
346 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
347 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
348 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
349 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
350 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
351 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
352 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
353 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
354 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
355 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
356 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
357 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
358 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
363 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.33
Metatranscriptomes 4.53
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.76
Nodule 0
Rhizoplane 3.5
Rhizosphere 84.53
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10004988 3300002459 Bacteria 2705
2 JGI25406J46586_10008857 3300003203 Bacteria 4531
3 JGI25153J46596_10001402 3300003215 Bacteria 14442
4 JGI25153J46596_10004909 3300003215 Bacteria 7109
5 Ga0055527_1000348 3300003760 Bacteria 22982
6 Ga0055535_1000137 3300003761 Bacteria 76845
7 Ga0055542_1008635 3300003762 Bacteria 1979
8 Ga0055529_1005228 3300003763 Bacteria 1897
9 Ga0055529_1012897 3300003763 Bacteria 1066
10 Ga0058859_11740191 3300004798 Bacteria 822
11 Ga0058860_12182228 3300004801 Bacteria 1040
12 Ga0058862_12589958 3300004803 Bacteria 922
13 Ga0058862_12880575 3300004803 Bacteria 978
14 Ga0065707_10217266 3300005295 Bacteria 1235
15 Ga0070670_100073795 3300005331 Bacteria 2931
16 Ga0068869_100257574 3300005334 Bacteria 1396
17 Ga0068868_100176757 3300005338 Bacteria 1769
18 Ga0070689_100243052 3300005340 Bacteria 1483
19 Ga0070668_100136068 3300005347 Bacteria 1976
20 Ga0070669_100100970 3300005353 Bacteria 2176
21 Ga0070669_100145045 3300005353 Bacteria 1833
22 Ga0070675_100026991 3300005354 Bacteria 4611
23 Ga0070675_100133330 3300005354 Bacteria 2118
24 Ga0070675_100370162 3300005354 Bacteria 1274
25 Ga0070671_100005912 3300005355 Bacteria 9750
26 Ga0070674_100021767 3300005356 Bacteria 4124
27 Ga0070674_100835671 3300005356 Bacteria 798
28 Ga0070673_100083880 3300005364 Bacteria 2590
29 Ga0070688_100099172 3300005365 Bacteria 1917
30 Ga0070667_100113718 3300005367 Bacteria 2349
31 Ga0070667_100330999 3300005367 Bacteria 1376
32 Ga0070709_10039119 3300005434 Bacteria 2909
33 Ga0070709_10177453 3300005434 Bacteria 1493
34 Ga0070714_100071523 3300005435 Bacteria 2999
35 Ga0070714_100226570 3300005435 Bacteria 1720
36 Ga0070713_100504625 3300005436 Bacteria 1142
37 Ga0070710_10071096 3300005437 Bacteria 2006
38 Ga0070701_10171535 3300005438 Bacteria 1264
39 Ga0070701_10495026 3300005438 Bacteria 792
40 Ga0070711_100141313 3300005439 Bacteria 1806
41 Ga0070700_100254832 3300005441 Bacteria 1261
42 Ga0070708_100084345 3300005445 Bacteria 2882
43 Ga0070681_10059291 3300005458 Bacteria 3807
44 Ga0068867_100050608 3300005459 Bacteria 3062
45 Ga0070685_10018946 3300005466 Bacteria 3708
46 Ga0070685_10300453 3300005466 Bacteria 1082
47 Ga0070699_100309949 3300005518 Bacteria 1417
48 Ga0070679_100048126 3300005530 Bacteria 4249
49 Ga0070679_100218279 3300005530 Bacteria 1868
50 Ga0070672_100075006 3300005543 Bacteria 2699
51 Ga0070695_100249106 3300005545 Bacteria 1292
52 Ga0070665_100383592 3300005548 Bacteria 1413
53 Ga0070664_100075564 3300005564 Bacteria 2893
54 Ga0070702_100130906 3300005615 Bacteria 1584
55 Ga0068859_100027770 3300005617 Bacteria 5676
56 Ga0068864_100007555 3300005618 Bacteria 8957
57 Ga0068870_10397914 3300005840 Bacteria 896
58 Ga0068858_100373962 3300005842 Bacteria 1367
59 Ga0068860_100351676 3300005843 Bacteria 1450
60 Ga0068862_100121391 3300005844 Bacteria 2304
61 Ga0068862_100393608 3300005844 Bacteria 1295
62 Ga0081538_10124878 3300005981 Bacteria 1226
63 Ga0081540_1001109 3300005983 Bacteria 23852
64 Ga0081539_10003227 3300005985 Bacteria 20568
65 Ga0070717_10079339 3300006028 Bacteria 2752
66 Ga0070717_10514261 3300006028 Bacteria 1083
67 Ga0075365_10053864 3300006038 Bacteria 2666
68 Ga0075365_10098968 3300006038 Bacteria 1995
69 Ga0075368_10085825 3300006042 Bacteria 1284
70 Ga0075363_100015573 3300006048 Bacteria 3739
71 Ga0075364_10016731 3300006051 Bacteria 4567
72 Ga0070715_10172002 3300006163 Bacteria 1080
73 Ga0075367_10093438 3300006178 Bacteria 1832
74 Ga0075367_10229203 3300006178 Bacteria 1163
75 Ga0075367_10232165 3300006178 Bacteria 1155
76 Ga0075369_10028288 3300006186 Bacteria 2349
77 Ga0075369_10069978 3300006186 Bacteria 1543
78 Ga0075369_10202646 3300006186 Bacteria 916
79 Ga0075427_10000389 3300006194 Bacteria 4930
80 Ga0075366_10010635 3300006195 Bacteria 5169
81 Ga0075366_10152062 3300006195 Bacteria 1402
82 Ga0075370_10012948 3300006353 Bacteria 4422
83 Ga0075370_10046449 3300006353 Bacteria 2457
84 Ga0075370_10294985 3300006353 Bacteria 964
85 Ga0075428_100007998 3300006844 Bacteria 11727
86 Ga0075428_100058970 3300006844 Bacteria 4203
87 Ga0075428_100111881 3300006844 Bacteria 2974
88 Ga0075430_100000032 3300006846 Bacteria 72679
89 Ga0075430_100094433 3300006846 Bacteria 2500
90 Ga0075431_100000903 3300006847 Bacteria 26158
91 Ga0075431_100052467 3300006847 Bacteria 4206
92 Ga0075431_100167999 3300006847 Bacteria 2255
93 Ga0075431_100483701 3300006847 Bacteria 1230
94 Ga0075433_10017192 3300006852 Bacteria 5984
95 Ga0075433_10019599 3300006852 Bacteria 5639
96 Ga0075434_100000271 3300006871 Bacteria 36857
97 Ga0075434_100009740 3300006871 Bacteria 8981
98 Ga0075434_100011424 3300006871 Bacteria 8377
99 Ga0075434_100705248 3300006871 Bacteria 1027
100 Ga0075429_100000561 3300006880 Bacteria 28469
101 Ga0075429_100007528 3300006880 Bacteria 9453
102 Ga0097620_100027770 3300006931 Bacteria 5676
103 Ga0075435_100033962 3300007076 Bacteria 4038
104 Ga0075435_100035256 3300007076 Bacteria 3970
105 Ga0075435_100049397 3300007076 Bacteria 3383
106 Ga0099794_10023255 3300007265 Bacteria 2832
107 Ga0099795_10016161 3300007788 Bacteria 2354
108 Ga0111539_10001270 3300009094 Bacteria 33682
109 Ga0111539_10106024 3300009094 Bacteria 3297
110 Ga0111539_10230550 3300009094 Bacteria 2156
111 Ga0105245_10787318 3300009098 Bacteria 988
112 Ga0105247_10345618 3300009101 Bacteria 1045
113 Ga0114129_10001444 3300009147 Bacteria 32043
114 Ga0114129_10395943 3300009147 Bacteria 1821
115 Ga0114129_10488916 3300009147 Bacteria 1609
116 Ga0105243_10622346 3300009148 Bacteria 1042
117 Ga0105243_10798172 3300009148 Bacteria 930
118 Ga0105248_10130763 3300009177 Bacteria 2832
119 Ga0105238_10122440 3300009551 Bacteria 2580
120 Ga0105238_10457467 3300009551 Bacteria 1274
121 Ga0105249_10282604 3300009553 Bacteria 1658
122 Ga0099796_10022382 3300010159 Bacteria 1960
123 Ga0099796_10116269 3300010159 Bacteria 1023
124 Ga0157370_10057496 3300013104 Bacteria 3698
125 Ga0157370_10191953 3300013104 Bacteria 1896
126 Ga0157370_10471142 3300013104 Bacteria 1154
127 Ga0157374_10199033 3300013296 Bacteria 1961
128 Ga0157374_10473994 3300013296 Bacteria 1254
129 Ga0157375_10071761 3300013308 Bacteria 3477
130 Ga0157375_10618559 3300013308 Bacteria 1241
131 Ga0157375_11151307 3300013308 Bacteria 909
132 Ga0157380_10316693 3300014326 Bacteria 1444
133 Ga0163161_10219279 3300017792 Bacteria 1472
134 Ga0184601_134529 3300019183 Bacteria 829
135 Ga0197907_10241108 3300020069 Bacteria 952
136 Ga0197907_11149821 3300020069 Bacteria 854
137 Ga0206356_10058304 3300020070 Bacteria 1870
138 Ga0206356_11190054 3300020070 Bacteria 804
139 Ga0206349_1686143 3300020075 Bacteria 855
140 Ga0206355_1367406 3300020076 Bacteria 1178
141 Ga0206351_10671826 3300020077 Bacteria 937
142 Ga0206351_10851183 3300020077 Bacteria 850
143 Ga0206352_10130377 3300020078 Bacteria 868
144 Ga0206352_10630827 3300020078 Bacteria 856
145 Ga0206350_10136915 3300020080 Bacteria 960
146 Ga0206350_11242039 3300020080 Bacteria 857
147 Ga0206354_10364600 3300020081 Bacteria 950
148 Ga0206353_10033645 3300020082 Bacteria 1858
149 Ga0206353_10830196 3300020082 Bacteria 950
150 Ga0213874_10073401 3300021377 Bacteria 1096
151 Ga0213876_10005720 3300021384 Bacteria 6814
152 Ga0213871_10042533 3300021441 Bacteria 1224
153 Ga0224712_10182174 3300022467 Bacteria 947
154 Ga0224572_1031817 3300024225 Bacteria 1006
155 Ga0228598_1013306 3300024227 Bacteria 1630
156 Ga0209672_100015 3300025228 Bacteria 529352
157 Ga0209147_100016 3300025229 Bacteria 527606
158 Ga0209258_100026 3300025242 Bacteria 527606
159 Ga0209148_1000952 3300025254 Bacteria 18941
160 Ga0209148_1006961 3300025254 Bacteria 2395
161 Ga0209455_1000321 3300025272 Bacteria 47677
162 Ga0209455_1000544 3300025272 Bacteria 26082
163 Ga0209758_1000469 3300025297 Bacteria 66568
164 Ga0209758_1088120 3300025297 Bacteria 917
165 Ga0207682_10000722 3300025893 Bacteria 15329
166 Ga0207692_10065966 3300025898 Bacteria 1891
167 Ga0207692_10073172 3300025898 Bacteria 1812
168 Ga0207688_10083701 3300025901 Bacteria 1825
169 Ga0207685_10153223 3300025905 Bacteria 1045
170 Ga0207699_10050154 3300025906 Bacteria 2459
171 Ga0207645_10020586 3300025907 Bacteria 4316
172 Ga0207645_10111527 3300025907 Bacteria 1771
173 Ga0207654_10369880 3300025911 Bacteria 991
174 Ga0207707_10116011 3300025912 Bacteria 2340
175 Ga0207693_10017643 3300025915 Bacteria 5691
176 Ga0207660_10084805 3300025917 Bacteria 2335
177 Ga0207662_10026247 3300025918 Bacteria 3359
178 Ga0207649_10328407 3300025920 Bacteria 1126
179 Ga0207652_10248325 3300025921 Bacteria 1605
180 Ga0207652_10631978 3300025921 Bacteria 958
181 Ga0207681_10091132 3300025923 Bacteria 2177
182 Ga0207681_10432867 3300025923 Bacteria 1067
183 Ga0207650_10003045 3300025925 Bacteria 11539
184 Ga0207659_10170772 3300025926 Bacteria 1715
185 Ga0207659_10288923 3300025926 Bacteria 1343
186 Ga0207659_10510969 3300025926 Bacteria 1018
187 Ga0207687_10084817 3300025927 Bacteria 2297
188 Ga0207687_10175773 3300025927 Bacteria 1655
189 Ga0207700_10043617 3300025928 Bacteria 3295
190 Ga0207700_10106049 3300025928 Bacteria 2252
191 Ga0207664_10597058 3300025929 Bacteria 991
192 Ga0207644_10003250 3300025931 Bacteria 10486
193 Ga0207690_10140463 3300025932 Bacteria 1779
194 Ga0207706_10575797 3300025933 Bacteria 968
195 Ga0207669_10071094 3300025937 Bacteria 2184
196 Ga0207669_10192897 3300025937 Bacteria 1471
197 Ga0207665_10234830 3300025939 Bacteria 1349
198 Ga0207691_10003529 3300025940 Bacteria 15210
199 Ga0207691_10131990 3300025940 Bacteria 2205
200 Ga0207691_10158744 3300025940 Bacteria 1985
201 Ga0207689_10196599 3300025942 Bacteria 1664
202 Ga0207689_10231147 3300025942 Bacteria 1528
203 Ga0207679_10063581 3300025945 Bacteria 2755
204 Ga0207651_10000859 3300025960 Bacteria 13273
205 Ga0207712_10164602 3300025961 Bacteria 1727
206 Ga0207668_10093724 3300025972 Bacteria 2213
207 Ga0207658_10062401 3300025986 Bacteria 2789
208 Ga0207658_10149656 3300025986 Bacteria 1900
209 Ga0207703_10274460 3300026035 Bacteria 1529
210 Ga0207678_10402337 3300026067 Bacteria 1186
211 Ga0207708_10451360 3300026075 Bacteria 1071
212 Ga0207708_10477546 3300026075 Bacteria 1042
213 Ga0207648_10177525 3300026089 Bacteria 1884
214 Ga0207676_10023059 3300026095 Bacteria 4585
215 Ga0207674_10186439 3300026116 Bacteria 2025
216 Ga0207675_100294924 3300026118 Bacteria 1578
217 Ga0207683_10013489 3300026121 Bacteria 6972
218 Ga0207683_10121660 3300026121 Bacteria 2344
219 Ga0209179_1004914 3300027512 Bacteria 2055
220 Ga0209588_1031078 3300027671 Bacteria 1707
221 Ga0209813_10066764 3300027866 Bacteria 1161
222 Ga0207428_10000082 3300027907 Bacteria 133684
223 Ga0207428_10154679 3300027907 Bacteria 1744
224 Ga0207428_10449065 3300027907 Bacteria 940
225 Ga0268265_10357194 3300028380 Bacteria 1336
226 Ga0268264_10411625 3300028381 Bacteria 1302
227 Ga0268264_11084638 3300028381 Bacteria 809
228 Ga0265334_10001877 3300028573 Bacteria 9974
229 Ga0265318_10008385 3300028577 Bacteria 4603
230 Ga0265338_10068313 3300028800 Bacteria 3062
231 Ga0265338_10081565 3300028800 Bacteria 2712
232 Ga0265330_10009843 3300031235 Bacteria 4524
233 Ga0265332_10007464 3300031238 Bacteria 4943
234 Ga0265325_10002531 3300031241 Bacteria 12306
235 Ga0265325_10004291 3300031241 Bacteria 9036
236 Ga0265325_10005464 3300031241 Bacteria 7838
237 Ga0265325_10016732 3300031241 Bacteria 4093
238 Ga0265325_10019267 3300031241 Bacteria 3776
239 Ga0265325_10033863 3300031241 Bacteria 2722
240 Ga0265340_10006803 3300031247 Bacteria 6257
241 Ga0265340_10010861 3300031247 Bacteria 4859
242 Ga0265340_10042659 3300031247 Bacteria 2226
243 Ga0265340_10073607 3300031247 Bacteria 1616
244 Ga0265339_10000126 3300031249 Bacteria 63942
245 Ga0265339_10019847 3300031249 Bacteria 3935
246 Ga0265331_10029658 3300031250 Bacteria 2728
247 Ga0265331_10044220 3300031250 Bacteria 2155
248 Ga0265316_10016618 3300031344 Bacteria 6379
249 Ga0265316_10246298 3300031344 Bacteria 1313
250 Ga0307513_10012476 3300031456 Bacteria 10485
251 Ga0307513_10170943 3300031456 Bacteria 2051
252 Ga0265313_10000054 3300031595 Bacteria 110199
253 Ga0265313_10000593 3300031595 Bacteria 37608
254 Ga0265313_10009618 3300031595 Bacteria 6253
255 Ga0265313_10016449 3300031595 Bacteria 4251
256 Ga0316575_10040077 3300031665 Bacteria 1850
257 Ga0265314_10144700 3300031711 Bacteria 1465
258 Ga0265342_10000034 3300031712 Bacteria 145074
259 Ga0265342_10012408 3300031712 Bacteria 5774
260 Ga0316576_10252323 3300031727 Bacteria 1324
261 Ga0307516_10205444 3300031730 Bacteria 1687
262 Ga0307405_10308451 3300031731 Bacteria 1204
263 Ga0307413_10413909 3300031824 Bacteria 1060
264 Ga0307416_100962018 3300032002 Bacteria 956
265 Ga0316583_10002336 3300032133 Bacteria 6547
266 Ga0316583_10034329 3300032133 Bacteria 1800
267 Ga0316593_10186110 3300032168 Bacteria 764
268 Ga0316592_1067264 3300033524 Bacteria 808
269 Ga0316587_1035520 3300033529 Bacteria 891
270 Ga0316596_1087836 3300033541 Bacteria 837
271 Ga0316596_1107409 3300033541 Bacteria 756
272 Ga0373923_0029554 3300035111 Bacteria 2199
273 Ga0373923_0038540 3300035111 Bacteria 1959
274 Ga0373923_0213495 3300035111 Bacteria 895
275 Ga0373945_0015071 3300035116 Bacteria 2598
276 Ga0373953_0003215 3300035117 Bacteria 5057
277 Ga0373953_0020098 3300035117 Bacteria 2493
278 Ga0373953_0052158 3300035117 Bacteria 1655
279 Ga0373953_0147965 3300035117 Bacteria 1006
280 Ga0373954_0000445 3300035118 Bacteria 15476
281 Ga0373954_0016395 3300035118 Bacteria 3316
282 Ga0373956_0015215 3300035119 Bacteria 3219
283 Ga0373956_0034655 3300035119 Bacteria 2223
284 Ga0373956_0039236 3300035119 Bacteria 2098
285 Ga0373956_0044526 3300035119 Bacteria 1978
286 Ga0373956_0123417 3300035119 Bacteria 1210
287 Ga0373957_0001446 3300035120 Bacteria 6435
288 Ga0373943_0001478 3300035170 Bacteria 10640
289 Ga0373943_0006511 3300035170 Bacteria 5247
290 Ga0373943_0035254 3300035170 Bacteria 2390
291 Ga0373946_0024272 3300035171 Bacteria 2374
292 Ga0373946_0101768 3300035171 Bacteria 1289
293 Ga0373946_0141751 3300035171 Bacteria 1115
294 Ga0373955_0000310 3300035172 Bacteria 20214
295 Ga0373955_0000456 3300035172 Bacteria 17318
296 Ga0373955_0004242 3300035172 Bacteria 6332
297 Ga0316574_0000145 3300035398 Bacteria 22563
298 Ga0373924_0099306 3300035410 Bacteria 1251
299 Ga0373935_0000011 3300035692 Bacteria 89873
300 Ga0373935_0117456 3300035692 Bacteria 1773
301 Ga0373935_0173475 3300035692 Bacteria 1476
302 Ga0373935_0210499 3300035692 Bacteria 1347
303 Ga0373927_0018445 3300035695 Bacteria 4587
304 Ga0373927_0022396 3300035695 Bacteria 4139
305 Ga0373927_0032762 3300035695 Bacteria 3384
306 Ga0373927_0053021 3300035695 Bacteria 2623
307 Ga0373927_0114613 3300035695 Bacteria 1757
308 Ga0373933_0000315 3300035724 Bacteria 31397
309 Ga0373933_0001894 3300035724 Bacteria 12065
310 Ga0373933_0004896 3300035724 Bacteria 7308
311 Ga0373933_0009553 3300035724 Bacteria 5295
312 Ga0373933_0068023 3300035724 Bacteria 2163
313 Ga0373933_0229686 3300035724 Bacteria 1192
314 Ga0373947_0002093 3300035725 Bacteria 12167
315 Ga0373947_0027350 3300035725 Bacteria 3338
316 Ga0373947_0040197 3300035725 Bacteria 2785
317 Ga0373947_0207074 3300035725 Bacteria 1285
318 Ga0373937_0000019 3300036401 Bacteria 138568
319 Ga0373937_0001931 3300036401 Bacteria 17346
320 Ga0373937_0005293 3300036401 Bacteria 11025
321 Ga0373937_0041506 3300036401 Bacteria 4196
322 Ga0373937_0043108 3300036401 Bacteria 4117
323 Ga0373937_0050476 3300036401 Bacteria 3810
324 Ga0373937_0057234 3300036401 Bacteria 3581
325 Ga0373937_0145718 3300036401 Bacteria 2217
326 Ga0373937_0339950 3300036401 Bacteria 1421
327 Ga0265778_019593 3300036457 Bacteria 828
328 Ga0316582_0062945 3300036647 Bacteria 2383
329 Ga0316584_0043408 3300036712 Bacteria 3352
330 Ga0373925_0000048 3300037068 Bacteria 129615
331 Ga0373925_0012867 3300037068 Bacteria 6061
332 Ga0373925_0396408 3300037068 Bacteria 1125
333 Ga0395899_0009821 3300037312 Bacteria 7342
334 Ga0395899_0013258 3300037312 Bacteria 6308
335 Ga0395900_0028146 3300037418 Bacteria 5755
336 Ga0395898_0104572 3300037466 Bacteria 2715
337 Ga0436364_0305691 3300037853 Bacteria 1025
338 Ga0436364_0548592 3300037853 Bacteria 946
339 Ga0436364_1214892 3300037853 Bacteria 996
340 Ga0395901_0051442 3300038443 Bacteria 4283
341 Ga0395901_0111981 3300038443 Bacteria 2866
342 Ga0395901_0320363 3300038443 Bacteria 1604
343 Ga0395901_0441559 3300038443 Bacteria 1332
344 Ga0436365_1410225 3300039437 Bacteria 2990
345 Ga0436365_1620475 3300039437 Bacteria 1282
346 Ga0436365_1855567 3300039437 Bacteria 16138
347 Ga0436365_1890998 3300039437 Bacteria 3695
348 Ga0436365_1910356 3300039437 Bacteria 2164
349 Ga0436360_0440024 3300039438 Bacteria 1547
350 Ga0436360_0832565 3300039438 Bacteria 8060
351 Ga0436361_0360492 3300039447 Bacteria 1514
352 Ga0436363_0008346 3300039450 Bacteria 1206
353 Ga0436363_0611312 3300039450 Bacteria 947
354 Ga0436363_1081647 3300039450 Bacteria 2557
355 Ga0436363_1307539 3300039450 Bacteria 1380
356 Ga0436362_0343721 3300039453 Bacteria 1597
357 Ga0439439_0051495 3300041406 Bacteria 1080
358 Ga0439453_0041658 3300041408 Bacteria 902
359 Ga0451798_0309505 3300041458 Bacteria 1032
360 Ga0439443_011511 3300042003 Bacteria 1297
361 Ga0450923_013571 3300042125 Bacteria 1499
362 Ga0439458_0053291 3300042157 Bacteria 1001
363 Ga0439464_0025326 3300042439 Bacteria 1643
364 Ga0450893_0013879 3300042532 Bacteria 1347
365 Ga0466971_0078114 3300044719 Bacteria 1508
366 Ga0466967_0081276 3300045976 Bacteria 2927
367 Ga0495592_0000017 3300046454 Bacteria 142442
368 Ga0495592_0001796 3300046454 Bacteria 15099
369 Ga0495592_0003385 3300046454 Bacteria 11438
370 Ga0495591_057922 3300046458 Bacteria 1037
371 Ga0495629_0040146 3300046459 Bacteria 3292
372 Ga0495638_0034696 3300046460 Bacteria 3221
373 Ga0495641_0025187 3300046461 Bacteria 2922
374 Ga0495641_0168293 3300046461 Bacteria 981
375 Ga0495651_0000923 3300046462 Bacteria 22782
376 Ga0495651_0006369 3300046462 Bacteria 9032
377 Ga0495651_0054550 3300046462 Bacteria 3073
378 Ga0495651_0107774 3300046462 Bacteria 2064
379 Ga0495653_0000033 3300046463 Bacteria 131680
380 Ga0495653_0000987 3300046463 Bacteria 21890
381 Ga0495653_0001211 3300046463 Bacteria 19984
382 Ga0495653_0385847 3300046463 Bacteria 894
383 Ga0495582_0069408 3300046473 Bacteria 1948
384 Ga0495639_0018119 3300046475 Bacteria 3062
385 Ga0495639_0050651 3300046475 Bacteria 1887
386 Ga0495662_0037857 3300046476 Bacteria 2330
387 Ga0495664_0000008 3300046477 Bacteria 307158
388 Ga0495664_0046218 3300046477 Bacteria 2583
389 Ga0495664_0072946 3300046477 Bacteria 2052
390 Ga0495664_0196334 3300046477 Bacteria 1223
391 Ga0495585_0000389 3300046492 Bacteria 42431
392 Ga0495608_0000014 3300046511 Bacteria 221042
393 Ga0495608_0033393 3300046511 Bacteria 3478
394 Ga0495618_0000013 3300046514 Bacteria 168671
395 Ga0495618_0040055 3300046514 Bacteria 2947
396 Ga0495628_0000008 3300046516 Bacteria 284313
397 Ga0495628_0003849 3300046516 Bacteria 13361
398 Ga0495628_0054508 3300046516 Bacteria 3152
399 Ga0495628_0152051 3300046516 Bacteria 1762
400 Ga0495628_0243599 3300046516 Bacteria 1344
401 Ga0495630_0000797 3300046517 Bacteria 22206
402 Ga0495630_0051135 3300046517 Bacteria 3092
403 Ga0495637_0154191 3300046520 Bacteria 865
404 Ga0495644_0000373 3300046523 Bacteria 20312
405 Ga0495663_0046982 3300046525 Bacteria 1328
406 Ga0495666_0033440 3300046526 Bacteria 2511
407 Ga0495652_0000005 3300046529 Bacteria 524368
408 Ga0495652_0006346 3300046529 Bacteria 11012
409 Ga0495652_0032454 3300046529 Bacteria 4566
410 Ga0495652_0439637 3300046529 Bacteria 915
411 Ga0495665_0151267 3300046531 Bacteria 1211
412 Ga0495640_0000017 3300046533 Bacteria 138688
413 Ga0495640_0002174 3300046533 Bacteria 15677
414 Ga0495640_0048679 3300046533 Bacteria 2927
415 Ga0495640_0156194 3300046533 Bacteria 1464
416 Ga0495640_0332859 3300046533 Bacteria 939
417 Ga0495586_0312196 3300046535 Bacteria 901
418 Ga0495587_0000005 3300046536 Bacteria 358412
419 Ga0495587_0001202 3300046536 Bacteria 17146
420 Ga0495587_0035484 3300046536 Bacteria 3003
421 Ga0495587_0121730 3300046536 Bacteria 1494
422 Ga0495587_0233941 3300046536 Bacteria 1035
423 Ga0495598_0087651 3300046537 Bacteria 1009
424 Ga0495645_0000007 3300046543 Bacteria 376299
425 Ga0495645_0001074 3300046543 Bacteria 18551
426 Ga0495645_0042155 3300046543 Bacteria 3328
427 Ga0495645_0268809 3300046543 Bacteria 1126
428 Ga0495633_0006655 3300046558 Bacteria 6809
429 Ga0495667_0000012 3300046559 Bacteria 220967
430 Ga0495667_0000905 3300046559 Bacteria 19136
431 Ga0495667_0004405 3300046559 Bacteria 9495
432 Ga0495667_0014158 3300046559 Bacteria 5384
433 Ga0495667_0242628 3300046559 Bacteria 1147
434 Ga0495656_0002104 3300046615 Bacteria 6575
435 Ga0495634_0000070 3300046642 Bacteria 79664
436 Ga0495634_0019551 3300046642 Bacteria 4811
437 Ga0495634_0037227 3300046642 Bacteria 3325
438 Ga0495634_0265951 3300046642 Bacteria 1045
439 Ga0495635_0000010 3300046663 Bacteria 246385
440 Ga0495635_0003590 3300046663 Bacteria 10738
441 Ga0495659_0003751 3300046664 Bacteria 4831
442 Ga0495588_0015269 3300046674 Bacteria 3692
443 Ga0495657_0000178 3300046675 Bacteria 57139
444 Ga0495657_0020484 3300046675 Bacteria 4753
445 Ga0495657_0140535 3300046675 Bacteria 1505
446 Ga0495599_0000015 3300046678 Bacteria 175055
447 Ga0495599_0012323 3300046678 Bacteria 5266
448 Ga0495599_0054864 3300046678 Bacteria 2496
449 Ga0495599_0203610 3300046678 Bacteria 1215
450 Ga0495623_0000054 3300046679 Bacteria 70217
451 Ga0495623_0024201 3300046679 Bacteria 3916
452 Ga0495646_0000012 3300046680 Bacteria 185805
453 Ga0495646_0083868 3300046680 Bacteria 1851
454 Ga0495647_0080003 3300046681 Bacteria 1324
455 Ga0495647_0101405 3300046681 Bacteria 1192
456 Ga0495658_0024037 3300046683 Bacteria 3240
457 Ga0495658_0121856 3300046683 Bacteria 1578
458 Ga0495658_0137699 3300046683 Bacteria 1491
459 Ga0495613_0010812 3300046689 Bacteria 6771
460 Ga0495613_0011807 3300046689 Bacteria 6488
461 Ga0495624_0018068 3300046690 Bacteria 4721
462 Ga0495670_0000106 3300046691 Bacteria 37100
463 Ga0495600_0000031 3300046809 Bacteria 85535
464 Ga0495600_0000293 3300046809 Bacteria 26819
465 Ga0495600_0008849 3300046809 Bacteria 6200
466 Ga0495581_0019786 3300047315 Bacteria 3909
467 Ga0495581_0030496 3300047315 Bacteria 3124
468 Ga0495581_0179917 3300047315 Bacteria 1236
469 Ga0495604_0000001 3300047317 Bacteria 708627
470 Ga0495604_0003139 3300047317 Bacteria 13208
471 Ga0495604_0021273 3300047317 Bacteria 5178
472 Ga0495604_0058002 3300047317 Bacteria 2974
473 Ga0495604_0092509 3300047317 Bacteria 2240
474 Ga0495604_0215288 3300047317 Bacteria 1325
475 Ga0495604_0239232 3300047317 Bacteria 1242
476 Ga0495674_0000012 3300047319 Bacteria 270651
477 Ga0495674_0036514 3300047319 Bacteria 4422
478 Ga0495674_0056041 3300047319 Bacteria 3454
479 Ga0495674_0136213 3300047319 Bacteria 2066
480 Ga0495674_0383770 3300047319 Bacteria 1136
481 Ga0495676_0077187 3300047321 Bacteria 2541
482 Ga0495676_0111879 3300047321 Bacteria 2002
483 Ga0495680_0000483 3300047322 Bacteria 44818
484 Ga0495680_0011330 3300047322 Bacteria 7903
485 Ga0495680_0040789 3300047322 Bacteria 3696
486 Ga0495680_0079071 3300047322 Bacteria 2487
487 Ga0495675_0000500 3300047444 Bacteria 25407
488 Ga0495675_0009488 3300047444 Bacteria 6058
489 Ga0495679_044624 3300047446 Bacteria 1357
490 Ga0495685_069074 3300047447 Bacteria 1185
491 Ga0495684_0000021 3300047471 Bacteria 144901
492 Ga0495684_0117918 3300047471 Bacteria 2000
493 Ga0495684_0268751 3300047471 Bacteria 1234
494 Ga0495593_0000387 3300047673 Bacteria 24410
495 Ga0495593_0040640 3300047673 Bacteria 2503
496 Ga0495602_0000031 3300048088 Bacteria 141518
497 Ga0495602_0014374 3300048088 Bacteria 8039
498 Ga0495602_0031070 3300048088 Bacteria 5055
499 Ga0495602_0108292 3300048088 Bacteria 2263
500 Ga0495602_0282037 3300048088 Bacteria 1223
501 Ga0495614_0005015 3300048089 Bacteria 5973
502 Ga0495614_0076720 3300048089 Bacteria 1445
503 Ga0495615_0049002 3300048090 Bacteria 1081
504 Ga0496100_0007708 3300048903 Bacteria 5959
505 Ga0496100_0100101 3300048903 Bacteria 1996
506 Ga0496100_0158715 3300048903 Bacteria 1620
507 Ga0496101_0368609 3300048904 Bacteria 1129
508 Ga0496101_0610585 3300048904 Bacteria 862
509 Ga0496104_0006199 3300048907 Bacteria 10503
510 Ga0496104_0124558 3300048907 Bacteria 2474
511 Ga0496105_0246905 3300048908 Bacteria 1447
512 Ga0496106_0385086 3300048909 Bacteria 1127
513 Ga0496106_0444866 3300048909 Bacteria 1041
514 Ga0496107_0283282 3300048910 Bacteria 1233
515 Ga0496107_0394978 3300048910 Bacteria 1029
516 Ga0496109_0070082 3300048912 Bacteria 3217
517 Ga0496110_0050779 3300048913 Bacteria 3643
518 Ga0496112_0051251 3300048915 Bacteria 4048
519 Ga0496112_0250944 3300048915 Bacteria 1720
520 Ga0496112_0397824 3300048915 Bacteria 1317
521 Ga0496113_0043582 3300048916 Bacteria 3321
522 Ga0496114_0068181 3300048917 Bacteria 2986
523 Ga0496114_0083899 3300048917 Bacteria 2697
524 Ga0496114_0109828 3300048917 Bacteria 2362
525 Ga0496115_0121428 3300048918 Bacteria 2150
526 Ga0496115_0190556 3300048918 Bacteria 1694
527 Ga0496126_0015811 3300048929 Bacteria 7580
528 Ga0496126_0042509 3300048929 Bacteria 4197
529 Ga0501031_0002913 3300049568 Bacteria 10943
530 Ga0501032_0001960 3300049569 Bacteria 16196
531 Ga0501032_0129048 3300049569 Bacteria 1669
532 Ga0501033_0014226 3300049570 Bacteria 6048
533 Ga0501033_0021483 3300049570 Bacteria 4869
534 Ga0501034_0003727 3300049571 Bacteria 17214
535 Ga0501034_0487980 3300049571 Bacteria 1147
536 Ga0501036_0015848 3300049572 Bacteria 6294
537 Ga0501036_0279009 3300049572 Bacteria 1399
538 Ga0501037_0010686 3300049573 Bacteria 6745
539 Ga0501037_0287712 3300049573 Bacteria 1144
540 Ga0501038_0008913 3300049574 Bacteria 9204
541 Ga0501038_0205971 3300049574 Bacteria 1576
542 Ga0501039_0001032 3300049575 Bacteria 20355
543 Ga0501042_0102050 3300049578 Bacteria 2063
544 Ga0501043_0022908 3300049579 Bacteria 4897
545 Ga0501043_0047745 3300049579 Bacteria 3366
546 Ga0501043_0328019 3300049579 Bacteria 1166
547 Ga0501046_0000897 3300049580 Bacteria 29016
548 Ga0501046_0314087 3300049580 Bacteria 1143
549 Ga0501047_0023976 3300049581 Bacteria 5859
550 Ga0501047_0036900 3300049581 Bacteria 4724
551 Ga0501047_0091531 3300049581 Bacteria 2920
552 Ga0501047_0352092 3300049581 Bacteria 1309
553 Ga0501047_0559659 3300049581 Bacteria 967
554 Ga0501048_0006504 3300049582 Bacteria 8882
555 Ga0501067_0032125 3300049583 Bacteria 2913
556 Ga0501068_0001271 3300049584 Bacteria 13384
557 Ga0501068_0109336 3300049584 Bacteria 1718
558 Ga0501069_0000490 3300049585 Bacteria 18056
559 Ga0501070_0012403 3300049586 Bacteria 7188
560 Ga0501070_0023540 3300049586 Bacteria 5159
561 Ga0501070_0067905 3300049586 Bacteria 2952
562 Ga0501071_0012141 3300049587 Bacteria 5829
563 Ga0501071_0169366 3300049587 Bacteria 1635
564 Ga0501072_0003460 3300049588 Bacteria 11898
565 Ga0501072_0004379 3300049588 Bacteria 10721
566 Ga0501072_0210737 3300049588 Bacteria 1548
567 Ga0501072_0589670 3300049588 Bacteria 877
568 Ga0501073_0001330 3300049589 Bacteria 18204
569 Ga0501073_0059989 3300049589 Bacteria 2655
570 Ga0501074_0001714 3300049590 Bacteria 14964
571 Ga0501074_0115632 3300049590 Bacteria 1919
572 Ga0501075_0027955 3300049591 Bacteria 4159
573 Ga0501075_0110810 3300049591 Bacteria 2087
574 Ga0501076_0397553 3300049592 Bacteria 1133
575 Ga0501076_0474424 3300049592 Bacteria 1031
576 Ga0501076_0659582 3300049592 Bacteria 863
577 Ga0501077_0013421 3300049593 Bacteria 5138
578 Ga0501077_0037268 3300049593 Bacteria 3098
579 Ga0501079_0017343 3300049741 Bacteria 5499
580 Ga0501079_0114417 3300049741 Bacteria 2097
581 Ga0501080_0005290 3300049742 Bacteria 11492
582 Ga0501080_0049606 3300049742 Bacteria 3907
583 Ga0501080_0129312 3300049742 Bacteria 2338
584 Ga0501080_0259571 3300049742 Bacteria 1583
585 Ga0501081_0120944 3300049743 Bacteria 1865
586 Ga0501081_0344456 3300049743 Bacteria 1098
587 Ga0501083_0006952 3300049744 Bacteria 8028
588 Ga0501083_0033311 3300049744 Bacteria 3529
589 Ga0501083_0058798 3300049744 Bacteria 2572
590 Ga0501083_0071562 3300049744 Bacteria 2305
591 Ga0501083_0241352 3300049744 Bacteria 1176
592 Ga0501035_0016898 3300049822 Bacteria 6727
593 Ga0501035_0040812 3300049822 Bacteria 4192
594 Ga0501035_0094431 3300049822 Bacteria 2630
595 Ga0501044_0004609 3300049823 Bacteria 15418
596 Ga0501044_0030415 3300049823 Bacteria 5691
597 Ga0501044_0086053 3300049823 Bacteria 3176
598 Ga0501044_0594138 3300049823 Bacteria 1000
599 Ga0501045_0014635 3300049824 Bacteria 5562
600 Ga0501045_0374458 3300049824 Bacteria 1060
601 nmdc:mga03683_96864_c1 3300050489 Bacteria 1293
602 nmdc:mga03n38_55175_c1 3300050490 Bacteria 1789
603 nmdc:mga00v17_70140_c1 3300050491 Bacteria 2170
604 nmdc:mga0yw44_49170_c1 3300050492 Bacteria 2544
605 nmdc:mga0k408_145779_c1 3300050493 Bacteria 1409
606 nmdc:mga0k408_95583_c1 3300050493 Bacteria 1748
607 nmdc:mga06z11_9341_c1 3300050494 Bacteria 4129
608 nmdc:mga07m45_423703_c1 3300050496 Bacteria 772
609 nmdc:mga07m45_53357_c1 3300050496 Bacteria 2284
610 nmdc:mga05p37_19_c2 3300050507 Bacteria 99994
611 nmdc:mga05p37_397809_c1 3300050507 Bacteria 1609
612 nmdc:mga05p37_4690_c1 3300050507 Bacteria 15966
613 nmdc:mga05p37_714414_c1 3300050507 Bacteria 1111
614 nmdc:mga05p37_8335_c1 3300050507 Bacteria 12261
615 nmdc:mga09592_123530_c1 3300050508 Bacteria 2224
616 nmdc:mga09592_1297_c1 3300050508 Bacteria 20091
617 nmdc:mga0qj67_187623_c1 3300050509 Bacteria 1680
618 nmdc:mga0qj67_20786_c1 3300050509 Bacteria 5026
619 nmdc:mga0qj67_259_c1 3300050509 Bacteria 36242
620 nmdc:mga06r32_1133_c1 3300050510 Bacteria 23910
621 nmdc:mga06r32_20691_c1 3300050510 Bacteria 6061
622 nmdc:mga06r32_304636_c1 3300050510 Bacteria 1579
623 nmdc:mga08y16_221041_c1 3300050511 Bacteria 1961
624 nmdc:mga08y16_354_c1 3300050511 Bacteria 41427
625 nmdc:mga08y16_87928_c1 3300050511 Bacteria 3238
626 nmdc:mga08y16_917950_c1 3300050511 Bacteria 861
627 nmdc:mga0n895_114398_c1 3300050512 Bacteria 2716
628 nmdc:mga0n895_31979_c1 3300050512 Bacteria 5045
629 nmdc:mga0n895_58419_c1 3300050512 Bacteria 3803
630 nmdc:mga0n895_701_c1 3300050512 Bacteria 23539
631 nmdc:mga0rr50_10515_c1 3300050513 Bacteria 5875
632 nmdc:mga0rr50_35347_c1 3300050513 Bacteria 3588
633 nmdc:mga0a205_21253_c1 3300050515 Bacteria 6138
634 nmdc:mga0a205_249_c1 3300050515 Bacteria 38472
635 nmdc:mga0sz30_1915_c1 3300050516 Bacteria 7430
636 nmdc:mga0sz30_45391_c1 3300050516 Bacteria 1853
637 Ga0495601_0000011 3300053077 Bacteria 264937
638 Ga0495601_0015267 3300053077 Bacteria 4641
639 Ga0495601_0042986 3300053077 Bacteria 2837
640 Ga0495601_0065052 3300053077 Bacteria 2320
641 Ga0495601_0066178 3300053077 Bacteria 2300
642 Ga0495601_0085934 3300053077 Bacteria 2021
643 Ga0495612_0000006 3300053078 Bacteria 269278
644 Ga0495612_0000089 3300053078 Bacteria 40250
645 Ga0495612_0005230 3300053078 Bacteria 5360
646 Ga0495612_0043377 3300053078 Bacteria 1837
647 Ga0495612_0050167 3300053078 Bacteria 1713
648 Ga0495655_0002001 3300053083 Bacteria 3188
649 Ga0495595_0000021 3300053084 Bacteria 115921
650 Ga0495595_0018109 3300053084 Bacteria 3039
651 Ga0495595_0068379 3300053084 Bacteria 1675
652 Ga0495595_0223661 3300053084 Bacteria 939
653 Ga0495619_0000013 3300053085 Bacteria 264865
654 Ga0495619_0001549 3300053085 Bacteria 15135
655 Ga0495619_0020373 3300053085 Bacteria 4222
656 Ga0500646_0142164 3300053090 Bacteria 788
657 Ga0500583_0208224 3300053092 Bacteria 971
658 Ga0500651_0087411 3300053093 Bacteria 1924
659 Ga0500651_0117410 3300053093 Bacteria 1618
660 Ga0500641_0159619 3300053096 Bacteria 972
661 Ga0500555_020690 3300053103 Bacteria 1895
662 Ga0500562_027598 3300053108 Bacteria 1490
663 Ga0500593_002685 3300053117 Bacteria 6578
664 Ga0500594_0086433 3300053118 Bacteria 946
665 Ga0500642_0026283 3300053130 Bacteria 2375
666 Ga0500577_0236081 3300053142 Bacteria 793
667 Ga0500604_0113132 3300053151 Bacteria 902
668 Ga0500616_0002635 3300053153 Bacteria 14631
669 Ga0500620_129648 3300053155 Bacteria 883
670 Ga0500627_0060635 3300053158 Bacteria 1664
671 Ga0500611_043870 3300053727 Bacteria 995
672 Ga0501084_0030212 3300054114 Bacteria 4531
673 Ga0501084_0422951 3300054114 Bacteria 1126
674 Ga0501084_0488303 3300054114 Bacteria 1041
675 Ga0590071_058722 3300059421 Bacteria 938
676 Ga0587092_033054 3300059512 Bacteria 866
677 Ga0587106_020398 3300059605 Bacteria 978
678 Ga0587108_005203 3300059653 Bacteria 974
679 Ga0587111_0007632 3300060346 Bacteria 1764
680 Ga0501082_0043600 3300060353 Bacteria 3868
681 Ga0501082_0065082 3300060353 Bacteria 3139
682 Ga0501082_0249051 3300060353 Bacteria 1546
683 Ga0501082_0501108 3300060353 Bacteria 1061
684 Ga0530510_0031863 3300061734 Bacteria 3791

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005983 Ga0081540_1001109 Ga0081540_100110919 203
2 3300009148 Ga0105243_10798172 Ga0105243_107981721 207
3 3300026075 Ga0207708_10477546 Ga0207708_104775461 212
4 3300053103 Ga0500555_020690 Ga0500555_020690_374_1030 214
5 3300036647 Ga0316582_0062945 Ga0316582_0062945_1134_1823 223
6 3300004803 Ga0058862_12589958 Ga0058862_125899581 225
7 3300020077 Ga0206351_10671826 Ga0206351_106718261 225
8 3300053090 Ga0500646_0142164 Ga0500646_0142164_57_752 227
9 3300006048 Ga0075363_100015573 Ga0075363_1000155732 231
10 3300006178 Ga0075367_10093438 Ga0075367_100934382 231
11 3300006195 Ga0075366_10152062 Ga0075366_101520622 231
12 3300014326 Ga0157380_10316693 Ga0157380_103166932 231
13 3300027866 Ga0209813_10066764 Ga0209813_100667641 231
14 3300032168 Ga0316593_10186110 Ga0316593_101861101 231
15 3300033541 Ga0316596_1107409 Ga0316596_11074091 231
16 3300050490 nmdc:mga03n38_55175_c1 nmdc:mga03n38_55175_c1_726_1499 231
17 3300050493 nmdc:mga0k408_95583_c1 nmdc:mga0k408_95583_c1_675_1448 231
18 3300053108 Ga0500562_027598 Ga0500562_027598_254_994 231
19 3300005354 Ga0070675_100133330 Ga0070675_1001333301 232
20 3300005356 Ga0070674_100021767 Ga0070674_1000217673 232
21 3300005840 Ga0068870_10397914 Ga0068870_103979141 232
22 3300013308 Ga0157375_10071761 Ga0157375_100717616 232
23 3300025901 Ga0207688_10083701 Ga0207688_100837012 232
24 3300025926 Ga0207659_10288923 Ga0207659_102889232 232
25 3300025940 Ga0207691_10158744 Ga0207691_101587443 232
26 3300003760 Ga0055527_1000348 Ga0055527_100034813 233
27 3300003761 Ga0055535_1000137 Ga0055535_100013713 233
28 3300003763 Ga0055529_1005228 Ga0055529_10052282 233
29 3300005844 Ga0068862_100393608 Ga0068862_1003936082 233
30 3300025228 Ga0209672_100015 Ga0209672_100015397 233
31 3300025229 Ga0209147_100016 Ga0209147_10001666 233
32 3300025242 Ga0209258_100026 Ga0209258_100026397 233
33 3300025254 Ga0209148_1000952 Ga0209148_100095216 233
34 3300025272 Ga0209455_1000321 Ga0209455_100032114 233
35 3300025937 Ga0207669_10192897 Ga0207669_101928971 233
36 3300048910 Ga0496107_0283282 Ga0496107_0283282_105_920 234
37 3300050507 nmdc:mga05p37_4690_c1 nmdc:mga05p37_4690_c1_10938_11714 234
38 3300059653 Ga0587108_005203 Ga0587108_005203_172_912 234
39 3300003203 JGI25406J46586_10008857 JGI25406J46586_100088573 235
40 3300005295 Ga0065707_10217266 Ga0065707_102172662 235
41 3300005356 Ga0070674_100835671 Ga0070674_1008356711 235
42 3300005844 Ga0068862_100121391 Ga0068862_1001213912 235
43 3300005985 Ga0081539_10003227 Ga0081539_1000322717 235
44 3300025961 Ga0207712_10164602 Ga0207712_101646022 235
45 3300028380 Ga0268265_10357194 Ga0268265_103571942 235
46 3300031241 Ga0265325_10019267 Ga0265325_100192673 235
47 3300039437 Ga0436365_1410225 Ga0436365_1410225_1213_1923 235
48 3300041406 Ga0439439_0051495 Ga0439439_0051495_42_752 235
49 3300042532 Ga0450893_0013879 Ga0450893_0013879_341_1090 235
50 3300048090 Ga0495615_0049002 Ga0495615_0049002_132_842 235
51 3300059512 Ga0587092_033054 Ga0587092_033054_11_766 235
52 3300004798 Ga0058859_11740191 Ga0058859_117401911 236
53 3300004801 Ga0058860_12182228 Ga0058860_121822281 236
54 3300005354 Ga0070675_100026991 Ga0070675_1000269913 236
55 3300005355 Ga0070671_100005912 Ga0070671_10000591210 236
56 3300005364 Ga0070673_100083880 Ga0070673_1000838802 236
57 3300005367 Ga0070667_100330999 Ga0070667_1003309991 236
58 3300005434 Ga0070709_10039119 Ga0070709_100391191 236
59 3300005435 Ga0070714_100071523 Ga0070714_1000715232 236
60 3300005436 Ga0070713_100504625 Ga0070713_1005046251 236
61 3300005437 Ga0070710_10071096 Ga0070710_100710961 236
62 3300005439 Ga0070711_100141313 Ga0070711_1001413132 236
63 3300005564 Ga0070664_100075564 Ga0070664_1000755643 236
64 3300006028 Ga0070717_10079339 Ga0070717_100793392 236
65 3300006847 Ga0075431_100167999 Ga0075431_1001679992 236
66 3300009177 Ga0105248_10130763 Ga0105248_101307632 236
67 3300009551 Ga0105238_10457467 Ga0105238_104574671 236
68 3300013296 Ga0157374_10473994 Ga0157374_104739942 236
69 3300021384 Ga0213876_10005720 Ga0213876_100057206 236
70 3300025898 Ga0207692_10065966 Ga0207692_100659661 236
71 3300025906 Ga0207699_10050154 Ga0207699_100501542 236
72 3300025915 Ga0207693_10017643 Ga0207693_100176434 236
73 3300025925 Ga0207650_10003045 Ga0207650_100030453 236
74 3300025926 Ga0207659_10170772 Ga0207659_101707722 236
75 3300025927 Ga0207687_10175773 Ga0207687_101757733 236
76 3300025928 Ga0207700_10043617 Ga0207700_100436172 236
77 3300025931 Ga0207644_10003250 Ga0207644_100032505 236
78 3300025933 Ga0207706_10575797 Ga0207706_105757971 236
79 3300025940 Ga0207691_10131990 Ga0207691_101319902 236
80 3300025945 Ga0207679_10063581 Ga0207679_100635814 236
81 3300025960 Ga0207651_10000859 Ga0207651_100008595 236
82 3300025986 Ga0207658_10062401 Ga0207658_100624012 236
83 3300026121 Ga0207683_10121660 Ga0207683_101216602 236
84 3300028381 Ga0268264_11084638 Ga0268264_110846381 236
85 3300028573 Ga0265334_10001877 Ga0265334_100018776 236
86 3300039437 Ga0436365_1855567 Ga0436365_1855567_6513_7283 236
87 3300048903 Ga0496100_0007708 Ga0496100_0007708_585_1352 236
88 3300048904 Ga0496101_0368609 Ga0496101_0368609_321_1088 236
89 3300048908 Ga0496105_0246905 Ga0496105_0246905_164_931 236
90 3300048912 Ga0496109_0070082 Ga0496109_0070082_2213_2980 236
91 3300048913 Ga0496110_0050779 Ga0496110_0050779_499_1266 236
92 3300048915 Ga0496112_0250944 Ga0496112_0250944_481_1248 236
93 3300048916 Ga0496113_0043582 Ga0496113_0043582_1373_2140 236
94 3300048918 Ga0496115_0190556 Ga0496115_0190556_259_1026 236
95 3300050510 nmdc:mga06r32_20691_c1 nmdc:mga06r32_20691_c1_1173_1961 236
96 3300006844 Ga0075428_100111881 Ga0075428_1001118815 237
97 3300009148 Ga0105243_10622346 Ga0105243_106223461 237
98 3300031238 Ga0265332_10007464 Ga0265332_100074642 237
99 3300031247 Ga0265340_10073607 Ga0265340_100736071 237
100 3300031249 Ga0265339_10019847 Ga0265339_100198473 237
101 3300031250 Ga0265331_10029658 Ga0265331_100296585 237
102 3300031712 Ga0265342_10000034 Ga0265342_10000034131 237
103 3300031730 Ga0307516_10205444 Ga0307516_102054441 237
104 3300042003 Ga0439443_011511 Ga0439443_011511_161_880 237
105 3300045976 Ga0466967_0081276 Ga0466967_0081276_766_1536 237
106 3300003762 Ga0055542_1008635 Ga0055542_10086351 238
107 3300003763 Ga0055529_1012897 Ga0055529_10128971 238
108 3300005347 Ga0070668_100136068 Ga0070668_1001360681 238
109 3300005353 Ga0070669_100100970 Ga0070669_1001009702 238
110 3300005843 Ga0068860_100351676 Ga0068860_1003516762 238
111 3300009553 Ga0105249_10282604 Ga0105249_102826043 238
112 3300024227 Ga0228598_1013306 Ga0228598_10133062 238
113 3300025254 Ga0209148_1006961 Ga0209148_10069611 238
114 3300025272 Ga0209455_1000544 Ga0209455_100054412 238
115 3300025923 Ga0207681_10091132 Ga0207681_100911323 238
116 3300025926 Ga0207659_10510969 Ga0207659_105109691 238
117 3300025932 Ga0207690_10140463 Ga0207690_101404632 238
118 3300025972 Ga0207668_10093724 Ga0207668_100937243 238
119 3300027907 Ga0207428_10154679 Ga0207428_101546791 238
120 3300028381 Ga0268264_10411625 Ga0268264_104116252 238
121 3300031241 Ga0265325_10005464 Ga0265325_100054646 238
122 3300031595 Ga0265313_10009618 Ga0265313_100096185 238
123 3300035117 Ga0373953_0052158 Ga0373953_0052158_490_1248 238
124 3300035119 Ga0373956_0015215 Ga0373956_0015215_1639_2397 238
125 3300035171 Ga0373946_0101768 Ga0373946_0101768_346_1104 238
126 3300035695 Ga0373927_0114613 Ga0373927_0114613_15_773 238
127 3300035724 Ga0373933_0004896 Ga0373933_0004896_5500_6258 238
128 3300035725 Ga0373947_0207074 Ga0373947_0207074_40_798 238
129 3300036401 Ga0373937_0043108 Ga0373937_0043108_2704_3462 238
130 3300037068 Ga0373925_0012867 Ga0373925_0012867_3694_4452 238
131 3300041458 Ga0451798_0309505 Ga0451798_0309505_186_920 238
132 3300046454 Ga0495592_0001796 Ga0495592_0001796_3885_4643 238
133 3300046463 Ga0495653_0385847 Ga0495653_0385847_38_796 238
134 3300046516 Ga0495628_0003849 Ga0495628_0003849_11186_11944 238
135 3300046529 Ga0495652_0006346 Ga0495652_0006346_4327_5085 238
136 3300046533 Ga0495640_0156194 Ga0495640_0156194_377_1135 238
137 3300046536 Ga0495587_0035484 Ga0495587_0035484_2222_2980 238
138 3300046543 Ga0495645_0001074 Ga0495645_0001074_653_1411 238
139 3300046559 Ga0495667_0014158 Ga0495667_0014158_649_1407 238
140 3300046675 Ga0495657_0140535 Ga0495657_0140535_289_1047 238
141 3300046678 Ga0495599_0012323 Ga0495599_0012323_277_1035 238
142 3300047317 Ga0495604_0058002 Ga0495604_0058002_1654_2412 238
143 3300047322 Ga0495680_0011330 Ga0495680_0011330_1854_2612 238
144 3300048088 Ga0495602_0014374 Ga0495602_0014374_4232_4990 238
145 3300048909 Ga0496106_0385086 Ga0496106_0385086_97_867 238
146 3300050511 nmdc:mga08y16_221041_c1 nmdc:mga08y16_221041_c1_115_912 238
147 3300053077 Ga0495601_0042986 Ga0495601_0042986_564_1322 238
148 3300053078 Ga0495612_0000089 Ga0495612_0000089_14181_14939 238
149 3300053084 Ga0495595_0018109 Ga0495595_0018109_1168_1926 238
150 3300053085 Ga0495619_0001549 Ga0495619_0001549_8333_9091 238
151 3300060346 Ga0587111_0007632 Ga0587111_0007632_708_1448 238
152 3300035111 Ga0373923_0038540 Ga0373923_0038540_301_1059 239
153 3300035119 Ga0373956_0034655 Ga0373956_0034655_1075_1833 239
154 3300035120 Ga0373957_0001446 Ga0373957_0001446_3938_4696 239
155 3300035172 Ga0373955_0000310 Ga0373955_0000310_17181_17939 239
156 3300035724 Ga0373933_0000315 Ga0373933_0000315_21817_22575 239
157 3300036401 Ga0373937_0050476 Ga0373937_0050476_2280_3038 239
158 3300036401 Ga0373937_0057234 Ga0373937_0057234_405_1163 239
159 3300046462 Ga0495651_0054550 Ga0495651_0054550_2100_2858 239
160 3300047317 Ga0495604_0092509 Ga0495604_0092509_1211_1969 239
161 3300047322 Ga0495680_0040789 Ga0495680_0040789_931_1689 239
162 3300048088 Ga0495602_0282037 Ga0495602_0282037_200_958 239
163 3300053077 Ga0495601_0066178 Ga0495601_0066178_403_1161 239
164 3300053078 Ga0495612_0005230 Ga0495612_0005230_210_968 239
165 3300053084 Ga0495595_0068379 Ga0495595_0068379_614_1372 239
166 3300005445 Ga0070708_100084345 Ga0070708_1000843453 240
167 3300005518 Ga0070699_100309949 Ga0070699_1003099492 240
168 3300005981 Ga0081538_10124878 Ga0081538_101248782 240
169 3300020070 Ga0206356_11190054 Ga0206356_111900541 240
170 3300049822 Ga0501035_0094431 Ga0501035_0094431_1289_2134 240
171 3300049823 Ga0501044_0004609 Ga0501044_0004609_7124_7969 240
172 3300005340 Ga0070689_100243052 Ga0070689_1002430522 241
173 3300006038 Ga0075365_10053864 Ga0075365_100538642 241
174 3300006038 Ga0075365_10098968 Ga0075365_100989683 241
175 3300006178 Ga0075367_10232165 Ga0075367_102321652 241
176 3300006186 Ga0075369_10069978 Ga0075369_100699783 241
177 3300006353 Ga0075370_10046449 Ga0075370_100464493 241
178 3300010159 Ga0099796_10116269 Ga0099796_101162691 241
179 3300026118 Ga0207675_100294924 Ga0207675_1002949242 241
180 3300031731 Ga0307405_10308451 Ga0307405_103084512 241
181 3300031824 Ga0307413_10413909 Ga0307413_104139091 241
182 3300037853 Ga0436364_0548592 Ga0436364_0548592_59_787 241
183 3300042157 Ga0439458_0053291 Ga0439458_0053291_164_913 241
184 3300042439 Ga0439464_0025326 Ga0439464_0025326_477_1226 241
185 3300046681 Ga0495647_0080003 Ga0495647_0080003_375_1124 241
186 3300046683 Ga0495658_0137699 Ga0495658_0137699_69_830 241
187 3300048929 Ga0496126_0015811 Ga0496126_0015811_6185_7063 241
188 3300048929 Ga0496126_0042509 Ga0496126_0042509_997_1746 241
189 3300050489 nmdc:mga03683_96864_c1 nmdc:mga03683_96864_c1_450_1199 241
190 3300050493 nmdc:mga0k408_145779_c1 nmdc:mga0k408_145779_c1_568_1314 241
191 3300050494 nmdc:mga06z11_9341_c1 nmdc:mga06z11_9341_c1_2142_2888 241
192 3300050496 nmdc:mga07m45_423703_c1 nmdc:mga07m45_423703_c1_12_761 241
193 3300050516 nmdc:mga0sz30_1915_c1 nmdc:mga0sz30_1915_c1_3640_4386 241
194 3300053093 Ga0500651_0117410 Ga0500651_0117410_454_1203 241
195 3300053153 Ga0500616_0002635 Ga0500616_0002635_9850_10596 241
196 3300053155 Ga0500620_129648 Ga0500620_129648_98_844 241
197 3300006871 Ga0075434_100705248 Ga0075434_1007052481 242
198 3300007076 Ga0075435_100035256 Ga0075435_1000352562 242
199 3300007788 Ga0099795_10016161 Ga0099795_100161612 242
200 3300010159 Ga0099796_10022382 Ga0099796_100223821 242
201 3300027512 Ga0209179_1004914 Ga0209179_10049141 242
202 3300027671 Ga0209588_1031078 Ga0209588_10310781 242
203 3300035170 Ga0373943_0035254 Ga0373943_0035254_676_1509 242
204 3300035398 Ga0316574_0000145 Ga0316574_0000145_2709_3440 242
205 3300036712 Ga0316584_0043408 Ga0316584_0043408_583_1314 242
206 3300037853 Ga0436364_1214892 Ga0436364_1214892_246_977 242
207 3300050512 nmdc:mga0n895_114398_c1 nmdc:mga0n895_114398_c1_1147_1881 242
208 3300013104 Ga0157370_10471142 Ga0157370_104711421 243
209 3300031344 Ga0265316_10016618 Ga0265316_100166189 243
210 3300031711 Ga0265314_10144700 Ga0265314_101447002 243
211 3300044719 Ga0466971_0078114 Ga0466971_0078114_360_1121 243
212 3300007265 Ga0099794_10023255 Ga0099794_100232551 244
213 3300049578 Ga0501042_0102050 Ga0501042_0102050_1089_1862 244
214 3300049580 Ga0501046_0314087 Ga0501046_0314087_57_827 244
215 3300049581 Ga0501047_0352092 Ga0501047_0352092_11_781 244
216 3300049584 Ga0501068_0109336 Ga0501068_0109336_817_1590 244
217 3300049587 Ga0501071_0012141 Ga0501071_0012141_4017_4790 244
218 3300049588 Ga0501072_0004379 Ga0501072_0004379_3920_4693 244
219 3300049591 Ga0501075_0027955 Ga0501075_0027955_1820_2593 244
220 3300049593 Ga0501077_0037268 Ga0501077_0037268_149_922 244
221 3300049741 Ga0501079_0114417 Ga0501079_0114417_173_946 244
222 3300049742 Ga0501080_0129312 Ga0501080_0129312_981_1754 244
223 3300049743 Ga0501081_0120944 Ga0501081_0120944_957_1730 244
224 3300060353 Ga0501082_0501108 Ga0501082_0501108_52_798 244
225 3300061734 Ga0530510_0031863 Ga0530510_0031863_2989_3762 244
226 3300049571 Ga0501034_0487980 Ga0501034_0487980_346_1104 245
227 3300049583 Ga0501067_0032125 Ga0501067_0032125_2007_2762 245
228 3300049589 Ga0501073_0059989 Ga0501073_0059989_1505_2260 245
229 3300049590 Ga0501074_0115632 Ga0501074_0115632_803_1558 245
230 3300049592 Ga0501076_0474424 Ga0501076_0474424_22_774 245
231 3300049744 Ga0501083_0071562 Ga0501083_0071562_1311_2066 245
232 3300060353 Ga0501082_0249051 Ga0501082_0249051_328_1083 245
233 3300048903 Ga0496100_0158715 Ga0496100_0158715_636_1391 246
234 3300006195 Ga0075366_10010635 Ga0075366_100106355 248
235 3300006353 Ga0075370_10294985 Ga0075370_102949851 248
236 3300003215 JGI25153J46596_10001402 JGI25153J46596_100014023 249
237 3300003215 JGI25153J46596_10004909 JGI25153J46596_100049093 249
238 3300025297 Ga0209758_1000469 Ga0209758_100046925 249
239 3300028577 Ga0265318_10008385 Ga0265318_100083854 249
240 3300031241 Ga0265325_10004291 Ga0265325_100042919 249
241 3300031247 Ga0265340_10006803 Ga0265340_100068033 249
242 3300031250 Ga0265331_10044220 Ga0265331_100442203 249
243 3300031344 Ga0265316_10246298 Ga0265316_102462982 249
244 3300031595 Ga0265313_10016449 Ga0265313_100164495 249
245 3300031712 Ga0265342_10012408 Ga0265342_100124086 249
246 3300049588 Ga0501072_0210737 Ga0501072_0210737_115_867 249
247 3300049593 Ga0501077_0013421 Ga0501077_0013421_3936_4706 249
248 3300049742 Ga0501080_0259571 Ga0501080_0259571_472_1224 249
249 3300049744 Ga0501083_0033311 Ga0501083_0033311_2552_3304 249
250 3300053092 Ga0500583_0208224 Ga0500583_0208224_50_820 249
251 3300054114 Ga0501084_0422951 Ga0501084_0422951_101_853 249
252 3300059605 Ga0587106_020398 Ga0587106_020398_128_895 249
253 3300060353 Ga0501082_0065082 Ga0501082_0065082_2104_2856 249
254 3300005434 Ga0070709_10177453 Ga0070709_101774532 250
255 3300005435 Ga0070714_100226570 Ga0070714_1002265703 250
256 3300005458 Ga0070681_10059291 Ga0070681_100592911 250
257 3300005530 Ga0070679_100048126 Ga0070679_1000481263 250
258 3300006042 Ga0075368_10085825 Ga0075368_100858251 250
259 3300006163 Ga0070715_10172002 Ga0070715_101720021 250
260 3300006186 Ga0075369_10202646 Ga0075369_102026461 250
261 3300006844 Ga0075428_100058970 Ga0075428_1000589705 250
262 3300006880 Ga0075429_100007528 Ga0075429_1000075283 250
263 3300025297 Ga0209758_1088120 Ga0209758_10881201 250
264 3300025898 Ga0207692_10073172 Ga0207692_100731722 250
265 3300025905 Ga0207685_10153223 Ga0207685_101532231 250
266 3300025917 Ga0207660_10084805 Ga0207660_100848053 250
267 3300025921 Ga0207652_10631978 Ga0207652_106319781 250
268 3300025929 Ga0207664_10597058 Ga0207664_105970581 250
269 3300025939 Ga0207665_10234830 Ga0207665_102348301 250
270 3300027907 Ga0207428_10449065 Ga0207428_104490651 250
271 3300031235 Ga0265330_10009843 Ga0265330_100098433 250
272 3300031241 Ga0265325_10016732 Ga0265325_100167322 250
273 3300035119 Ga0373956_0123417 Ga0373956_0123417_323_1078 250
274 3300035170 Ga0373943_0006511 Ga0373943_0006511_4477_5232 250
275 3300035171 Ga0373946_0024272 Ga0373946_0024272_1605_2360 250
276 3300035172 Ga0373955_0004242 Ga0373955_0004242_1316_2071 250
277 3300035695 Ga0373927_0022396 Ga0373927_0022396_2299_3054 250
278 3300035724 Ga0373933_0068023 Ga0373933_0068023_297_1052 250
279 3300036401 Ga0373937_0041506 Ga0373937_0041506_516_1271 250
280 3300039437 Ga0436365_1910356 Ga0436365_1910356_927_1679 250
281 3300042125 Ga0450923_013571 Ga0450923_013571_382_1140 250
282 3300046458 Ga0495591_057922 Ga0495591_057922_197_952 250
283 3300046459 Ga0495629_0040146 Ga0495629_0040146_1236_1991 250
284 3300046461 Ga0495641_0025187 Ga0495641_0025187_310_1065 250
285 3300046463 Ga0495653_0000987 Ga0495653_0000987_122_877 250
286 3300046473 Ga0495582_0069408 Ga0495582_0069408_81_836 250
287 3300046475 Ga0495639_0018119 Ga0495639_0018119_1443_2198 250
288 3300046477 Ga0495664_0046218 Ga0495664_0046218_1730_2485 250
289 3300046492 Ga0495585_0000389 Ga0495585_0000389_31535_32290 250
290 3300046516 Ga0495628_0054508 Ga0495628_0054508_2207_2962 250
291 3300046517 Ga0495630_0051135 Ga0495630_0051135_1408_2163 250
292 3300046520 Ga0495637_0154191 Ga0495637_0154191_16_771 250
293 3300046523 Ga0495644_0000373 Ga0495644_0000373_9654_10409 250
294 3300046526 Ga0495666_0033440 Ga0495666_0033440_1445_2200 250
295 3300046531 Ga0495665_0151267 Ga0495665_0151267_272_1027 250
296 3300046533 Ga0495640_0048679 Ga0495640_0048679_1087_1842 250
297 3300046535 Ga0495586_0312196 Ga0495586_0312196_16_771 250
298 3300046536 Ga0495587_0121730 Ga0495587_0121730_573_1328 250
299 3300046537 Ga0495598_0087651 Ga0495598_0087651_170_925 250
300 3300046558 Ga0495633_0006655 Ga0495633_0006655_555_1310 250
301 3300046559 Ga0495667_0004405 Ga0495667_0004405_2279_3034 250
302 3300046615 Ga0495656_0002104 Ga0495656_0002104_388_1143 250
303 3300046642 Ga0495634_0037227 Ga0495634_0037227_1703_2458 250
304 3300046664 Ga0495659_0003751 Ga0495659_0003751_3750_4505 250
305 3300046674 Ga0495588_0015269 Ga0495588_0015269_1431_2186 250
306 3300046681 Ga0495647_0101405 Ga0495647_0101405_312_1067 250
307 3300046683 Ga0495658_0024037 Ga0495658_0024037_2199_2954 250
308 3300046689 Ga0495613_0011807 Ga0495613_0011807_3256_4011 250
309 3300046690 Ga0495624_0018068 Ga0495624_0018068_1550_2305 250
310 3300046691 Ga0495670_0000106 Ga0495670_0000106_27654_28409 250
311 3300046809 Ga0495600_0000293 Ga0495600_0000293_23413_24168 250
312 3300047315 Ga0495581_0030496 Ga0495581_0030496_111_866 250
313 3300047317 Ga0495604_0021273 Ga0495604_0021273_2931_3686 250
314 3300047319 Ga0495674_0056041 Ga0495674_0056041_868_1623 250
315 3300047321 Ga0495676_0077187 Ga0495676_0077187_57_812 250
316 3300047322 Ga0495680_0079071 Ga0495680_0079071_868_1623 250
317 3300047446 Ga0495679_044624 Ga0495679_044624_383_1138 250
318 3300047471 Ga0495684_0117918 Ga0495684_0117918_506_1261 250
319 3300047673 Ga0495593_0040640 Ga0495593_0040640_1343_2098 250
320 3300048089 Ga0495614_0005015 Ga0495614_0005015_1263_2018 250
321 3300048915 Ga0496112_0051251 Ga0496112_0051251_2423_3178 250
322 3300049581 Ga0501047_0559659 Ga0501047_0559659_104_859 250
323 3300049592 Ga0501076_0397553 Ga0501076_0397553_184_939 250
324 3300050508 nmdc:mga09592_123530_c1 nmdc:mga09592_123530_c1_680_1435 250
325 3300050511 nmdc:mga08y16_917950_c1 nmdc:mga08y16_917950_c1_45_803 250
326 3300050516 nmdc:mga0sz30_45391_c1 nmdc:mga0sz30_45391_c1_519_1277 250
327 3300053077 Ga0495601_0085934 Ga0495601_0085934_865_1620 250
328 3300053078 Ga0495612_0050167 Ga0495612_0050167_296_1051 250
329 3300053085 Ga0495619_0020373 Ga0495619_0020373_1213_1968 250
330 3300053130 Ga0500642_0026283 Ga0500642_0026283_667_1425 250
331 iso_pu_bacteria 2643221547 2643758246 250
332 3300005438 Ga0070701_10495026 Ga0070701_104950261 251
333 3300005530 Ga0070679_100218279 Ga0070679_1002182792 251
334 3300006194 Ga0075427_10000389 Ga0075427_100003894 251
335 3300006844 Ga0075428_100007998 Ga0075428_1000079983 251
336 3300006846 Ga0075430_100000032 Ga0075430_10000003215 251
337 3300006847 Ga0075431_100000903 Ga0075431_10000090320 251
338 3300006852 Ga0075433_10019599 Ga0075433_100195993 251
339 3300006871 Ga0075434_100000271 Ga0075434_10000027134 251
340 3300006880 Ga0075429_100000561 Ga0075429_10000056124 251
341 3300007076 Ga0075435_100049397 Ga0075435_1000493974 251
342 3300009094 Ga0111539_10001270 Ga0111539_1000127026 251
343 3300009094 Ga0111539_10230550 Ga0111539_102305502 251
344 3300009147 Ga0114129_10395943 Ga0114129_103959432 251
345 3300013104 Ga0157370_10057496 Ga0157370_100574962 251
346 3300013308 Ga0157375_11151307 Ga0157375_111513071 251
347 3300020069 Ga0197907_10241108 Ga0197907_102411081 251
348 3300020069 Ga0197907_11149821 Ga0197907_111498211 251
349 3300020076 Ga0206355_1367406 Ga0206355_13674062 251
350 3300020078 Ga0206352_10130377 Ga0206352_101303771 251
351 3300020080 Ga0206350_10136915 Ga0206350_101369151 251
352 3300020081 Ga0206354_10364600 Ga0206354_103646001 251
353 3300020082 Ga0206353_10830196 Ga0206353_108301961 251
354 3300021377 Ga0213874_10073401 Ga0213874_100734011 251
355 3300021441 Ga0213871_10042533 Ga0213871_100425332 251
356 3300022467 Ga0224712_10182174 Ga0224712_101821741 251
357 3300025907 Ga0207645_10111527 Ga0207645_101115271 251
358 3300025912 Ga0207707_10116011 Ga0207707_101160111 251
359 3300025920 Ga0207649_10328407 Ga0207649_103284072 251
360 3300025921 Ga0207652_10248325 Ga0207652_102483252 251
361 3300026075 Ga0207708_10451360 Ga0207708_104513601 251
362 3300027907 Ga0207428_10000082 Ga0207428_1000008270 251
363 3300031247 Ga0265340_10042659 Ga0265340_100426592 251
364 3300031456 Ga0307513_10012476 Ga0307513_100124763 251
365 3300031665 Ga0316575_10040077 Ga0316575_100400772 251
366 3300031727 Ga0316576_10252323 Ga0316576_102523232 251
367 3300032002 Ga0307416_100962018 Ga0307416_1009620181 251
368 3300032133 Ga0316583_10002336 Ga0316583_100023361 251
369 3300032133 Ga0316583_10034329 Ga0316583_100343291 251
370 3300033524 Ga0316592_1067264 Ga0316592_10672641 251
371 3300033529 Ga0316587_1035520 Ga0316587_10355201 251
372 3300033541 Ga0316596_1087836 Ga0316596_10878361 251
373 3300035111 Ga0373923_0213495 Ga0373923_0213495_92_850 251
374 3300035117 Ga0373953_0147965 Ga0373953_0147965_65_823 251
375 3300035692 Ga0373935_0117456 Ga0373935_0117456_684_1442 251
376 3300035695 Ga0373927_0053021 Ga0373927_0053021_338_1096 251
377 3300036401 Ga0373937_0145718 Ga0373937_0145718_30_791 251
378 3300036401 Ga0373937_0339950 Ga0373937_0339950_520_1278 251
379 3300037312 Ga0395899_0013258 Ga0395899_0013258_2166_2924 251
380 3300037466 Ga0395898_0104572 Ga0395898_0104572_1375_2133 251
381 3300038443 Ga0395901_0111981 Ga0395901_0111981_720_1478 251
382 3300038443 Ga0395901_0320363 Ga0395901_0320363_63_860 251
383 3300038443 Ga0395901_0441559 Ga0395901_0441559_313_1110 251
384 3300039438 Ga0436360_0832565 Ga0436360_0832565_3648_4409 251
385 3300039447 Ga0436361_0360492 Ga0436361_0360492_98_859 251
386 3300039450 Ga0436363_1307539 Ga0436363_1307539_435_1196 251
387 3300041408 Ga0439453_0041658 Ga0439453_0041658_14_772 251
388 3300046462 Ga0495651_0107774 Ga0495651_0107774_974_1732 251
389 3300046477 Ga0495664_0196334 Ga0495664_0196334_432_1190 251
390 3300046516 Ga0495628_0243599 Ga0495628_0243599_356_1114 251
391 3300046529 Ga0495652_0439637 Ga0495652_0439637_68_826 251
392 3300046533 Ga0495640_0332859 Ga0495640_0332859_21_782 251
393 3300046536 Ga0495587_0233941 Ga0495587_0233941_167_925 251
394 3300046543 Ga0495645_0268809 Ga0495645_0268809_193_951 251
395 3300046559 Ga0495667_0242628 Ga0495667_0242628_274_1032 251
396 3300046642 Ga0495634_0265951 Ga0495634_0265951_15_773 251
397 3300046678 Ga0495599_0203610 Ga0495599_0203610_325_1083 251
398 3300047317 Ga0495604_0239232 Ga0495604_0239232_416_1174 251
399 3300047319 Ga0495674_0383770 Ga0495674_0383770_127_885 251
400 3300048088 Ga0495602_0108292 Ga0495602_0108292_530_1288 251
401 3300048089 Ga0495614_0076720 Ga0495614_0076720_297_1055 251
402 3300048904 Ga0496101_0610585 Ga0496101_0610585_28_789 251
403 3300048907 Ga0496104_0124558 Ga0496104_0124558_876_1637 251
404 3300048910 Ga0496107_0394978 Ga0496107_0394978_139_900 251
405 3300048915 Ga0496112_0397824 Ga0496112_0397824_53_814 251
406 3300048917 Ga0496114_0068181 Ga0496114_0068181_835_1596 251
407 3300048917 Ga0496114_0109828 Ga0496114_0109828_1352_2113 251
408 3300049568 Ga0501031_0002913 Ga0501031_0002913_7258_8016 251
409 3300049569 Ga0501032_0001960 Ga0501032_0001960_11542_12300 251
410 3300049570 Ga0501033_0021483 Ga0501033_0021483_615_1373 251
411 3300049571 Ga0501034_0003727 Ga0501034_0003727_11672_12430 251
412 3300049572 Ga0501036_0015848 Ga0501036_0015848_933_1691 251
413 3300049573 Ga0501037_0010686 Ga0501037_0010686_3503_4261 251
414 3300049573 Ga0501037_0287712 Ga0501037_0287712_357_1115 251
415 3300049574 Ga0501038_0008913 Ga0501038_0008913_7429_8187 251
416 3300049575 Ga0501039_0001032 Ga0501039_0001032_2918_3676 251
417 3300049579 Ga0501043_0022908 Ga0501043_0022908_615_1373 251
418 3300049579 Ga0501043_0328019 Ga0501043_0328019_84_842 251
419 3300049580 Ga0501046_0000897 Ga0501046_0000897_27241_27999 251
420 3300049581 Ga0501047_0023976 Ga0501047_0023976_1577_2335 251
421 3300049581 Ga0501047_0091531 Ga0501047_0091531_353_1111 251
422 3300049582 Ga0501048_0006504 Ga0501048_0006504_3701_4459 251
423 3300049584 Ga0501068_0001271 Ga0501068_0001271_829_1587 251
424 3300049585 Ga0501069_0000490 Ga0501069_0000490_12927_13685 251
425 3300049586 Ga0501070_0012403 Ga0501070_0012403_5914_6672 251
426 3300049586 Ga0501070_0023540 Ga0501070_0023540_83_841 251
427 3300049587 Ga0501071_0169366 Ga0501071_0169366_617_1375 251
428 3300049589 Ga0501073_0001330 Ga0501073_0001330_1449_2207 251
429 3300049590 Ga0501074_0001714 Ga0501074_0001714_11947_12705 251
430 3300049741 Ga0501079_0017343 Ga0501079_0017343_3884_4642 251
431 3300049742 Ga0501080_0005290 Ga0501080_0005290_3378_4136 251
432 3300049742 Ga0501080_0049606 Ga0501080_0049606_2848_3609 251
433 3300049744 Ga0501083_0006952 Ga0501083_0006952_6863_7621 251
434 3300049744 Ga0501083_0058798 Ga0501083_0058798_1076_1852 251
435 3300049822 Ga0501035_0016898 Ga0501035_0016898_615_1373 251
436 3300049823 Ga0501044_0030415 Ga0501044_0030415_4319_5077 251
437 3300049823 Ga0501044_0086053 Ga0501044_0086053_57_815 251
438 3300049824 Ga0501045_0014635 Ga0501045_0014635_3994_4752 251
439 3300050507 nmdc:mga05p37_19_c2 nmdc:mga05p37_19_c2_65642_66418 251
440 3300050507 nmdc:mga05p37_714414_c1 nmdc:mga05p37_714414_c1_28_786 251
441 3300050508 nmdc:mga09592_1297_c1 nmdc:mga09592_1297_c1_2562_3338 251
442 3300050509 nmdc:mga0qj67_259_c1 nmdc:mga0qj67_259_c1_1979_2755 251
443 3300050510 nmdc:mga06r32_1133_c1 nmdc:mga06r32_1133_c1_16754_17530 251
444 3300050511 nmdc:mga08y16_354_c1 nmdc:mga08y16_354_c1_11523_12299 251
445 3300050512 nmdc:mga0n895_701_c1 nmdc:mga0n895_701_c1_15172_15948 251
446 3300050513 nmdc:mga0rr50_35347_c1 nmdc:mga0rr50_35347_c1_396_1172 251
447 3300050515 nmdc:mga0a205_249_c1 nmdc:mga0a205_249_c1_4209_4985 251
448 3300053077 Ga0495601_0065052 Ga0495601_0065052_322_1080 251
449 3300053083 Ga0495655_0002001 Ga0495655_0002001_298_1056 251
450 3300053084 Ga0495595_0223661 Ga0495595_0223661_81_839 251
451 3300053093 Ga0500651_0087411 Ga0500651_0087411_311_1084 251
452 3300053117 Ga0500593_002685 Ga0500593_002685_3032_3790 251
453 3300054114 Ga0501084_0488303 Ga0501084_0488303_35_793 251
454 3300060353 Ga0501082_0043600 Ga0501082_0043600_615_1373 251
455 3300004803 Ga0058862_12880575 Ga0058862_128805751 252
456 3300005334 Ga0068869_100257574 Ga0068869_1002575741 252
457 3300006028 Ga0070717_10514261 Ga0070717_105142611 252
458 3300006051 Ga0075364_10016731 Ga0075364_100167313 252
459 3300006178 Ga0075367_10229203 Ga0075367_102292032 252
460 3300006186 Ga0075369_10028288 Ga0075369_100282881 252
461 3300006353 Ga0075370_10012948 Ga0075370_100129483 252
462 3300009101 Ga0105247_10345618 Ga0105247_103456181 252
463 3300019183 Ga0184601_134529 Ga0184601_1345291 252
464 3300025942 Ga0207689_10231147 Ga0207689_102311472 252
465 3300035692 Ga0373935_0210499 Ga0373935_0210499_374_1135 252
466 3300035695 Ga0373927_0018445 Ga0373927_0018445_1949_2710 252
467 3300035725 Ga0373947_0027350 Ga0373947_0027350_2031_2792 252
468 3300036457 Ga0265778_019593 Ga0265778_019593_13_774 252
469 3300039437 Ga0436365_1890998 Ga0436365_1890998_2778_3539 252
470 3300039438 Ga0436360_0440024 Ga0436360_0440024_291_1067 252
471 3300039450 Ga0436363_0611312 Ga0436363_0611312_66_830 252
472 3300039453 Ga0436362_0343721 Ga0436362_0343721_724_1500 252
473 3300047319 Ga0495674_0136213 Ga0495674_0136213_1181_1942 252
474 3300048903 Ga0496100_0100101 Ga0496100_0100101_1195_1956 252
475 3300048907 Ga0496104_0006199 Ga0496104_0006199_1500_2261 252
476 3300048909 Ga0496106_0444866 Ga0496106_0444866_193_954 252
477 3300048917 Ga0496114_0083899 Ga0496114_0083899_1887_2648 252
478 3300048918 Ga0496115_0121428 Ga0496115_0121428_1156_1917 252
479 3300049569 Ga0501032_0129048 Ga0501032_0129048_709_1470 252
480 3300049570 Ga0501033_0014226 Ga0501033_0014226_1796_2557 252
481 3300049574 Ga0501038_0205971 Ga0501038_0205971_360_1121 252
482 3300049579 Ga0501043_0047745 Ga0501043_0047745_1768_2529 252
483 3300049581 Ga0501047_0036900 Ga0501047_0036900_919_1680 252
484 3300049586 Ga0501070_0067905 Ga0501070_0067905_1259_2020 252
485 3300049822 Ga0501035_0040812 Ga0501035_0040812_2531_3292 252
486 3300049823 Ga0501044_0594138 Ga0501044_0594138_33_794 252
487 3300050491 nmdc:mga00v17_70140_c1 nmdc:mga00v17_70140_c1_533_1294 252
488 3300050496 nmdc:mga07m45_53357_c1 nmdc:mga07m45_53357_c1_276_1037 252
489 3300053118 Ga0500594_0086433 Ga0500594_0086433_11_772 252
490 3300053142 Ga0500577_0236081 Ga0500577_0236081_22_783 252
491 3300059421 Ga0590071_058722 Ga0590071_058722_141_902 252
492 3300020077 Ga0206351_10851183 Ga0206351_108511831 253
493 3300031241 Ga0265325_10002531 Ga0265325_100025316 253
494 3300031595 Ga0265313_10000593 Ga0265313_100005935 253
495 3300039450 Ga0436363_1081647 Ga0436363_1081647_1652_2416 253
496 3300005545 Ga0070695_100249106 Ga0070695_1002491062 254
497 3300009147 Ga0114129_10001444 Ga0114129_1000144415 254
498 3300009551 Ga0105238_10122440 Ga0105238_101224401 254
499 3300013104 Ga0157370_10191953 Ga0157370_101919532 254
500 3300024225 Ga0224572_1031817 Ga0224572_10318171 254
501 3300025911 Ga0207654_10369880 Ga0207654_103698801 254
502 3300025928 Ga0207700_10106049 Ga0207700_101060492 254
503 3300028800 Ga0265338_10068313 Ga0265338_100683132 254
504 3300028800 Ga0265338_10081565 Ga0265338_100815651 254
505 3300031241 Ga0265325_10033863 Ga0265325_100338632 254
506 3300031247 Ga0265340_10010861 Ga0265340_100108614 254
507 3300031249 Ga0265339_10000126 Ga0265339_1000012658 254
508 3300031595 Ga0265313_10000054 Ga0265313_100000548 254
509 3300035410 Ga0373924_0099306 Ga0373924_0099306_19_792 254
510 3300035724 Ga0373933_0229686 Ga0373933_0229686_63_836 254
511 3300036401 Ga0373937_0001931 Ga0373937_0001931_118_891 254
512 3300037312 Ga0395899_0009821 Ga0395899_0009821_6460_7227 254
513 3300037418 Ga0395900_0028146 Ga0395900_0028146_119_886 254
514 3300038443 Ga0395901_0051442 Ga0395901_0051442_98_865 254
515 3300049588 Ga0501072_0003460 Ga0501072_0003460_9374_10138 254
516 3300049744 Ga0501083_0241352 Ga0501083_0241352_128_1015 254
517 3300050507 nmdc:mga05p37_8335_c1 nmdc:mga05p37_8335_c1_5448_6233 254
518 3300054114 Ga0501084_0030212 Ga0501084_0030212_3024_3788 254
519 3300006847 Ga0075431_100052467 Ga0075431_1000524673 255
520 3300006852 Ga0075433_10017192 Ga0075433_100171924 255
521 3300006871 Ga0075434_100009740 Ga0075434_1000097405 255
522 3300006871 Ga0075434_100011424 Ga0075434_1000114245 255
523 3300007076 Ga0075435_100033962 Ga0075435_1000339624 255
524 3300009094 Ga0111539_10106024 Ga0111539_101060242 255
525 3300009147 Ga0114129_10488916 Ga0114129_104889162 255
526 3300020070 Ga0206356_10058304 Ga0206356_100583042 255
527 3300020075 Ga0206349_1686143 Ga0206349_16861431 255
528 3300020078 Ga0206352_10630827 Ga0206352_106308271 255
529 3300020080 Ga0206350_11242039 Ga0206350_112420391 255
530 3300020082 Ga0206353_10033645 Ga0206353_100336453 255
531 3300035117 Ga0373953_0003215 Ga0373953_0003215_3878_4648 255
532 3300035118 Ga0373954_0000445 Ga0373954_0000445_10652_11422 255
533 3300035119 Ga0373956_0044526 Ga0373956_0044526_911_1681 255
534 3300035170 Ga0373943_0001478 Ga0373943_0001478_697_1467 255
535 3300035172 Ga0373955_0000456 Ga0373955_0000456_11857_12627 255
536 3300035692 Ga0373935_0000011 Ga0373935_0000011_40498_41268 255
537 3300035724 Ga0373933_0001894 Ga0373933_0001894_4356_5126 255
538 3300035725 Ga0373947_0002093 Ga0373947_0002093_7917_8687 255
539 3300036401 Ga0373937_0000019 Ga0373937_0000019_112514_113284 255
540 3300037068 Ga0373925_0000048 Ga0373925_0000048_122498_123268 255
541 3300046454 Ga0495592_0000017 Ga0495592_0000017_33955_34725 255
542 3300046461 Ga0495641_0168293 Ga0495641_0168293_146_916 255
543 3300046462 Ga0495651_0000923 Ga0495651_0000923_17483_18253 255
544 3300046463 Ga0495653_0000033 Ga0495653_0000033_97518_98288 255
545 3300046476 Ga0495662_0037857 Ga0495662_0037857_134_904 255
546 3300046477 Ga0495664_0000008 Ga0495664_0000008_160799_161569 255
547 3300046511 Ga0495608_0000014 Ga0495608_0000014_97526_98296 255
548 3300046514 Ga0495618_0000013 Ga0495618_0000013_45278_46048 255
549 3300046516 Ga0495628_0000008 Ga0495628_0000008_160784_161554 255
550 3300046517 Ga0495630_0000797 Ga0495630_0000797_3592_4362 255
551 3300046529 Ga0495652_0000005 Ga0495652_0000005_160799_161569 255
552 3300046533 Ga0495640_0000017 Ga0495640_0000017_25398_26168 255
553 3300046536 Ga0495587_0000005 Ga0495587_0000005_196830_197600 255
554 3300046543 Ga0495645_0000007 Ga0495645_0000007_174976_175746 255
555 3300046559 Ga0495667_0000012 Ga0495667_0000012_122666_123436 255
556 3300046642 Ga0495634_0000070 Ga0495634_0000070_16530_17300 255
557 3300046663 Ga0495635_0000010 Ga0495635_0000010_97552_98322 255
558 3300046675 Ga0495657_0000178 Ga0495657_0000178_23126_23896 255
559 3300046678 Ga0495599_0000015 Ga0495599_0000015_161013_161783 255
560 3300046679 Ga0495623_0000054 Ga0495623_0000054_32806_33576 255
561 3300046680 Ga0495646_0000012 Ga0495646_0000012_62370_63140 255
562 3300046683 Ga0495658_0121856 Ga0495658_0121856_639_1409 255
563 3300046689 Ga0495613_0010812 Ga0495613_0010812_4639_5409 255
564 3300046809 Ga0495600_0000031 Ga0495600_0000031_33385_34155 255
565 3300047315 Ga0495581_0019786 Ga0495581_0019786_1743_2513 255
566 3300047317 Ga0495604_0000001 Ga0495604_0000001_122667_123437 255
567 3300047317 Ga0495604_0215288 Ga0495604_0215288_102_872 255
568 3300047319 Ga0495674_0000012 Ga0495674_0000012_157398_158168 255
569 3300047444 Ga0495675_0000500 Ga0495675_0000500_10478_11248 255
570 3300047471 Ga0495684_0000021 Ga0495684_0000021_21324_22094 255
571 3300047673 Ga0495593_0000387 Ga0495593_0000387_20478_21248 255
572 3300048088 Ga0495602_0000031 Ga0495602_0000031_122796_123566 255
573 3300049588 Ga0501072_0589670 Ga0501072_0589670_82_849 255
574 3300050507 nmdc:mga05p37_397809_c1 nmdc:mga05p37_397809_c1_398_1201 255
575 3300050509 nmdc:mga0qj67_187623_c1 nmdc:mga0qj67_187623_c1_854_1624 255
576 3300050510 nmdc:mga06r32_304636_c1 nmdc:mga06r32_304636_c1_59_829 255
577 3300050511 nmdc:mga08y16_87928_c1 nmdc:mga08y16_87928_c1_2284_3087 255
578 3300050512 nmdc:mga0n895_31979_c1 nmdc:mga0n895_31979_c1_1060_1863 255
579 3300050512 nmdc:mga0n895_58419_c1 nmdc:mga0n895_58419_c1_1673_2443 255
580 3300050513 nmdc:mga0rr50_10515_c1 nmdc:mga0rr50_10515_c1_2913_3716 255
581 3300050515 nmdc:mga0a205_21253_c1 nmdc:mga0a205_21253_c1_1293_2096 255
582 3300053077 Ga0495601_0000011 Ga0495601_0000011_151681_152451 255
583 3300053078 Ga0495612_0000006 Ga0495612_0000006_134441_135211 255
584 3300053084 Ga0495595_0000021 Ga0495595_0000021_17633_18403 255
585 3300053085 Ga0495619_0000013 Ga0495619_0000013_151602_152372 255
586 3300002459 JGI24751J29686_10004988 JGI24751J29686_100049881 256
587 3300005331 Ga0070670_100073795 Ga0070670_1000737952 256
588 3300005338 Ga0068868_100176757 Ga0068868_1001767571 256
589 3300005353 Ga0070669_100145045 Ga0070669_1001450451 256
590 3300005354 Ga0070675_100370162 Ga0070675_1003701622 256
591 3300005365 Ga0070688_100099172 Ga0070688_1000991722 256
592 3300005367 Ga0070667_100113718 Ga0070667_1001137182 256
593 3300005438 Ga0070701_10171535 Ga0070701_101715351 256
594 3300005441 Ga0070700_100254832 Ga0070700_1002548322 256
595 3300005459 Ga0068867_100050608 Ga0068867_1000506083 256
596 3300005466 Ga0070685_10018946 Ga0070685_100189462 256
597 3300005466 Ga0070685_10300453 Ga0070685_103004531 256
598 3300005543 Ga0070672_100075006 Ga0070672_1000750062 256
599 3300005548 Ga0070665_100383592 Ga0070665_1003835921 256
600 3300005615 Ga0070702_100130906 Ga0070702_1001309061 256
601 3300005617 Ga0068859_100027770 Ga0068859_1000277703 256
602 3300005618 Ga0068864_100007555 Ga0068864_1000075555 256
603 3300005842 Ga0068858_100373962 Ga0068858_1003739622 256
604 3300006846 Ga0075430_100094433 Ga0075430_1000944333 256
605 3300006847 Ga0075431_100483701 Ga0075431_1004837012 256
606 3300006931 Ga0097620_100027770 Ga0097620_1000277703 256
607 3300009098 Ga0105245_10787318 Ga0105245_107873181 256
608 3300013296 Ga0157374_10199033 Ga0157374_101990332 256
609 3300013308 Ga0157375_10618559 Ga0157375_106185591 256
610 3300017792 Ga0163161_10219279 Ga0163161_102192792 256
611 3300025893 Ga0207682_10000722 Ga0207682_1000072212 256
612 3300025907 Ga0207645_10020586 Ga0207645_100205863 256
613 3300025918 Ga0207662_10026247 Ga0207662_100262473 256
614 3300025923 Ga0207681_10432867 Ga0207681_104328671 256
615 3300025927 Ga0207687_10084817 Ga0207687_100848171 256
616 3300025937 Ga0207669_10071094 Ga0207669_100710942 256
617 3300025940 Ga0207691_10003529 Ga0207691_1000352912 256
618 3300025942 Ga0207689_10196599 Ga0207689_101965991 256
619 3300025986 Ga0207658_10149656 Ga0207658_101496563 256
620 3300026035 Ga0207703_10274460 Ga0207703_102744602 256
621 3300026067 Ga0207678_10402337 Ga0207678_104023371 256
622 3300026089 Ga0207648_10177525 Ga0207648_101775252 256
623 3300026095 Ga0207676_10023059 Ga0207676_100230593 256
624 3300026116 Ga0207674_10186439 Ga0207674_101864391 256
625 3300026121 Ga0207683_10013489 Ga0207683_100134895 256
626 3300031456 Ga0307513_10170943 Ga0307513_101709432 256
627 3300035111 Ga0373923_0029554 Ga0373923_0029554_1256_2026 256
628 3300035116 Ga0373945_0015071 Ga0373945_0015071_377_1147 256
629 3300035117 Ga0373953_0020098 Ga0373953_0020098_1638_2408 256
630 3300035118 Ga0373954_0016395 Ga0373954_0016395_129_899 256
631 3300035119 Ga0373956_0039236 Ga0373956_0039236_312_1082 256
632 3300035171 Ga0373946_0141751 Ga0373946_0141751_89_859 256
633 3300035692 Ga0373935_0173475 Ga0373935_0173475_492_1262 256
634 3300035695 Ga0373927_0032762 Ga0373927_0032762_2540_3310 256
635 3300035724 Ga0373933_0009553 Ga0373933_0009553_3429_4199 256
636 3300035725 Ga0373947_0040197 Ga0373947_0040197_1818_2588 256
637 3300036401 Ga0373937_0005293 Ga0373937_0005293_4765_5535 256
638 3300037068 Ga0373925_0396408 Ga0373925_0396408_159_929 256
639 3300037853 Ga0436364_0305691 Ga0436364_0305691_200_970 256
640 3300039437 Ga0436365_1620475 Ga0436365_1620475_169_939 256
641 3300039450 Ga0436363_0008346 Ga0436363_0008346_224_994 256
642 3300046454 Ga0495592_0003385 Ga0495592_0003385_6660_7430 256
643 3300046460 Ga0495638_0034696 Ga0495638_0034696_2313_3083 256
644 3300046462 Ga0495651_0006369 Ga0495651_0006369_190_960 256
645 3300046463 Ga0495653_0001211 Ga0495653_0001211_18751_19521 256
646 3300046475 Ga0495639_0050651 Ga0495639_0050651_1086_1856 256
647 3300046477 Ga0495664_0072946 Ga0495664_0072946_971_1741 256
648 3300046511 Ga0495608_0033393 Ga0495608_0033393_2618_3388 256
649 3300046514 Ga0495618_0040055 Ga0495618_0040055_175_945 256
650 3300046516 Ga0495628_0152051 Ga0495628_0152051_648_1418 256
651 3300046525 Ga0495663_0046982 Ga0495663_0046982_238_1008 256
652 3300046529 Ga0495652_0032454 Ga0495652_0032454_3090_3860 256
653 3300046533 Ga0495640_0002174 Ga0495640_0002174_11081_11851 256
654 3300046536 Ga0495587_0001202 Ga0495587_0001202_4841_5611 256
655 3300046543 Ga0495645_0042155 Ga0495645_0042155_85_855 256
656 3300046559 Ga0495667_0000905 Ga0495667_0000905_9480_10250 256
657 3300046642 Ga0495634_0019551 Ga0495634_0019551_4010_4780 256
658 3300046663 Ga0495635_0003590 Ga0495635_0003590_2050_2820 256
659 3300046675 Ga0495657_0020484 Ga0495657_0020484_2831_3601 256
660 3300046678 Ga0495599_0054864 Ga0495599_0054864_70_840 256
661 3300046679 Ga0495623_0024201 Ga0495623_0024201_2317_3087 256
662 3300046680 Ga0495646_0083868 Ga0495646_0083868_418_1188 256
663 3300046809 Ga0495600_0008849 Ga0495600_0008849_5297_6067 256
664 3300047315 Ga0495581_0179917 Ga0495581_0179917_276_1046 256
665 3300047317 Ga0495604_0003139 Ga0495604_0003139_8302_9072 256
666 3300047319 Ga0495674_0036514 Ga0495674_0036514_1825_2595 256
667 3300047321 Ga0495676_0111879 Ga0495676_0111879_326_1096 256
668 3300047322 Ga0495680_0000483 Ga0495680_0000483_2368_3138 256
669 3300047444 Ga0495675_0009488 Ga0495675_0009488_83_853 256
670 3300047447 Ga0495685_069074 Ga0495685_069074_69_839 256
671 3300047471 Ga0495684_0268751 Ga0495684_0268751_268_1038 256
672 3300048088 Ga0495602_0031070 Ga0495602_0031070_220_990 256
673 3300049572 Ga0501036_0279009 Ga0501036_0279009_43_813 256
674 3300049591 Ga0501075_0110810 Ga0501075_0110810_1263_2033 256
675 3300049592 Ga0501076_0659582 Ga0501076_0659582_69_839 256
676 3300049743 Ga0501081_0344456 Ga0501081_0344456_70_840 256
677 3300049824 Ga0501045_0374458 Ga0501045_0374458_123_893 256
678 3300050492 nmdc:mga0yw44_49170_c1 nmdc:mga0yw44_49170_c1_1621_2391 256
679 3300050509 nmdc:mga0qj67_20786_c1 nmdc:mga0qj67_20786_c1_879_1718 256
680 3300053077 Ga0495601_0015267 Ga0495601_0015267_3510_4280 256
681 3300053078 Ga0495612_0043377 Ga0495612_0043377_873_1643 256
682 3300053096 Ga0500641_0159619 Ga0500641_0159619_160_930 256
683 3300053151 Ga0500604_0113132 Ga0500604_0113132_86_856 256
684 3300053158 Ga0500627_0060635 Ga0500627_0060635_134_904 256
685 3300053727 Ga0500611_043870 Ga0500611_043870_159_929 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01027

Bax1-I

Inhibitor of apoptosis-promoting Bax1

66

291

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nq8-assembly2.cif.gz_B crystal structure of yetj mutant from bacillus subtilis - d171e 0.8584 29 252
4pgw-assembly1.cif.gz_A crystal structure of yetj from bacillus subtilis at ph 6 by pt-sad 0.8541 29 252
6nq9-assembly3.cif.gz_C crystal structure of yetj mutant from bacillus subtilis - d195e 0.8393 29 254
4pgw-assembly1.cif.gz_A crystal structure of yetj from bacillus subtilis at ph 6 by pt-sad 0.8337 29 252
6nq9-assembly3.cif.gz_C crystal structure of yetj mutant from bacillus subtilis - d195e 0.8315 29 254
ID Description Score Start End Superfamily
af_P0AAC4_18_230_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9246 29 252 1.20.1250.20
af_P0AAC4_18_230_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9121 29 252 1.20.1250.20
af_Q4DZH5_101_300_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8818 29 248 1.20.1250.20
af_O74888_1_266_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8811 26 253 1.20.1250.20
af_P0AAC6_18_213_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8773 29 250 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A435NBU8-F1-model_v4 deleted 0.9913 116 256
AF-A0A2D5WXY5-F1-model_v4 BAX inhibitor (BI)-1/YccA family protein 0.9797 115 256 GO:0005886
AF-A0A435NBU8-F1-model_v4 deleted 0.9775 116 256
AF-A0A1F3AYZ5-F1-model_v4 SecY protein 0.9745 90 256 GO:0005886
AF-A0A3A0EYU3-F1-model_v4 BAX inhibitor (BI)-1/YccA family protein 0.9718 14 256 GO:0005886

Feature Viewer

pLDDT pTM Quality
89.13 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map