F474747
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 679 | 403 | 627 | 317 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221648|2644271992 |
| Length | 378 |
| Sequence | DDPSLCDLVAVLPDEAAAGGPLERERPRSRAVPERVTAHLDQSHLDWLEEEAIFILRETVAAFERPALLFSGGKDSCVVLRLAEKAFKTXGADGEFKGRLPFPLLHVDTGHNFPEVIEFRDRRIAEMGERLVVGHLEDSIKRGTVRLSHPLXRDRRIAEMGERLVVGHLEDSIKRGTVRLSHPLESRNGHQTVALLEAIEEHRFDVLMGGARRXEEKARAKERIFSHRDSFGQWQPKEQRPELWTLFNTRIKPGEHMRAFPISNWTELDVWLYIARENIPLPNLYYAHDRQVIRRKGLLVPLTEVTPPEAGEVVETAEVRFRTVGDMTCTCPVESPAANATEIVAETLKVTVSERGATRMDDRTSXASMERRKKEGYF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 2 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 3 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 4 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 5 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 6 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 7 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 8 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 9 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 10 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 11 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 12 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 13 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 14 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 15 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 16 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 17 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 18 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 19 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 20 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 21 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 22 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 23 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 24 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 25 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 26 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 27 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 28 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 29 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 30 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 31 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 32 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 33 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 34 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 35 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 36 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 37 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 38 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 39 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 40 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 41 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 42 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 43 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 44 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 45 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 46 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 47 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 48 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 49 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 50 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 51 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 52 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 53 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 54 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 55 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 56 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 57 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 58 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 63 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 64 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 65 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 66 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 67 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 68 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 72 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 74 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 91 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 98 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 102 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 103 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 104 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 107 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 108 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 109 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 110 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 111 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 112 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 113 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 118 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 119 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 120 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 121 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 122 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 123 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 124 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 125 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 126 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 128 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 129 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 130 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 131 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 150 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 151 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 152 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 153 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 154 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 155 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 214 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 222 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 225 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 226 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 228 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 229 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 230 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 233 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 234 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 235 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 236 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 237 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 238 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 240 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 241 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 243 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 244 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 245 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 246 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 247 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 248 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 249 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 250 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 251 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 252 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 258 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 259 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 267 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 269 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 271 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 272 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 273 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 274 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 275 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 276 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 277 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 278 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 279 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 280 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 281 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 282 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 283 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 284 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 285 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 286 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 287 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 288 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 289 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 290 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 291 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 292 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 293 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 294 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 295 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 296 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 297 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 298 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 299 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 300 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 301 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 302 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 303 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 304 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 305 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 326 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 327 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 328 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 329 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 332 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 333 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 334 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 335 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 336 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 337 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 338 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 339 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 340 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 353 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 354 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 355 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 356 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 357 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 358 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 361 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 364 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 365 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 366 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 368 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 369 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 370 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 371 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 381 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 382 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 383 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 384 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 385 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 386 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 387 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 388 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 389 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 390 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 391 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 392 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 394 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 395 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 396 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 397 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 398 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 399 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 400 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 401 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 402 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.05 |
| Metatranscriptomes | 0.29 |
| Isolates | 7.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.24 |
| Nodule | 4.42 |
| Rhizoplane | 2.65 |
| Rhizosphere | 59.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10005095 | 3300001979 | Bacteria | 5580 |
| 2 | JGI24737J22298_10041977 | 3300001990 | Bacteria | 1403 |
| 3 | JGI25153J46596_10002317 | 3300003215 | Bacteria | 11061 |
| 4 | JGI25153J46596_10002417 | 3300003215 | Bacteria | 10768 |
| 5 | Ga0006770J48903_1042115 | 3300003305 | Bacteria | 3136 |
| 6 | rootL2_10000073 | 3300003322 | Bacteria | 23640 |
| 7 | JGI26145J50221_1004043 | 3300003371 | Bacteria | 1182 |
| 8 | Ga0055539_1003304 | 3300003752 | Bacteria | 2279 |
| 9 | Ga0055525_1000031 | 3300003759 | Bacteria | 314909 |
| 10 | Ga0055529_1001253 | 3300003763 | Bacteria | 9385 |
| 11 | Ga0055526_1004906 | 3300003771 | Bacteria | 7870 |
| 12 | Ga0055524_1000158 | 3300003775 | Bacteria | 78973 |
| 13 | Ga0055528_1028380 | 3300003790 | Bacteria | 1545 |
| 14 | Ga0055540_1000035 | 3300003792 | Bacteria | 166843 |
| 15 | Ga0055531_10000024 | 3300003794 | Bacteria | 164239 |
| 16 | Ga0055531_10004532 | 3300003794 | Bacteria | 8426 |
| 17 | Ga0055543_1003950 | 3300004625 | Bacteria | 4185 |
| 18 | Ga0065165_1000248 | 3300005262 | Bacteria | 93216 |
| 19 | Ga0065165_1000390 | 3300005262 | Bacteria | 71262 |
| 20 | Ga0065165_1003068 | 3300005262 | Bacteria | 12498 |
| 21 | Ga0065165_1003542 | 3300005262 | Bacteria | 10800 |
| 22 | Ga0065715_10023582 | 3300005293 | Bacteria | 1749 |
| 23 | Ga0070658_10305120 | 3300005327 | Bacteria | 1358 |
| 24 | Ga0070676_10002065 | 3300005328 | Bacteria | 10209 |
| 25 | Ga0070676_10005115 | 3300005328 | Bacteria | 6959 |
| 26 | Ga0070670_100001786 | 3300005331 | Bacteria | 17507 |
| 27 | Ga0070670_100371698 | 3300005331 | Bacteria | 1259 |
| 28 | Ga0068869_100141052 | 3300005334 | Bacteria | 1861 |
| 29 | Ga0070682_100050418 | 3300005337 | Bacteria | 2598 |
| 30 | Ga0070682_100122391 | 3300005337 | Bacteria | 1749 |
| 31 | Ga0068868_100302932 | 3300005338 | Bacteria | 1358 |
| 32 | Ga0070661_100000649 | 3300005344 | Bacteria | 25606 |
| 33 | Ga0070661_100100993 | 3300005344 | Bacteria | 2145 |
| 34 | Ga0070692_10012635 | 3300005345 | Bacteria | 3917 |
| 35 | Ga0070668_100010300 | 3300005347 | Bacteria | 6942 |
| 36 | Ga0070669_100048889 | 3300005353 | Bacteria | 3087 |
| 37 | Ga0070675_100007685 | 3300005354 | Bacteria | 8344 |
| 38 | Ga0070675_100065006 | 3300005354 | Bacteria | 3016 |
| 39 | Ga0070675_100230632 | 3300005354 | Bacteria | 1615 |
| 40 | Ga0070671_100007621 | 3300005355 | Bacteria | 8658 |
| 41 | Ga0070671_100013507 | 3300005355 | Bacteria | 6584 |
| 42 | Ga0070671_100019824 | 3300005355 | Bacteria | 5479 |
| 43 | Ga0070671_100026644 | 3300005355 | Bacteria | 4753 |
| 44 | Ga0070671_100181600 | 3300005355 | Bacteria | 1781 |
| 45 | Ga0070674_100004831 | 3300005356 | Bacteria | 7724 |
| 46 | Ga0070674_100020712 | 3300005356 | Bacteria | 4209 |
| 47 | Ga0070674_100059339 | 3300005356 | Bacteria | 2663 |
| 48 | Ga0070674_100241061 | 3300005356 | Bacteria | 1415 |
| 49 | Ga0070673_100020575 | 3300005364 | Bacteria | 4760 |
| 50 | Ga0070673_100103902 | 3300005364 | Bacteria | 2345 |
| 51 | Ga0070659_100000430 | 3300005366 | Bacteria | 31705 |
| 52 | Ga0070659_100041211 | 3300005366 | Bacteria | 3608 |
| 53 | Ga0070659_100058088 | 3300005366 | Bacteria | 3052 |
| 54 | Ga0070667_100001640 | 3300005367 | Bacteria | 20011 |
| 55 | Ga0070667_100327322 | 3300005367 | Bacteria | 1384 |
| 56 | Ga0070667_100344714 | 3300005367 | Bacteria | 1348 |
| 57 | Ga0070709_10005663 | 3300005434 | Bacteria | 6769 |
| 58 | Ga0070711_100211429 | 3300005439 | Bacteria | 1502 |
| 59 | Ga0070708_100032815 | 3300005445 | Bacteria | 4506 |
| 60 | Ga0070663_100002390 | 3300005455 | Bacteria | 10552 |
| 61 | Ga0070678_100002432 | 3300005456 | Bacteria | 10201 |
| 62 | Ga0070662_100003301 | 3300005457 | Bacteria | 10051 |
| 63 | Ga0068867_100000228 | 3300005459 | Bacteria | 36773 |
| 64 | Ga0068867_100003245 | 3300005459 | Bacteria | 11462 |
| 65 | Ga0068867_100158774 | 3300005459 | Bacteria | 1782 |
| 66 | Ga0070706_100009701 | 3300005467 | Bacteria | 8948 |
| 67 | Ga0070706_100026361 | 3300005467 | Bacteria | 5348 |
| 68 | Ga0070706_100143194 | 3300005467 | Bacteria | 2232 |
| 69 | Ga0070707_100017523 | 3300005468 | Bacteria | 6735 |
| 70 | Ga0070698_100068205 | 3300005471 | Bacteria | 3575 |
| 71 | Ga0070698_100155566 | 3300005471 | Bacteria | 2232 |
| 72 | Ga0070699_100131099 | 3300005518 | Bacteria | 2210 |
| 73 | Ga0070684_100099095 | 3300005535 | Bacteria | 2600 |
| 74 | Ga0070697_100025130 | 3300005536 | Bacteria | 4748 |
| 75 | Ga0068853_100054042 | 3300005539 | Bacteria | 3461 |
| 76 | Ga0068853_100174816 | 3300005539 | Bacteria | 1945 |
| 77 | Ga0070672_100000447 | 3300005543 | Bacteria | 24121 |
| 78 | Ga0070672_100038681 | 3300005543 | Bacteria | 3648 |
| 79 | Ga0070665_100004803 | 3300005548 | Bacteria | 14048 |
| 80 | Ga0070664_100000913 | 3300005564 | Bacteria | 23039 |
| 81 | Ga0070664_100006225 | 3300005564 | Bacteria | 9641 |
| 82 | Ga0068857_100059339 | 3300005577 | Bacteria | 3398 |
| 83 | Ga0068859_100012341 | 3300005617 | Bacteria | 8594 |
| 84 | Ga0068859_100371854 | 3300005617 | Bacteria | 1525 |
| 85 | Ga0068861_100002083 | 3300005719 | Bacteria | 12968 |
| 86 | Ga0068863_100605473 | 3300005841 | Bacteria | 1085 |
| 87 | Ga0068860_100003217 | 3300005843 | Bacteria | 16844 |
| 88 | Ga0068862_100004055 | 3300005844 | Bacteria | 12416 |
| 89 | Ga0068862_100006190 | 3300005844 | Bacteria | 9966 |
| 90 | Ga0081455_10002830 | 3300005937 | Bacteria | 20425 |
| 91 | Ga0081455_10018432 | 3300005937 | Bacteria | 6651 |
| 92 | Ga0081455_10040926 | 3300005937 | Bacteria | 4083 |
| 93 | Ga0081455_10055397 | 3300005937 | Bacteria | 3373 |
| 94 | Ga0081539_10001822 | 3300005985 | Bacteria | 33628 |
| 95 | Ga0081539_10003077 | 3300005985 | Bacteria | 21465 |
| 96 | Ga0075365_10015895 | 3300006038 | Bacteria | 4561 |
| 97 | Ga0075368_10003121 | 3300006042 | Bacteria | 5496 |
| 98 | Ga0075368_10015679 | 3300006042 | Bacteria | 2815 |
| 99 | Ga0075363_100000538 | 3300006048 | Bacteria | 12245 |
| 100 | Ga0075363_100015590 | 3300006048 | Bacteria | 3738 |
| 101 | Ga0075363_100045740 | 3300006048 | Bacteria | 2321 |
| 102 | Ga0075364_10033021 | 3300006051 | Bacteria | 3329 |
| 103 | Ga0075364_10054094 | 3300006051 | Bacteria | 2624 |
| 104 | Ga0075364_10198425 | 3300006051 | Bacteria | 1360 |
| 105 | Ga0075364_10240507 | 3300006051 | Bacteria | 1230 |
| 106 | Ga0070712_100045885 | 3300006175 | Bacteria | 3019 |
| 107 | Ga0075362_10000173 | 3300006177 | Bacteria | 17794 |
| 108 | Ga0075362_10022235 | 3300006177 | Bacteria | 2670 |
| 109 | Ga0075367_10029207 | 3300006178 | Bacteria | 3152 |
| 110 | Ga0075367_10044166 | 3300006178 | Bacteria | 2611 |
| 111 | Ga0075367_10067815 | 3300006178 | Bacteria | 2139 |
| 112 | Ga0075367_10115022 | 3300006178 | Bacteria | 1654 |
| 113 | Ga0075367_10281073 | 3300006178 | Bacteria | 1046 |
| 114 | Ga0075366_10000472 | 3300006195 | Bacteria | 18720 |
| 115 | Ga0075366_10011930 | 3300006195 | Bacteria | 4919 |
| 116 | Ga0075366_10013336 | 3300006195 | Bacteria | 4677 |
| 117 | Ga0075366_10018606 | 3300006195 | Bacteria | 4013 |
| 118 | Ga0075366_10027250 | 3300006195 | Bacteria | 3351 |
| 119 | Ga0075366_10028967 | 3300006195 | Bacteria | 3251 |
| 120 | Ga0075366_10031881 | 3300006195 | Bacteria | 3102 |
| 121 | Ga0075366_10033377 | 3300006195 | Bacteria | 3032 |
| 122 | Ga0075366_10039587 | 3300006195 | Bacteria | 2786 |
| 123 | Ga0075366_10092386 | 3300006195 | Bacteria | 1813 |
| 124 | Ga0075366_10099557 | 3300006195 | Bacteria | 1744 |
| 125 | Ga0075370_10001362 | 3300006353 | Bacteria | 10515 |
| 126 | Ga0075370_10013927 | 3300006353 | Bacteria | 4280 |
| 127 | Ga0075370_10014833 | 3300006353 | Bacteria | 4162 |
| 128 | Ga0075370_10057351 | 3300006353 | Bacteria | 2214 |
| 129 | Ga0075370_10130310 | 3300006353 | Bacteria | 1467 |
| 130 | Ga0068871_100249139 | 3300006358 | Bacteria | 1547 |
| 131 | Ga0075428_100019815 | 3300006844 | Bacteria | 7443 |
| 132 | Ga0075428_100573053 | 3300006844 | Bacteria | 1206 |
| 133 | Ga0075430_100112978 | 3300006846 | Bacteria | 2264 |
| 134 | Ga0075430_100158637 | 3300006846 | Bacteria | 1883 |
| 135 | Ga0075431_100290698 | 3300006847 | Bacteria | 1653 |
| 136 | Ga0075433_10001288 | 3300006852 | Bacteria | 18335 |
| 137 | Ga0075434_100002418 | 3300006871 | Bacteria | 16405 |
| 138 | Ga0075429_100002218 | 3300006880 | Bacteria | 16266 |
| 139 | Ga0075436_100033776 | 3300006914 | Bacteria | 3526 |
| 140 | Ga0097620_100012343 | 3300006931 | Bacteria | 8594 |
| 141 | Ga0097620_100371847 | 3300006931 | Bacteria | 1525 |
| 142 | Ga0099823_1000211 | 3300006944 | Bacteria | 32728 |
| 143 | Ga0079104_1000024 | 3300006946 | Bacteria | 219543 |
| 144 | Ga0075435_100006694 | 3300007076 | Bacteria | 8171 |
| 145 | Ga0099794_10093503 | 3300007265 | Bacteria | 1495 |
| 146 | Ga0105240_10001280 | 3300009093 | Bacteria | 43524 |
| 147 | Ga0105240_10161787 | 3300009093 | Bacteria | 2658 |
| 148 | Ga0111539_10298879 | 3300009094 | Bacteria | 1874 |
| 149 | Ga0114129_10121124 | 3300009147 | Bacteria | 3601 |
| 150 | Ga0114129_10443967 | 3300009147 | Bacteria | 1703 |
| 151 | Ga0105243_10001277 | 3300009148 | Bacteria | 22593 |
| 152 | Ga0105243_10103366 | 3300009148 | Bacteria | 2369 |
| 153 | Ga0105248_10000537 | 3300009177 | Bacteria | 43166 |
| 154 | Ga0105248_10062185 | 3300009177 | Bacteria | 4193 |
| 155 | Ga0105237_10001734 | 3300009545 | Bacteria | 28197 |
| 156 | Ga0105237_10020538 | 3300009545 | Bacteria | 6807 |
| 157 | Ga0105237_10184429 | 3300009545 | Bacteria | 2087 |
| 158 | Ga0105237_10216349 | 3300009545 | Bacteria | 1916 |
| 159 | Ga0105238_10007274 | 3300009551 | Bacteria | 11082 |
| 160 | Ga0105238_10008735 | 3300009551 | Bacteria | 10135 |
| 161 | Ga0105238_10366693 | 3300009551 | Bacteria | 1430 |
| 162 | Ga0105249_10067688 | 3300009553 | Bacteria | 3291 |
| 163 | Ga0105249_10530849 | 3300009553 | Bacteria | 1225 |
| 164 | Ga0105239_10001342 | 3300010375 | Bacteria | 33155 |
| 165 | Ga0105239_10068264 | 3300010375 | Bacteria | 3907 |
| 166 | Ga0105239_10144427 | 3300010375 | Bacteria | 2653 |
| 167 | Ga0157319_1000003 | 3300012497 | Bacteria | 397199 |
| 168 | Ga0157370_10019246 | 3300013104 | Bacteria | 6855 |
| 169 | Ga0157369_10384195 | 3300013105 | Bacteria | 1457 |
| 170 | Ga0163162_10004268 | 3300013306 | Bacteria | 13751 |
| 171 | Ga0163162_10079187 | 3300013306 | Bacteria | 3352 |
| 172 | Ga0163162_10810900 | 3300013306 | Bacteria | 1053 |
| 173 | Ga0157375_10020176 | 3300013308 | Bacteria | 6082 |
| 174 | Ga0157375_10094576 | 3300013308 | Bacteria | 3057 |
| 175 | Ga0157375_10173980 | 3300013308 | Bacteria | 2302 |
| 176 | Ga0157375_10262067 | 3300013308 | Bacteria | 1890 |
| 177 | Ga0157380_10086958 | 3300014326 | Bacteria | 2570 |
| 178 | Ga0157377_10000016 | 3300014745 | Bacteria | 190613 |
| 179 | Ga0157377_10075135 | 3300014745 | Bacteria | 1962 |
| 180 | Ga0157377_10135781 | 3300014745 | Bacteria | 1507 |
| 181 | Ga0157379_10000359 | 3300014968 | Bacteria | 36602 |
| 182 | Ga0157379_10007067 | 3300014968 | Bacteria | 9703 |
| 183 | Ga0157379_10011186 | 3300014968 | Bacteria | 7821 |
| 184 | Ga0157379_10421815 | 3300014968 | Bacteria | 1229 |
| 185 | Ga0163161_10011249 | 3300017792 | Bacteria | 6200 |
| 186 | Ga0163161_10215640 | 3300017792 | Bacteria | 1484 |
| 187 | Ga0214544_1000016 | 3300021320 | Bacteria | 204278 |
| 188 | Ga0214542_1000016 | 3300021321 | Bacteria | 210332 |
| 189 | Ga0214545_1000008 | 3300021324 | Bacteria | 215190 |
| 190 | Ga0214543_1000043 | 3300021327 | Bacteria | 160517 |
| 191 | Ga0213872_10000006 | 3300021361 | Bacteria | 249845 |
| 192 | Ga0213872_10000102 | 3300021361 | Bacteria | 79440 |
| 193 | Ga0213872_10000139 | 3300021361 | Bacteria | 65459 |
| 194 | Ga0213872_10000152 | 3300021361 | Bacteria | 63382 |
| 195 | Ga0213872_10005055 | 3300021361 | Bacteria | 6839 |
| 196 | Ga0213874_10013580 | 3300021377 | Bacteria | 2113 |
| 197 | Ga0213874_10069374 | 3300021377 | Bacteria | 1121 |
| 198 | Ga0209672_103607 | 3300025228 | Bacteria | 3135 |
| 199 | Ga0209563_100044 | 3300025230 | Bacteria | 396812 |
| 200 | Ga0209258_105519 | 3300025242 | Bacteria | 2126 |
| 201 | Ga0209258_107796 | 3300025242 | Bacteria | 1559 |
| 202 | Ga0207425_1000946 | 3300025245 | Bacteria | 13795 |
| 203 | Ga0209677_100522 | 3300025253 | Bacteria | 21397 |
| 204 | Ga0209129_1000041 | 3300025258 | Bacteria | 307590 |
| 205 | Ga0209129_1016733 | 3300025258 | Bacteria | 1461 |
| 206 | Ga0209455_1000528 | 3300025272 | Bacteria | 26777 |
| 207 | Ga0209455_1001225 | 3300025272 | Bacteria | 12169 |
| 208 | Ga0209673_1001671 | 3300025273 | Bacteria | 18985 |
| 209 | Ga0209673_1014555 | 3300025273 | Bacteria | 3039 |
| 210 | Ga0209673_1015984 | 3300025273 | Bacteria | 2826 |
| 211 | Ga0209673_1040989 | 3300025273 | Bacteria | 1319 |
| 212 | Ga0209564_1000029 | 3300025295 | Bacteria | 505995 |
| 213 | Ga0209564_1000051 | 3300025295 | Bacteria | 357748 |
| 214 | Ga0209564_1005871 | 3300025295 | Bacteria | 6816 |
| 215 | Ga0209758_1000043 | 3300025297 | Bacteria | 402310 |
| 216 | Ga0209758_1000057 | 3300025297 | Bacteria | 333111 |
| 217 | Ga0209758_1000069 | 3300025297 | Bacteria | 286161 |
| 218 | Ga0209758_1031198 | 3300025297 | Bacteria | 2191 |
| 219 | Ga0209050_1000247 | 3300025298 | Bacteria | 116514 |
| 220 | Ga0209050_1000995 | 3300025298 | Bacteria | 35798 |
| 221 | Ga0209050_1003881 | 3300025298 | Bacteria | 10622 |
| 222 | Ga0209050_1005005 | 3300025298 | Bacteria | 8612 |
| 223 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 224 | Ga0209256_1000675 | 3300025299 | Bacteria | 46128 |
| 225 | Ga0209256_1005586 | 3300025299 | Bacteria | 7153 |
| 226 | Ga0209256_1010579 | 3300025299 | Bacteria | 3836 |
| 227 | Ga0209051_1000016 | 3300025303 | Bacteria | 541891 |
| 228 | Ga0209257_1000017 | 3300025304 | Bacteria | 866287 |
| 229 | Ga0209257_1000102 | 3300025304 | Bacteria | 251074 |
| 230 | Ga0209257_1000564 | 3300025304 | Bacteria | 62815 |
| 231 | Ga0209257_1005336 | 3300025304 | Bacteria | 9099 |
| 232 | Ga0209257_1013434 | 3300025304 | Bacteria | 3641 |
| 233 | Ga0209257_1019601 | 3300025304 | Bacteria | 2540 |
| 234 | Ga0207697_10032538 | 3300025315 | Bacteria | 2135 |
| 235 | Ga0207682_10000748 | 3300025893 | Bacteria | 15009 |
| 236 | Ga0207642_10006672 | 3300025899 | Bacteria | 3852 |
| 237 | Ga0207688_10075364 | 3300025901 | Bacteria | 1920 |
| 238 | Ga0207688_10100344 | 3300025901 | Bacteria | 1671 |
| 239 | Ga0207645_10002560 | 3300025907 | Bacteria | 14212 |
| 240 | Ga0207645_10021528 | 3300025907 | Bacteria | 4204 |
| 241 | Ga0207645_10036230 | 3300025907 | Bacteria | 3168 |
| 242 | Ga0207643_10119031 | 3300025908 | Bacteria | 1563 |
| 243 | Ga0207643_10223236 | 3300025908 | Bacteria | 1154 |
| 244 | Ga0207705_10066616 | 3300025909 | Bacteria | 2605 |
| 245 | Ga0207684_10030653 | 3300025910 | Bacteria | 4577 |
| 246 | Ga0207684_10055446 | 3300025910 | Bacteria | 3363 |
| 247 | Ga0207695_10012371 | 3300025913 | Bacteria | 10250 |
| 248 | Ga0207695_10057886 | 3300025913 | Bacteria | 4025 |
| 249 | Ga0207671_10011049 | 3300025914 | Bacteria | 7391 |
| 250 | Ga0207693_10012757 | 3300025915 | Bacteria | 6783 |
| 251 | Ga0207663_10032461 | 3300025916 | Bacteria | 3100 |
| 252 | Ga0207649_10008572 | 3300025920 | Bacteria | 5578 |
| 253 | Ga0207649_10065713 | 3300025920 | Bacteria | 2297 |
| 254 | Ga0207649_10116700 | 3300025920 | Bacteria | 1793 |
| 255 | Ga0207652_10334321 | 3300025921 | Bacteria | 1368 |
| 256 | Ga0207681_10029245 | 3300025923 | Bacteria | 3577 |
| 257 | Ga0207681_10043404 | 3300025923 | Bacteria | 3009 |
| 258 | Ga0207694_10010050 | 3300025924 | Bacteria | 7133 |
| 259 | Ga0207650_10000783 | 3300025925 | Bacteria | 24484 |
| 260 | Ga0207659_10000307 | 3300025926 | Bacteria | 29582 |
| 261 | Ga0207659_10044568 | 3300025926 | Bacteria | 3122 |
| 262 | Ga0207659_10263633 | 3300025926 | Bacteria | 1403 |
| 263 | Ga0207659_10322558 | 3300025926 | Bacteria | 1275 |
| 264 | Ga0207644_10013045 | 3300025931 | Bacteria | 5531 |
| 265 | Ga0207690_10001923 | 3300025932 | Bacteria | 12736 |
| 266 | Ga0207706_10005864 | 3300025933 | Bacteria | 11427 |
| 267 | Ga0207709_10001251 | 3300025935 | Bacteria | 18257 |
| 268 | Ga0207709_10043178 | 3300025935 | Bacteria | 2716 |
| 269 | Ga0207669_10002758 | 3300025937 | Bacteria | 7535 |
| 270 | Ga0207669_10030762 | 3300025937 | Bacteria | 2988 |
| 271 | Ga0207669_10061484 | 3300025937 | Bacteria | 2308 |
| 272 | Ga0207691_10003997 | 3300025940 | Bacteria | 14303 |
| 273 | Ga0207691_10070487 | 3300025940 | Bacteria | 3156 |
| 274 | Ga0207711_10017338 | 3300025941 | Bacteria | 5983 |
| 275 | Ga0207689_10035247 | 3300025942 | Bacteria | 4158 |
| 276 | Ga0207689_10087815 | 3300025942 | Bacteria | 2554 |
| 277 | Ga0207689_10259765 | 3300025942 | Bacteria | 1437 |
| 278 | Ga0207679_10000573 | 3300025945 | Bacteria | 24705 |
| 279 | Ga0207679_10003682 | 3300025945 | Bacteria | 9499 |
| 280 | Ga0207651_10032204 | 3300025960 | Bacteria | 3364 |
| 281 | Ga0207651_10054492 | 3300025960 | Bacteria | 2741 |
| 282 | Ga0207712_10090818 | 3300025961 | Bacteria | 2248 |
| 283 | Ga0207668_10005534 | 3300025972 | Bacteria | 7449 |
| 284 | Ga0207640_10478093 | 3300025981 | Bacteria | 1033 |
| 285 | Ga0207658_10001138 | 3300025986 | Bacteria | 21341 |
| 286 | Ga0207658_10075072 | 3300025986 | Bacteria | 2571 |
| 287 | Ga0207658_10149502 | 3300025986 | Bacteria | 1901 |
| 288 | Ga0207703_10313091 | 3300026035 | Bacteria | 1435 |
| 289 | Ga0207639_10097383 | 3300026041 | Bacteria | 2369 |
| 290 | Ga0207678_10001091 | 3300026067 | Bacteria | 24903 |
| 291 | Ga0207708_10012895 | 3300026075 | Bacteria | 6232 |
| 292 | Ga0207702_10192031 | 3300026078 | Bacteria | 1887 |
| 293 | Ga0207641_10060413 | 3300026088 | Bacteria | 3231 |
| 294 | Ga0207648_10000598 | 3300026089 | Bacteria | 40545 |
| 295 | Ga0207648_10002165 | 3300026089 | Bacteria | 21350 |
| 296 | Ga0207648_10030699 | 3300026089 | Bacteria | 4757 |
| 297 | Ga0207648_10156399 | 3300026089 | Bacteria | 2012 |
| 298 | Ga0207648_10288666 | 3300026089 | Bacteria | 1468 |
| 299 | Ga0207648_10426461 | 3300026089 | Bacteria | 1205 |
| 300 | Ga0207676_10192200 | 3300026095 | Bacteria | 1797 |
| 301 | Ga0207674_10019011 | 3300026116 | Bacteria | 7445 |
| 302 | Ga0207674_10039848 | 3300026116 | Bacteria | 4868 |
| 303 | Ga0207675_100004351 | 3300026118 | Bacteria | 13688 |
| 304 | Ga0207683_10001684 | 3300026121 | Bacteria | 19770 |
| 305 | Ga0207698_10014891 | 3300026142 | Bacteria | 5189 |
| 306 | Ga0207698_10254220 | 3300026142 | Bacteria | 1610 |
| 307 | Ga0209281_1000104 | 3300027111 | Bacteria | 221056 |
| 308 | Ga0209371_1019135 | 3300027312 | Bacteria | 1715 |
| 309 | Ga0209998_10010480 | 3300027717 | Bacteria | 1920 |
| 310 | Ga0209813_10011507 | 3300027866 | Bacteria | 2315 |
| 311 | Ga0209974_10005897 | 3300027876 | Bacteria | 4294 |
| 312 | Ga0268266_10001895 | 3300028379 | Bacteria | 23574 |
| 313 | Ga0268266_10007319 | 3300028379 | Bacteria | 9977 |
| 314 | Ga0268266_10084814 | 3300028379 | Bacteria | 2767 |
| 315 | Ga0268265_10005004 | 3300028380 | Bacteria | 9095 |
| 316 | Ga0268264_10003397 | 3300028381 | Bacteria | 13750 |
| 317 | Ga0265319_1025651 | 3300028563 | Bacteria | 2107 |
| 318 | Ga0265323_10005053 | 3300028653 | Bacteria | 5635 |
| 319 | Ga0265336_10002549 | 3300028666 | Bacteria | 7455 |
| 320 | Ga0307517_10000150 | 3300028786 | Bacteria | 110446 |
| 321 | Ga0307517_10084135 | 3300028786 | Bacteria | 2681 |
| 322 | Ga0307517_10134755 | 3300028786 | Bacteria | 1761 |
| 323 | Ga0307515_10000004 | 3300028794 | Bacteria | 846506 |
| 324 | Ga0307515_10000830 | 3300028794 | Bacteria | 71111 |
| 325 | Ga0307515_10002402 | 3300028794 | Bacteria | 40839 |
| 326 | Ga0307515_10011679 | 3300028794 | Bacteria | 16633 |
| 327 | Ga0307515_10021637 | 3300028794 | Bacteria | 11387 |
| 328 | Ga0307515_10026130 | 3300028794 | Bacteria | 10064 |
| 329 | Ga0307515_10067150 | 3300028794 | Bacteria | 4952 |
| 330 | Ga0307515_10170346 | 3300028794 | Bacteria | 2174 |
| 331 | Ga0307515_10171782 | 3300028794 | Bacteria | 2157 |
| 332 | Ga0265338_10001066 | 3300028800 | Bacteria | 45588 |
| 333 | Ga0268256_1011825 | 3300030500 | Bacteria | 2734 |
| 334 | Ga0307512_10012395 | 3300030522 | Bacteria | 8045 |
| 335 | Ga0307512_10025747 | 3300030522 | Bacteria | 5205 |
| 336 | Ga0265325_10013360 | 3300031241 | Bacteria | 4677 |
| 337 | Ga0265339_10026808 | 3300031249 | Bacteria | 3297 |
| 338 | Ga0265331_10001772 | 3300031250 | Bacteria | 15463 |
| 339 | Ga0265331_10030192 | 3300031250 | Bacteria | 2699 |
| 340 | Ga0265327_10000012 | 3300031251 | Bacteria | 530403 |
| 341 | Ga0265327_10001814 | 3300031251 | Bacteria | 25001 |
| 342 | Ga0307513_10030508 | 3300031456 | Bacteria | 6124 |
| 343 | Ga0307513_10381799 | 3300031456 | Bacteria | 1148 |
| 344 | Ga0307509_10002837 | 3300031507 | Bacteria | 27455 |
| 345 | Ga0307509_10011064 | 3300031507 | Bacteria | 10987 |
| 346 | Ga0307509_10017922 | 3300031507 | Bacteria | 8131 |
| 347 | Ga0307509_10129106 | 3300031507 | Bacteria | 2487 |
| 348 | Ga0307509_10196928 | 3300031507 | Bacteria | 1857 |
| 349 | Ga0307408_100000010 | 3300031548 | Bacteria | 420048 |
| 350 | Ga0307508_10000061 | 3300031616 | Bacteria | 124749 |
| 351 | Ga0307508_10001937 | 3300031616 | Bacteria | 22703 |
| 352 | Ga0307508_10002030 | 3300031616 | Bacteria | 21943 |
| 353 | Ga0307508_10217239 | 3300031616 | Bacteria | 1512 |
| 354 | Ga0307508_10222589 | 3300031616 | Bacteria | 1486 |
| 355 | Ga0307514_10089166 | 3300031649 | Bacteria | 2254 |
| 356 | Ga0307514_10116209 | 3300031649 | Bacteria | 1880 |
| 357 | Ga0265314_10008364 | 3300031711 | Bacteria | 8869 |
| 358 | Ga0265314_10066066 | 3300031711 | Bacteria | 2441 |
| 359 | Ga0265342_10158482 | 3300031712 | Bacteria | 1252 |
| 360 | Ga0307516_10000293 | 3300031730 | Bacteria | 65013 |
| 361 | Ga0307516_10006910 | 3300031730 | Bacteria | 13188 |
| 362 | Ga0307516_10106435 | 3300031730 | Bacteria | 2615 |
| 363 | Ga0307516_10202286 | 3300031730 | Bacteria | 1705 |
| 364 | Ga0307516_10237918 | 3300031730 | Bacteria | 1521 |
| 365 | Ga0307405_10014843 | 3300031731 | Bacteria | 4202 |
| 366 | Ga0307413_10030884 | 3300031824 | Bacteria | 3015 |
| 367 | Ga0307410_10102429 | 3300031852 | Bacteria | 2054 |
| 368 | Ga0307406_10025146 | 3300031901 | Bacteria | 3563 |
| 369 | Ga0307409_100015073 | 3300031995 | Bacteria | 5056 |
| 370 | Ga0307409_100246349 | 3300031995 | Bacteria | 1631 |
| 371 | Ga0307416_100167725 | 3300032002 | Bacteria | 2039 |
| 372 | Ga0307414_10028632 | 3300032004 | Bacteria | 3616 |
| 373 | Ga0307411_10227843 | 3300032005 | Bacteria | 1450 |
| 374 | Ga0307415_100039530 | 3300032126 | Bacteria | 3119 |
| 375 | Ga0307507_10142156 | 3300033179 | Bacteria | 1836 |
| 376 | Ga0307510_10002474 | 3300033180 | Bacteria | 21007 |
| 377 | Ga0307510_10032222 | 3300033180 | Bacteria | 5906 |
| 378 | Ga0307510_10082015 | 3300033180 | Bacteria | 3122 |
| 379 | Ga0316588_1001033 | 3300033528 | Bacteria | 4368 |
| 380 | Ga0373959_0003778 | 3300034820 | Bacteria | 2426 |
| 381 | Ga0373940_0063735 | 3300035088 | Bacteria | 1059 |
| 382 | Ga0373944_0009484 | 3300035089 | Bacteria | 2641 |
| 383 | Ga0373949_0009358 | 3300035090 | Bacteria | 2147 |
| 384 | Ga0373936_0038480 | 3300035113 | Bacteria | 1912 |
| 385 | Ga0373939_0000160 | 3300035114 | Bacteria | 18870 |
| 386 | Ga0373945_0072435 | 3300035116 | Bacteria | 1306 |
| 387 | Ga0373960_0000788 | 3300035121 | Bacteria | 6656 |
| 388 | Ga0373943_0075340 | 3300035170 | Bacteria | 1718 |
| 389 | Ga0373946_0085616 | 3300035171 | Bacteria | 1388 |
| 390 | Ga0373961_0068057 | 3300035241 | Bacteria | 1096 |
| 391 | Ga0373931_0000233 | 3300035691 | Bacteria | 23590 |
| 392 | Ga0373931_0008851 | 3300035691 | Bacteria | 4793 |
| 393 | Ga0373931_0073786 | 3300035691 | Bacteria | 1868 |
| 394 | Ga0373935_0066670 | 3300035692 | Bacteria | 2313 |
| 395 | Ga0373927_0028336 | 3300035695 | Bacteria | 3652 |
| 396 | Ga0373933_0098175 | 3300035724 | Bacteria | 1815 |
| 397 | Ga0373947_0029221 | 3300035725 | Bacteria | 3234 |
| 398 | Ga0373947_0054990 | 3300035725 | Bacteria | 2403 |
| 399 | Ga0373925_0000845 | 3300037068 | Bacteria | 28162 |
| 400 | Ga0395900_0000131 | 3300037418 | Bacteria | 125554 |
| 401 | Ga0395898_0001669 | 3300037466 | Bacteria | 29777 |
| 402 | Ga0395898_0080691 | 3300037466 | Bacteria | 3137 |
| 403 | Ga0395905_0001385 | 3300037471 | Bacteria | 29377 |
| 404 | Ga0395905_0002862 | 3300037471 | Bacteria | 18861 |
| 405 | Ga0395905_0003089 | 3300037471 | Bacteria | 17998 |
| 406 | Ga0395905_0015223 | 3300037471 | Bacteria | 7314 |
| 407 | Ga0395905_0054712 | 3300037471 | Bacteria | 3734 |
| 408 | Ga0395905_0059971 | 3300037471 | Bacteria | 3557 |
| 409 | Ga0395905_0095910 | 3300037471 | Bacteria | 2784 |
| 410 | Ga0395905_0271694 | 3300037471 | Bacteria | 1581 |
| 411 | Ga0436364_1183040 | 3300037853 | Bacteria | 1415 |
| 412 | Ga0436360_0130330 | 3300039438 | Bacteria | 4642 |
| 413 | Ga0436361_0208451 | 3300039447 | Bacteria | 3319 |
| 414 | Ga0436361_0301322 | 3300039447 | Bacteria | 54194 |
| 415 | Ga0436361_0369025 | 3300039447 | Bacteria | 1008 |
| 416 | Ga0436361_0614815 | 3300039447 | Bacteria | 45728 |
| 417 | Ga0436361_0734234 | 3300039447 | Bacteria | 30887 |
| 418 | Ga0436361_0825317 | 3300039447 | Bacteria | 2567 |
| 419 | Ga0436361_1059830 | 3300039447 | Bacteria | 25253 |
| 420 | Ga0436363_0024718 | 3300039450 | Bacteria | 3023 |
| 421 | Ga0436363_0086029 | 3300039450 | Bacteria | 1924 |
| 422 | Ga0436363_0610754 | 3300039450 | Bacteria | 5168 |
| 423 | Ga0436363_1060569 | 3300039450 | Bacteria | 1102 |
| 424 | Ga0436363_1578922 | 3300039450 | Bacteria | 4744 |
| 425 | Ga0436362_1278682 | 3300039453 | Bacteria | 2081 |
| 426 | Ga0439465_0070744 | 3300041413 | Bacteria | 1169 |
| 427 | Ga0451800_0538243 | 3300041459 | Bacteria | 2078 |
| 428 | Ga0439441_011679 | 3300042001 | Bacteria | 1493 |
| 429 | Ga0439450_021202 | 3300042008 | Bacteria | 1393 |
| 430 | Ga0450917_000031 | 3300042120 | Bacteria | 6907 |
| 431 | Ga0450919_000578 | 3300042121 | Bacteria | 4616 |
| 432 | Ga0450891_000788 | 3300042129 | Bacteria | 3314 |
| 433 | Ga0450892_000949 | 3300042130 | Bacteria | 3116 |
| 434 | Ga0450889_000243 | 3300042144 | Bacteria | 6015 |
| 435 | Ga0439459_0010540 | 3300042438 | Bacteria | 1614 |
| 436 | Ga0450916_006341 | 3300042530 | Bacteria | 1391 |
| 437 | Ga0450918_000929 | 3300042531 | Bacteria | 6115 |
| 438 | Ga0450893_0000452 | 3300042532 | Bacteria | 5800 |
| 439 | Ga0451577_0006041 | 3300042876 | Bacteria | 12188 |
| 440 | Ga0466969_0000017 | 3300044656 | Bacteria | 103792 |
| 441 | Ga0466969_0016731 | 3300044656 | Bacteria | 3834 |
| 442 | Ga0466969_0024691 | 3300044656 | Bacteria | 3092 |
| 443 | Ga0466972_0000564 | 3300044658 | Bacteria | 18111 |
| 444 | Ga0466972_0048615 | 3300044658 | Bacteria | 2049 |
| 445 | Ga0466965_0008331 | 3300044683 | Bacteria | 4795 |
| 446 | Ga0466965_0064814 | 3300044683 | Bacteria | 1829 |
| 447 | Ga0466966_0009318 | 3300044684 | Bacteria | 6501 |
| 448 | Ga0466961_0000074 | 3300044693 | Bacteria | 61968 |
| 449 | Ga0466961_0005109 | 3300044693 | Bacteria | 8260 |
| 450 | Ga0466963_0026258 | 3300044694 | Bacteria | 3723 |
| 451 | Ga0466963_0162299 | 3300044694 | Bacteria | 1555 |
| 452 | Ga0466964_0001826 | 3300044706 | Bacteria | 7410 |
| 453 | Ga0466964_0071065 | 3300044706 | Bacteria | 1472 |
| 454 | Ga0453684_0069157 | 3300044712 | Bacteria | 4480 |
| 455 | Ga0466970_0012504 | 3300044765 | Bacteria | 4342 |
| 456 | Ga0466960_0009764 | 3300044901 | Bacteria | 3968 |
| 457 | Ga0466959_0004446 | 3300045049 | Bacteria | 9384 |
| 458 | Ga0466959_0046795 | 3300045049 | Bacteria | 3183 |
| 459 | Ga0466959_0060757 | 3300045049 | Bacteria | 2749 |
| 460 | Ga0451576_0003849 | 3300045051 | Bacteria | 20145 |
| 461 | Ga0451576_0024941 | 3300045051 | Bacteria | 6451 |
| 462 | Ga0451576_0030018 | 3300045051 | Bacteria | 5814 |
| 463 | Ga0451576_0061714 | 3300045051 | Bacteria | 3909 |
| 464 | Ga0451576_0383311 | 3300045051 | Bacteria | 1473 |
| 465 | Ga0466967_0025238 | 3300045976 | Bacteria | 4898 |
| 466 | Ga0495592_0005413 | 3300046454 | Bacteria | 9423 |
| 467 | Ga0495592_0106780 | 3300046454 | Bacteria | 1987 |
| 468 | Ga0495638_0035681 | 3300046460 | Bacteria | 3169 |
| 469 | Ga0495580_0072083 | 3300046472 | Bacteria | 2413 |
| 470 | Ga0495605_0091194 | 3300046474 | Bacteria | 1412 |
| 471 | Ga0495610_0016173 | 3300046512 | Bacteria | 4308 |
| 472 | Ga0495620_0086886 | 3300046515 | Bacteria | 1258 |
| 473 | Ga0495632_0004080 | 3300046519 | Bacteria | 10076 |
| 474 | Ga0495632_0063116 | 3300046519 | Bacteria | 1794 |
| 475 | Ga0495643_0078625 | 3300046522 | Bacteria | 1721 |
| 476 | Ga0495648_0150663 | 3300046524 | Bacteria | 1214 |
| 477 | Ga0495640_0046861 | 3300046533 | Bacteria | 2993 |
| 478 | Ga0495640_0060812 | 3300046533 | Bacteria | 2568 |
| 479 | Ga0495621_0000186 | 3300046539 | Bacteria | 14274 |
| 480 | Ga0495597_0048143 | 3300046542 | Bacteria | 1886 |
| 481 | Ga0495667_0159711 | 3300046559 | Bacteria | 1450 |
| 482 | Ga0495625_0001549 | 3300046660 | Bacteria | 27422 |
| 483 | Ga0495625_0071759 | 3300046660 | Bacteria | 2429 |
| 484 | Ga0495658_0075922 | 3300046683 | Bacteria | 1963 |
| 485 | Ga0495658_0095825 | 3300046683 | Bacteria | 1764 |
| 486 | Ga0495649_0008664 | 3300046694 | Bacteria | 6107 |
| 487 | Ga0495672_0134309 | 3300047320 | Bacteria | 1299 |
| 488 | Ga0495676_0028995 | 3300047321 | Bacteria | 4718 |
| 489 | Ga0495687_001178 | 3300047443 | Bacteria | 25204 |
| 490 | Ga0495626_0014741 | 3300048091 | Bacteria | 4020 |
| 491 | Ga0496102_0027674 | 3300048905 | Bacteria | 5063 |
| 492 | Ga0496102_0035862 | 3300048905 | Bacteria | 4467 |
| 493 | Ga0496102_0357184 | 3300048905 | Bacteria | 1375 |
| 494 | Ga0496103_0048511 | 3300048906 | Bacteria | 2624 |
| 495 | Ga0496104_0040713 | 3300048907 | Bacteria | 4356 |
| 496 | Ga0496107_0164599 | 3300048910 | Bacteria | 1644 |
| 497 | Ga0496108_0089284 | 3300048911 | Bacteria | 2619 |
| 498 | Ga0496109_0016778 | 3300048912 | Bacteria | 6408 |
| 499 | Ga0496109_0114394 | 3300048912 | Bacteria | 2510 |
| 500 | Ga0496110_0002699 | 3300048913 | Bacteria | 13407 |
| 501 | Ga0496110_0080162 | 3300048913 | Bacteria | 2908 |
| 502 | Ga0496111_0007354 | 3300048914 | Bacteria | 7209 |
| 503 | Ga0496112_0120830 | 3300048915 | Bacteria | 2589 |
| 504 | Ga0496112_0395590 | 3300048915 | Bacteria | 1322 |
| 505 | Ga0496113_0151404 | 3300048916 | Bacteria | 1830 |
| 506 | Ga0496114_0002388 | 3300048917 | Bacteria | 14284 |
| 507 | Ga0496114_0050228 | 3300048917 | Bacteria | 3471 |
| 508 | Ga0496121_0040338 | 3300048924 | Bacteria | 4098 |
| 509 | Ga0496121_0103054 | 3300048924 | Bacteria | 2197 |
| 510 | Ga0496124_0000344 | 3300048927 | Bacteria | 85082 |
| 511 | Ga0496124_0073367 | 3300048927 | Bacteria | 2832 |
| 512 | Ga0496126_0397397 | 3300048929 | Bacteria | 1119 |
| 513 | Ga0501300_002135 | 3300049523 | Bacteria | 2945 |
| 514 | Ga0501033_0004389 | 3300049570 | Bacteria | 11303 |
| 515 | Ga0501033_0069214 | 3300049570 | Bacteria | 2594 |
| 516 | Ga0501034_0082652 | 3300049571 | Bacteria | 3213 |
| 517 | Ga0501034_0112378 | 3300049571 | Bacteria | 2714 |
| 518 | Ga0501034_0424909 | 3300049571 | Bacteria | 1249 |
| 519 | Ga0501036_0032714 | 3300049572 | Bacteria | 4396 |
| 520 | Ga0501036_0366043 | 3300049572 | Bacteria | 1203 |
| 521 | Ga0501038_0045228 | 3300049574 | Bacteria | 3822 |
| 522 | Ga0501038_0135965 | 3300049574 | Bacteria | 2014 |
| 523 | Ga0501039_0020771 | 3300049575 | Bacteria | 5033 |
| 524 | Ga0501042_0225088 | 3300049578 | Bacteria | 1353 |
| 525 | Ga0501043_0000053 | 3300049579 | Bacteria | 106085 |
| 526 | Ga0501043_0323223 | 3300049579 | Bacteria | 1176 |
| 527 | Ga0501046_0000018 | 3300049580 | Bacteria | 220589 |
| 528 | Ga0501047_0000020 | 3300049581 | Bacteria | 259377 |
| 529 | Ga0501047_0000450 | 3300049581 | Bacteria | 45480 |
| 530 | Ga0501047_0120364 | 3300049581 | Bacteria | 2507 |
| 531 | Ga0501048_0001721 | 3300049582 | Bacteria | 16679 |
| 532 | Ga0501070_0040069 | 3300049586 | Bacteria | 3907 |
| 533 | Ga0501073_0124316 | 3300049589 | Bacteria | 1788 |
| 534 | Ga0501198_000008 | 3300049649 | Bacteria | 129023 |
| 535 | Ga0501222_000006 | 3300049662 | Bacteria | 129030 |
| 536 | Ga0501222_000379 | 3300049662 | Bacteria | 6797 |
| 537 | Ga0501223_008869 | 3300049663 | Bacteria | 2046 |
| 538 | Ga0501233_001124 | 3300049668 | Bacteria | 4527 |
| 539 | Ga0501235_007250 | 3300049669 | Bacteria | 2419 |
| 540 | Ga0501229_000306 | 3300049706 | Bacteria | 5525 |
| 541 | Ga0501080_0008732 | 3300049742 | Bacteria | 9202 |
| 542 | Ga0501083_0085655 | 3300049744 | Bacteria | 2084 |
| 543 | Ga0501265_001741 | 3300049762 | Bacteria | 2470 |
| 544 | Ga0501035_0024881 | 3300049822 | Bacteria | 5490 |
| 545 | Ga0501035_0188752 | 3300049822 | Bacteria | 1773 |
| 546 | Ga0501044_0005424 | 3300049823 | Bacteria | 14164 |
| 547 | Ga0501044_0040165 | 3300049823 | Bacteria | 4877 |
| 548 | Ga0501044_0209651 | 3300049823 | Bacteria | 1903 |
| 549 | nmdc:mga03683_17461_c1 | 3300050489 | Bacteria | 2716 |
| 550 | nmdc:mga03683_225_c1 | 3300050489 | Bacteria | 17847 |
| 551 | nmdc:mga03683_96075_c1 | 3300050489 | Bacteria | 1297 |
| 552 | nmdc:mga03n38_29224_c1 | 3300050490 | Bacteria | 2305 |
| 553 | nmdc:mga03n38_47794_c1 | 3300050490 | Bacteria | 1896 |
| 554 | nmdc:mga00v17_108519_c1 | 3300050491 | Bacteria | 1759 |
| 555 | nmdc:mga0yw44_134354_c1 | 3300050492 | Bacteria | 1604 |
| 556 | nmdc:mga0yw44_2367_c1 | 3300050492 | Bacteria | 8005 |
| 557 | nmdc:mga0k408_1070_c1 | 3300050493 | Bacteria | 5611 |
| 558 | nmdc:mga0k408_112045_c1 | 3300050493 | Bacteria | 1613 |
| 559 | nmdc:mga0k408_1281_c1 | 3300050493 | Bacteria | 13618 |
| 560 | nmdc:mga0k408_16810_c2 | 3300050493 | Bacteria | 1840 |
| 561 | nmdc:mga0k408_1749_c1 | 3300050493 | Bacteria | 11633 |
| 562 | nmdc:mga0k408_226254_c1 | 3300050493 | Bacteria | 1117 |
| 563 | nmdc:mga0k408_330_c1 | 3300050493 | Bacteria | 25941 |
| 564 | nmdc:mga0k408_34111_c1 | 3300050493 | Bacteria | 2913 |
| 565 | nmdc:mga0k408_41753_c1 | 3300050493 | Bacteria | 2641 |
| 566 | nmdc:mga0k408_51273_c2 | 3300050493 | Bacteria | 1177 |
| 567 | nmdc:mga0k408_5951_c1 | 3300050493 | Bacteria | 6507 |
| 568 | nmdc:mga0k408_79678_c1 | 3300050493 | Bacteria | 1917 |
| 569 | nmdc:mga0k408_83212_c1 | 3300050493 | Bacteria | 1876 |
| 570 | nmdc:mga0k408_97238_c1 | 3300050493 | Bacteria | 1734 |
| 571 | nmdc:mga06z11_242838_c1 | 3300050494 | Bacteria | 1058 |
| 572 | nmdc:mga06z11_4773_c1 | 3300050494 | Bacteria | 5363 |
| 573 | nmdc:mga04h51_18533_c1 | 3300050495 | Bacteria | 2052 |
| 574 | nmdc:mga04h51_22170_c1 | 3300050495 | Bacteria | 1919 |
| 575 | nmdc:mga07m45_1145_c1 | 3300050496 | Bacteria | 11887 |
| 576 | nmdc:mga07m45_191_c1 | 3300050496 | Bacteria | 24330 |
| 577 | nmdc:mga07m45_20994_c1 | 3300050496 | Bacteria | 3552 |
| 578 | nmdc:mga07m45_22525_c1 | 3300050496 | Bacteria | 3440 |
| 579 | nmdc:mga07m45_32623_c1 | 3300050496 | Bacteria | 2888 |
| 580 | nmdc:mga07m45_3609_c1 | 3300050496 | Bacteria | 7474 |
| 581 | nmdc:mga07m45_6895_c1 | 3300050496 | Bacteria | 5778 |
| 582 | nmdc:mga07m45_7386_c1 | 3300050496 | Bacteria | 5614 |
| 583 | nmdc:mga07m45_80696_c1 | 3300050496 | Bacteria | 1857 |
| 584 | nmdc:mga05p37_243536_c1 | 3300050507 | Bacteria | 2161 |
| 585 | nmdc:mga09592_171580_c1 | 3300050508 | Bacteria | 1876 |
| 586 | nmdc:mga09592_32016_c1 | 3300050508 | Bacteria | 4383 |
| 587 | nmdc:mga0qj67_142164_c1 | 3300050509 | Bacteria | 1946 |
| 588 | nmdc:mga06r32_119501_c1 | 3300050510 | Bacteria | 2599 |
| 589 | nmdc:mga06r32_16794_c1 | 3300050510 | Bacteria | 6673 |
| 590 | nmdc:mga08y16_397516_c1 | 3300050511 | Bacteria | 1411 |
| 591 | nmdc:mga08y16_432827_c1 | 3300050511 | Bacteria | 1343 |
| 592 | nmdc:mga0n895_12302_c1 | 3300050512 | Bacteria | 7671 |
| 593 | nmdc:mga0rr50_160975_c1 | 3300050513 | Bacteria | 1822 |
| 594 | nmdc:mga0a205_2105_c1 | 3300050515 | Bacteria | 17452 |
| 595 | Ga0495619_0104564 | 3300053085 | Bacteria | 1930 |
| 596 | Ga0500578_0002292 | 3300053086 | Bacteria | 16416 |
| 597 | Ga0500644_0000369 | 3300053088 | Bacteria | 22061 |
| 598 | Ga0500644_0045667 | 3300053088 | Bacteria | 1477 |
| 599 | Ga0500646_0002920 | 3300053090 | Bacteria | 4387 |
| 600 | Ga0500651_0026657 | 3300053093 | Bacteria | 3634 |
| 601 | Ga0500651_0036230 | 3300053093 | Bacteria | 3109 |
| 602 | Ga0500651_0138644 | 3300053093 | Bacteria | 1467 |
| 603 | Ga0500566_0176182 | 3300053094 | Bacteria | 1101 |
| 604 | Ga0500641_0001080 | 3300053096 | Bacteria | 9716 |
| 605 | Ga0500562_032977 | 3300053108 | Bacteria | 1368 |
| 606 | Ga0500569_015919 | 3300053109 | Bacteria | 1894 |
| 607 | Ga0500593_000112 | 3300053117 | Bacteria | 31359 |
| 608 | Ga0500594_0000801 | 3300053118 | Bacteria | 6704 |
| 609 | Ga0500594_0056879 | 3300053118 | Bacteria | 1117 |
| 610 | Ga0500642_0000226 | 3300053130 | Bacteria | 22146 |
| 611 | Ga0500652_001118 | 3300053131 | Bacteria | 8634 |
| 612 | Ga0500652_051291 | 3300053131 | Bacteria | 1685 |
| 613 | Ga0500658_0006490 | 3300053134 | Bacteria | 4337 |
| 614 | Ga0500658_0045469 | 3300053134 | Bacteria | 1775 |
| 615 | Ga0500559_0000069 | 3300053136 | Bacteria | 82288 |
| 616 | Ga0500577_0014963 | 3300053142 | Bacteria | 2412 |
| 617 | Ga0500590_012594 | 3300053148 | Bacteria | 4315 |
| 618 | Ga0500619_000115 | 3300053154 | Bacteria | 21281 |
| 619 | Ga0500622_0000881 | 3300053156 | Bacteria | 25562 |
| 620 | Ga0500622_0002263 | 3300053156 | Bacteria | 14137 |
| 621 | Ga0500622_0002736 | 3300053156 | Bacteria | 12446 |
| 622 | Ga0500645_000143 | 3300053730 | Bacteria | 56081 |
| 623 | Ga0500552_000173 | 3300053733 | Bacteria | 5642 |
| 624 | Ga0500587_001168 | 3300053739 | Bacteria | 3627 |
| 625 | Ga0500587_001948 | 3300053739 | Bacteria | 2944 |
| 626 | Ga0590071_001052 | 3300059421 | Bacteria | 7476 |
| 627 | Ga0501082_0027134 | 3300060353 | Bacteria | 4933 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035724 | Ga0373933_0098175 | Ga0373933_0098175_25_837 | 268 |
| 2 | 3300044694 | Ga0466963_0162299 | Ga0466963_0162299_582_1397 | 269 |
| 3 | 3300005439 | Ga0070711_100211429 | Ga0070711_1002114292 | 281 |
| 4 | 3300006175 | Ga0070712_100045885 | Ga0070712_1000458852 | 281 |
| 5 | 3300025297 | Ga0209758_1031198 | Ga0209758_10311982 | 281 |
| 6 | 3300025915 | Ga0207693_10012757 | Ga0207693_100127574 | 281 |
| 7 | 3300025916 | Ga0207663_10032461 | Ga0207663_100324612 | 281 |
| 8 | 3300047320 | Ga0495672_0134309 | Ga0495672_0134309_358_1209 | 281 |
| 9 | 3300049570 | Ga0501033_0004389 | Ga0501033_0004389_4930_5781 | 281 |
| 10 | 3300049581 | Ga0501047_0120364 | Ga0501047_0120364_1464_2315 | 281 |
| 11 | 3300049823 | Ga0501044_0005424 | Ga0501044_0005424_9621_10472 | 281 |
| 12 | 3300025926 | Ga0207659_10044568 | Ga0207659_100445682 | 289 |
| 13 | 3300014968 | Ga0157379_10000359 | Ga0157379_100003594 | 292 |
| 14 | 3300046472 | Ga0495580_0072083 | Ga0495580_0072083_881_1876 | 293 |
| 15 | iso_pu_bacteria | 3003930520 | 3003934594 | 293 |
| 16 | 3300050494 | nmdc:mga06z11_242838_c1 | nmdc:mga06z11_242838_c1_13_906 | 295 |
| 17 | 3300009551 | Ga0105238_10008735 | Ga0105238_100087353 | 296 |
| 18 | 3300048924 | Ga0496121_0103054 | Ga0496121_0103054_867_1763 | 296 |
| 19 | 3300053093 | Ga0500651_0036230 | Ga0500651_0036230_167_1075 | 296 |
| 20 | 3300053108 | Ga0500562_032977 | Ga0500562_032977_315_1223 | 296 |
| 21 | 3300005331 | Ga0070670_100371698 | Ga0070670_1003716981 | 297 |
| 22 | 3300005344 | Ga0070661_100100993 | Ga0070661_1001009932 | 297 |
| 23 | 3300005355 | Ga0070671_100181600 | Ga0070671_1001816002 | 297 |
| 24 | 3300006177 | Ga0075362_10000173 | Ga0075362_100001732 | 297 |
| 25 | 3300009545 | Ga0105237_10020538 | Ga0105237_100205384 | 297 |
| 26 | 3300021377 | Ga0213874_10069374 | Ga0213874_100693741 | 297 |
| 27 | 3300025920 | Ga0207649_10065713 | Ga0207649_100657132 | 297 |
| 28 | 3300026142 | Ga0207698_10254220 | Ga0207698_102542202 | 297 |
| 29 | 3300031241 | Ga0265325_10013360 | Ga0265325_100133604 | 297 |
| 30 | 3300031249 | Ga0265339_10026808 | Ga0265339_100268082 | 297 |
| 31 | 3300031250 | Ga0265331_10030192 | Ga0265331_100301921 | 297 |
| 32 | 3300031711 | Ga0265314_10008364 | Ga0265314_100083643 | 297 |
| 33 | 3300031712 | Ga0265342_10158482 | Ga0265342_101584822 | 297 |
| 34 | 3300033528 | Ga0316588_1001033 | Ga0316588_10010331 | 297 |
| 35 | 3300039450 | Ga0436363_0086029 | Ga0436363_0086029_26_931 | 297 |
| 36 | 3300039450 | Ga0436363_0610754 | Ga0436363_0610754_3793_4701 | 297 |
| 37 | 3300039450 | Ga0436363_1060569 | Ga0436363_1060569_166_1068 | 297 |
| 38 | 3300039453 | Ga0436362_1278682 | Ga0436362_1278682_693_1601 | 297 |
| 39 | 3300048929 | Ga0496126_0397397 | Ga0496126_0397397_165_1076 | 297 |
| 40 | 3300049570 | Ga0501033_0069214 | Ga0501033_0069214_1191_2093 | 297 |
| 41 | 3300049571 | Ga0501034_0082652 | Ga0501034_0082652_159_1061 | 297 |
| 42 | 3300049571 | Ga0501034_0112378 | Ga0501034_0112378_1742_2653 | 297 |
| 43 | 3300049571 | Ga0501034_0424909 | Ga0501034_0424909_85_987 | 297 |
| 44 | 3300049572 | Ga0501036_0032714 | Ga0501036_0032714_1832_2734 | 297 |
| 45 | 3300049572 | Ga0501036_0366043 | Ga0501036_0366043_255_1157 | 297 |
| 46 | 3300049574 | Ga0501038_0045228 | Ga0501038_0045228_1046_1948 | 297 |
| 47 | 3300049574 | Ga0501038_0135965 | Ga0501038_0135965_1029_1940 | 297 |
| 48 | 3300049575 | Ga0501039_0020771 | Ga0501039_0020771_571_1473 | 297 |
| 49 | 3300049586 | Ga0501070_0040069 | Ga0501070_0040069_2501_3403 | 297 |
| 50 | 3300049589 | Ga0501073_0124316 | Ga0501073_0124316_677_1588 | 297 |
| 51 | 3300049822 | Ga0501035_0024881 | Ga0501035_0024881_2715_3617 | 297 |
| 52 | 3300049823 | Ga0501044_0040165 | Ga0501044_0040165_2328_3230 | 297 |
| 53 | 3300050489 | nmdc:mga03683_225_c1 | nmdc:mga03683_225_c1_15012_15926 | 297 |
| 54 | 3300053088 | Ga0500644_0000369 | Ga0500644_0000369_5921_6832 | 297 |
| 55 | 3300053096 | Ga0500641_0001080 | Ga0500641_0001080_4203_5114 | 297 |
| 56 | 3300053118 | Ga0500594_0056879 | Ga0500594_0056879_30_941 | 297 |
| 57 | iso_pu_bacteria | 2522572158 | 2523105150 | 297 |
| 58 | 3300005985 | Ga0081539_10003077 | Ga0081539_1000307713 | 298 |
| 59 | 3300005434 | Ga0070709_10005663 | Ga0070709_100056634 | 299 |
| 60 | 3300021377 | Ga0213874_10013580 | Ga0213874_100135802 | 299 |
| 61 | 3300025972 | Ga0207668_10005534 | Ga0207668_100055342 | 299 |
| 62 | 3300039450 | Ga0436363_1578922 | Ga0436363_1578922_2418_3353 | 299 |
| 63 | 3300013104 | Ga0157370_10019246 | Ga0157370_100192463 | 300 |
| 64 | 3300028379 | Ga0268266_10007319 | Ga0268266_100073192 | 300 |
| 65 | 3300039447 | Ga0436361_0369025 | Ga0436361_0369025_28_957 | 300 |
| 66 | 3300005844 | Ga0068862_100006190 | Ga0068862_1000061906 | 301 |
| 67 | 3300006195 | Ga0075366_10039587 | Ga0075366_100395874 | 301 |
| 68 | 3300005543 | Ga0070672_100038681 | Ga0070672_1000386813 | 302 |
| 69 | 3300025923 | Ga0207681_10029245 | Ga0207681_100292452 | 302 |
| 70 | 3300025940 | Ga0207691_10070487 | Ga0207691_100704874 | 302 |
| 71 | 3300039450 | Ga0436363_0024718 | Ga0436363_0024718_285_1220 | 302 |
| 72 | 3300046539 | Ga0495621_0000186 | Ga0495621_0000186_9813_10784 | 302 |
| 73 | iso_pu_bacteria | 2824732956 | 2824737709 | 302 |
| 74 | iso_pu_bacteria | 2824746037 | 2824748649 | 302 |
| 75 | iso_pu_bacteria | 2908775508 | 2908776325 | 302 |
| 76 | 3300005327 | Ga0070658_10305120 | Ga0070658_103051202 | 303 |
| 77 | 3300005337 | Ga0070682_100050418 | Ga0070682_1000504182 | 303 |
| 78 | 3300005345 | Ga0070692_10012635 | Ga0070692_100126351 | 303 |
| 79 | 3300005356 | Ga0070674_100020712 | Ga0070674_1000207123 | 303 |
| 80 | 3300005366 | Ga0070659_100041211 | Ga0070659_1000412114 | 303 |
| 81 | 3300005367 | Ga0070667_100344714 | Ga0070667_1003447142 | 303 |
| 82 | 3300005459 | Ga0068867_100158774 | Ga0068867_1001587742 | 303 |
| 83 | 3300005535 | Ga0070684_100099095 | Ga0070684_1000990953 | 303 |
| 84 | 3300006358 | Ga0068871_100249139 | Ga0068871_1002491392 | 303 |
| 85 | 3300009545 | Ga0105237_10216349 | Ga0105237_102163492 | 303 |
| 86 | 3300009551 | Ga0105238_10366693 | Ga0105238_103666932 | 303 |
| 87 | 3300013306 | Ga0163162_10079187 | Ga0163162_100791873 | 303 |
| 88 | 3300013308 | Ga0157375_10262067 | Ga0157375_102620673 | 303 |
| 89 | 3300014745 | Ga0157377_10135781 | Ga0157377_101357812 | 303 |
| 90 | 3300014968 | Ga0157379_10421815 | Ga0157379_104218152 | 303 |
| 91 | 3300017792 | Ga0163161_10215640 | Ga0163161_102156402 | 303 |
| 92 | 3300025901 | Ga0207688_10100344 | Ga0207688_101003442 | 303 |
| 93 | 3300025909 | Ga0207705_10066616 | Ga0207705_100666162 | 303 |
| 94 | 3300025921 | Ga0207652_10334321 | Ga0207652_103343212 | 303 |
| 95 | 3300025926 | Ga0207659_10322558 | Ga0207659_103225582 | 303 |
| 96 | 3300025937 | Ga0207669_10030762 | Ga0207669_100307623 | 303 |
| 97 | 3300025942 | Ga0207689_10087815 | Ga0207689_100878152 | 303 |
| 98 | 3300025981 | Ga0207640_10478093 | Ga0207640_104780931 | 303 |
| 99 | 3300026035 | Ga0207703_10313091 | Ga0207703_103130912 | 303 |
| 100 | 3300026089 | Ga0207648_10288666 | Ga0207648_102886662 | 303 |
| 101 | 3300028794 | Ga0307515_10000004 | Ga0307515_10000004337 | 303 |
| 102 | 3300031711 | Ga0265314_10066066 | Ga0265314_100660663 | 303 |
| 103 | 3300037471 | Ga0395905_0001385 | Ga0395905_0001385_17005_17928 | 303 |
| 104 | 3300045051 | Ga0451576_0061714 | Ga0451576_0061714_1328_2248 | 303 |
| 105 | 3300046559 | Ga0495667_0159711 | Ga0495667_0159711_181_1113 | 303 |
| 106 | 3300048905 | Ga0496102_0357184 | Ga0496102_0357184_130_1050 | 303 |
| 107 | 3300048906 | Ga0496103_0048511 | Ga0496103_0048511_135_1055 | 303 |
| 108 | 3300048910 | Ga0496107_0164599 | Ga0496107_0164599_707_1627 | 303 |
| 109 | 3300048911 | Ga0496108_0089284 | Ga0496108_0089284_1340_2260 | 303 |
| 110 | 3300048912 | Ga0496109_0016778 | Ga0496109_0016778_5453_6373 | 303 |
| 111 | 3300048913 | Ga0496110_0002699 | Ga0496110_0002699_7134_8054 | 303 |
| 112 | 3300048914 | Ga0496111_0007354 | Ga0496111_0007354_2734_3654 | 303 |
| 113 | 3300049579 | Ga0501043_0323223 | Ga0501043_0323223_81_1010 | 303 |
| 114 | 3300049649 | Ga0501198_000008 | Ga0501198_000008_22510_23469 | 303 |
| 115 | 3300049662 | Ga0501222_000006 | Ga0501222_000006_105575_106534 | 303 |
| 116 | 3300053085 | Ga0495619_0104564 | Ga0495619_0104564_646_1578 | 303 |
| 117 | iso_pu_bacteria | 2513237161 | 2514012535 | 303 |
| 118 | iso_pu_bacteria | 2617270741 | 2617373808 | 303 |
| 119 | iso_pu_bacteria | 2838122688 | 2838124566 | 303 |
| 120 | iso_pu_bacteria | 2841941048 | 2841945253 | 303 |
| 121 | iso_pu_bacteria | 2841949485 | 2841952034 | 303 |
| 122 | iso_pu_bacteria | 2841974524 | 2841981821 | 303 |
| 123 | iso_pu_bacteria | 2841983080 | 2841985099 | 303 |
| 124 | iso_pu_bacteria | 2842038055 | 2842043456 | 303 |
| 125 | iso_pu_bacteria | 2842045827 | 2842052554 | 303 |
| 126 | 3300009093 | Ga0105240_10001280 | Ga0105240_1000128026 | 304 |
| 127 | 3300009553 | Ga0105249_10530849 | Ga0105249_105308492 | 304 |
| 128 | 3300021320 | Ga0214544_1000016 | Ga0214544_1000016124 | 304 |
| 129 | 3300021321 | Ga0214542_1000016 | Ga0214542_100001678 | 304 |
| 130 | 3300021324 | Ga0214545_1000008 | Ga0214545_100000884 | 304 |
| 131 | 3300021327 | Ga0214543_1000043 | Ga0214543_100004334 | 304 |
| 132 | 3300033180 | Ga0307510_10002474 | Ga0307510_100024747 | 304 |
| 133 | 3300037471 | Ga0395905_0015223 | Ga0395905_0015223_5085_6059 | 304 |
| 134 | 3300037853 | Ga0436364_1183040 | Ga0436364_1183040_438_1388 | 304 |
| 135 | 3300044656 | Ga0466969_0024691 | Ga0466969_0024691_1789_2763 | 304 |
| 136 | 3300044693 | Ga0466961_0000074 | Ga0466961_0000074_29524_30498 | 304 |
| 137 | 3300045049 | Ga0466959_0060757 | Ga0466959_0060757_753_1727 | 304 |
| 138 | 3300053094 | Ga0500566_0176182 | Ga0500566_0176182_18_989 | 304 |
| 139 | iso_pu_bacteria | 2874620515 | 2874624841 | 304 |
| 140 | iso_pu_bacteria | 2904666416 | 2904670204 | 304 |
| 141 | iso_pu_bacteria | 2935648319 | 2935653568 | 304 |
| 142 | iso_pu_bacteria | 2935656913 | 2935662317 | 304 |
| 143 | iso_pu_bacteria | 2935984226 | 2935985194 | 304 |
| 144 | iso_pu_bacteria | 2936011229 | 2936016619 | 304 |
| 145 | iso_pu_bacteria | 2936019824 | 2936025252 | 304 |
| 146 | iso_pu_bacteria | 2936028420 | 2936034094 | 304 |
| 147 | iso_pu_bacteria | 2936046547 | 2936052151 | 304 |
| 148 | iso_pu_bacteria | 2936055302 | 2936056366 | 304 |
| 149 | iso_pu_bacteria | 3005587118 | 3005591567 | 304 |
| 150 | iso_pu_bacteria | 8016630954 | 8016635567 | 304 |
| 151 | 3300001990 | JGI24737J22298_10041977 | JGI24737J22298_100419772 | 305 |
| 152 | 3300003215 | JGI25153J46596_10002417 | JGI25153J46596_100024176 | 305 |
| 153 | 3300003794 | Ga0055531_10004532 | Ga0055531_100045324 | 305 |
| 154 | 3300005262 | Ga0065165_1003542 | Ga0065165_10035427 | 305 |
| 155 | 3300005366 | Ga0070659_100058088 | Ga0070659_1000580882 | 305 |
| 156 | 3300005445 | Ga0070708_100032815 | Ga0070708_1000328154 | 305 |
| 157 | 3300005467 | Ga0070706_100026361 | Ga0070706_1000263614 | 305 |
| 158 | 3300005467 | Ga0070706_100143194 | Ga0070706_1001431942 | 305 |
| 159 | 3300005471 | Ga0070698_100068205 | Ga0070698_1000682053 | 305 |
| 160 | 3300005471 | Ga0070698_100155566 | Ga0070698_1001555662 | 305 |
| 161 | 3300005518 | Ga0070699_100131099 | Ga0070699_1001310993 | 305 |
| 162 | 3300005536 | Ga0070697_100025130 | Ga0070697_1000251303 | 305 |
| 163 | 3300006048 | Ga0075363_100000538 | Ga0075363_1000005385 | 305 |
| 164 | 3300006051 | Ga0075364_10198425 | Ga0075364_101984252 | 305 |
| 165 | 3300006178 | Ga0075367_10115022 | Ga0075367_101150222 | 305 |
| 166 | 3300006844 | Ga0075428_100019815 | Ga0075428_1000198152 | 305 |
| 167 | 3300006844 | Ga0075428_100573053 | Ga0075428_1005730531 | 305 |
| 168 | 3300006846 | Ga0075430_100158637 | Ga0075430_1001586372 | 305 |
| 169 | 3300006847 | Ga0075431_100290698 | Ga0075431_1002906982 | 305 |
| 170 | 3300006852 | Ga0075433_10001288 | Ga0075433_1000128818 | 305 |
| 171 | 3300006871 | Ga0075434_100002418 | Ga0075434_1000024182 | 305 |
| 172 | 3300006914 | Ga0075436_100033776 | Ga0075436_1000337763 | 305 |
| 173 | 3300007076 | Ga0075435_100006694 | Ga0075435_1000066946 | 305 |
| 174 | 3300009093 | Ga0105240_10161787 | Ga0105240_101617872 | 305 |
| 175 | 3300009147 | Ga0114129_10443967 | Ga0114129_104439672 | 305 |
| 176 | 3300010375 | Ga0105239_10144427 | Ga0105239_101444272 | 305 |
| 177 | 3300025295 | Ga0209564_1005871 | Ga0209564_10058713 | 305 |
| 178 | 3300025297 | Ga0209758_1000069 | Ga0209758_1000069105 | 305 |
| 179 | 3300025299 | Ga0209256_1005586 | Ga0209256_10055862 | 305 |
| 180 | 3300025304 | Ga0209257_1000564 | Ga0209257_100056441 | 305 |
| 181 | 3300025910 | Ga0207684_10055446 | Ga0207684_100554463 | 305 |
| 182 | 3300025913 | Ga0207695_10057886 | Ga0207695_100578862 | 305 |
| 183 | 3300035725 | Ga0373947_0029221 | Ga0373947_0029221_1167_2129 | 305 |
| 184 | 3300050489 | nmdc:mga03683_96075_c1 | nmdc:mga03683_96075_c1_182_1144 | 305 |
| 185 | 3300050490 | nmdc:mga03n38_29224_c1 | nmdc:mga03n38_29224_c1_204_1127 | 305 |
| 186 | 3300050493 | nmdc:mga0k408_41753_c1 | nmdc:mga0k408_41753_c1_1086_2048 | 305 |
| 187 | 3300050507 | nmdc:mga05p37_243536_c1 | nmdc:mga05p37_243536_c1_110_1072 | 305 |
| 188 | 3300050508 | nmdc:mga09592_171580_c1 | nmdc:mga09592_171580_c1_582_1544 | 305 |
| 189 | 3300050510 | nmdc:mga06r32_119501_c1 | nmdc:mga06r32_119501_c1_268_1230 | 305 |
| 190 | 3300050510 | nmdc:mga06r32_16794_c1 | nmdc:mga06r32_16794_c1_3450_4412 | 305 |
| 191 | 3300050512 | nmdc:mga0n895_12302_c1 | nmdc:mga0n895_12302_c1_1983_2945 | 305 |
| 192 | 3300050513 | nmdc:mga0rr50_160975_c1 | nmdc:mga0rr50_160975_c1_176_1138 | 305 |
| 193 | 3300050515 | nmdc:mga0a205_2105_c1 | nmdc:mga0a205_2105_c1_15806_16768 | 305 |
| 194 | iso_pu_bacteria | 2802428858 | 2802722132 | 305 |
| 195 | iso_pu_bacteria | 2802428862 | 2802747757 | 305 |
| 196 | iso_pu_bacteria | 2824671348 | 2824674390 | 305 |
| 197 | iso_pu_bacteria | 2824687955 | 2824691112 | 305 |
| 198 | iso_pu_bacteria | 2841966195 | 2841970572 | 305 |
| 199 | iso_pu_bacteria | 2960693952 | 2960694723 | 305 |
| 200 | 3300003752 | Ga0055539_1003304 | Ga0055539_10033042 | 306 |
| 201 | 3300005937 | Ga0081455_10040926 | Ga0081455_100409263 | 306 |
| 202 | 3300025253 | Ga0209677_100522 | Ga0209677_1005222 | 306 |
| 203 | 3300025272 | Ga0209455_1001225 | Ga0209455_100122510 | 306 |
| 204 | 3300026116 | Ga0207674_10019011 | Ga0207674_100190112 | 306 |
| 205 | 3300028563 | Ga0265319_1025651 | Ga0265319_10256512 | 306 |
| 206 | 3300028653 | Ga0265323_10005053 | Ga0265323_100050532 | 306 |
| 207 | 3300028666 | Ga0265336_10002549 | Ga0265336_100025492 | 306 |
| 208 | 3300028800 | Ga0265338_10001066 | Ga0265338_1000106648 | 306 |
| 209 | 3300039447 | Ga0436361_0825317 | Ga0436361_0825317_123_1097 | 306 |
| 210 | 3300046533 | Ga0495640_0046861 | Ga0495640_0046861_693_1679 | 306 |
| 211 | 3300048924 | Ga0496121_0040338 | Ga0496121_0040338_1479_2447 | 306 |
| 212 | 3300050492 | nmdc:mga0yw44_2367_c1 | nmdc:mga0yw44_2367_c1_3364_4365 | 306 |
| 213 | 3300053130 | Ga0500642_0000226 | Ga0500642_0000226_17271_18236 | 306 |
| 214 | 3300053730 | Ga0500645_000143 | Ga0500645_000143_14683_15660 | 306 |
| 215 | iso_pu_bacteria | 2847930680 | 2847931125 | 306 |
| 216 | 3300005293 | Ga0065715_10023582 | Ga0065715_100235822 | 307 |
| 217 | 3300005331 | Ga0070670_100001786 | Ga0070670_1000017869 | 307 |
| 218 | 3300005353 | Ga0070669_100048889 | Ga0070669_1000488892 | 307 |
| 219 | 3300005354 | Ga0070675_100007685 | Ga0070675_1000076856 | 307 |
| 220 | 3300005355 | Ga0070671_100013507 | Ga0070671_1000135076 | 307 |
| 221 | 3300005356 | Ga0070674_100004831 | Ga0070674_1000048316 | 307 |
| 222 | 3300005364 | Ga0070673_100020575 | Ga0070673_1000205755 | 307 |
| 223 | 3300005456 | Ga0070678_100002432 | Ga0070678_1000024327 | 307 |
| 224 | 3300005459 | Ga0068867_100003245 | Ga0068867_1000032451 | 307 |
| 225 | 3300005543 | Ga0070672_100000447 | Ga0070672_1000004479 | 307 |
| 226 | 3300005548 | Ga0070665_100004803 | Ga0070665_1000048037 | 307 |
| 227 | 3300005937 | Ga0081455_10002830 | Ga0081455_1000283011 | 307 |
| 228 | 3300005937 | Ga0081455_10018432 | Ga0081455_100184326 | 307 |
| 229 | 3300005937 | Ga0081455_10055397 | Ga0081455_100553973 | 307 |
| 230 | 3300005985 | Ga0081539_10001822 | Ga0081539_1000182218 | 307 |
| 231 | 3300006195 | Ga0075366_10013336 | Ga0075366_100133362 | 307 |
| 232 | 3300007265 | Ga0099794_10093503 | Ga0099794_100935032 | 307 |
| 233 | 3300009094 | Ga0111539_10298879 | Ga0111539_102988792 | 307 |
| 234 | 3300009545 | Ga0105237_10184429 | Ga0105237_101844292 | 307 |
| 235 | 3300013105 | Ga0157369_10384195 | Ga0157369_103841952 | 307 |
| 236 | 3300017792 | Ga0163161_10011249 | Ga0163161_100112494 | 307 |
| 237 | 3300025315 | Ga0207697_10032538 | Ga0207697_100325382 | 307 |
| 238 | 3300025893 | Ga0207682_10000748 | Ga0207682_1000074813 | 307 |
| 239 | 3300025901 | Ga0207688_10075364 | Ga0207688_100753642 | 307 |
| 240 | 3300025920 | Ga0207649_10116700 | Ga0207649_101167002 | 307 |
| 241 | 3300025923 | Ga0207681_10043404 | Ga0207681_100434044 | 307 |
| 242 | 3300025925 | Ga0207650_10000783 | Ga0207650_100007838 | 307 |
| 243 | 3300025926 | Ga0207659_10000307 | Ga0207659_1000030729 | 307 |
| 244 | 3300025937 | Ga0207669_10002758 | Ga0207669_100027584 | 307 |
| 245 | 3300025940 | Ga0207691_10003997 | Ga0207691_100039978 | 307 |
| 246 | 3300025960 | Ga0207651_10032204 | Ga0207651_100322041 | 307 |
| 247 | 3300025986 | Ga0207658_10075072 | Ga0207658_100750723 | 307 |
| 248 | 3300026089 | Ga0207648_10030699 | Ga0207648_100306991 | 307 |
| 249 | 3300026121 | Ga0207683_10001684 | Ga0207683_100016847 | 307 |
| 250 | 3300028379 | Ga0268266_10001895 | Ga0268266_1000189513 | 307 |
| 251 | 3300028379 | Ga0268266_10084814 | Ga0268266_100848144 | 307 |
| 252 | 3300032002 | Ga0307416_100167725 | Ga0307416_1001677252 | 307 |
| 253 | 3300037466 | Ga0395898_0080691 | Ga0395898_0080691_849_1964 | 307 |
| 254 | 3300039438 | Ga0436360_0130330 | Ga0436360_0130330_352_1320 | 307 |
| 255 | 3300039447 | Ga0436361_0208451 | Ga0436361_0208451_969_1937 | 307 |
| 256 | 3300042001 | Ga0439441_011679 | Ga0439441_011679_125_1084 | 307 |
| 257 | 3300045976 | Ga0466967_0025238 | Ga0466967_0025238_2707_3669 | 307 |
| 258 | 3300046533 | Ga0495640_0060812 | Ga0495640_0060812_134_1150 | 307 |
| 259 | 3300049822 | Ga0501035_0188752 | Ga0501035_0188752_635_1603 | 307 |
| 260 | 3300049823 | Ga0501044_0209651 | Ga0501044_0209651_43_1011 | 307 |
| 261 | 3300050493 | nmdc:mga0k408_16810_c2 | nmdc:mga0k408_16810_c2_35_1003 | 307 |
| 262 | 3300053088 | Ga0500644_0045667 | Ga0500644_0045667_434_1399 | 307 |
| 263 | 3300053733 | Ga0500552_000173 | Ga0500552_000173_3213_4184 | 307 |
| 264 | 3300005844 | Ga0068862_100004055 | Ga0068862_10000405510 | 308 |
| 265 | 3300028380 | Ga0268265_10005004 | Ga0268265_100050042 | 308 |
| 266 | 3300003763 | Ga0055529_1001253 | Ga0055529_10012536 | 309 |
| 267 | 3300025228 | Ga0209672_103607 | Ga0209672_1036073 | 309 |
| 268 | 3300025242 | Ga0209258_107796 | Ga0209258_1077962 | 309 |
| 269 | 3300025272 | Ga0209455_1000528 | Ga0209455_100052823 | 309 |
| 270 | 3300049581 | Ga0501047_0000450 | Ga0501047_0000450_1508_2470 | 309 |
| 271 | 3300049742 | Ga0501080_0008732 | Ga0501080_0008732_8070_9032 | 309 |
| 272 | 3300049744 | Ga0501083_0085655 | Ga0501083_0085655_659_1621 | 309 |
| 273 | 3300060353 | Ga0501082_0027134 | Ga0501082_0027134_2251_3213 | 309 |
| 274 | 3300025304 | Ga0209257_1013434 | Ga0209257_10134341 | 310 |
| 275 | iso_pu_bacteria | 2547132374 | 2548498666 | 310 |
| 276 | iso_pu_bacteria | 2643221596 | 2643990674 | 310 |
| 277 | iso_pu_bacteria | 2643221717 | 2644649398 | 310 |
| 278 | 3300021361 | Ga0213872_10000102 | Ga0213872_1000010238 | 313 |
| 279 | iso_pu_bacteria | 2588253510 | 2588295546 | 313 |
| 280 | iso_pu_bacteria | 2643221660 | 2644340032 | 313 |
| 281 | iso_pu_bacteria | 2831864461 | 2831866058 | 313 |
| 282 | iso_pu_bacteria | 2886848708 | 2886851530 | 313 |
| 283 | iso_pu_bacteria | 2585428057 | 2587730287 | 315 |
| 284 | iso_pu_bacteria | 2585428062 | 2587755772 | 315 |
| 285 | iso_pu_bacteria | 2588253510 | 2588294175 | 315 |
| 286 | iso_pu_bacteria | 2643221544 | 2643742485 | 315 |
| 287 | iso_pu_bacteria | 2643221585 | 2643933487 | 315 |
| 288 | iso_pu_bacteria | 2643221639 | 2644222153 | 315 |
| 289 | iso_pu_bacteria | 2643221644 | 2644245646 | 315 |
| 290 | iso_pu_bacteria | 2643221646 | 2644257071 | 315 |
| 291 | iso_pu_bacteria | 2643221654 | 2644301977 | 315 |
| 292 | iso_pu_bacteria | 2643221656 | 2644314736 | 315 |
| 293 | iso_pu_bacteria | 2738541337 | 2739055373 | 315 |
| 294 | 3300005347 | Ga0070668_100010300 | Ga0070668_1000103004 | 316 |
| 295 | 3300005355 | Ga0070671_100007621 | Ga0070671_1000076218 | 316 |
| 296 | 3300005356 | Ga0070674_100059339 | Ga0070674_1000593391 | 316 |
| 297 | 3300005356 | Ga0070674_100241061 | Ga0070674_1002410612 | 316 |
| 298 | 3300005367 | Ga0070667_100327322 | Ga0070667_1003273221 | 316 |
| 299 | 3300005617 | Ga0068859_100012341 | Ga0068859_1000123414 | 316 |
| 300 | 3300005617 | Ga0068859_100371854 | Ga0068859_1003718541 | 316 |
| 301 | 3300005719 | Ga0068861_100002083 | Ga0068861_10000208311 | 316 |
| 302 | 3300005843 | Ga0068860_100003217 | Ga0068860_1000032172 | 316 |
| 303 | 3300006195 | Ga0075366_10011930 | Ga0075366_100119305 | 316 |
| 304 | 3300006931 | Ga0097620_100012343 | Ga0097620_1000123434 | 316 |
| 305 | 3300006931 | Ga0097620_100371847 | Ga0097620_1003718471 | 316 |
| 306 | 3300009148 | Ga0105243_10103366 | Ga0105243_101033662 | 316 |
| 307 | 3300009177 | Ga0105248_10000537 | Ga0105248_1000053731 | 316 |
| 308 | 3300009177 | Ga0105248_10062185 | Ga0105248_100621855 | 316 |
| 309 | 3300009553 | Ga0105249_10067688 | Ga0105249_100676883 | 316 |
| 310 | 3300013306 | Ga0163162_10004268 | Ga0163162_100042683 | 316 |
| 311 | 3300013308 | Ga0157375_10094576 | Ga0157375_100945764 | 316 |
| 312 | 3300014326 | Ga0157380_10086958 | Ga0157380_100869582 | 316 |
| 313 | 3300014968 | Ga0157379_10007067 | Ga0157379_100070676 | 316 |
| 314 | 3300025899 | Ga0207642_10006672 | Ga0207642_100066723 | 316 |
| 315 | 3300025931 | Ga0207644_10013045 | Ga0207644_100130456 | 316 |
| 316 | 3300025937 | Ga0207669_10061484 | Ga0207669_100614841 | 316 |
| 317 | 3300025941 | Ga0207711_10017338 | Ga0207711_100173386 | 316 |
| 318 | 3300025961 | Ga0207712_10090818 | Ga0207712_100908182 | 316 |
| 319 | 3300025986 | Ga0207658_10149502 | Ga0207658_101495022 | 316 |
| 320 | 3300026075 | Ga0207708_10012895 | Ga0207708_100128953 | 316 |
| 321 | 3300026088 | Ga0207641_10060413 | Ga0207641_100604134 | 316 |
| 322 | 3300026089 | Ga0207648_10002165 | Ga0207648_1000216514 | 316 |
| 323 | 3300026095 | Ga0207676_10192200 | Ga0207676_101922002 | 316 |
| 324 | 3300026118 | Ga0207675_100004351 | Ga0207675_1000043516 | 316 |
| 325 | 3300028381 | Ga0268264_10003397 | Ga0268264_1000339714 | 316 |
| 326 | 3300028794 | Ga0307515_10067150 | Ga0307515_100671504 | 316 |
| 327 | 3300031251 | Ga0265327_10001814 | Ga0265327_1000181410 | 316 |
| 328 | 3300035089 | Ga0373944_0009484 | Ga0373944_0009484_63_1100 | 316 |
| 329 | 3300035113 | Ga0373936_0038480 | Ga0373936_0038480_892_1851 | 316 |
| 330 | 3300035116 | Ga0373945_0072435 | Ga0373945_0072435_318_1277 | 316 |
| 331 | 3300035170 | Ga0373943_0075340 | Ga0373943_0075340_616_1653 | 316 |
| 332 | 3300035692 | Ga0373935_0066670 | Ga0373935_0066670_533_1570 | 316 |
| 333 | 3300035695 | Ga0373927_0028336 | Ga0373927_0028336_2107_3066 | 316 |
| 334 | 3300035725 | Ga0373947_0054990 | Ga0373947_0054990_1396_2355 | 316 |
| 335 | 3300037068 | Ga0373925_0000845 | Ga0373925_0000845_6114_7151 | 316 |
| 336 | 3300042876 | Ga0451577_0006041 | Ga0451577_0006041_2271_3242 | 316 |
| 337 | 3300046683 | Ga0495658_0075922 | Ga0495658_0075922_159_1118 | 316 |
| 338 | 3300048907 | Ga0496104_0040713 | Ga0496104_0040713_2786_3745 | 316 |
| 339 | 3300048915 | Ga0496112_0120830 | Ga0496112_0120830_1077_2036 | 316 |
| 340 | 3300048916 | Ga0496113_0151404 | Ga0496113_0151404_277_1236 | 316 |
| 341 | 3300048917 | Ga0496114_0050228 | Ga0496114_0050228_976_1974 | 316 |
| 342 | 3300050489 | nmdc:mga03683_17461_c1 | nmdc:mga03683_17461_c1_1069_2028 | 316 |
| 343 | 3300050493 | nmdc:mga0k408_79678_c1 | nmdc:mga0k408_79678_c1_776_1735 | 316 |
| 344 | 3300050511 | nmdc:mga08y16_397516_c1 | nmdc:mga08y16_397516_c1_424_1377 | 316 |
| 345 | 3300050511 | nmdc:mga08y16_432827_c1 | nmdc:mga08y16_432827_c1_351_1310 | 316 |
| 346 | 3300003322 | rootL2_10000073 | rootL2_100000734 | 317 |
| 347 | 3300003759 | Ga0055525_1000031 | Ga0055525_1000031225 | 317 |
| 348 | 3300003771 | Ga0055526_1004906 | Ga0055526_10049062 | 317 |
| 349 | 3300004625 | Ga0055543_1003950 | Ga0055543_10039504 | 317 |
| 350 | 3300005262 | Ga0065165_1000248 | Ga0065165_100024828 | 317 |
| 351 | 3300005262 | Ga0065165_1000390 | Ga0065165_100039014 | 317 |
| 352 | 3300005457 | Ga0070662_100003301 | Ga0070662_10000330111 | 317 |
| 353 | 3300006195 | Ga0075366_10018606 | Ga0075366_100186063 | 317 |
| 354 | 3300006353 | Ga0075370_10014833 | Ga0075370_100148335 | 317 |
| 355 | 3300009147 | Ga0114129_10121124 | Ga0114129_101211244 | 317 |
| 356 | 3300012497 | Ga0157319_1000003 | Ga0157319_1000003291 | 317 |
| 357 | 3300021361 | Ga0213872_10000006 | Ga0213872_10000006140 | 317 |
| 358 | 3300021361 | Ga0213872_10000139 | Ga0213872_1000013921 | 317 |
| 359 | 3300021361 | Ga0213872_10000152 | Ga0213872_1000015226 | 317 |
| 360 | 3300021361 | Ga0213872_10005055 | Ga0213872_100050555 | 317 |
| 361 | 3300025230 | Ga0209563_100044 | Ga0209563_100044294 | 317 |
| 362 | 3300025273 | Ga0209673_1014555 | Ga0209673_10145552 | 317 |
| 363 | 3300025273 | Ga0209673_1040989 | Ga0209673_10409892 | 317 |
| 364 | 3300025295 | Ga0209564_1000051 | Ga0209564_1000051162 | 317 |
| 365 | 3300025299 | Ga0209256_1000675 | Ga0209256_100067541 | 317 |
| 366 | 3300025933 | Ga0207706_10005864 | Ga0207706_100058643 | 317 |
| 367 | 3300028794 | Ga0307515_10170346 | Ga0307515_101703463 | 317 |
| 368 | 3300031250 | Ga0265331_10001772 | Ga0265331_1000177211 | 317 |
| 369 | 3300031251 | Ga0265327_10000012 | Ga0265327_10000012331 | 317 |
| 370 | 3300031616 | Ga0307508_10217239 | Ga0307508_102172392 | 317 |
| 371 | 3300031730 | Ga0307516_10106435 | Ga0307516_101064352 | 317 |
| 372 | 3300031995 | Ga0307409_100246349 | Ga0307409_1002463491 | 317 |
| 373 | 3300037418 | Ga0395900_0000131 | Ga0395900_0000131_17795_18754 | 317 |
| 374 | 3300037466 | Ga0395898_0001669 | Ga0395898_0001669_11033_11992 | 317 |
| 375 | 3300037471 | Ga0395905_0003089 | Ga0395905_0003089_15997_16956 | 317 |
| 376 | 3300037471 | Ga0395905_0271694 | Ga0395905_0271694_227_1216 | 317 |
| 377 | 3300039447 | Ga0436361_0301322 | Ga0436361_0301322_17678_18637 | 317 |
| 378 | 3300039447 | Ga0436361_0614815 | Ga0436361_0614815_6269_7228 | 317 |
| 379 | 3300039447 | Ga0436361_0734234 | Ga0436361_0734234_1273_2232 | 317 |
| 380 | 3300039447 | Ga0436361_1059830 | Ga0436361_1059830_281_1240 | 317 |
| 381 | 3300042008 | Ga0439450_021202 | Ga0439450_021202_301_1260 | 317 |
| 382 | 3300042438 | Ga0439459_0010540 | Ga0439459_0010540_332_1291 | 317 |
| 383 | 3300044656 | Ga0466969_0000017 | Ga0466969_0000017_22685_23644 | 317 |
| 384 | 3300044656 | Ga0466969_0016731 | Ga0466969_0016731_1886_2845 | 317 |
| 385 | 3300044658 | Ga0466972_0000564 | Ga0466972_0000564_6051_7010 | 317 |
| 386 | 3300044658 | Ga0466972_0048615 | Ga0466972_0048615_252_1214 | 317 |
| 387 | 3300044683 | Ga0466965_0008331 | Ga0466965_0008331_2203_3162 | 317 |
| 388 | 3300044683 | Ga0466965_0064814 | Ga0466965_0064814_736_1698 | 317 |
| 389 | 3300044684 | Ga0466966_0009318 | Ga0466966_0009318_5214_6173 | 317 |
| 390 | 3300044693 | Ga0466961_0005109 | Ga0466961_0005109_3902_4861 | 317 |
| 391 | 3300044694 | Ga0466963_0026258 | Ga0466963_0026258_1243_2202 | 317 |
| 392 | 3300044706 | Ga0466964_0001826 | Ga0466964_0001826_4985_5944 | 317 |
| 393 | 3300044706 | Ga0466964_0071065 | Ga0466964_0071065_175_1134 | 317 |
| 394 | 3300044765 | Ga0466970_0012504 | Ga0466970_0012504_1927_2886 | 317 |
| 395 | 3300044901 | Ga0466960_0009764 | Ga0466960_0009764_1532_2494 | 317 |
| 396 | 3300045049 | Ga0466959_0004446 | Ga0466959_0004446_2561_3520 | 317 |
| 397 | 3300045049 | Ga0466959_0046795 | Ga0466959_0046795_2138_3097 | 317 |
| 398 | 3300048927 | Ga0496124_0000344 | Ga0496124_0000344_20287_21246 | 317 |
| 399 | 3300048927 | Ga0496124_0073367 | Ga0496124_0073367_1320_2279 | 317 |
| 400 | 3300050496 | nmdc:mga07m45_3609_c1 | nmdc:mga07m45_3609_c1_3234_4193 | 317 |
| 401 | 3300053156 | Ga0500622_0002736 | Ga0500622_0002736_1401_2360 | 317 |
| 402 | 3300006944 | Ga0099823_1000211 | Ga0099823_10002115 | 318 |
| 403 | 3300025242 | Ga0209258_105519 | Ga0209258_1055192 | 318 |
| 404 | 3300025298 | Ga0209050_1005005 | Ga0209050_10050053 | 318 |
| 405 | 3300025304 | Ga0209257_1005336 | Ga0209257_10053369 | 318 |
| 406 | 3300027312 | Ga0209371_1019135 | Ga0209371_10191352 | 318 |
| 407 | 3300030500 | Ga0268256_1011825 | Ga0268256_10118252 | 318 |
| 408 | 3300031731 | Ga0307405_10014843 | Ga0307405_100148434 | 318 |
| 409 | 3300031824 | Ga0307413_10030884 | Ga0307413_100308842 | 318 |
| 410 | 3300031852 | Ga0307410_10102429 | Ga0307410_101024292 | 318 |
| 411 | 3300031901 | Ga0307406_10025146 | Ga0307406_100251464 | 318 |
| 412 | 3300031995 | Ga0307409_100015073 | Ga0307409_1000150734 | 318 |
| 413 | 3300032004 | Ga0307414_10028632 | Ga0307414_100286324 | 318 |
| 414 | 3300032126 | Ga0307415_100039530 | Ga0307415_1000395302 | 318 |
| 415 | 3300037471 | Ga0395905_0095910 | Ga0395905_0095910_715_1746 | 318 |
| 416 | 3300041413 | Ga0439465_0070744 | Ga0439465_0070744_154_1113 | 318 |
| 417 | 3300045051 | Ga0451576_0003849 | Ga0451576_0003849_3947_4906 | 318 |
| 418 | 3300045051 | Ga0451576_0383311 | Ga0451576_0383311_166_1125 | 318 |
| 419 | 3300001979 | JGI24740J21852_10005095 | JGI24740J21852_100050952 | 319 |
| 420 | 3300003215 | JGI25153J46596_10002317 | JGI25153J46596_1000231711 | 319 |
| 421 | 3300003305 | Ga0006770J48903_1042115 | Ga0006770J48903_10421152 | 319 |
| 422 | 3300003371 | JGI26145J50221_1004043 | JGI26145J50221_10040431 | 319 |
| 423 | 3300003775 | Ga0055524_1000158 | Ga0055524_100015845 | 319 |
| 424 | 3300003790 | Ga0055528_1028380 | Ga0055528_10283801 | 319 |
| 425 | 3300003792 | Ga0055540_1000035 | Ga0055540_1000035134 | 319 |
| 426 | 3300003794 | Ga0055531_10000024 | Ga0055531_1000002452 | 319 |
| 427 | 3300005262 | Ga0065165_1003068 | Ga0065165_10030682 | 319 |
| 428 | 3300005328 | Ga0070676_10002065 | Ga0070676_100020658 | 319 |
| 429 | 3300005328 | Ga0070676_10005115 | Ga0070676_100051152 | 319 |
| 430 | 3300005334 | Ga0068869_100141052 | Ga0068869_1001410522 | 319 |
| 431 | 3300005337 | Ga0070682_100122391 | Ga0070682_1001223912 | 319 |
| 432 | 3300005338 | Ga0068868_100302932 | Ga0068868_1003029322 | 319 |
| 433 | 3300005344 | Ga0070661_100000649 | Ga0070661_1000006496 | 319 |
| 434 | 3300005354 | Ga0070675_100065006 | Ga0070675_1000650064 | 319 |
| 435 | 3300005354 | Ga0070675_100230632 | Ga0070675_1002306322 | 319 |
| 436 | 3300005355 | Ga0070671_100019824 | Ga0070671_1000198245 | 319 |
| 437 | 3300005355 | Ga0070671_100026644 | Ga0070671_1000266444 | 319 |
| 438 | 3300005364 | Ga0070673_100103902 | Ga0070673_1001039022 | 319 |
| 439 | 3300005366 | Ga0070659_100000430 | Ga0070659_10000043023 | 319 |
| 440 | 3300005367 | Ga0070667_100001640 | Ga0070667_10000164020 | 319 |
| 441 | 3300005455 | Ga0070663_100002390 | Ga0070663_1000023903 | 319 |
| 442 | 3300005459 | Ga0068867_100000228 | Ga0068867_10000022819 | 319 |
| 443 | 3300005467 | Ga0070706_100009701 | Ga0070706_1000097014 | 319 |
| 444 | 3300005468 | Ga0070707_100017523 | Ga0070707_1000175234 | 319 |
| 445 | 3300005539 | Ga0068853_100054042 | Ga0068853_1000540422 | 319 |
| 446 | 3300005539 | Ga0068853_100174816 | Ga0068853_1001748162 | 319 |
| 447 | 3300005564 | Ga0070664_100000913 | Ga0070664_10000091320 | 319 |
| 448 | 3300005564 | Ga0070664_100006225 | Ga0070664_1000062252 | 319 |
| 449 | 3300005577 | Ga0068857_100059339 | Ga0068857_1000593394 | 319 |
| 450 | 3300005841 | Ga0068863_100605473 | Ga0068863_1006054732 | 319 |
| 451 | 3300006038 | Ga0075365_10015895 | Ga0075365_100158952 | 319 |
| 452 | 3300006042 | Ga0075368_10003121 | Ga0075368_100031212 | 319 |
| 453 | 3300006042 | Ga0075368_10015679 | Ga0075368_100156793 | 319 |
| 454 | 3300006048 | Ga0075363_100015590 | Ga0075363_1000155904 | 319 |
| 455 | 3300006048 | Ga0075363_100045740 | Ga0075363_1000457402 | 319 |
| 456 | 3300006051 | Ga0075364_10033021 | Ga0075364_100330213 | 319 |
| 457 | 3300006051 | Ga0075364_10054094 | Ga0075364_100540942 | 319 |
| 458 | 3300006051 | Ga0075364_10240507 | Ga0075364_102405072 | 319 |
| 459 | 3300006177 | Ga0075362_10022235 | Ga0075362_100222352 | 319 |
| 460 | 3300006178 | Ga0075367_10029207 | Ga0075367_100292073 | 319 |
| 461 | 3300006178 | Ga0075367_10044166 | Ga0075367_100441662 | 319 |
| 462 | 3300006178 | Ga0075367_10067815 | Ga0075367_100678152 | 319 |
| 463 | 3300006178 | Ga0075367_10281073 | Ga0075367_102810731 | 319 |
| 464 | 3300006195 | Ga0075366_10000472 | Ga0075366_1000047213 | 319 |
| 465 | 3300006195 | Ga0075366_10027250 | Ga0075366_100272502 | 319 |
| 466 | 3300006195 | Ga0075366_10028967 | Ga0075366_100289672 | 319 |
| 467 | 3300006195 | Ga0075366_10031881 | Ga0075366_100318813 | 319 |
| 468 | 3300006195 | Ga0075366_10033377 | Ga0075366_100333773 | 319 |
| 469 | 3300006195 | Ga0075366_10092386 | Ga0075366_100923862 | 319 |
| 470 | 3300006195 | Ga0075366_10099557 | Ga0075366_100995572 | 319 |
| 471 | 3300006353 | Ga0075370_10001362 | Ga0075370_1000136211 | 319 |
| 472 | 3300006353 | Ga0075370_10013927 | Ga0075370_100139274 | 319 |
| 473 | 3300006353 | Ga0075370_10057351 | Ga0075370_100573512 | 319 |
| 474 | 3300006353 | Ga0075370_10130310 | Ga0075370_101303101 | 319 |
| 475 | 3300006846 | Ga0075430_100112978 | Ga0075430_1001129783 | 319 |
| 476 | 3300006880 | Ga0075429_100002218 | Ga0075429_10000221813 | 319 |
| 477 | 3300006946 | Ga0079104_1000024 | Ga0079104_1000024111 | 319 |
| 478 | 3300009148 | Ga0105243_10001277 | Ga0105243_100012774 | 319 |
| 479 | 3300009545 | Ga0105237_10001734 | Ga0105237_1000173420 | 319 |
| 480 | 3300009551 | Ga0105238_10007274 | Ga0105238_100072749 | 319 |
| 481 | 3300010375 | Ga0105239_10001342 | Ga0105239_1000134225 | 319 |
| 482 | 3300010375 | Ga0105239_10068264 | Ga0105239_100682643 | 319 |
| 483 | 3300013306 | Ga0163162_10810900 | Ga0163162_108109001 | 319 |
| 484 | 3300013308 | Ga0157375_10020176 | Ga0157375_100201763 | 319 |
| 485 | 3300013308 | Ga0157375_10173980 | Ga0157375_101739803 | 319 |
| 486 | 3300014745 | Ga0157377_10000016 | Ga0157377_1000001612 | 319 |
| 487 | 3300014745 | Ga0157377_10075135 | Ga0157377_100751352 | 319 |
| 488 | 3300014968 | Ga0157379_10011186 | Ga0157379_100111862 | 319 |
| 489 | 3300025245 | Ga0207425_1000946 | Ga0207425_100094610 | 319 |
| 490 | 3300025258 | Ga0209129_1000041 | Ga0209129_1000041268 | 319 |
| 491 | 3300025258 | Ga0209129_1016733 | Ga0209129_10167332 | 319 |
| 492 | 3300025273 | Ga0209673_1001671 | Ga0209673_100167110 | 319 |
| 493 | 3300025273 | Ga0209673_1015984 | Ga0209673_10159842 | 319 |
| 494 | 3300025295 | Ga0209564_1000029 | Ga0209564_1000029414 | 319 |
| 495 | 3300025297 | Ga0209758_1000043 | Ga0209758_100004326 | 319 |
| 496 | 3300025297 | Ga0209758_1000057 | Ga0209758_1000057275 | 319 |
| 497 | 3300025298 | Ga0209050_1000247 | Ga0209050_100024727 | 319 |
| 498 | 3300025298 | Ga0209050_1000995 | Ga0209050_100099521 | 319 |
| 499 | 3300025298 | Ga0209050_1003881 | Ga0209050_10038815 | 319 |
| 500 | 3300025299 | Ga0209256_1000011 | Ga0209256_1000011242 | 319 |
| 501 | 3300025299 | Ga0209256_1010579 | Ga0209256_10105793 | 319 |
| 502 | 3300025303 | Ga0209051_1000016 | Ga0209051_100001693 | 319 |
| 503 | 3300025304 | Ga0209257_1000017 | Ga0209257_100001780 | 319 |
| 504 | 3300025304 | Ga0209257_1000102 | Ga0209257_1000102200 | 319 |
| 505 | 3300025304 | Ga0209257_1019601 | Ga0209257_10196012 | 319 |
| 506 | 3300025907 | Ga0207645_10002560 | Ga0207645_100025604 | 319 |
| 507 | 3300025907 | Ga0207645_10021528 | Ga0207645_100215282 | 319 |
| 508 | 3300025907 | Ga0207645_10036230 | Ga0207645_100362302 | 319 |
| 509 | 3300025908 | Ga0207643_10119031 | Ga0207643_101190312 | 319 |
| 510 | 3300025908 | Ga0207643_10223236 | Ga0207643_102232362 | 319 |
| 511 | 3300025910 | Ga0207684_10030653 | Ga0207684_100306535 | 319 |
| 512 | 3300025913 | Ga0207695_10012371 | Ga0207695_100123712 | 319 |
| 513 | 3300025914 | Ga0207671_10011049 | Ga0207671_100110492 | 319 |
| 514 | 3300025920 | Ga0207649_10008572 | Ga0207649_100085725 | 319 |
| 515 | 3300025924 | Ga0207694_10010050 | Ga0207694_100100502 | 319 |
| 516 | 3300025926 | Ga0207659_10263633 | Ga0207659_102636332 | 319 |
| 517 | 3300025932 | Ga0207690_10001923 | Ga0207690_100019235 | 319 |
| 518 | 3300025935 | Ga0207709_10001251 | Ga0207709_100012514 | 319 |
| 519 | 3300025935 | Ga0207709_10043178 | Ga0207709_100431782 | 319 |
| 520 | 3300025942 | Ga0207689_10035247 | Ga0207689_100352474 | 319 |
| 521 | 3300025942 | Ga0207689_10259765 | Ga0207689_102597652 | 319 |
| 522 | 3300025945 | Ga0207679_10000573 | Ga0207679_1000057320 | 319 |
| 523 | 3300025945 | Ga0207679_10003682 | Ga0207679_100036822 | 319 |
| 524 | 3300025960 | Ga0207651_10054492 | Ga0207651_100544923 | 319 |
| 525 | 3300025986 | Ga0207658_10001138 | Ga0207658_1000113821 | 319 |
| 526 | 3300026041 | Ga0207639_10097383 | Ga0207639_100973832 | 319 |
| 527 | 3300026067 | Ga0207678_10001091 | Ga0207678_1000109113 | 319 |
| 528 | 3300026078 | Ga0207702_10192031 | Ga0207702_101920312 | 319 |
| 529 | 3300026089 | Ga0207648_10000598 | Ga0207648_1000059814 | 319 |
| 530 | 3300026089 | Ga0207648_10156399 | Ga0207648_101563993 | 319 |
| 531 | 3300026089 | Ga0207648_10426461 | Ga0207648_104264612 | 319 |
| 532 | 3300026116 | Ga0207674_10039848 | Ga0207674_100398485 | 319 |
| 533 | 3300026142 | Ga0207698_10014891 | Ga0207698_100148911 | 319 |
| 534 | 3300027111 | Ga0209281_1000104 | Ga0209281_100010491 | 319 |
| 535 | 3300027717 | Ga0209998_10010480 | Ga0209998_100104802 | 319 |
| 536 | 3300027866 | Ga0209813_10011507 | Ga0209813_100115073 | 319 |
| 537 | 3300027876 | Ga0209974_10005897 | Ga0209974_100058972 | 319 |
| 538 | 3300028786 | Ga0307517_10000150 | Ga0307517_1000015077 | 319 |
| 539 | 3300028786 | Ga0307517_10084135 | Ga0307517_100841354 | 319 |
| 540 | 3300028786 | Ga0307517_10134755 | Ga0307517_101347552 | 319 |
| 541 | 3300028794 | Ga0307515_10000830 | Ga0307515_100008304 | 319 |
| 542 | 3300028794 | Ga0307515_10002402 | Ga0307515_100024025 | 319 |
| 543 | 3300028794 | Ga0307515_10011679 | Ga0307515_100116793 | 319 |
| 544 | 3300028794 | Ga0307515_10021637 | Ga0307515_1002163711 | 319 |
| 545 | 3300028794 | Ga0307515_10026130 | Ga0307515_100261308 | 319 |
| 546 | 3300028794 | Ga0307515_10171782 | Ga0307515_101717822 | 319 |
| 547 | 3300030522 | Ga0307512_10012395 | Ga0307512_100123954 | 319 |
| 548 | 3300030522 | Ga0307512_10025747 | Ga0307512_100257475 | 319 |
| 549 | 3300031456 | Ga0307513_10030508 | Ga0307513_100305084 | 319 |
| 550 | 3300031456 | Ga0307513_10381799 | Ga0307513_103817991 | 319 |
| 551 | 3300031507 | Ga0307509_10002837 | Ga0307509_1000283710 | 319 |
| 552 | 3300031507 | Ga0307509_10011064 | Ga0307509_1001106410 | 319 |
| 553 | 3300031507 | Ga0307509_10017922 | Ga0307509_100179222 | 319 |
| 554 | 3300031507 | Ga0307509_10129106 | Ga0307509_101291062 | 319 |
| 555 | 3300031507 | Ga0307509_10196928 | Ga0307509_101969282 | 319 |
| 556 | 3300031548 | Ga0307408_100000010 | Ga0307408_100000010243 | 319 |
| 557 | 3300031616 | Ga0307508_10000061 | Ga0307508_1000006156 | 319 |
| 558 | 3300031616 | Ga0307508_10001937 | Ga0307508_1000193710 | 319 |
| 559 | 3300031616 | Ga0307508_10002030 | Ga0307508_1000203013 | 319 |
| 560 | 3300031616 | Ga0307508_10222589 | Ga0307508_102225892 | 319 |
| 561 | 3300031649 | Ga0307514_10089166 | Ga0307514_100891662 | 319 |
| 562 | 3300031649 | Ga0307514_10116209 | Ga0307514_101162092 | 319 |
| 563 | 3300031730 | Ga0307516_10000293 | Ga0307516_1000029344 | 319 |
| 564 | 3300031730 | Ga0307516_10006910 | Ga0307516_100069106 | 319 |
| 565 | 3300031730 | Ga0307516_10202286 | Ga0307516_102022862 | 319 |
| 566 | 3300031730 | Ga0307516_10237918 | Ga0307516_102379182 | 319 |
| 567 | 3300032005 | Ga0307411_10227843 | Ga0307411_102278432 | 319 |
| 568 | 3300033179 | Ga0307507_10142156 | Ga0307507_101421561 | 319 |
| 569 | 3300033180 | Ga0307510_10032222 | Ga0307510_100322225 | 319 |
| 570 | 3300033180 | Ga0307510_10082015 | Ga0307510_100820153 | 319 |
| 571 | 3300034820 | Ga0373959_0003778 | Ga0373959_0003778_46_1011 | 319 |
| 572 | 3300035088 | Ga0373940_0063735 | Ga0373940_0063735_76_1041 | 319 |
| 573 | 3300035090 | Ga0373949_0009358 | Ga0373949_0009358_914_1879 | 319 |
| 574 | 3300035114 | Ga0373939_0000160 | Ga0373939_0000160_5518_6483 | 319 |
| 575 | 3300035121 | Ga0373960_0000788 | Ga0373960_0000788_5374_6339 | 319 |
| 576 | 3300035171 | Ga0373946_0085616 | Ga0373946_0085616_363_1322 | 319 |
| 577 | 3300035241 | Ga0373961_0068057 | Ga0373961_0068057_105_1070 | 319 |
| 578 | 3300035691 | Ga0373931_0000233 | Ga0373931_0000233_3011_3976 | 319 |
| 579 | 3300035691 | Ga0373931_0008851 | Ga0373931_0008851_2713_3672 | 319 |
| 580 | 3300035691 | Ga0373931_0073786 | Ga0373931_0073786_806_1765 | 319 |
| 581 | 3300037471 | Ga0395905_0002862 | Ga0395905_0002862_10366_11343 | 319 |
| 582 | 3300037471 | Ga0395905_0054712 | Ga0395905_0054712_1765_2724 | 319 |
| 583 | 3300037471 | Ga0395905_0059971 | Ga0395905_0059971_1818_2783 | 319 |
| 584 | 3300041459 | Ga0451800_0538243 | Ga0451800_0538243_1104_2063 | 319 |
| 585 | 3300042120 | Ga0450917_000031 | Ga0450917_000031_2850_3815 | 319 |
| 586 | 3300042121 | Ga0450919_000578 | Ga0450919_000578_3486_4445 | 319 |
| 587 | 3300042129 | Ga0450891_000788 | Ga0450891_000788_1548_2513 | 319 |
| 588 | 3300042130 | Ga0450892_000949 | Ga0450892_000949_1822_2787 | 319 |
| 589 | 3300042144 | Ga0450889_000243 | Ga0450889_000243_3466_4431 | 319 |
| 590 | 3300042530 | Ga0450916_006341 | Ga0450916_006341_235_1200 | 319 |
| 591 | 3300042531 | Ga0450918_000929 | Ga0450918_000929_4012_4971 | 319 |
| 592 | 3300042532 | Ga0450893_0000452 | Ga0450893_0000452_4591_5556 | 319 |
| 593 | 3300044712 | Ga0453684_0069157 | Ga0453684_0069157_43_1002 | 319 |
| 594 | 3300045051 | Ga0451576_0024941 | Ga0451576_0024941_2329_3294 | 319 |
| 595 | 3300045051 | Ga0451576_0030018 | Ga0451576_0030018_1077_2072 | 319 |
| 596 | 3300046454 | Ga0495592_0005413 | Ga0495592_0005413_6545_7504 | 319 |
| 597 | 3300046454 | Ga0495592_0106780 | Ga0495592_0106780_509_1468 | 319 |
| 598 | 3300046460 | Ga0495638_0035681 | Ga0495638_0035681_1803_2762 | 319 |
| 599 | 3300046474 | Ga0495605_0091194 | Ga0495605_0091194_422_1381 | 319 |
| 600 | 3300046512 | Ga0495610_0016173 | Ga0495610_0016173_2106_3065 | 319 |
| 601 | 3300046515 | Ga0495620_0086886 | Ga0495620_0086886_283_1242 | 319 |
| 602 | 3300046519 | Ga0495632_0004080 | Ga0495632_0004080_4474_5433 | 319 |
| 603 | 3300046519 | Ga0495632_0063116 | Ga0495632_0063116_172_1131 | 319 |
| 604 | 3300046522 | Ga0495643_0078625 | Ga0495643_0078625_501_1460 | 319 |
| 605 | 3300046524 | Ga0495648_0150663 | Ga0495648_0150663_244_1203 | 319 |
| 606 | 3300046542 | Ga0495597_0048143 | Ga0495597_0048143_287_1246 | 319 |
| 607 | 3300046660 | Ga0495625_0001549 | Ga0495625_0001549_7630_8670 | 319 |
| 608 | 3300046660 | Ga0495625_0071759 | Ga0495625_0071759_1200_2159 | 319 |
| 609 | 3300046683 | Ga0495658_0095825 | Ga0495658_0095825_43_1002 | 319 |
| 610 | 3300046694 | Ga0495649_0008664 | Ga0495649_0008664_4047_5006 | 319 |
| 611 | 3300047321 | Ga0495676_0028995 | Ga0495676_0028995_2991_3950 | 319 |
| 612 | 3300047443 | Ga0495687_001178 | Ga0495687_001178_1790_2749 | 319 |
| 613 | 3300048091 | Ga0495626_0014741 | Ga0495626_0014741_232_1191 | 319 |
| 614 | 3300048905 | Ga0496102_0027674 | Ga0496102_0027674_1560_2519 | 319 |
| 615 | 3300048905 | Ga0496102_0035862 | Ga0496102_0035862_2659_3618 | 319 |
| 616 | 3300048912 | Ga0496109_0114394 | Ga0496109_0114394_972_1931 | 319 |
| 617 | 3300048913 | Ga0496110_0080162 | Ga0496110_0080162_1907_2866 | 319 |
| 618 | 3300048915 | Ga0496112_0395590 | Ga0496112_0395590_353_1312 | 319 |
| 619 | 3300048917 | Ga0496114_0002388 | Ga0496114_0002388_7250_8209 | 319 |
| 620 | 3300049523 | Ga0501300_002135 | Ga0501300_002135_268_1233 | 319 |
| 621 | 3300049578 | Ga0501042_0225088 | Ga0501042_0225088_359_1318 | 319 |
| 622 | 3300049579 | Ga0501043_0000053 | Ga0501043_0000053_16866_17825 | 319 |
| 623 | 3300049580 | Ga0501046_0000018 | Ga0501046_0000018_48464_49423 | 319 |
| 624 | 3300049581 | Ga0501047_0000020 | Ga0501047_0000020_87273_88232 | 319 |
| 625 | 3300049582 | Ga0501048_0001721 | Ga0501048_0001721_10167_11126 | 319 |
| 626 | 3300049662 | Ga0501222_000379 | Ga0501222_000379_2159_3124 | 319 |
| 627 | 3300049663 | Ga0501223_008869 | Ga0501223_008869_999_1964 | 319 |
| 628 | 3300049668 | Ga0501233_001124 | Ga0501233_001124_3030_3995 | 319 |
| 629 | 3300049669 | Ga0501235_007250 | Ga0501235_007250_356_1321 | 319 |
| 630 | 3300049706 | Ga0501229_000306 | Ga0501229_000306_3531_4496 | 319 |
| 631 | 3300049762 | Ga0501265_001741 | Ga0501265_001741_1086_2051 | 319 |
| 632 | 3300050490 | nmdc:mga03n38_47794_c1 | nmdc:mga03n38_47794_c1_716_1675 | 319 |
| 633 | 3300050491 | nmdc:mga00v17_108519_c1 | nmdc:mga00v17_108519_c1_726_1685 | 319 |
| 634 | 3300050492 | nmdc:mga0yw44_134354_c1 | nmdc:mga0yw44_134354_c1_145_1104 | 319 |
| 635 | 3300050493 | nmdc:mga0k408_1070_c1 | nmdc:mga0k408_1070_c1_3952_4911 | 319 |
| 636 | 3300050493 | nmdc:mga0k408_112045_c1 | nmdc:mga0k408_112045_c1_52_1011 | 319 |
| 637 | 3300050493 | nmdc:mga0k408_1281_c1 | nmdc:mga0k408_1281_c1_2030_2989 | 319 |
| 638 | 3300050493 | nmdc:mga0k408_1749_c1 | nmdc:mga0k408_1749_c1_8355_9314 | 319 |
| 639 | 3300050493 | nmdc:mga0k408_226254_c1 | nmdc:mga0k408_226254_c1_52_1092 | 319 |
| 640 | 3300050493 | nmdc:mga0k408_330_c1 | nmdc:mga0k408_330_c1_5816_6775 | 319 |
| 641 | 3300050493 | nmdc:mga0k408_34111_c1 | nmdc:mga0k408_34111_c1_1619_2578 | 319 |
| 642 | 3300050493 | nmdc:mga0k408_51273_c2 | nmdc:mga0k408_51273_c2_179_1144 | 319 |
| 643 | 3300050493 | nmdc:mga0k408_5951_c1 | nmdc:mga0k408_5951_c1_4764_5723 | 319 |
| 644 | 3300050493 | nmdc:mga0k408_83212_c1 | nmdc:mga0k408_83212_c1_516_1475 | 319 |
| 645 | 3300050493 | nmdc:mga0k408_97238_c1 | nmdc:mga0k408_97238_c1_651_1610 | 319 |
| 646 | 3300050494 | nmdc:mga06z11_4773_c1 | nmdc:mga06z11_4773_c1_88_1047 | 319 |
| 647 | 3300050495 | nmdc:mga04h51_18533_c1 | nmdc:mga04h51_18533_c1_961_1920 | 319 |
| 648 | 3300050495 | nmdc:mga04h51_22170_c1 | nmdc:mga04h51_22170_c1_511_1470 | 319 |
| 649 | 3300050496 | nmdc:mga07m45_1145_c1 | nmdc:mga07m45_1145_c1_3403_4362 | 319 |
| 650 | 3300050496 | nmdc:mga07m45_191_c1 | nmdc:mga07m45_191_c1_14011_14970 | 319 |
| 651 | 3300050496 | nmdc:mga07m45_20994_c1 | nmdc:mga07m45_20994_c1_1379_2338 | 319 |
| 652 | 3300050496 | nmdc:mga07m45_22525_c1 | nmdc:mga07m45_22525_c1_1319_2284 | 319 |
| 653 | 3300050496 | nmdc:mga07m45_32623_c1 | nmdc:mga07m45_32623_c1_1811_2776 | 319 |
| 654 | 3300050496 | nmdc:mga07m45_6895_c1 | nmdc:mga07m45_6895_c1_3373_4332 | 319 |
| 655 | 3300050496 | nmdc:mga07m45_7386_c1 | nmdc:mga07m45_7386_c1_3706_4665 | 319 |
| 656 | 3300050496 | nmdc:mga07m45_80696_c1 | nmdc:mga07m45_80696_c1_252_1211 | 319 |
| 657 | 3300050508 | nmdc:mga09592_32016_c1 | nmdc:mga09592_32016_c1_3243_4202 | 319 |
| 658 | 3300050509 | nmdc:mga0qj67_142164_c1 | nmdc:mga0qj67_142164_c1_212_1171 | 319 |
| 659 | 3300053086 | Ga0500578_0002292 | Ga0500578_0002292_10909_11868 | 319 |
| 660 | 3300053090 | Ga0500646_0002920 | Ga0500646_0002920_3348_4307 | 319 |
| 661 | 3300053093 | Ga0500651_0026657 | Ga0500651_0026657_1679_2638 | 319 |
| 662 | 3300053093 | Ga0500651_0138644 | Ga0500651_0138644_33_992 | 319 |
| 663 | 3300053109 | Ga0500569_015919 | Ga0500569_015919_154_1113 | 319 |
| 664 | 3300053117 | Ga0500593_000112 | Ga0500593_000112_2341_3300 | 319 |
| 665 | 3300053118 | Ga0500594_0000801 | Ga0500594_0000801_3698_4657 | 319 |
| 666 | 3300053131 | Ga0500652_001118 | Ga0500652_001118_3202_4161 | 319 |
| 667 | 3300053131 | Ga0500652_051291 | Ga0500652_051291_421_1380 | 319 |
| 668 | 3300053134 | Ga0500658_0006490 | Ga0500658_0006490_2290_3249 | 319 |
| 669 | 3300053134 | Ga0500658_0045469 | Ga0500658_0045469_311_1270 | 319 |
| 670 | 3300053136 | Ga0500559_0000069 | Ga0500559_0000069_38281_39240 | 319 |
| 671 | 3300053142 | Ga0500577_0014963 | Ga0500577_0014963_1170_2129 | 319 |
| 672 | 3300053148 | Ga0500590_012594 | Ga0500590_012594_2984_3943 | 319 |
| 673 | 3300053154 | Ga0500619_000115 | Ga0500619_000115_16829_17791 | 319 |
| 674 | 3300053156 | Ga0500622_0000881 | Ga0500622_0000881_19673_20632 | 319 |
| 675 | 3300053156 | Ga0500622_0002263 | Ga0500622_0002263_5905_6864 | 319 |
| 676 | 3300053739 | Ga0500587_001168 | Ga0500587_001168_1817_2776 | 319 |
| 677 | 3300053739 | Ga0500587_001948 | Ga0500587_001948_1705_2664 | 319 |
| 678 | 3300059421 | Ga0590071_001052 | Ga0590071_001052_1636_2610 | 319 |
| 679 | iso_pu_bacteria | 2643221648 | 2644271992 | 319 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zun-assembly1.cif.gz_A | crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae | 0.8718 | 18 | 229 |
| 1zun-assembly1.cif.gz_A | crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae | 0.8143 | 18 | 229 |
| 3g6k-assembly5.cif.gz_E | crystal structure of candida glabrata fmn adenylyltransferase in complex with fad and inorganic pyrophosphate | 0.7849 | 17 | 226 |
| 3g5a-assembly5.cif.gz_E | crystal structure of candida glabrata fmn adenylyltransferase in complex with fmn and atp analog ampcpp | 0.7512 | 17 | 226 |
| 4bwv-assembly1.cif.gz_B | structure of adenosine 5-prime-phosphosulfate reductase apr-b from physcomitrella patens | 0.7259 | 17 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1zunA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8956 | 18 | 229 | 3.40.50.620 |
| 1zunA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8864 | 18 | 229 | 3.40.50.620 |
| af_Q4DC85_142_361_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8411 | 20 | 226 | 3.40.50.620 |
| af_Q9VJY1_8_244_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7892 | 14 | 226 | 3.40.50.620 |
| af_O74841_2_240_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7884 | 17 | 226 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C4KPT8-F1-model_v4 | deleted | 0.967 | 18 | 319 |
|
| AF-A0A3S0CBN9-F1-model_v4 | Sulfate adenylyltransferase small subunit (EC 2.7.7.4) | 0.9667 | 18 | 138 |
GO:0004781
|
| AF-A0A0C1GVZ8-F1-model_v4 | Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4) (ATP-sulfurylase small subunit) (Sulfate adenylate transferase) | 0.9665 | 12 | 319 |
GO:0000103
GO:0004781 |
| AF-A0A2N7YEK7-F1-model_v4 | Sulfate adenylyltransferase small subunit | 0.9665 | 204 | 290 |
GO:0016779
|
| AF-B1HKH8-F1-model_v4 | deleted | 0.9652 | 18 | 319 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar