F474747

General Info

Members Datasets Scaffolds Average Seq Length
679 403 627 317

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221648|2644271992
Length 378
Sequence DDPSLCDLVAVLPDEAAAGGPLERERPRSRAVPERVTAHLDQSHLDWLEEEAIFILRETVAAFERPALLFSGGKDSCVVLRLAEKAFKTXGADGEFKGRLPFPLLHVDTGHNFPEVIEFRDRRIAEMGERLVVGHLEDSIKRGTVRLSHPLXRDRRIAEMGERLVVGHLEDSIKRGTVRLSHPLESRNGHQTVALLEAIEEHRFDVLMGGARRXEEKARAKERIFSHRDSFGQWQPKEQRPELWTLFNTRIKPGEHMRAFPISNWTELDVWLYIARENIPLPNLYYAHDRQVIRRKGLLVPLTEVTPPEAGEVVETAEVRFRTVGDMTCTCPVESPAANATEIVAETLKVTVSERGATRMDDRTSXASMERRKKEGYF

Samples

Sample ID Description Type Environment
1 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
2 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
6 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
7 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
8 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
9 2643221585 Pelomonas sp. Root662 Isolate Unclassified
10 2643221596 Acidovorax sp. Root70 Isolate Unclassified
11 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
12 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
13 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
14 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
15 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
16 2643221656 Pelomonas sp. Root405 Isolate Unclassified
17 2643221660 Methylibium sp. Root1272 Isolate Unclassified
18 2643221717 Acidovorax sp. Root267 Isolate Unclassified
19 2738541337 Pelomonas sp. BT06 Isolate Unclassified
20 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
21 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
22 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
23 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
24 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
25 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
26 2831864461 Roseateles noduli HZ7 Isolate Nodule
27 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
28 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
29 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
30 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
31 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
32 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
33 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
34 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
35 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
36 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
37 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
38 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
39 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
40 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
41 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
42 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
43 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
44 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
45 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
46 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
47 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
48 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
49 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
50 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
51 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
52 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
53 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
54 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
55 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
56 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
57 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
58 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
59 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
60 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
61 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
62 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
63 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
64 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
65 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
66 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
67 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
68 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
69 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
70 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
71 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
72 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
73 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
74 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
75 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
81 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
82 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
83 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
84 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
85 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
86 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
89 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
90 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
91 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
92 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
93 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
94 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
95 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
96 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
100 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
101 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
102 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
111 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
112 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
120 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
121 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
122 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
123 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
124 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
125 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
126 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
128 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
129 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
130 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
135 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
136 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
150 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
151 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
152 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
153 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
154 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
155 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
159 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
161 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
214 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
217 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
222 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
223 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
224 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
225 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
226 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
227 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
228 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
229 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
232 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
233 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
234 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
237 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
240 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
243 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
244 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
245 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
248 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
249 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
250 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
251 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
252 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
254 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
255 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
256 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
257 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
259 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
260 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
261 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
262 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
263 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
271 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
272 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
273 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
274 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
277 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
278 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
279 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
280 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
281 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
282 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
283 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
284 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
285 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
286 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
287 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
288 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
289 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
290 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
291 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
292 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
293 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
294 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
295 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
296 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
297 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
298 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
299 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
300 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
301 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
302 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
303 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
304 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
305 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
306 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
307 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
308 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
309 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
310 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
311 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
312 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
313 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
314 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
315 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
316 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
317 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
318 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
321 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
322 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
323 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
324 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
327 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
328 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
329 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
330 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
331 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
332 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
333 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
334 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
335 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
336 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
337 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
338 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
339 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
340 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
352 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
353 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
354 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
355 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
356 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
357 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
358 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
359 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
360 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
364 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
365 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
366 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
367 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
368 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
369 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
370 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
371 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
372 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
373 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
374 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
375 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
376 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
377 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
378 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
379 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
380 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
381 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
382 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
383 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
384 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
385 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
386 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
387 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
388 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
389 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
390 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
391 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
392 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
393 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
394 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
395 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
396 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
397 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
398 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
399 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
400 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
401 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
402 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
403 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.05
Metatranscriptomes 0.29
Isolates 7.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.24
Nodule 4.42
Rhizoplane 2.65
Rhizosphere 59.65
Stem 0
Stem Tuber 0
Unclassified 11.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005095 3300001979 Bacteria 5580
2 JGI24737J22298_10041977 3300001990 Bacteria 1403
3 JGI25153J46596_10002317 3300003215 Bacteria 11061
4 JGI25153J46596_10002417 3300003215 Bacteria 10768
5 Ga0006770J48903_1042115 3300003305 Bacteria 3136
6 rootL2_10000073 3300003322 Bacteria 23640
7 JGI26145J50221_1004043 3300003371 Bacteria 1182
8 Ga0055539_1003304 3300003752 Bacteria 2279
9 Ga0055525_1000031 3300003759 Bacteria 314909
10 Ga0055529_1001253 3300003763 Bacteria 9385
11 Ga0055526_1004906 3300003771 Bacteria 7870
12 Ga0055524_1000158 3300003775 Bacteria 78973
13 Ga0055528_1028380 3300003790 Bacteria 1545
14 Ga0055540_1000035 3300003792 Bacteria 166843
15 Ga0055531_10000024 3300003794 Bacteria 164239
16 Ga0055531_10004532 3300003794 Bacteria 8426
17 Ga0055543_1003950 3300004625 Bacteria 4185
18 Ga0065165_1000248 3300005262 Bacteria 93216
19 Ga0065165_1000390 3300005262 Bacteria 71262
20 Ga0065165_1003068 3300005262 Bacteria 12498
21 Ga0065165_1003542 3300005262 Bacteria 10800
22 Ga0065715_10023582 3300005293 Bacteria 1749
23 Ga0070658_10305120 3300005327 Bacteria 1358
24 Ga0070676_10002065 3300005328 Bacteria 10209
25 Ga0070676_10005115 3300005328 Bacteria 6959
26 Ga0070670_100001786 3300005331 Bacteria 17507
27 Ga0070670_100371698 3300005331 Bacteria 1259
28 Ga0068869_100141052 3300005334 Bacteria 1861
29 Ga0070682_100050418 3300005337 Bacteria 2598
30 Ga0070682_100122391 3300005337 Bacteria 1749
31 Ga0068868_100302932 3300005338 Bacteria 1358
32 Ga0070661_100000649 3300005344 Bacteria 25606
33 Ga0070661_100100993 3300005344 Bacteria 2145
34 Ga0070692_10012635 3300005345 Bacteria 3917
35 Ga0070668_100010300 3300005347 Bacteria 6942
36 Ga0070669_100048889 3300005353 Bacteria 3087
37 Ga0070675_100007685 3300005354 Bacteria 8344
38 Ga0070675_100065006 3300005354 Bacteria 3016
39 Ga0070675_100230632 3300005354 Bacteria 1615
40 Ga0070671_100007621 3300005355 Bacteria 8658
41 Ga0070671_100013507 3300005355 Bacteria 6584
42 Ga0070671_100019824 3300005355 Bacteria 5479
43 Ga0070671_100026644 3300005355 Bacteria 4753
44 Ga0070671_100181600 3300005355 Bacteria 1781
45 Ga0070674_100004831 3300005356 Bacteria 7724
46 Ga0070674_100020712 3300005356 Bacteria 4209
47 Ga0070674_100059339 3300005356 Bacteria 2663
48 Ga0070674_100241061 3300005356 Bacteria 1415
49 Ga0070673_100020575 3300005364 Bacteria 4760
50 Ga0070673_100103902 3300005364 Bacteria 2345
51 Ga0070659_100000430 3300005366 Bacteria 31705
52 Ga0070659_100041211 3300005366 Bacteria 3608
53 Ga0070659_100058088 3300005366 Bacteria 3052
54 Ga0070667_100001640 3300005367 Bacteria 20011
55 Ga0070667_100327322 3300005367 Bacteria 1384
56 Ga0070667_100344714 3300005367 Bacteria 1348
57 Ga0070709_10005663 3300005434 Bacteria 6769
58 Ga0070711_100211429 3300005439 Bacteria 1502
59 Ga0070708_100032815 3300005445 Bacteria 4506
60 Ga0070663_100002390 3300005455 Bacteria 10552
61 Ga0070678_100002432 3300005456 Bacteria 10201
62 Ga0070662_100003301 3300005457 Bacteria 10051
63 Ga0068867_100000228 3300005459 Bacteria 36773
64 Ga0068867_100003245 3300005459 Bacteria 11462
65 Ga0068867_100158774 3300005459 Bacteria 1782
66 Ga0070706_100009701 3300005467 Bacteria 8948
67 Ga0070706_100026361 3300005467 Bacteria 5348
68 Ga0070706_100143194 3300005467 Bacteria 2232
69 Ga0070707_100017523 3300005468 Bacteria 6735
70 Ga0070698_100068205 3300005471 Bacteria 3575
71 Ga0070698_100155566 3300005471 Bacteria 2232
72 Ga0070699_100131099 3300005518 Bacteria 2210
73 Ga0070684_100099095 3300005535 Bacteria 2600
74 Ga0070697_100025130 3300005536 Bacteria 4748
75 Ga0068853_100054042 3300005539 Bacteria 3461
76 Ga0068853_100174816 3300005539 Bacteria 1945
77 Ga0070672_100000447 3300005543 Bacteria 24121
78 Ga0070672_100038681 3300005543 Bacteria 3648
79 Ga0070665_100004803 3300005548 Bacteria 14048
80 Ga0070664_100000913 3300005564 Bacteria 23039
81 Ga0070664_100006225 3300005564 Bacteria 9641
82 Ga0068857_100059339 3300005577 Bacteria 3398
83 Ga0068859_100012341 3300005617 Bacteria 8594
84 Ga0068859_100371854 3300005617 Bacteria 1525
85 Ga0068861_100002083 3300005719 Bacteria 12968
86 Ga0068863_100605473 3300005841 Bacteria 1085
87 Ga0068860_100003217 3300005843 Bacteria 16844
88 Ga0068862_100004055 3300005844 Bacteria 12416
89 Ga0068862_100006190 3300005844 Bacteria 9966
90 Ga0081455_10002830 3300005937 Bacteria 20425
91 Ga0081455_10018432 3300005937 Bacteria 6651
92 Ga0081455_10040926 3300005937 Bacteria 4083
93 Ga0081455_10055397 3300005937 Bacteria 3373
94 Ga0081539_10001822 3300005985 Bacteria 33628
95 Ga0081539_10003077 3300005985 Bacteria 21465
96 Ga0075365_10015895 3300006038 Bacteria 4561
97 Ga0075368_10003121 3300006042 Bacteria 5496
98 Ga0075368_10015679 3300006042 Bacteria 2815
99 Ga0075363_100000538 3300006048 Bacteria 12245
100 Ga0075363_100015590 3300006048 Bacteria 3738
101 Ga0075363_100045740 3300006048 Bacteria 2321
102 Ga0075364_10033021 3300006051 Bacteria 3329
103 Ga0075364_10054094 3300006051 Bacteria 2624
104 Ga0075364_10198425 3300006051 Bacteria 1360
105 Ga0075364_10240507 3300006051 Bacteria 1230
106 Ga0070712_100045885 3300006175 Bacteria 3019
107 Ga0075362_10000173 3300006177 Bacteria 17794
108 Ga0075362_10022235 3300006177 Bacteria 2670
109 Ga0075367_10029207 3300006178 Bacteria 3152
110 Ga0075367_10044166 3300006178 Bacteria 2611
111 Ga0075367_10067815 3300006178 Bacteria 2139
112 Ga0075367_10115022 3300006178 Bacteria 1654
113 Ga0075367_10281073 3300006178 Bacteria 1046
114 Ga0075366_10000472 3300006195 Bacteria 18720
115 Ga0075366_10011930 3300006195 Bacteria 4919
116 Ga0075366_10013336 3300006195 Bacteria 4677
117 Ga0075366_10018606 3300006195 Bacteria 4013
118 Ga0075366_10027250 3300006195 Bacteria 3351
119 Ga0075366_10028967 3300006195 Bacteria 3251
120 Ga0075366_10031881 3300006195 Bacteria 3102
121 Ga0075366_10033377 3300006195 Bacteria 3032
122 Ga0075366_10039587 3300006195 Bacteria 2786
123 Ga0075366_10092386 3300006195 Bacteria 1813
124 Ga0075366_10099557 3300006195 Bacteria 1744
125 Ga0075370_10001362 3300006353 Bacteria 10515
126 Ga0075370_10013927 3300006353 Bacteria 4280
127 Ga0075370_10014833 3300006353 Bacteria 4162
128 Ga0075370_10057351 3300006353 Bacteria 2214
129 Ga0075370_10130310 3300006353 Bacteria 1467
130 Ga0068871_100249139 3300006358 Bacteria 1547
131 Ga0075428_100019815 3300006844 Bacteria 7443
132 Ga0075428_100573053 3300006844 Bacteria 1206
133 Ga0075430_100112978 3300006846 Bacteria 2264
134 Ga0075430_100158637 3300006846 Bacteria 1883
135 Ga0075431_100290698 3300006847 Bacteria 1653
136 Ga0075433_10001288 3300006852 Bacteria 18335
137 Ga0075434_100002418 3300006871 Bacteria 16405
138 Ga0075429_100002218 3300006880 Bacteria 16266
139 Ga0075436_100033776 3300006914 Bacteria 3526
140 Ga0097620_100012343 3300006931 Bacteria 8594
141 Ga0097620_100371847 3300006931 Bacteria 1525
142 Ga0099823_1000211 3300006944 Bacteria 32728
143 Ga0079104_1000024 3300006946 Bacteria 219543
144 Ga0075435_100006694 3300007076 Bacteria 8171
145 Ga0099794_10093503 3300007265 Bacteria 1495
146 Ga0105240_10001280 3300009093 Bacteria 43524
147 Ga0105240_10161787 3300009093 Bacteria 2658
148 Ga0111539_10298879 3300009094 Bacteria 1874
149 Ga0114129_10121124 3300009147 Bacteria 3601
150 Ga0114129_10443967 3300009147 Bacteria 1703
151 Ga0105243_10001277 3300009148 Bacteria 22593
152 Ga0105243_10103366 3300009148 Bacteria 2369
153 Ga0105248_10000537 3300009177 Bacteria 43166
154 Ga0105248_10062185 3300009177 Bacteria 4193
155 Ga0105237_10001734 3300009545 Bacteria 28197
156 Ga0105237_10020538 3300009545 Bacteria 6807
157 Ga0105237_10184429 3300009545 Bacteria 2087
158 Ga0105237_10216349 3300009545 Bacteria 1916
159 Ga0105238_10007274 3300009551 Bacteria 11082
160 Ga0105238_10008735 3300009551 Bacteria 10135
161 Ga0105238_10366693 3300009551 Bacteria 1430
162 Ga0105249_10067688 3300009553 Bacteria 3291
163 Ga0105249_10530849 3300009553 Bacteria 1225
164 Ga0105239_10001342 3300010375 Bacteria 33155
165 Ga0105239_10068264 3300010375 Bacteria 3907
166 Ga0105239_10144427 3300010375 Bacteria 2653
167 Ga0157319_1000003 3300012497 Bacteria 397199
168 Ga0157370_10019246 3300013104 Bacteria 6855
169 Ga0157369_10384195 3300013105 Bacteria 1457
170 Ga0163162_10004268 3300013306 Bacteria 13751
171 Ga0163162_10079187 3300013306 Bacteria 3352
172 Ga0163162_10810900 3300013306 Bacteria 1053
173 Ga0157375_10020176 3300013308 Bacteria 6082
174 Ga0157375_10094576 3300013308 Bacteria 3057
175 Ga0157375_10173980 3300013308 Bacteria 2302
176 Ga0157375_10262067 3300013308 Bacteria 1890
177 Ga0157380_10086958 3300014326 Bacteria 2570
178 Ga0157377_10000016 3300014745 Bacteria 190613
179 Ga0157377_10075135 3300014745 Bacteria 1962
180 Ga0157377_10135781 3300014745 Bacteria 1507
181 Ga0157379_10000359 3300014968 Bacteria 36602
182 Ga0157379_10007067 3300014968 Bacteria 9703
183 Ga0157379_10011186 3300014968 Bacteria 7821
184 Ga0157379_10421815 3300014968 Bacteria 1229
185 Ga0163161_10011249 3300017792 Bacteria 6200
186 Ga0163161_10215640 3300017792 Bacteria 1484
187 Ga0214544_1000016 3300021320 Bacteria 204278
188 Ga0214542_1000016 3300021321 Bacteria 210332
189 Ga0214545_1000008 3300021324 Bacteria 215190
190 Ga0214543_1000043 3300021327 Bacteria 160517
191 Ga0213872_10000006 3300021361 Bacteria 249845
192 Ga0213872_10000102 3300021361 Bacteria 79440
193 Ga0213872_10000139 3300021361 Bacteria 65459
194 Ga0213872_10000152 3300021361 Bacteria 63382
195 Ga0213872_10005055 3300021361 Bacteria 6839
196 Ga0213874_10013580 3300021377 Bacteria 2113
197 Ga0213874_10069374 3300021377 Bacteria 1121
198 Ga0209672_103607 3300025228 Bacteria 3135
199 Ga0209563_100044 3300025230 Bacteria 396812
200 Ga0209258_105519 3300025242 Bacteria 2126
201 Ga0209258_107796 3300025242 Bacteria 1559
202 Ga0207425_1000946 3300025245 Bacteria 13795
203 Ga0209677_100522 3300025253 Bacteria 21397
204 Ga0209129_1000041 3300025258 Bacteria 307590
205 Ga0209129_1016733 3300025258 Bacteria 1461
206 Ga0209455_1000528 3300025272 Bacteria 26777
207 Ga0209455_1001225 3300025272 Bacteria 12169
208 Ga0209673_1001671 3300025273 Bacteria 18985
209 Ga0209673_1014555 3300025273 Bacteria 3039
210 Ga0209673_1015984 3300025273 Bacteria 2826
211 Ga0209673_1040989 3300025273 Bacteria 1319
212 Ga0209564_1000029 3300025295 Bacteria 505995
213 Ga0209564_1000051 3300025295 Bacteria 357748
214 Ga0209564_1005871 3300025295 Bacteria 6816
215 Ga0209758_1000043 3300025297 Bacteria 402310
216 Ga0209758_1000057 3300025297 Bacteria 333111
217 Ga0209758_1000069 3300025297 Bacteria 286161
218 Ga0209758_1031198 3300025297 Bacteria 2191
219 Ga0209050_1000247 3300025298 Bacteria 116514
220 Ga0209050_1000995 3300025298 Bacteria 35798
221 Ga0209050_1003881 3300025298 Bacteria 10622
222 Ga0209050_1005005 3300025298 Bacteria 8612
223 Ga0209256_1000011 3300025299 Bacteria 865309
224 Ga0209256_1000675 3300025299 Bacteria 46128
225 Ga0209256_1005586 3300025299 Bacteria 7153
226 Ga0209256_1010579 3300025299 Bacteria 3836
227 Ga0209051_1000016 3300025303 Bacteria 541891
228 Ga0209257_1000017 3300025304 Bacteria 866287
229 Ga0209257_1000102 3300025304 Bacteria 251074
230 Ga0209257_1000564 3300025304 Bacteria 62815
231 Ga0209257_1005336 3300025304 Bacteria 9099
232 Ga0209257_1013434 3300025304 Bacteria 3641
233 Ga0209257_1019601 3300025304 Bacteria 2540
234 Ga0207697_10032538 3300025315 Bacteria 2135
235 Ga0207682_10000748 3300025893 Bacteria 15009
236 Ga0207642_10006672 3300025899 Bacteria 3852
237 Ga0207688_10075364 3300025901 Bacteria 1920
238 Ga0207688_10100344 3300025901 Bacteria 1671
239 Ga0207645_10002560 3300025907 Bacteria 14212
240 Ga0207645_10021528 3300025907 Bacteria 4204
241 Ga0207645_10036230 3300025907 Bacteria 3168
242 Ga0207643_10119031 3300025908 Bacteria 1563
243 Ga0207643_10223236 3300025908 Bacteria 1154
244 Ga0207705_10066616 3300025909 Bacteria 2605
245 Ga0207684_10030653 3300025910 Bacteria 4577
246 Ga0207684_10055446 3300025910 Bacteria 3363
247 Ga0207695_10012371 3300025913 Bacteria 10250
248 Ga0207695_10057886 3300025913 Bacteria 4025
249 Ga0207671_10011049 3300025914 Bacteria 7391
250 Ga0207693_10012757 3300025915 Bacteria 6783
251 Ga0207663_10032461 3300025916 Bacteria 3100
252 Ga0207649_10008572 3300025920 Bacteria 5578
253 Ga0207649_10065713 3300025920 Bacteria 2297
254 Ga0207649_10116700 3300025920 Bacteria 1793
255 Ga0207652_10334321 3300025921 Bacteria 1368
256 Ga0207681_10029245 3300025923 Bacteria 3577
257 Ga0207681_10043404 3300025923 Bacteria 3009
258 Ga0207694_10010050 3300025924 Bacteria 7133
259 Ga0207650_10000783 3300025925 Bacteria 24484
260 Ga0207659_10000307 3300025926 Bacteria 29582
261 Ga0207659_10044568 3300025926 Bacteria 3122
262 Ga0207659_10263633 3300025926 Bacteria 1403
263 Ga0207659_10322558 3300025926 Bacteria 1275
264 Ga0207644_10013045 3300025931 Bacteria 5531
265 Ga0207690_10001923 3300025932 Bacteria 12736
266 Ga0207706_10005864 3300025933 Bacteria 11427
267 Ga0207709_10001251 3300025935 Bacteria 18257
268 Ga0207709_10043178 3300025935 Bacteria 2716
269 Ga0207669_10002758 3300025937 Bacteria 7535
270 Ga0207669_10030762 3300025937 Bacteria 2988
271 Ga0207669_10061484 3300025937 Bacteria 2308
272 Ga0207691_10003997 3300025940 Bacteria 14303
273 Ga0207691_10070487 3300025940 Bacteria 3156
274 Ga0207711_10017338 3300025941 Bacteria 5983
275 Ga0207689_10035247 3300025942 Bacteria 4158
276 Ga0207689_10087815 3300025942 Bacteria 2554
277 Ga0207689_10259765 3300025942 Bacteria 1437
278 Ga0207679_10000573 3300025945 Bacteria 24705
279 Ga0207679_10003682 3300025945 Bacteria 9499
280 Ga0207651_10032204 3300025960 Bacteria 3364
281 Ga0207651_10054492 3300025960 Bacteria 2741
282 Ga0207712_10090818 3300025961 Bacteria 2248
283 Ga0207668_10005534 3300025972 Bacteria 7449
284 Ga0207640_10478093 3300025981 Bacteria 1033
285 Ga0207658_10001138 3300025986 Bacteria 21341
286 Ga0207658_10075072 3300025986 Bacteria 2571
287 Ga0207658_10149502 3300025986 Bacteria 1901
288 Ga0207703_10313091 3300026035 Bacteria 1435
289 Ga0207639_10097383 3300026041 Bacteria 2369
290 Ga0207678_10001091 3300026067 Bacteria 24903
291 Ga0207708_10012895 3300026075 Bacteria 6232
292 Ga0207702_10192031 3300026078 Bacteria 1887
293 Ga0207641_10060413 3300026088 Bacteria 3231
294 Ga0207648_10000598 3300026089 Bacteria 40545
295 Ga0207648_10002165 3300026089 Bacteria 21350
296 Ga0207648_10030699 3300026089 Bacteria 4757
297 Ga0207648_10156399 3300026089 Bacteria 2012
298 Ga0207648_10288666 3300026089 Bacteria 1468
299 Ga0207648_10426461 3300026089 Bacteria 1205
300 Ga0207676_10192200 3300026095 Bacteria 1797
301 Ga0207674_10019011 3300026116 Bacteria 7445
302 Ga0207674_10039848 3300026116 Bacteria 4868
303 Ga0207675_100004351 3300026118 Bacteria 13688
304 Ga0207683_10001684 3300026121 Bacteria 19770
305 Ga0207698_10014891 3300026142 Bacteria 5189
306 Ga0207698_10254220 3300026142 Bacteria 1610
307 Ga0209281_1000104 3300027111 Bacteria 221056
308 Ga0209371_1019135 3300027312 Bacteria 1715
309 Ga0209998_10010480 3300027717 Bacteria 1920
310 Ga0209813_10011507 3300027866 Bacteria 2315
311 Ga0209974_10005897 3300027876 Bacteria 4294
312 Ga0268266_10001895 3300028379 Bacteria 23574
313 Ga0268266_10007319 3300028379 Bacteria 9977
314 Ga0268266_10084814 3300028379 Bacteria 2767
315 Ga0268265_10005004 3300028380 Bacteria 9095
316 Ga0268264_10003397 3300028381 Bacteria 13750
317 Ga0265319_1025651 3300028563 Bacteria 2107
318 Ga0265323_10005053 3300028653 Bacteria 5635
319 Ga0265336_10002549 3300028666 Bacteria 7455
320 Ga0307517_10000150 3300028786 Bacteria 110446
321 Ga0307517_10084135 3300028786 Bacteria 2681
322 Ga0307517_10134755 3300028786 Bacteria 1761
323 Ga0307515_10000004 3300028794 Bacteria 846506
324 Ga0307515_10000830 3300028794 Bacteria 71111
325 Ga0307515_10002402 3300028794 Bacteria 40839
326 Ga0307515_10011679 3300028794 Bacteria 16633
327 Ga0307515_10021637 3300028794 Bacteria 11387
328 Ga0307515_10026130 3300028794 Bacteria 10064
329 Ga0307515_10067150 3300028794 Bacteria 4952
330 Ga0307515_10170346 3300028794 Bacteria 2174
331 Ga0307515_10171782 3300028794 Bacteria 2157
332 Ga0265338_10001066 3300028800 Bacteria 45588
333 Ga0268256_1011825 3300030500 Bacteria 2734
334 Ga0307512_10012395 3300030522 Bacteria 8045
335 Ga0307512_10025747 3300030522 Bacteria 5205
336 Ga0265325_10013360 3300031241 Bacteria 4677
337 Ga0265339_10026808 3300031249 Bacteria 3297
338 Ga0265331_10001772 3300031250 Bacteria 15463
339 Ga0265331_10030192 3300031250 Bacteria 2699
340 Ga0265327_10000012 3300031251 Bacteria 530403
341 Ga0265327_10001814 3300031251 Bacteria 25001
342 Ga0307513_10030508 3300031456 Bacteria 6124
343 Ga0307513_10381799 3300031456 Bacteria 1148
344 Ga0307509_10002837 3300031507 Bacteria 27455
345 Ga0307509_10011064 3300031507 Bacteria 10987
346 Ga0307509_10017922 3300031507 Bacteria 8131
347 Ga0307509_10129106 3300031507 Bacteria 2487
348 Ga0307509_10196928 3300031507 Bacteria 1857
349 Ga0307408_100000010 3300031548 Bacteria 420048
350 Ga0307508_10000061 3300031616 Bacteria 124749
351 Ga0307508_10001937 3300031616 Bacteria 22703
352 Ga0307508_10002030 3300031616 Bacteria 21943
353 Ga0307508_10217239 3300031616 Bacteria 1512
354 Ga0307508_10222589 3300031616 Bacteria 1486
355 Ga0307514_10089166 3300031649 Bacteria 2254
356 Ga0307514_10116209 3300031649 Bacteria 1880
357 Ga0265314_10008364 3300031711 Bacteria 8869
358 Ga0265314_10066066 3300031711 Bacteria 2441
359 Ga0265342_10158482 3300031712 Bacteria 1252
360 Ga0307516_10000293 3300031730 Bacteria 65013
361 Ga0307516_10006910 3300031730 Bacteria 13188
362 Ga0307516_10106435 3300031730 Bacteria 2615
363 Ga0307516_10202286 3300031730 Bacteria 1705
364 Ga0307516_10237918 3300031730 Bacteria 1521
365 Ga0307405_10014843 3300031731 Bacteria 4202
366 Ga0307413_10030884 3300031824 Bacteria 3015
367 Ga0307410_10102429 3300031852 Bacteria 2054
368 Ga0307406_10025146 3300031901 Bacteria 3563
369 Ga0307409_100015073 3300031995 Bacteria 5056
370 Ga0307409_100246349 3300031995 Bacteria 1631
371 Ga0307416_100167725 3300032002 Bacteria 2039
372 Ga0307414_10028632 3300032004 Bacteria 3616
373 Ga0307411_10227843 3300032005 Bacteria 1450
374 Ga0307415_100039530 3300032126 Bacteria 3119
375 Ga0307507_10142156 3300033179 Bacteria 1836
376 Ga0307510_10002474 3300033180 Bacteria 21007
377 Ga0307510_10032222 3300033180 Bacteria 5906
378 Ga0307510_10082015 3300033180 Bacteria 3122
379 Ga0316588_1001033 3300033528 Bacteria 4368
380 Ga0373959_0003778 3300034820 Bacteria 2426
381 Ga0373940_0063735 3300035088 Bacteria 1059
382 Ga0373944_0009484 3300035089 Bacteria 2641
383 Ga0373949_0009358 3300035090 Bacteria 2147
384 Ga0373936_0038480 3300035113 Bacteria 1912
385 Ga0373939_0000160 3300035114 Bacteria 18870
386 Ga0373945_0072435 3300035116 Bacteria 1306
387 Ga0373960_0000788 3300035121 Bacteria 6656
388 Ga0373943_0075340 3300035170 Bacteria 1718
389 Ga0373946_0085616 3300035171 Bacteria 1388
390 Ga0373961_0068057 3300035241 Bacteria 1096
391 Ga0373931_0000233 3300035691 Bacteria 23590
392 Ga0373931_0008851 3300035691 Bacteria 4793
393 Ga0373931_0073786 3300035691 Bacteria 1868
394 Ga0373935_0066670 3300035692 Bacteria 2313
395 Ga0373927_0028336 3300035695 Bacteria 3652
396 Ga0373933_0098175 3300035724 Bacteria 1815
397 Ga0373947_0029221 3300035725 Bacteria 3234
398 Ga0373947_0054990 3300035725 Bacteria 2403
399 Ga0373925_0000845 3300037068 Bacteria 28162
400 Ga0395900_0000131 3300037418 Bacteria 125554
401 Ga0395898_0001669 3300037466 Bacteria 29777
402 Ga0395898_0080691 3300037466 Bacteria 3137
403 Ga0395905_0001385 3300037471 Bacteria 29377
404 Ga0395905_0002862 3300037471 Bacteria 18861
405 Ga0395905_0003089 3300037471 Bacteria 17998
406 Ga0395905_0015223 3300037471 Bacteria 7314
407 Ga0395905_0054712 3300037471 Bacteria 3734
408 Ga0395905_0059971 3300037471 Bacteria 3557
409 Ga0395905_0095910 3300037471 Bacteria 2784
410 Ga0395905_0271694 3300037471 Bacteria 1581
411 Ga0436364_1183040 3300037853 Bacteria 1415
412 Ga0436360_0130330 3300039438 Bacteria 4642
413 Ga0436361_0208451 3300039447 Bacteria 3319
414 Ga0436361_0301322 3300039447 Bacteria 54194
415 Ga0436361_0369025 3300039447 Bacteria 1008
416 Ga0436361_0614815 3300039447 Bacteria 45728
417 Ga0436361_0734234 3300039447 Bacteria 30887
418 Ga0436361_0825317 3300039447 Bacteria 2567
419 Ga0436361_1059830 3300039447 Bacteria 25253
420 Ga0436363_0024718 3300039450 Bacteria 3023
421 Ga0436363_0086029 3300039450 Bacteria 1924
422 Ga0436363_0610754 3300039450 Bacteria 5168
423 Ga0436363_1060569 3300039450 Bacteria 1102
424 Ga0436363_1578922 3300039450 Bacteria 4744
425 Ga0436362_1278682 3300039453 Bacteria 2081
426 Ga0439465_0070744 3300041413 Bacteria 1169
427 Ga0451800_0538243 3300041459 Bacteria 2078
428 Ga0439441_011679 3300042001 Bacteria 1493
429 Ga0439450_021202 3300042008 Bacteria 1393
430 Ga0450917_000031 3300042120 Bacteria 6907
431 Ga0450919_000578 3300042121 Bacteria 4616
432 Ga0450891_000788 3300042129 Bacteria 3314
433 Ga0450892_000949 3300042130 Bacteria 3116
434 Ga0450889_000243 3300042144 Bacteria 6015
435 Ga0439459_0010540 3300042438 Bacteria 1614
436 Ga0450916_006341 3300042530 Bacteria 1391
437 Ga0450918_000929 3300042531 Bacteria 6115
438 Ga0450893_0000452 3300042532 Bacteria 5800
439 Ga0451577_0006041 3300042876 Bacteria 12188
440 Ga0466969_0000017 3300044656 Bacteria 103792
441 Ga0466969_0016731 3300044656 Bacteria 3834
442 Ga0466969_0024691 3300044656 Bacteria 3092
443 Ga0466972_0000564 3300044658 Bacteria 18111
444 Ga0466972_0048615 3300044658 Bacteria 2049
445 Ga0466965_0008331 3300044683 Bacteria 4795
446 Ga0466965_0064814 3300044683 Bacteria 1829
447 Ga0466966_0009318 3300044684 Bacteria 6501
448 Ga0466961_0000074 3300044693 Bacteria 61968
449 Ga0466961_0005109 3300044693 Bacteria 8260
450 Ga0466963_0026258 3300044694 Bacteria 3723
451 Ga0466963_0162299 3300044694 Bacteria 1555
452 Ga0466964_0001826 3300044706 Bacteria 7410
453 Ga0466964_0071065 3300044706 Bacteria 1472
454 Ga0453684_0069157 3300044712 Bacteria 4480
455 Ga0466970_0012504 3300044765 Bacteria 4342
456 Ga0466960_0009764 3300044901 Bacteria 3968
457 Ga0466959_0004446 3300045049 Bacteria 9384
458 Ga0466959_0046795 3300045049 Bacteria 3183
459 Ga0466959_0060757 3300045049 Bacteria 2749
460 Ga0451576_0003849 3300045051 Bacteria 20145
461 Ga0451576_0024941 3300045051 Bacteria 6451
462 Ga0451576_0030018 3300045051 Bacteria 5814
463 Ga0451576_0061714 3300045051 Bacteria 3909
464 Ga0451576_0383311 3300045051 Bacteria 1473
465 Ga0466967_0025238 3300045976 Bacteria 4898
466 Ga0495592_0005413 3300046454 Bacteria 9423
467 Ga0495592_0106780 3300046454 Bacteria 1987
468 Ga0495638_0035681 3300046460 Bacteria 3169
469 Ga0495580_0072083 3300046472 Bacteria 2413
470 Ga0495605_0091194 3300046474 Bacteria 1412
471 Ga0495610_0016173 3300046512 Bacteria 4308
472 Ga0495620_0086886 3300046515 Bacteria 1258
473 Ga0495632_0004080 3300046519 Bacteria 10076
474 Ga0495632_0063116 3300046519 Bacteria 1794
475 Ga0495643_0078625 3300046522 Bacteria 1721
476 Ga0495648_0150663 3300046524 Bacteria 1214
477 Ga0495640_0046861 3300046533 Bacteria 2993
478 Ga0495640_0060812 3300046533 Bacteria 2568
479 Ga0495621_0000186 3300046539 Bacteria 14274
480 Ga0495597_0048143 3300046542 Bacteria 1886
481 Ga0495667_0159711 3300046559 Bacteria 1450
482 Ga0495625_0001549 3300046660 Bacteria 27422
483 Ga0495625_0071759 3300046660 Bacteria 2429
484 Ga0495658_0075922 3300046683 Bacteria 1963
485 Ga0495658_0095825 3300046683 Bacteria 1764
486 Ga0495649_0008664 3300046694 Bacteria 6107
487 Ga0495672_0134309 3300047320 Bacteria 1299
488 Ga0495676_0028995 3300047321 Bacteria 4718
489 Ga0495687_001178 3300047443 Bacteria 25204
490 Ga0495626_0014741 3300048091 Bacteria 4020
491 Ga0496102_0027674 3300048905 Bacteria 5063
492 Ga0496102_0035862 3300048905 Bacteria 4467
493 Ga0496102_0357184 3300048905 Bacteria 1375
494 Ga0496103_0048511 3300048906 Bacteria 2624
495 Ga0496104_0040713 3300048907 Bacteria 4356
496 Ga0496107_0164599 3300048910 Bacteria 1644
497 Ga0496108_0089284 3300048911 Bacteria 2619
498 Ga0496109_0016778 3300048912 Bacteria 6408
499 Ga0496109_0114394 3300048912 Bacteria 2510
500 Ga0496110_0002699 3300048913 Bacteria 13407
501 Ga0496110_0080162 3300048913 Bacteria 2908
502 Ga0496111_0007354 3300048914 Bacteria 7209
503 Ga0496112_0120830 3300048915 Bacteria 2589
504 Ga0496112_0395590 3300048915 Bacteria 1322
505 Ga0496113_0151404 3300048916 Bacteria 1830
506 Ga0496114_0002388 3300048917 Bacteria 14284
507 Ga0496114_0050228 3300048917 Bacteria 3471
508 Ga0496121_0040338 3300048924 Bacteria 4098
509 Ga0496121_0103054 3300048924 Bacteria 2197
510 Ga0496124_0000344 3300048927 Bacteria 85082
511 Ga0496124_0073367 3300048927 Bacteria 2832
512 Ga0496126_0397397 3300048929 Bacteria 1119
513 Ga0501300_002135 3300049523 Bacteria 2945
514 Ga0501033_0004389 3300049570 Bacteria 11303
515 Ga0501033_0069214 3300049570 Bacteria 2594
516 Ga0501034_0082652 3300049571 Bacteria 3213
517 Ga0501034_0112378 3300049571 Bacteria 2714
518 Ga0501034_0424909 3300049571 Bacteria 1249
519 Ga0501036_0032714 3300049572 Bacteria 4396
520 Ga0501036_0366043 3300049572 Bacteria 1203
521 Ga0501038_0045228 3300049574 Bacteria 3822
522 Ga0501038_0135965 3300049574 Bacteria 2014
523 Ga0501039_0020771 3300049575 Bacteria 5033
524 Ga0501042_0225088 3300049578 Bacteria 1353
525 Ga0501043_0000053 3300049579 Bacteria 106085
526 Ga0501043_0323223 3300049579 Bacteria 1176
527 Ga0501046_0000018 3300049580 Bacteria 220589
528 Ga0501047_0000020 3300049581 Bacteria 259377
529 Ga0501047_0000450 3300049581 Bacteria 45480
530 Ga0501047_0120364 3300049581 Bacteria 2507
531 Ga0501048_0001721 3300049582 Bacteria 16679
532 Ga0501070_0040069 3300049586 Bacteria 3907
533 Ga0501073_0124316 3300049589 Bacteria 1788
534 Ga0501198_000008 3300049649 Bacteria 129023
535 Ga0501222_000006 3300049662 Bacteria 129030
536 Ga0501222_000379 3300049662 Bacteria 6797
537 Ga0501223_008869 3300049663 Bacteria 2046
538 Ga0501233_001124 3300049668 Bacteria 4527
539 Ga0501235_007250 3300049669 Bacteria 2419
540 Ga0501229_000306 3300049706 Bacteria 5525
541 Ga0501080_0008732 3300049742 Bacteria 9202
542 Ga0501083_0085655 3300049744 Bacteria 2084
543 Ga0501265_001741 3300049762 Bacteria 2470
544 Ga0501035_0024881 3300049822 Bacteria 5490
545 Ga0501035_0188752 3300049822 Bacteria 1773
546 Ga0501044_0005424 3300049823 Bacteria 14164
547 Ga0501044_0040165 3300049823 Bacteria 4877
548 Ga0501044_0209651 3300049823 Bacteria 1903
549 nmdc:mga03683_17461_c1 3300050489 Bacteria 2716
550 nmdc:mga03683_225_c1 3300050489 Bacteria 17847
551 nmdc:mga03683_96075_c1 3300050489 Bacteria 1297
552 nmdc:mga03n38_29224_c1 3300050490 Bacteria 2305
553 nmdc:mga03n38_47794_c1 3300050490 Bacteria 1896
554 nmdc:mga00v17_108519_c1 3300050491 Bacteria 1759
555 nmdc:mga0yw44_134354_c1 3300050492 Bacteria 1604
556 nmdc:mga0yw44_2367_c1 3300050492 Bacteria 8005
557 nmdc:mga0k408_1070_c1 3300050493 Bacteria 5611
558 nmdc:mga0k408_112045_c1 3300050493 Bacteria 1613
559 nmdc:mga0k408_1281_c1 3300050493 Bacteria 13618
560 nmdc:mga0k408_16810_c2 3300050493 Bacteria 1840
561 nmdc:mga0k408_1749_c1 3300050493 Bacteria 11633
562 nmdc:mga0k408_226254_c1 3300050493 Bacteria 1117
563 nmdc:mga0k408_330_c1 3300050493 Bacteria 25941
564 nmdc:mga0k408_34111_c1 3300050493 Bacteria 2913
565 nmdc:mga0k408_41753_c1 3300050493 Bacteria 2641
566 nmdc:mga0k408_51273_c2 3300050493 Bacteria 1177
567 nmdc:mga0k408_5951_c1 3300050493 Bacteria 6507
568 nmdc:mga0k408_79678_c1 3300050493 Bacteria 1917
569 nmdc:mga0k408_83212_c1 3300050493 Bacteria 1876
570 nmdc:mga0k408_97238_c1 3300050493 Bacteria 1734
571 nmdc:mga06z11_242838_c1 3300050494 Bacteria 1058
572 nmdc:mga06z11_4773_c1 3300050494 Bacteria 5363
573 nmdc:mga04h51_18533_c1 3300050495 Bacteria 2052
574 nmdc:mga04h51_22170_c1 3300050495 Bacteria 1919
575 nmdc:mga07m45_1145_c1 3300050496 Bacteria 11887
576 nmdc:mga07m45_191_c1 3300050496 Bacteria 24330
577 nmdc:mga07m45_20994_c1 3300050496 Bacteria 3552
578 nmdc:mga07m45_22525_c1 3300050496 Bacteria 3440
579 nmdc:mga07m45_32623_c1 3300050496 Bacteria 2888
580 nmdc:mga07m45_3609_c1 3300050496 Bacteria 7474
581 nmdc:mga07m45_6895_c1 3300050496 Bacteria 5778
582 nmdc:mga07m45_7386_c1 3300050496 Bacteria 5614
583 nmdc:mga07m45_80696_c1 3300050496 Bacteria 1857
584 nmdc:mga05p37_243536_c1 3300050507 Bacteria 2161
585 nmdc:mga09592_171580_c1 3300050508 Bacteria 1876
586 nmdc:mga09592_32016_c1 3300050508 Bacteria 4383
587 nmdc:mga0qj67_142164_c1 3300050509 Bacteria 1946
588 nmdc:mga06r32_119501_c1 3300050510 Bacteria 2599
589 nmdc:mga06r32_16794_c1 3300050510 Bacteria 6673
590 nmdc:mga08y16_397516_c1 3300050511 Bacteria 1411
591 nmdc:mga08y16_432827_c1 3300050511 Bacteria 1343
592 nmdc:mga0n895_12302_c1 3300050512 Bacteria 7671
593 nmdc:mga0rr50_160975_c1 3300050513 Bacteria 1822
594 nmdc:mga0a205_2105_c1 3300050515 Bacteria 17452
595 Ga0495619_0104564 3300053085 Bacteria 1930
596 Ga0500578_0002292 3300053086 Bacteria 16416
597 Ga0500644_0000369 3300053088 Bacteria 22061
598 Ga0500644_0045667 3300053088 Bacteria 1477
599 Ga0500646_0002920 3300053090 Bacteria 4387
600 Ga0500651_0026657 3300053093 Bacteria 3634
601 Ga0500651_0036230 3300053093 Bacteria 3109
602 Ga0500651_0138644 3300053093 Bacteria 1467
603 Ga0500566_0176182 3300053094 Bacteria 1101
604 Ga0500641_0001080 3300053096 Bacteria 9716
605 Ga0500562_032977 3300053108 Bacteria 1368
606 Ga0500569_015919 3300053109 Bacteria 1894
607 Ga0500593_000112 3300053117 Bacteria 31359
608 Ga0500594_0000801 3300053118 Bacteria 6704
609 Ga0500594_0056879 3300053118 Bacteria 1117
610 Ga0500642_0000226 3300053130 Bacteria 22146
611 Ga0500652_001118 3300053131 Bacteria 8634
612 Ga0500652_051291 3300053131 Bacteria 1685
613 Ga0500658_0006490 3300053134 Bacteria 4337
614 Ga0500658_0045469 3300053134 Bacteria 1775
615 Ga0500559_0000069 3300053136 Bacteria 82288
616 Ga0500577_0014963 3300053142 Bacteria 2412
617 Ga0500590_012594 3300053148 Bacteria 4315
618 Ga0500619_000115 3300053154 Bacteria 21281
619 Ga0500622_0000881 3300053156 Bacteria 25562
620 Ga0500622_0002263 3300053156 Bacteria 14137
621 Ga0500622_0002736 3300053156 Bacteria 12446
622 Ga0500645_000143 3300053730 Bacteria 56081
623 Ga0500552_000173 3300053733 Bacteria 5642
624 Ga0500587_001168 3300053739 Bacteria 3627
625 Ga0500587_001948 3300053739 Bacteria 2944
626 Ga0590071_001052 3300059421 Bacteria 7476
627 Ga0501082_0027134 3300060353 Bacteria 4933

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_0098175 Ga0373933_0098175_25_837 268
2 3300044694 Ga0466963_0162299 Ga0466963_0162299_582_1397 269
3 3300005439 Ga0070711_100211429 Ga0070711_1002114292 281
4 3300006175 Ga0070712_100045885 Ga0070712_1000458852 281
5 3300025297 Ga0209758_1031198 Ga0209758_10311982 281
6 3300025915 Ga0207693_10012757 Ga0207693_100127574 281
7 3300025916 Ga0207663_10032461 Ga0207663_100324612 281
8 3300047320 Ga0495672_0134309 Ga0495672_0134309_358_1209 281
9 3300049570 Ga0501033_0004389 Ga0501033_0004389_4930_5781 281
10 3300049581 Ga0501047_0120364 Ga0501047_0120364_1464_2315 281
11 3300049823 Ga0501044_0005424 Ga0501044_0005424_9621_10472 281
12 3300025926 Ga0207659_10044568 Ga0207659_100445682 289
13 3300014968 Ga0157379_10000359 Ga0157379_100003594 292
14 3300046472 Ga0495580_0072083 Ga0495580_0072083_881_1876 293
15 iso_pu_bacteria 3003930520 3003934594 293
16 3300050494 nmdc:mga06z11_242838_c1 nmdc:mga06z11_242838_c1_13_906 295
17 3300009551 Ga0105238_10008735 Ga0105238_100087353 296
18 3300048924 Ga0496121_0103054 Ga0496121_0103054_867_1763 296
19 3300053093 Ga0500651_0036230 Ga0500651_0036230_167_1075 296
20 3300053108 Ga0500562_032977 Ga0500562_032977_315_1223 296
21 3300005331 Ga0070670_100371698 Ga0070670_1003716981 297
22 3300005344 Ga0070661_100100993 Ga0070661_1001009932 297
23 3300005355 Ga0070671_100181600 Ga0070671_1001816002 297
24 3300006177 Ga0075362_10000173 Ga0075362_100001732 297
25 3300009545 Ga0105237_10020538 Ga0105237_100205384 297
26 3300021377 Ga0213874_10069374 Ga0213874_100693741 297
27 3300025920 Ga0207649_10065713 Ga0207649_100657132 297
28 3300026142 Ga0207698_10254220 Ga0207698_102542202 297
29 3300031241 Ga0265325_10013360 Ga0265325_100133604 297
30 3300031249 Ga0265339_10026808 Ga0265339_100268082 297
31 3300031250 Ga0265331_10030192 Ga0265331_100301921 297
32 3300031711 Ga0265314_10008364 Ga0265314_100083643 297
33 3300031712 Ga0265342_10158482 Ga0265342_101584822 297
34 3300033528 Ga0316588_1001033 Ga0316588_10010331 297
35 3300039450 Ga0436363_0086029 Ga0436363_0086029_26_931 297
36 3300039450 Ga0436363_0610754 Ga0436363_0610754_3793_4701 297
37 3300039450 Ga0436363_1060569 Ga0436363_1060569_166_1068 297
38 3300039453 Ga0436362_1278682 Ga0436362_1278682_693_1601 297
39 3300048929 Ga0496126_0397397 Ga0496126_0397397_165_1076 297
40 3300049570 Ga0501033_0069214 Ga0501033_0069214_1191_2093 297
41 3300049571 Ga0501034_0082652 Ga0501034_0082652_159_1061 297
42 3300049571 Ga0501034_0112378 Ga0501034_0112378_1742_2653 297
43 3300049571 Ga0501034_0424909 Ga0501034_0424909_85_987 297
44 3300049572 Ga0501036_0032714 Ga0501036_0032714_1832_2734 297
45 3300049572 Ga0501036_0366043 Ga0501036_0366043_255_1157 297
46 3300049574 Ga0501038_0045228 Ga0501038_0045228_1046_1948 297
47 3300049574 Ga0501038_0135965 Ga0501038_0135965_1029_1940 297
48 3300049575 Ga0501039_0020771 Ga0501039_0020771_571_1473 297
49 3300049586 Ga0501070_0040069 Ga0501070_0040069_2501_3403 297
50 3300049589 Ga0501073_0124316 Ga0501073_0124316_677_1588 297
51 3300049822 Ga0501035_0024881 Ga0501035_0024881_2715_3617 297
52 3300049823 Ga0501044_0040165 Ga0501044_0040165_2328_3230 297
53 3300050489 nmdc:mga03683_225_c1 nmdc:mga03683_225_c1_15012_15926 297
54 3300053088 Ga0500644_0000369 Ga0500644_0000369_5921_6832 297
55 3300053096 Ga0500641_0001080 Ga0500641_0001080_4203_5114 297
56 3300053118 Ga0500594_0056879 Ga0500594_0056879_30_941 297
57 iso_pu_bacteria 2522572158 2523105150 297
58 3300005985 Ga0081539_10003077 Ga0081539_1000307713 298
59 3300005434 Ga0070709_10005663 Ga0070709_100056634 299
60 3300021377 Ga0213874_10013580 Ga0213874_100135802 299
61 3300025972 Ga0207668_10005534 Ga0207668_100055342 299
62 3300039450 Ga0436363_1578922 Ga0436363_1578922_2418_3353 299
63 3300013104 Ga0157370_10019246 Ga0157370_100192463 300
64 3300028379 Ga0268266_10007319 Ga0268266_100073192 300
65 3300039447 Ga0436361_0369025 Ga0436361_0369025_28_957 300
66 3300005844 Ga0068862_100006190 Ga0068862_1000061906 301
67 3300006195 Ga0075366_10039587 Ga0075366_100395874 301
68 3300005543 Ga0070672_100038681 Ga0070672_1000386813 302
69 3300025923 Ga0207681_10029245 Ga0207681_100292452 302
70 3300025940 Ga0207691_10070487 Ga0207691_100704874 302
71 3300039450 Ga0436363_0024718 Ga0436363_0024718_285_1220 302
72 3300046539 Ga0495621_0000186 Ga0495621_0000186_9813_10784 302
73 iso_pu_bacteria 2824732956 2824737709 302
74 iso_pu_bacteria 2824746037 2824748649 302
75 iso_pu_bacteria 2908775508 2908776325 302
76 3300005327 Ga0070658_10305120 Ga0070658_103051202 303
77 3300005337 Ga0070682_100050418 Ga0070682_1000504182 303
78 3300005345 Ga0070692_10012635 Ga0070692_100126351 303
79 3300005356 Ga0070674_100020712 Ga0070674_1000207123 303
80 3300005366 Ga0070659_100041211 Ga0070659_1000412114 303
81 3300005367 Ga0070667_100344714 Ga0070667_1003447142 303
82 3300005459 Ga0068867_100158774 Ga0068867_1001587742 303
83 3300005535 Ga0070684_100099095 Ga0070684_1000990953 303
84 3300006358 Ga0068871_100249139 Ga0068871_1002491392 303
85 3300009545 Ga0105237_10216349 Ga0105237_102163492 303
86 3300009551 Ga0105238_10366693 Ga0105238_103666932 303
87 3300013306 Ga0163162_10079187 Ga0163162_100791873 303
88 3300013308 Ga0157375_10262067 Ga0157375_102620673 303
89 3300014745 Ga0157377_10135781 Ga0157377_101357812 303
90 3300014968 Ga0157379_10421815 Ga0157379_104218152 303
91 3300017792 Ga0163161_10215640 Ga0163161_102156402 303
92 3300025901 Ga0207688_10100344 Ga0207688_101003442 303
93 3300025909 Ga0207705_10066616 Ga0207705_100666162 303
94 3300025921 Ga0207652_10334321 Ga0207652_103343212 303
95 3300025926 Ga0207659_10322558 Ga0207659_103225582 303
96 3300025937 Ga0207669_10030762 Ga0207669_100307623 303
97 3300025942 Ga0207689_10087815 Ga0207689_100878152 303
98 3300025981 Ga0207640_10478093 Ga0207640_104780931 303
99 3300026035 Ga0207703_10313091 Ga0207703_103130912 303
100 3300026089 Ga0207648_10288666 Ga0207648_102886662 303
101 3300028794 Ga0307515_10000004 Ga0307515_10000004337 303
102 3300031711 Ga0265314_10066066 Ga0265314_100660663 303
103 3300037471 Ga0395905_0001385 Ga0395905_0001385_17005_17928 303
104 3300045051 Ga0451576_0061714 Ga0451576_0061714_1328_2248 303
105 3300046559 Ga0495667_0159711 Ga0495667_0159711_181_1113 303
106 3300048905 Ga0496102_0357184 Ga0496102_0357184_130_1050 303
107 3300048906 Ga0496103_0048511 Ga0496103_0048511_135_1055 303
108 3300048910 Ga0496107_0164599 Ga0496107_0164599_707_1627 303
109 3300048911 Ga0496108_0089284 Ga0496108_0089284_1340_2260 303
110 3300048912 Ga0496109_0016778 Ga0496109_0016778_5453_6373 303
111 3300048913 Ga0496110_0002699 Ga0496110_0002699_7134_8054 303
112 3300048914 Ga0496111_0007354 Ga0496111_0007354_2734_3654 303
113 3300049579 Ga0501043_0323223 Ga0501043_0323223_81_1010 303
114 3300049649 Ga0501198_000008 Ga0501198_000008_22510_23469 303
115 3300049662 Ga0501222_000006 Ga0501222_000006_105575_106534 303
116 3300053085 Ga0495619_0104564 Ga0495619_0104564_646_1578 303
117 iso_pu_bacteria 2513237161 2514012535 303
118 iso_pu_bacteria 2617270741 2617373808 303
119 iso_pu_bacteria 2838122688 2838124566 303
120 iso_pu_bacteria 2841941048 2841945253 303
121 iso_pu_bacteria 2841949485 2841952034 303
122 iso_pu_bacteria 2841974524 2841981821 303
123 iso_pu_bacteria 2841983080 2841985099 303
124 iso_pu_bacteria 2842038055 2842043456 303
125 iso_pu_bacteria 2842045827 2842052554 303
126 3300009093 Ga0105240_10001280 Ga0105240_1000128026 304
127 3300009553 Ga0105249_10530849 Ga0105249_105308492 304
128 3300021320 Ga0214544_1000016 Ga0214544_1000016124 304
129 3300021321 Ga0214542_1000016 Ga0214542_100001678 304
130 3300021324 Ga0214545_1000008 Ga0214545_100000884 304
131 3300021327 Ga0214543_1000043 Ga0214543_100004334 304
132 3300033180 Ga0307510_10002474 Ga0307510_100024747 304
133 3300037471 Ga0395905_0015223 Ga0395905_0015223_5085_6059 304
134 3300037853 Ga0436364_1183040 Ga0436364_1183040_438_1388 304
135 3300044656 Ga0466969_0024691 Ga0466969_0024691_1789_2763 304
136 3300044693 Ga0466961_0000074 Ga0466961_0000074_29524_30498 304
137 3300045049 Ga0466959_0060757 Ga0466959_0060757_753_1727 304
138 3300053094 Ga0500566_0176182 Ga0500566_0176182_18_989 304
139 iso_pu_bacteria 2874620515 2874624841 304
140 iso_pu_bacteria 2904666416 2904670204 304
141 iso_pu_bacteria 2935648319 2935653568 304
142 iso_pu_bacteria 2935656913 2935662317 304
143 iso_pu_bacteria 2935984226 2935985194 304
144 iso_pu_bacteria 2936011229 2936016619 304
145 iso_pu_bacteria 2936019824 2936025252 304
146 iso_pu_bacteria 2936028420 2936034094 304
147 iso_pu_bacteria 2936046547 2936052151 304
148 iso_pu_bacteria 2936055302 2936056366 304
149 iso_pu_bacteria 3005587118 3005591567 304
150 iso_pu_bacteria 8016630954 8016635567 304
151 3300001990 JGI24737J22298_10041977 JGI24737J22298_100419772 305
152 3300003215 JGI25153J46596_10002417 JGI25153J46596_100024176 305
153 3300003794 Ga0055531_10004532 Ga0055531_100045324 305
154 3300005262 Ga0065165_1003542 Ga0065165_10035427 305
155 3300005366 Ga0070659_100058088 Ga0070659_1000580882 305
156 3300005445 Ga0070708_100032815 Ga0070708_1000328154 305
157 3300005467 Ga0070706_100026361 Ga0070706_1000263614 305
158 3300005467 Ga0070706_100143194 Ga0070706_1001431942 305
159 3300005471 Ga0070698_100068205 Ga0070698_1000682053 305
160 3300005471 Ga0070698_100155566 Ga0070698_1001555662 305
161 3300005518 Ga0070699_100131099 Ga0070699_1001310993 305
162 3300005536 Ga0070697_100025130 Ga0070697_1000251303 305
163 3300006048 Ga0075363_100000538 Ga0075363_1000005385 305
164 3300006051 Ga0075364_10198425 Ga0075364_101984252 305
165 3300006178 Ga0075367_10115022 Ga0075367_101150222 305
166 3300006844 Ga0075428_100019815 Ga0075428_1000198152 305
167 3300006844 Ga0075428_100573053 Ga0075428_1005730531 305
168 3300006846 Ga0075430_100158637 Ga0075430_1001586372 305
169 3300006847 Ga0075431_100290698 Ga0075431_1002906982 305
170 3300006852 Ga0075433_10001288 Ga0075433_1000128818 305
171 3300006871 Ga0075434_100002418 Ga0075434_1000024182 305
172 3300006914 Ga0075436_100033776 Ga0075436_1000337763 305
173 3300007076 Ga0075435_100006694 Ga0075435_1000066946 305
174 3300009093 Ga0105240_10161787 Ga0105240_101617872 305
175 3300009147 Ga0114129_10443967 Ga0114129_104439672 305
176 3300010375 Ga0105239_10144427 Ga0105239_101444272 305
177 3300025295 Ga0209564_1005871 Ga0209564_10058713 305
178 3300025297 Ga0209758_1000069 Ga0209758_1000069105 305
179 3300025299 Ga0209256_1005586 Ga0209256_10055862 305
180 3300025304 Ga0209257_1000564 Ga0209257_100056441 305
181 3300025910 Ga0207684_10055446 Ga0207684_100554463 305
182 3300025913 Ga0207695_10057886 Ga0207695_100578862 305
183 3300035725 Ga0373947_0029221 Ga0373947_0029221_1167_2129 305
184 3300050489 nmdc:mga03683_96075_c1 nmdc:mga03683_96075_c1_182_1144 305
185 3300050490 nmdc:mga03n38_29224_c1 nmdc:mga03n38_29224_c1_204_1127 305
186 3300050493 nmdc:mga0k408_41753_c1 nmdc:mga0k408_41753_c1_1086_2048 305
187 3300050507 nmdc:mga05p37_243536_c1 nmdc:mga05p37_243536_c1_110_1072 305
188 3300050508 nmdc:mga09592_171580_c1 nmdc:mga09592_171580_c1_582_1544 305
189 3300050510 nmdc:mga06r32_119501_c1 nmdc:mga06r32_119501_c1_268_1230 305
190 3300050510 nmdc:mga06r32_16794_c1 nmdc:mga06r32_16794_c1_3450_4412 305
191 3300050512 nmdc:mga0n895_12302_c1 nmdc:mga0n895_12302_c1_1983_2945 305
192 3300050513 nmdc:mga0rr50_160975_c1 nmdc:mga0rr50_160975_c1_176_1138 305
193 3300050515 nmdc:mga0a205_2105_c1 nmdc:mga0a205_2105_c1_15806_16768 305
194 iso_pu_bacteria 2802428858 2802722132 305
195 iso_pu_bacteria 2802428862 2802747757 305
196 iso_pu_bacteria 2824671348 2824674390 305
197 iso_pu_bacteria 2824687955 2824691112 305
198 iso_pu_bacteria 2841966195 2841970572 305
199 iso_pu_bacteria 2960693952 2960694723 305
200 3300003752 Ga0055539_1003304 Ga0055539_10033042 306
201 3300005937 Ga0081455_10040926 Ga0081455_100409263 306
202 3300025253 Ga0209677_100522 Ga0209677_1005222 306
203 3300025272 Ga0209455_1001225 Ga0209455_100122510 306
204 3300026116 Ga0207674_10019011 Ga0207674_100190112 306
205 3300028563 Ga0265319_1025651 Ga0265319_10256512 306
206 3300028653 Ga0265323_10005053 Ga0265323_100050532 306
207 3300028666 Ga0265336_10002549 Ga0265336_100025492 306
208 3300028800 Ga0265338_10001066 Ga0265338_1000106648 306
209 3300039447 Ga0436361_0825317 Ga0436361_0825317_123_1097 306
210 3300046533 Ga0495640_0046861 Ga0495640_0046861_693_1679 306
211 3300048924 Ga0496121_0040338 Ga0496121_0040338_1479_2447 306
212 3300050492 nmdc:mga0yw44_2367_c1 nmdc:mga0yw44_2367_c1_3364_4365 306
213 3300053130 Ga0500642_0000226 Ga0500642_0000226_17271_18236 306
214 3300053730 Ga0500645_000143 Ga0500645_000143_14683_15660 306
215 iso_pu_bacteria 2847930680 2847931125 306
216 3300005293 Ga0065715_10023582 Ga0065715_100235822 307
217 3300005331 Ga0070670_100001786 Ga0070670_1000017869 307
218 3300005353 Ga0070669_100048889 Ga0070669_1000488892 307
219 3300005354 Ga0070675_100007685 Ga0070675_1000076856 307
220 3300005355 Ga0070671_100013507 Ga0070671_1000135076 307
221 3300005356 Ga0070674_100004831 Ga0070674_1000048316 307
222 3300005364 Ga0070673_100020575 Ga0070673_1000205755 307
223 3300005456 Ga0070678_100002432 Ga0070678_1000024327 307
224 3300005459 Ga0068867_100003245 Ga0068867_1000032451 307
225 3300005543 Ga0070672_100000447 Ga0070672_1000004479 307
226 3300005548 Ga0070665_100004803 Ga0070665_1000048037 307
227 3300005937 Ga0081455_10002830 Ga0081455_1000283011 307
228 3300005937 Ga0081455_10018432 Ga0081455_100184326 307
229 3300005937 Ga0081455_10055397 Ga0081455_100553973 307
230 3300005985 Ga0081539_10001822 Ga0081539_1000182218 307
231 3300006195 Ga0075366_10013336 Ga0075366_100133362 307
232 3300007265 Ga0099794_10093503 Ga0099794_100935032 307
233 3300009094 Ga0111539_10298879 Ga0111539_102988792 307
234 3300009545 Ga0105237_10184429 Ga0105237_101844292 307
235 3300013105 Ga0157369_10384195 Ga0157369_103841952 307
236 3300017792 Ga0163161_10011249 Ga0163161_100112494 307
237 3300025315 Ga0207697_10032538 Ga0207697_100325382 307
238 3300025893 Ga0207682_10000748 Ga0207682_1000074813 307
239 3300025901 Ga0207688_10075364 Ga0207688_100753642 307
240 3300025920 Ga0207649_10116700 Ga0207649_101167002 307
241 3300025923 Ga0207681_10043404 Ga0207681_100434044 307
242 3300025925 Ga0207650_10000783 Ga0207650_100007838 307
243 3300025926 Ga0207659_10000307 Ga0207659_1000030729 307
244 3300025937 Ga0207669_10002758 Ga0207669_100027584 307
245 3300025940 Ga0207691_10003997 Ga0207691_100039978 307
246 3300025960 Ga0207651_10032204 Ga0207651_100322041 307
247 3300025986 Ga0207658_10075072 Ga0207658_100750723 307
248 3300026089 Ga0207648_10030699 Ga0207648_100306991 307
249 3300026121 Ga0207683_10001684 Ga0207683_100016847 307
250 3300028379 Ga0268266_10001895 Ga0268266_1000189513 307
251 3300028379 Ga0268266_10084814 Ga0268266_100848144 307
252 3300032002 Ga0307416_100167725 Ga0307416_1001677252 307
253 3300037466 Ga0395898_0080691 Ga0395898_0080691_849_1964 307
254 3300039438 Ga0436360_0130330 Ga0436360_0130330_352_1320 307
255 3300039447 Ga0436361_0208451 Ga0436361_0208451_969_1937 307
256 3300042001 Ga0439441_011679 Ga0439441_011679_125_1084 307
257 3300045976 Ga0466967_0025238 Ga0466967_0025238_2707_3669 307
258 3300046533 Ga0495640_0060812 Ga0495640_0060812_134_1150 307
259 3300049822 Ga0501035_0188752 Ga0501035_0188752_635_1603 307
260 3300049823 Ga0501044_0209651 Ga0501044_0209651_43_1011 307
261 3300050493 nmdc:mga0k408_16810_c2 nmdc:mga0k408_16810_c2_35_1003 307
262 3300053088 Ga0500644_0045667 Ga0500644_0045667_434_1399 307
263 3300053733 Ga0500552_000173 Ga0500552_000173_3213_4184 307
264 3300005844 Ga0068862_100004055 Ga0068862_10000405510 308
265 3300028380 Ga0268265_10005004 Ga0268265_100050042 308
266 3300003763 Ga0055529_1001253 Ga0055529_10012536 309
267 3300025228 Ga0209672_103607 Ga0209672_1036073 309
268 3300025242 Ga0209258_107796 Ga0209258_1077962 309
269 3300025272 Ga0209455_1000528 Ga0209455_100052823 309
270 3300049581 Ga0501047_0000450 Ga0501047_0000450_1508_2470 309
271 3300049742 Ga0501080_0008732 Ga0501080_0008732_8070_9032 309
272 3300049744 Ga0501083_0085655 Ga0501083_0085655_659_1621 309
273 3300060353 Ga0501082_0027134 Ga0501082_0027134_2251_3213 309
274 3300025304 Ga0209257_1013434 Ga0209257_10134341 310
275 iso_pu_bacteria 2547132374 2548498666 310
276 iso_pu_bacteria 2643221596 2643990674 310
277 iso_pu_bacteria 2643221717 2644649398 310
278 3300021361 Ga0213872_10000102 Ga0213872_1000010238 313
279 iso_pu_bacteria 2588253510 2588295546 313
280 iso_pu_bacteria 2643221660 2644340032 313
281 iso_pu_bacteria 2831864461 2831866058 313
282 iso_pu_bacteria 2886848708 2886851530 313
283 iso_pu_bacteria 2585428057 2587730287 315
284 iso_pu_bacteria 2585428062 2587755772 315
285 iso_pu_bacteria 2588253510 2588294175 315
286 iso_pu_bacteria 2643221544 2643742485 315
287 iso_pu_bacteria 2643221585 2643933487 315
288 iso_pu_bacteria 2643221639 2644222153 315
289 iso_pu_bacteria 2643221644 2644245646 315
290 iso_pu_bacteria 2643221646 2644257071 315
291 iso_pu_bacteria 2643221654 2644301977 315
292 iso_pu_bacteria 2643221656 2644314736 315
293 iso_pu_bacteria 2738541337 2739055373 315
294 3300005347 Ga0070668_100010300 Ga0070668_1000103004 316
295 3300005355 Ga0070671_100007621 Ga0070671_1000076218 316
296 3300005356 Ga0070674_100059339 Ga0070674_1000593391 316
297 3300005356 Ga0070674_100241061 Ga0070674_1002410612 316
298 3300005367 Ga0070667_100327322 Ga0070667_1003273221 316
299 3300005617 Ga0068859_100012341 Ga0068859_1000123414 316
300 3300005617 Ga0068859_100371854 Ga0068859_1003718541 316
301 3300005719 Ga0068861_100002083 Ga0068861_10000208311 316
302 3300005843 Ga0068860_100003217 Ga0068860_1000032172 316
303 3300006195 Ga0075366_10011930 Ga0075366_100119305 316
304 3300006931 Ga0097620_100012343 Ga0097620_1000123434 316
305 3300006931 Ga0097620_100371847 Ga0097620_1003718471 316
306 3300009148 Ga0105243_10103366 Ga0105243_101033662 316
307 3300009177 Ga0105248_10000537 Ga0105248_1000053731 316
308 3300009177 Ga0105248_10062185 Ga0105248_100621855 316
309 3300009553 Ga0105249_10067688 Ga0105249_100676883 316
310 3300013306 Ga0163162_10004268 Ga0163162_100042683 316
311 3300013308 Ga0157375_10094576 Ga0157375_100945764 316
312 3300014326 Ga0157380_10086958 Ga0157380_100869582 316
313 3300014968 Ga0157379_10007067 Ga0157379_100070676 316
314 3300025899 Ga0207642_10006672 Ga0207642_100066723 316
315 3300025931 Ga0207644_10013045 Ga0207644_100130456 316
316 3300025937 Ga0207669_10061484 Ga0207669_100614841 316
317 3300025941 Ga0207711_10017338 Ga0207711_100173386 316
318 3300025961 Ga0207712_10090818 Ga0207712_100908182 316
319 3300025986 Ga0207658_10149502 Ga0207658_101495022 316
320 3300026075 Ga0207708_10012895 Ga0207708_100128953 316
321 3300026088 Ga0207641_10060413 Ga0207641_100604134 316
322 3300026089 Ga0207648_10002165 Ga0207648_1000216514 316
323 3300026095 Ga0207676_10192200 Ga0207676_101922002 316
324 3300026118 Ga0207675_100004351 Ga0207675_1000043516 316
325 3300028381 Ga0268264_10003397 Ga0268264_1000339714 316
326 3300028794 Ga0307515_10067150 Ga0307515_100671504 316
327 3300031251 Ga0265327_10001814 Ga0265327_1000181410 316
328 3300035089 Ga0373944_0009484 Ga0373944_0009484_63_1100 316
329 3300035113 Ga0373936_0038480 Ga0373936_0038480_892_1851 316
330 3300035116 Ga0373945_0072435 Ga0373945_0072435_318_1277 316
331 3300035170 Ga0373943_0075340 Ga0373943_0075340_616_1653 316
332 3300035692 Ga0373935_0066670 Ga0373935_0066670_533_1570 316
333 3300035695 Ga0373927_0028336 Ga0373927_0028336_2107_3066 316
334 3300035725 Ga0373947_0054990 Ga0373947_0054990_1396_2355 316
335 3300037068 Ga0373925_0000845 Ga0373925_0000845_6114_7151 316
336 3300042876 Ga0451577_0006041 Ga0451577_0006041_2271_3242 316
337 3300046683 Ga0495658_0075922 Ga0495658_0075922_159_1118 316
338 3300048907 Ga0496104_0040713 Ga0496104_0040713_2786_3745 316
339 3300048915 Ga0496112_0120830 Ga0496112_0120830_1077_2036 316
340 3300048916 Ga0496113_0151404 Ga0496113_0151404_277_1236 316
341 3300048917 Ga0496114_0050228 Ga0496114_0050228_976_1974 316
342 3300050489 nmdc:mga03683_17461_c1 nmdc:mga03683_17461_c1_1069_2028 316
343 3300050493 nmdc:mga0k408_79678_c1 nmdc:mga0k408_79678_c1_776_1735 316
344 3300050511 nmdc:mga08y16_397516_c1 nmdc:mga08y16_397516_c1_424_1377 316
345 3300050511 nmdc:mga08y16_432827_c1 nmdc:mga08y16_432827_c1_351_1310 316
346 3300003322 rootL2_10000073 rootL2_100000734 317
347 3300003759 Ga0055525_1000031 Ga0055525_1000031225 317
348 3300003771 Ga0055526_1004906 Ga0055526_10049062 317
349 3300004625 Ga0055543_1003950 Ga0055543_10039504 317
350 3300005262 Ga0065165_1000248 Ga0065165_100024828 317
351 3300005262 Ga0065165_1000390 Ga0065165_100039014 317
352 3300005457 Ga0070662_100003301 Ga0070662_10000330111 317
353 3300006195 Ga0075366_10018606 Ga0075366_100186063 317
354 3300006353 Ga0075370_10014833 Ga0075370_100148335 317
355 3300009147 Ga0114129_10121124 Ga0114129_101211244 317
356 3300012497 Ga0157319_1000003 Ga0157319_1000003291 317
357 3300021361 Ga0213872_10000006 Ga0213872_10000006140 317
358 3300021361 Ga0213872_10000139 Ga0213872_1000013921 317
359 3300021361 Ga0213872_10000152 Ga0213872_1000015226 317
360 3300021361 Ga0213872_10005055 Ga0213872_100050555 317
361 3300025230 Ga0209563_100044 Ga0209563_100044294 317
362 3300025273 Ga0209673_1014555 Ga0209673_10145552 317
363 3300025273 Ga0209673_1040989 Ga0209673_10409892 317
364 3300025295 Ga0209564_1000051 Ga0209564_1000051162 317
365 3300025299 Ga0209256_1000675 Ga0209256_100067541 317
366 3300025933 Ga0207706_10005864 Ga0207706_100058643 317
367 3300028794 Ga0307515_10170346 Ga0307515_101703463 317
368 3300031250 Ga0265331_10001772 Ga0265331_1000177211 317
369 3300031251 Ga0265327_10000012 Ga0265327_10000012331 317
370 3300031616 Ga0307508_10217239 Ga0307508_102172392 317
371 3300031730 Ga0307516_10106435 Ga0307516_101064352 317
372 3300031995 Ga0307409_100246349 Ga0307409_1002463491 317
373 3300037418 Ga0395900_0000131 Ga0395900_0000131_17795_18754 317
374 3300037466 Ga0395898_0001669 Ga0395898_0001669_11033_11992 317
375 3300037471 Ga0395905_0003089 Ga0395905_0003089_15997_16956 317
376 3300037471 Ga0395905_0271694 Ga0395905_0271694_227_1216 317
377 3300039447 Ga0436361_0301322 Ga0436361_0301322_17678_18637 317
378 3300039447 Ga0436361_0614815 Ga0436361_0614815_6269_7228 317
379 3300039447 Ga0436361_0734234 Ga0436361_0734234_1273_2232 317
380 3300039447 Ga0436361_1059830 Ga0436361_1059830_281_1240 317
381 3300042008 Ga0439450_021202 Ga0439450_021202_301_1260 317
382 3300042438 Ga0439459_0010540 Ga0439459_0010540_332_1291 317
383 3300044656 Ga0466969_0000017 Ga0466969_0000017_22685_23644 317
384 3300044656 Ga0466969_0016731 Ga0466969_0016731_1886_2845 317
385 3300044658 Ga0466972_0000564 Ga0466972_0000564_6051_7010 317
386 3300044658 Ga0466972_0048615 Ga0466972_0048615_252_1214 317
387 3300044683 Ga0466965_0008331 Ga0466965_0008331_2203_3162 317
388 3300044683 Ga0466965_0064814 Ga0466965_0064814_736_1698 317
389 3300044684 Ga0466966_0009318 Ga0466966_0009318_5214_6173 317
390 3300044693 Ga0466961_0005109 Ga0466961_0005109_3902_4861 317
391 3300044694 Ga0466963_0026258 Ga0466963_0026258_1243_2202 317
392 3300044706 Ga0466964_0001826 Ga0466964_0001826_4985_5944 317
393 3300044706 Ga0466964_0071065 Ga0466964_0071065_175_1134 317
394 3300044765 Ga0466970_0012504 Ga0466970_0012504_1927_2886 317
395 3300044901 Ga0466960_0009764 Ga0466960_0009764_1532_2494 317
396 3300045049 Ga0466959_0004446 Ga0466959_0004446_2561_3520 317
397 3300045049 Ga0466959_0046795 Ga0466959_0046795_2138_3097 317
398 3300048927 Ga0496124_0000344 Ga0496124_0000344_20287_21246 317
399 3300048927 Ga0496124_0073367 Ga0496124_0073367_1320_2279 317
400 3300050496 nmdc:mga07m45_3609_c1 nmdc:mga07m45_3609_c1_3234_4193 317
401 3300053156 Ga0500622_0002736 Ga0500622_0002736_1401_2360 317
402 3300006944 Ga0099823_1000211 Ga0099823_10002115 318
403 3300025242 Ga0209258_105519 Ga0209258_1055192 318
404 3300025298 Ga0209050_1005005 Ga0209050_10050053 318
405 3300025304 Ga0209257_1005336 Ga0209257_10053369 318
406 3300027312 Ga0209371_1019135 Ga0209371_10191352 318
407 3300030500 Ga0268256_1011825 Ga0268256_10118252 318
408 3300031731 Ga0307405_10014843 Ga0307405_100148434 318
409 3300031824 Ga0307413_10030884 Ga0307413_100308842 318
410 3300031852 Ga0307410_10102429 Ga0307410_101024292 318
411 3300031901 Ga0307406_10025146 Ga0307406_100251464 318
412 3300031995 Ga0307409_100015073 Ga0307409_1000150734 318
413 3300032004 Ga0307414_10028632 Ga0307414_100286324 318
414 3300032126 Ga0307415_100039530 Ga0307415_1000395302 318
415 3300037471 Ga0395905_0095910 Ga0395905_0095910_715_1746 318
416 3300041413 Ga0439465_0070744 Ga0439465_0070744_154_1113 318
417 3300045051 Ga0451576_0003849 Ga0451576_0003849_3947_4906 318
418 3300045051 Ga0451576_0383311 Ga0451576_0383311_166_1125 318
419 3300001979 JGI24740J21852_10005095 JGI24740J21852_100050952 319
420 3300003215 JGI25153J46596_10002317 JGI25153J46596_1000231711 319
421 3300003305 Ga0006770J48903_1042115 Ga0006770J48903_10421152 319
422 3300003371 JGI26145J50221_1004043 JGI26145J50221_10040431 319
423 3300003775 Ga0055524_1000158 Ga0055524_100015845 319
424 3300003790 Ga0055528_1028380 Ga0055528_10283801 319
425 3300003792 Ga0055540_1000035 Ga0055540_1000035134 319
426 3300003794 Ga0055531_10000024 Ga0055531_1000002452 319
427 3300005262 Ga0065165_1003068 Ga0065165_10030682 319
428 3300005328 Ga0070676_10002065 Ga0070676_100020658 319
429 3300005328 Ga0070676_10005115 Ga0070676_100051152 319
430 3300005334 Ga0068869_100141052 Ga0068869_1001410522 319
431 3300005337 Ga0070682_100122391 Ga0070682_1001223912 319
432 3300005338 Ga0068868_100302932 Ga0068868_1003029322 319
433 3300005344 Ga0070661_100000649 Ga0070661_1000006496 319
434 3300005354 Ga0070675_100065006 Ga0070675_1000650064 319
435 3300005354 Ga0070675_100230632 Ga0070675_1002306322 319
436 3300005355 Ga0070671_100019824 Ga0070671_1000198245 319
437 3300005355 Ga0070671_100026644 Ga0070671_1000266444 319
438 3300005364 Ga0070673_100103902 Ga0070673_1001039022 319
439 3300005366 Ga0070659_100000430 Ga0070659_10000043023 319
440 3300005367 Ga0070667_100001640 Ga0070667_10000164020 319
441 3300005455 Ga0070663_100002390 Ga0070663_1000023903 319
442 3300005459 Ga0068867_100000228 Ga0068867_10000022819 319
443 3300005467 Ga0070706_100009701 Ga0070706_1000097014 319
444 3300005468 Ga0070707_100017523 Ga0070707_1000175234 319
445 3300005539 Ga0068853_100054042 Ga0068853_1000540422 319
446 3300005539 Ga0068853_100174816 Ga0068853_1001748162 319
447 3300005564 Ga0070664_100000913 Ga0070664_10000091320 319
448 3300005564 Ga0070664_100006225 Ga0070664_1000062252 319
449 3300005577 Ga0068857_100059339 Ga0068857_1000593394 319
450 3300005841 Ga0068863_100605473 Ga0068863_1006054732 319
451 3300006038 Ga0075365_10015895 Ga0075365_100158952 319
452 3300006042 Ga0075368_10003121 Ga0075368_100031212 319
453 3300006042 Ga0075368_10015679 Ga0075368_100156793 319
454 3300006048 Ga0075363_100015590 Ga0075363_1000155904 319
455 3300006048 Ga0075363_100045740 Ga0075363_1000457402 319
456 3300006051 Ga0075364_10033021 Ga0075364_100330213 319
457 3300006051 Ga0075364_10054094 Ga0075364_100540942 319
458 3300006051 Ga0075364_10240507 Ga0075364_102405072 319
459 3300006177 Ga0075362_10022235 Ga0075362_100222352 319
460 3300006178 Ga0075367_10029207 Ga0075367_100292073 319
461 3300006178 Ga0075367_10044166 Ga0075367_100441662 319
462 3300006178 Ga0075367_10067815 Ga0075367_100678152 319
463 3300006178 Ga0075367_10281073 Ga0075367_102810731 319
464 3300006195 Ga0075366_10000472 Ga0075366_1000047213 319
465 3300006195 Ga0075366_10027250 Ga0075366_100272502 319
466 3300006195 Ga0075366_10028967 Ga0075366_100289672 319
467 3300006195 Ga0075366_10031881 Ga0075366_100318813 319
468 3300006195 Ga0075366_10033377 Ga0075366_100333773 319
469 3300006195 Ga0075366_10092386 Ga0075366_100923862 319
470 3300006195 Ga0075366_10099557 Ga0075366_100995572 319
471 3300006353 Ga0075370_10001362 Ga0075370_1000136211 319
472 3300006353 Ga0075370_10013927 Ga0075370_100139274 319
473 3300006353 Ga0075370_10057351 Ga0075370_100573512 319
474 3300006353 Ga0075370_10130310 Ga0075370_101303101 319
475 3300006846 Ga0075430_100112978 Ga0075430_1001129783 319
476 3300006880 Ga0075429_100002218 Ga0075429_10000221813 319
477 3300006946 Ga0079104_1000024 Ga0079104_1000024111 319
478 3300009148 Ga0105243_10001277 Ga0105243_100012774 319
479 3300009545 Ga0105237_10001734 Ga0105237_1000173420 319
480 3300009551 Ga0105238_10007274 Ga0105238_100072749 319
481 3300010375 Ga0105239_10001342 Ga0105239_1000134225 319
482 3300010375 Ga0105239_10068264 Ga0105239_100682643 319
483 3300013306 Ga0163162_10810900 Ga0163162_108109001 319
484 3300013308 Ga0157375_10020176 Ga0157375_100201763 319
485 3300013308 Ga0157375_10173980 Ga0157375_101739803 319
486 3300014745 Ga0157377_10000016 Ga0157377_1000001612 319
487 3300014745 Ga0157377_10075135 Ga0157377_100751352 319
488 3300014968 Ga0157379_10011186 Ga0157379_100111862 319
489 3300025245 Ga0207425_1000946 Ga0207425_100094610 319
490 3300025258 Ga0209129_1000041 Ga0209129_1000041268 319
491 3300025258 Ga0209129_1016733 Ga0209129_10167332 319
492 3300025273 Ga0209673_1001671 Ga0209673_100167110 319
493 3300025273 Ga0209673_1015984 Ga0209673_10159842 319
494 3300025295 Ga0209564_1000029 Ga0209564_1000029414 319
495 3300025297 Ga0209758_1000043 Ga0209758_100004326 319
496 3300025297 Ga0209758_1000057 Ga0209758_1000057275 319
497 3300025298 Ga0209050_1000247 Ga0209050_100024727 319
498 3300025298 Ga0209050_1000995 Ga0209050_100099521 319
499 3300025298 Ga0209050_1003881 Ga0209050_10038815 319
500 3300025299 Ga0209256_1000011 Ga0209256_1000011242 319
501 3300025299 Ga0209256_1010579 Ga0209256_10105793 319
502 3300025303 Ga0209051_1000016 Ga0209051_100001693 319
503 3300025304 Ga0209257_1000017 Ga0209257_100001780 319
504 3300025304 Ga0209257_1000102 Ga0209257_1000102200 319
505 3300025304 Ga0209257_1019601 Ga0209257_10196012 319
506 3300025907 Ga0207645_10002560 Ga0207645_100025604 319
507 3300025907 Ga0207645_10021528 Ga0207645_100215282 319
508 3300025907 Ga0207645_10036230 Ga0207645_100362302 319
509 3300025908 Ga0207643_10119031 Ga0207643_101190312 319
510 3300025908 Ga0207643_10223236 Ga0207643_102232362 319
511 3300025910 Ga0207684_10030653 Ga0207684_100306535 319
512 3300025913 Ga0207695_10012371 Ga0207695_100123712 319
513 3300025914 Ga0207671_10011049 Ga0207671_100110492 319
514 3300025920 Ga0207649_10008572 Ga0207649_100085725 319
515 3300025924 Ga0207694_10010050 Ga0207694_100100502 319
516 3300025926 Ga0207659_10263633 Ga0207659_102636332 319
517 3300025932 Ga0207690_10001923 Ga0207690_100019235 319
518 3300025935 Ga0207709_10001251 Ga0207709_100012514 319
519 3300025935 Ga0207709_10043178 Ga0207709_100431782 319
520 3300025942 Ga0207689_10035247 Ga0207689_100352474 319
521 3300025942 Ga0207689_10259765 Ga0207689_102597652 319
522 3300025945 Ga0207679_10000573 Ga0207679_1000057320 319
523 3300025945 Ga0207679_10003682 Ga0207679_100036822 319
524 3300025960 Ga0207651_10054492 Ga0207651_100544923 319
525 3300025986 Ga0207658_10001138 Ga0207658_1000113821 319
526 3300026041 Ga0207639_10097383 Ga0207639_100973832 319
527 3300026067 Ga0207678_10001091 Ga0207678_1000109113 319
528 3300026078 Ga0207702_10192031 Ga0207702_101920312 319
529 3300026089 Ga0207648_10000598 Ga0207648_1000059814 319
530 3300026089 Ga0207648_10156399 Ga0207648_101563993 319
531 3300026089 Ga0207648_10426461 Ga0207648_104264612 319
532 3300026116 Ga0207674_10039848 Ga0207674_100398485 319
533 3300026142 Ga0207698_10014891 Ga0207698_100148911 319
534 3300027111 Ga0209281_1000104 Ga0209281_100010491 319
535 3300027717 Ga0209998_10010480 Ga0209998_100104802 319
536 3300027866 Ga0209813_10011507 Ga0209813_100115073 319
537 3300027876 Ga0209974_10005897 Ga0209974_100058972 319
538 3300028786 Ga0307517_10000150 Ga0307517_1000015077 319
539 3300028786 Ga0307517_10084135 Ga0307517_100841354 319
540 3300028786 Ga0307517_10134755 Ga0307517_101347552 319
541 3300028794 Ga0307515_10000830 Ga0307515_100008304 319
542 3300028794 Ga0307515_10002402 Ga0307515_100024025 319
543 3300028794 Ga0307515_10011679 Ga0307515_100116793 319
544 3300028794 Ga0307515_10021637 Ga0307515_1002163711 319
545 3300028794 Ga0307515_10026130 Ga0307515_100261308 319
546 3300028794 Ga0307515_10171782 Ga0307515_101717822 319
547 3300030522 Ga0307512_10012395 Ga0307512_100123954 319
548 3300030522 Ga0307512_10025747 Ga0307512_100257475 319
549 3300031456 Ga0307513_10030508 Ga0307513_100305084 319
550 3300031456 Ga0307513_10381799 Ga0307513_103817991 319
551 3300031507 Ga0307509_10002837 Ga0307509_1000283710 319
552 3300031507 Ga0307509_10011064 Ga0307509_1001106410 319
553 3300031507 Ga0307509_10017922 Ga0307509_100179222 319
554 3300031507 Ga0307509_10129106 Ga0307509_101291062 319
555 3300031507 Ga0307509_10196928 Ga0307509_101969282 319
556 3300031548 Ga0307408_100000010 Ga0307408_100000010243 319
557 3300031616 Ga0307508_10000061 Ga0307508_1000006156 319
558 3300031616 Ga0307508_10001937 Ga0307508_1000193710 319
559 3300031616 Ga0307508_10002030 Ga0307508_1000203013 319
560 3300031616 Ga0307508_10222589 Ga0307508_102225892 319
561 3300031649 Ga0307514_10089166 Ga0307514_100891662 319
562 3300031649 Ga0307514_10116209 Ga0307514_101162092 319
563 3300031730 Ga0307516_10000293 Ga0307516_1000029344 319
564 3300031730 Ga0307516_10006910 Ga0307516_100069106 319
565 3300031730 Ga0307516_10202286 Ga0307516_102022862 319
566 3300031730 Ga0307516_10237918 Ga0307516_102379182 319
567 3300032005 Ga0307411_10227843 Ga0307411_102278432 319
568 3300033179 Ga0307507_10142156 Ga0307507_101421561 319
569 3300033180 Ga0307510_10032222 Ga0307510_100322225 319
570 3300033180 Ga0307510_10082015 Ga0307510_100820153 319
571 3300034820 Ga0373959_0003778 Ga0373959_0003778_46_1011 319
572 3300035088 Ga0373940_0063735 Ga0373940_0063735_76_1041 319
573 3300035090 Ga0373949_0009358 Ga0373949_0009358_914_1879 319
574 3300035114 Ga0373939_0000160 Ga0373939_0000160_5518_6483 319
575 3300035121 Ga0373960_0000788 Ga0373960_0000788_5374_6339 319
576 3300035171 Ga0373946_0085616 Ga0373946_0085616_363_1322 319
577 3300035241 Ga0373961_0068057 Ga0373961_0068057_105_1070 319
578 3300035691 Ga0373931_0000233 Ga0373931_0000233_3011_3976 319
579 3300035691 Ga0373931_0008851 Ga0373931_0008851_2713_3672 319
580 3300035691 Ga0373931_0073786 Ga0373931_0073786_806_1765 319
581 3300037471 Ga0395905_0002862 Ga0395905_0002862_10366_11343 319
582 3300037471 Ga0395905_0054712 Ga0395905_0054712_1765_2724 319
583 3300037471 Ga0395905_0059971 Ga0395905_0059971_1818_2783 319
584 3300041459 Ga0451800_0538243 Ga0451800_0538243_1104_2063 319
585 3300042120 Ga0450917_000031 Ga0450917_000031_2850_3815 319
586 3300042121 Ga0450919_000578 Ga0450919_000578_3486_4445 319
587 3300042129 Ga0450891_000788 Ga0450891_000788_1548_2513 319
588 3300042130 Ga0450892_000949 Ga0450892_000949_1822_2787 319
589 3300042144 Ga0450889_000243 Ga0450889_000243_3466_4431 319
590 3300042530 Ga0450916_006341 Ga0450916_006341_235_1200 319
591 3300042531 Ga0450918_000929 Ga0450918_000929_4012_4971 319
592 3300042532 Ga0450893_0000452 Ga0450893_0000452_4591_5556 319
593 3300044712 Ga0453684_0069157 Ga0453684_0069157_43_1002 319
594 3300045051 Ga0451576_0024941 Ga0451576_0024941_2329_3294 319
595 3300045051 Ga0451576_0030018 Ga0451576_0030018_1077_2072 319
596 3300046454 Ga0495592_0005413 Ga0495592_0005413_6545_7504 319
597 3300046454 Ga0495592_0106780 Ga0495592_0106780_509_1468 319
598 3300046460 Ga0495638_0035681 Ga0495638_0035681_1803_2762 319
599 3300046474 Ga0495605_0091194 Ga0495605_0091194_422_1381 319
600 3300046512 Ga0495610_0016173 Ga0495610_0016173_2106_3065 319
601 3300046515 Ga0495620_0086886 Ga0495620_0086886_283_1242 319
602 3300046519 Ga0495632_0004080 Ga0495632_0004080_4474_5433 319
603 3300046519 Ga0495632_0063116 Ga0495632_0063116_172_1131 319
604 3300046522 Ga0495643_0078625 Ga0495643_0078625_501_1460 319
605 3300046524 Ga0495648_0150663 Ga0495648_0150663_244_1203 319
606 3300046542 Ga0495597_0048143 Ga0495597_0048143_287_1246 319
607 3300046660 Ga0495625_0001549 Ga0495625_0001549_7630_8670 319
608 3300046660 Ga0495625_0071759 Ga0495625_0071759_1200_2159 319
609 3300046683 Ga0495658_0095825 Ga0495658_0095825_43_1002 319
610 3300046694 Ga0495649_0008664 Ga0495649_0008664_4047_5006 319
611 3300047321 Ga0495676_0028995 Ga0495676_0028995_2991_3950 319
612 3300047443 Ga0495687_001178 Ga0495687_001178_1790_2749 319
613 3300048091 Ga0495626_0014741 Ga0495626_0014741_232_1191 319
614 3300048905 Ga0496102_0027674 Ga0496102_0027674_1560_2519 319
615 3300048905 Ga0496102_0035862 Ga0496102_0035862_2659_3618 319
616 3300048912 Ga0496109_0114394 Ga0496109_0114394_972_1931 319
617 3300048913 Ga0496110_0080162 Ga0496110_0080162_1907_2866 319
618 3300048915 Ga0496112_0395590 Ga0496112_0395590_353_1312 319
619 3300048917 Ga0496114_0002388 Ga0496114_0002388_7250_8209 319
620 3300049523 Ga0501300_002135 Ga0501300_002135_268_1233 319
621 3300049578 Ga0501042_0225088 Ga0501042_0225088_359_1318 319
622 3300049579 Ga0501043_0000053 Ga0501043_0000053_16866_17825 319
623 3300049580 Ga0501046_0000018 Ga0501046_0000018_48464_49423 319
624 3300049581 Ga0501047_0000020 Ga0501047_0000020_87273_88232 319
625 3300049582 Ga0501048_0001721 Ga0501048_0001721_10167_11126 319
626 3300049662 Ga0501222_000379 Ga0501222_000379_2159_3124 319
627 3300049663 Ga0501223_008869 Ga0501223_008869_999_1964 319
628 3300049668 Ga0501233_001124 Ga0501233_001124_3030_3995 319
629 3300049669 Ga0501235_007250 Ga0501235_007250_356_1321 319
630 3300049706 Ga0501229_000306 Ga0501229_000306_3531_4496 319
631 3300049762 Ga0501265_001741 Ga0501265_001741_1086_2051 319
632 3300050490 nmdc:mga03n38_47794_c1 nmdc:mga03n38_47794_c1_716_1675 319
633 3300050491 nmdc:mga00v17_108519_c1 nmdc:mga00v17_108519_c1_726_1685 319
634 3300050492 nmdc:mga0yw44_134354_c1 nmdc:mga0yw44_134354_c1_145_1104 319
635 3300050493 nmdc:mga0k408_1070_c1 nmdc:mga0k408_1070_c1_3952_4911 319
636 3300050493 nmdc:mga0k408_112045_c1 nmdc:mga0k408_112045_c1_52_1011 319
637 3300050493 nmdc:mga0k408_1281_c1 nmdc:mga0k408_1281_c1_2030_2989 319
638 3300050493 nmdc:mga0k408_1749_c1 nmdc:mga0k408_1749_c1_8355_9314 319
639 3300050493 nmdc:mga0k408_226254_c1 nmdc:mga0k408_226254_c1_52_1092 319
640 3300050493 nmdc:mga0k408_330_c1 nmdc:mga0k408_330_c1_5816_6775 319
641 3300050493 nmdc:mga0k408_34111_c1 nmdc:mga0k408_34111_c1_1619_2578 319
642 3300050493 nmdc:mga0k408_51273_c2 nmdc:mga0k408_51273_c2_179_1144 319
643 3300050493 nmdc:mga0k408_5951_c1 nmdc:mga0k408_5951_c1_4764_5723 319
644 3300050493 nmdc:mga0k408_83212_c1 nmdc:mga0k408_83212_c1_516_1475 319
645 3300050493 nmdc:mga0k408_97238_c1 nmdc:mga0k408_97238_c1_651_1610 319
646 3300050494 nmdc:mga06z11_4773_c1 nmdc:mga06z11_4773_c1_88_1047 319
647 3300050495 nmdc:mga04h51_18533_c1 nmdc:mga04h51_18533_c1_961_1920 319
648 3300050495 nmdc:mga04h51_22170_c1 nmdc:mga04h51_22170_c1_511_1470 319
649 3300050496 nmdc:mga07m45_1145_c1 nmdc:mga07m45_1145_c1_3403_4362 319
650 3300050496 nmdc:mga07m45_191_c1 nmdc:mga07m45_191_c1_14011_14970 319
651 3300050496 nmdc:mga07m45_20994_c1 nmdc:mga07m45_20994_c1_1379_2338 319
652 3300050496 nmdc:mga07m45_22525_c1 nmdc:mga07m45_22525_c1_1319_2284 319
653 3300050496 nmdc:mga07m45_32623_c1 nmdc:mga07m45_32623_c1_1811_2776 319
654 3300050496 nmdc:mga07m45_6895_c1 nmdc:mga07m45_6895_c1_3373_4332 319
655 3300050496 nmdc:mga07m45_7386_c1 nmdc:mga07m45_7386_c1_3706_4665 319
656 3300050496 nmdc:mga07m45_80696_c1 nmdc:mga07m45_80696_c1_252_1211 319
657 3300050508 nmdc:mga09592_32016_c1 nmdc:mga09592_32016_c1_3243_4202 319
658 3300050509 nmdc:mga0qj67_142164_c1 nmdc:mga0qj67_142164_c1_212_1171 319
659 3300053086 Ga0500578_0002292 Ga0500578_0002292_10909_11868 319
660 3300053090 Ga0500646_0002920 Ga0500646_0002920_3348_4307 319
661 3300053093 Ga0500651_0026657 Ga0500651_0026657_1679_2638 319
662 3300053093 Ga0500651_0138644 Ga0500651_0138644_33_992 319
663 3300053109 Ga0500569_015919 Ga0500569_015919_154_1113 319
664 3300053117 Ga0500593_000112 Ga0500593_000112_2341_3300 319
665 3300053118 Ga0500594_0000801 Ga0500594_0000801_3698_4657 319
666 3300053131 Ga0500652_001118 Ga0500652_001118_3202_4161 319
667 3300053131 Ga0500652_051291 Ga0500652_051291_421_1380 319
668 3300053134 Ga0500658_0006490 Ga0500658_0006490_2290_3249 319
669 3300053134 Ga0500658_0045469 Ga0500658_0045469_311_1270 319
670 3300053136 Ga0500559_0000069 Ga0500559_0000069_38281_39240 319
671 3300053142 Ga0500577_0014963 Ga0500577_0014963_1170_2129 319
672 3300053148 Ga0500590_012594 Ga0500590_012594_2984_3943 319
673 3300053154 Ga0500619_000115 Ga0500619_000115_16829_17791 319
674 3300053156 Ga0500622_0000881 Ga0500622_0000881_19673_20632 319
675 3300053156 Ga0500622_0002263 Ga0500622_0002263_5905_6864 319
676 3300053739 Ga0500587_001168 Ga0500587_001168_1817_2776 319
677 3300053739 Ga0500587_001948 Ga0500587_001948_1705_2664 319
678 3300059421 Ga0590071_001052 Ga0590071_001052_1636_2610 319
679 iso_pu_bacteria 2643221648 2644271992 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01507

PAPS_reduct

Phosphoadenosine phosphosulfate reductase family

65

332

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zun-assembly1.cif.gz_A crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae 0.8718 18 229
1zun-assembly1.cif.gz_A crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae 0.8143 18 229
3g6k-assembly5.cif.gz_E crystal structure of candida glabrata fmn adenylyltransferase in complex with fad and inorganic pyrophosphate 0.7849 17 226
3g5a-assembly5.cif.gz_E crystal structure of candida glabrata fmn adenylyltransferase in complex with fmn and atp analog ampcpp 0.7512 17 226
4bwv-assembly1.cif.gz_B structure of adenosine 5-prime-phosphosulfate reductase apr-b from physcomitrella patens 0.7259 17 243
ID Description Score Start End Superfamily
1zunA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8956 18 229 3.40.50.620
1zunA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8864 18 229 3.40.50.620
af_Q4DC85_142_361_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8411 20 226 3.40.50.620
af_Q9VJY1_8_244_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7892 14 226 3.40.50.620
af_O74841_2_240_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7884 17 226 3.40.50.620
ID Description Score Start End GO Terms
AF-C4KPT8-F1-model_v4 deleted 0.967 18 319
AF-A0A3S0CBN9-F1-model_v4 Sulfate adenylyltransferase small subunit (EC 2.7.7.4) 0.9667 18 138 GO:0004781
AF-A0A0C1GVZ8-F1-model_v4 Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4) (ATP-sulfurylase small subunit) (Sulfate adenylate transferase) 0.9665 12 319 GO:0000103
GO:0004781
AF-A0A2N7YEK7-F1-model_v4 Sulfate adenylyltransferase small subunit 0.9665 204 290 GO:0016779
AF-B1HKH8-F1-model_v4 deleted 0.9652 18 319

Feature Viewer

pLDDT pTM Quality
85.67 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map