F474626
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 678 | 348 | 1356 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300005289|Ga0065704_10120400|Ga0065704_101204003 |
| Length | 303 |
| Sequence | MRRRGRRQGSTNCYGIKARPADDCGKRIEGLAVRTCASNDATMTDDDIQLAQRLADAAGAAIRPFFRASYTTEIKGDASPVTEADRAAEAAIRAILEAERPGDGIIGEEYGIVREGASRRWVLDPIDGTRSFITGRPIFGTLIALIEETTPVLGIIDQPILRERWLGAAGQGTTFNGLRCRTRPCSELGEAHVGTTSPGLFDPDDKERFEAVATACSNTVWGGDCYSYAMVALGQLDIVIESGLKLYDFAALVPVVEGAGGRMCDWRGNPLGSNSEGHVIAAGDPALISAILERLGKASHSEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 81 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 111 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 115 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 204 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 207 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 208 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 209 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 210 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 213 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 214 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 215 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 216 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 217 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 218 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 219 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 220 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 221 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 222 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 223 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 224 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 225 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 226 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 227 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 230 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 231 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 232 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 257 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 258 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 259 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 260 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 261 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 262 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 263 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 264 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 265 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 266 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 267 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 268 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 269 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 270 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 281 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 282 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 283 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 284 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 285 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 286 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 287 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 288 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 289 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 290 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 291 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 294 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 296 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 297 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 298 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 299 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 300 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 301 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 302 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 303 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 304 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 305 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 306 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 307 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 308 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 309 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 310 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 311 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 313 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 314 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 315 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 316 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 317 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 318 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 319 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 322 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 323 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 324 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 325 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 326 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 327 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 328 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 329 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 330 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 331 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 332 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 333 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 334 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 335 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 336 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 337 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 338 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 339 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 340 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 341 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 342 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 343 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 344 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 345 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 346 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 347 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 348 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.61 |
| Metatranscriptomes | 0 |
| Isolates | 3.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.74 |
| Bulb | 0 |
| Endosphere | 15.63 |
| Nodule | 0 |
| Rhizoplane | 2.06 |
| Rhizosphere | 73.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10120400 | 3300005289 | Bacteria | 1783 |
| 2 | JGI24741J21665_1002093 | 3300001915 | Bacteria | 5328 |
| 3 | JGI24740J21852_10001545 | 3300001979 | Bacteria | 10596 |
| 4 | JGI24739J22299_10007692 | 3300001989 | Bacteria | 4031 |
| 5 | JGI24739J22299_10012970 | 3300001989 | Bacteria | 3050 |
| 6 | JGI24739J22299_10033187 | 3300001989 | Bacteria | 1769 |
| 7 | JGI24737J22298_10001850 | 3300001990 | Bacteria | 7568 |
| 8 | JGI24737J22298_10018216 | 3300001990 | Bacteria | 2255 |
| 9 | JGI24735J21928_10002160 | 3300002067 | Bacteria | 6904 |
| 10 | JGI24735J21928_10002466 | 3300002067 | Bacteria | 6428 |
| 11 | JGI24750J21931_1016035 | 3300002070 | Bacteria | 1015 |
| 12 | JGI24748J21848_1000053 | 3300002074 | Bacteria | 50665 |
| 13 | JGI24738J21930_10002840 | 3300002075 | Bacteria | 4438 |
| 14 | JGI24749J21850_1000019 | 3300002076 | Bacteria | 32251 |
| 15 | JGI24749J21850_1000152 | 3300002076 | Bacteria | 11101 |
| 16 | JGI24034J26672_10000036 | 3300002239 | Bacteria | 84333 |
| 17 | JGI24751J29686_10000519 | 3300002459 | Bacteria | 11120 |
| 18 | JGI25151J46595_10006038 | 3300003187 | Bacteria | 6165 |
| 19 | JGI25165J46597_1000106 | 3300003214 | Bacteria | 151139 |
| 20 | JGI25153J46596_10000073 | 3300003215 | Bacteria | 115166 |
| 21 | rootH2_10015355 | 3300003320 | Bacteria | 1252 |
| 22 | rootL2_10226620 | 3300003322 | Bacteria | 1244 |
| 23 | rootH1_10214361 | 3300003323 | Bacteria | 1470 |
| 24 | Ga0055526_1008485 | 3300003771 | Bacteria | 5122 |
| 25 | Ga0055537_1001577 | 3300003773 | Bacteria | 8661 |
| 26 | Ga0055537_1004584 | 3300003773 | Bacteria | 3919 |
| 27 | Ga0055524_1004959 | 3300003775 | Bacteria | 6033 |
| 28 | Ga0055536_1003303 | 3300003781 | Bacteria | 8727 |
| 29 | Ga0055536_1016127 | 3300003781 | Bacteria | 2516 |
| 30 | Ga0055530_10000919 | 3300003791 | Bacteria | 24154 |
| 31 | Ga0055540_1001791 | 3300003792 | Bacteria | 12220 |
| 32 | Ga0055531_10000727 | 3300003794 | Bacteria | 27870 |
| 33 | Ga0055531_10002471 | 3300003794 | Bacteria | 12332 |
| 34 | Ga0055531_10003687 | 3300003794 | Bacteria | 9647 |
| 35 | Ga0055531_10007054 | 3300003794 | Bacteria | 6217 |
| 36 | Ga0065165_1014363 | 3300005262 | Bacteria | 3080 |
| 37 | Ga0065707_10081960 | 3300005295 | Bacteria | 27438 |
| 38 | Ga0065707_10084228 | 3300005295 | Bacteria | 7485 |
| 39 | Ga0070658_10005193 | 3300005327 | Bacteria | 10592 |
| 40 | Ga0070658_10005573 | 3300005327 | Bacteria | 10214 |
| 41 | Ga0070658_10031587 | 3300005327 | Bacteria | 4253 |
| 42 | Ga0070658_10310037 | 3300005327 | Bacteria | 1346 |
| 43 | Ga0070676_10001299 | 3300005328 | Bacteria | 12568 |
| 44 | Ga0070690_100000093 | 3300005330 | Bacteria | 44990 |
| 45 | Ga0070670_100000060 | 3300005331 | Bacteria | 113477 |
| 46 | Ga0070670_100000202 | 3300005331 | Bacteria | 55420 |
| 47 | Ga0070670_100012257 | 3300005331 | Bacteria | 7335 |
| 48 | Ga0068869_100000134 | 3300005334 | Bacteria | 35796 |
| 49 | Ga0070666_10000009 | 3300005335 | Bacteria | 279209 |
| 50 | Ga0070666_10000476 | 3300005335 | Bacteria | 24221 |
| 51 | Ga0068868_100000596 | 3300005338 | Bacteria | 24264 |
| 52 | Ga0070660_100033451 | 3300005339 | Bacteria | 3876 |
| 53 | Ga0070660_100073908 | 3300005339 | Bacteria | 2666 |
| 54 | Ga0070689_100012983 | 3300005340 | Bacteria | 6018 |
| 55 | Ga0070661_100042425 | 3300005344 | Bacteria | 3320 |
| 56 | Ga0070668_100054655 | 3300005347 | Bacteria | 3080 |
| 57 | Ga0070668_100067396 | 3300005347 | Bacteria | 2780 |
| 58 | Ga0070669_100000053 | 3300005353 | Bacteria | 113601 |
| 59 | Ga0070669_100000096 | 3300005353 | Bacteria | 86930 |
| 60 | Ga0070669_100000103 | 3300005353 | Bacteria | 81387 |
| 61 | Ga0070669_100299079 | 3300005353 | Bacteria | 1294 |
| 62 | Ga0070675_100013296 | 3300005354 | Bacteria | 6468 |
| 63 | Ga0070671_100000045 | 3300005355 | Bacteria | 85779 |
| 64 | Ga0070671_100340534 | 3300005355 | Bacteria | 1279 |
| 65 | Ga0070671_100398326 | 3300005355 | Bacteria | 1177 |
| 66 | Ga0070674_100087507 | 3300005356 | Bacteria | 2240 |
| 67 | Ga0070673_100000004 | 3300005364 | Bacteria | 199809 |
| 68 | Ga0070688_100002603 | 3300005365 | Bacteria | 9152 |
| 69 | Ga0070659_100024801 | 3300005366 | Bacteria | 4600 |
| 70 | Ga0070659_100078374 | 3300005366 | Bacteria | 2636 |
| 71 | Ga0070659_100116264 | 3300005366 | Bacteria | 2162 |
| 72 | Ga0070667_100001658 | 3300005367 | Bacteria | 19885 |
| 73 | Ga0070667_100004131 | 3300005367 | Bacteria | 12272 |
| 74 | Ga0070667_100007570 | 3300005367 | Bacteria | 9011 |
| 75 | Ga0070667_100425227 | 3300005367 | Bacteria | 1211 |
| 76 | Ga0070708_100292320 | 3300005445 | Bacteria | 1534 |
| 77 | Ga0070663_100103577 | 3300005455 | Bacteria | 2127 |
| 78 | Ga0070678_100012107 | 3300005456 | Bacteria | 5348 |
| 79 | Ga0070662_100049945 | 3300005457 | Bacteria | 3017 |
| 80 | Ga0070662_100101113 | 3300005457 | Bacteria | 2182 |
| 81 | Ga0070681_10429176 | 3300005458 | Bacteria | 1234 |
| 82 | Ga0068867_100000028 | 3300005459 | Bacteria | 87716 |
| 83 | Ga0068867_100034485 | 3300005459 | Bacteria | 3668 |
| 84 | Ga0070685_10000076 | 3300005466 | Bacteria | 59090 |
| 85 | Ga0070707_100462071 | 3300005468 | Bacteria | 1230 |
| 86 | Ga0070679_100209119 | 3300005530 | Bacteria | 1915 |
| 87 | Ga0068853_100022149 | 3300005539 | Bacteria | 5303 |
| 88 | Ga0068853_100076589 | 3300005539 | Bacteria | 2921 |
| 89 | Ga0068853_100139907 | 3300005539 | Bacteria | 2172 |
| 90 | Ga0070672_100021658 | 3300005543 | Bacteria | 4708 |
| 91 | Ga0070686_100000018 | 3300005544 | Bacteria | 140685 |
| 92 | Ga0070665_100000071 | 3300005548 | Bacteria | 200675 |
| 93 | Ga0070665_100000849 | 3300005548 | Bacteria | 39827 |
| 94 | Ga0068855_100003904 | 3300005563 | Bacteria | 18210 |
| 95 | Ga0068855_100052461 | 3300005563 | Bacteria | 4801 |
| 96 | Ga0068855_100117567 | 3300005563 | Bacteria | 3046 |
| 97 | Ga0068855_100160648 | 3300005563 | Bacteria | 2551 |
| 98 | Ga0070664_100138478 | 3300005564 | Bacteria | 2141 |
| 99 | Ga0068857_100008705 | 3300005577 | Bacteria | 8784 |
| 100 | Ga0068857_100237878 | 3300005577 | Bacteria | 1667 |
| 101 | Ga0068854_100000881 | 3300005578 | Bacteria | 18023 |
| 102 | Ga0068854_100014919 | 3300005578 | Bacteria | 5131 |
| 103 | Ga0068854_100098220 | 3300005578 | Bacteria | 2191 |
| 104 | Ga0068854_100110532 | 3300005578 | Bacteria | 2072 |
| 105 | Ga0068856_100058850 | 3300005614 | Bacteria | 3795 |
| 106 | Ga0068852_100007489 | 3300005616 | Bacteria | 7968 |
| 107 | Ga0068852_100156634 | 3300005616 | Bacteria | 2122 |
| 108 | Ga0068852_100277914 | 3300005616 | Bacteria | 1613 |
| 109 | Ga0068852_100588814 | 3300005616 | Bacteria | 1116 |
| 110 | Ga0068859_100000162 | 3300005617 | Bacteria | 65033 |
| 111 | Ga0068859_100000623 | 3300005617 | Bacteria | 35426 |
| 112 | Ga0068859_100006620 | 3300005617 | Bacteria | 11765 |
| 113 | Ga0068859_100008763 | 3300005617 | Bacteria | 10215 |
| 114 | Ga0068859_100135635 | 3300005617 | Bacteria | 2534 |
| 115 | Ga0068859_100672187 | 3300005617 | Bacteria | 1127 |
| 116 | Ga0068864_100000069 | 3300005618 | Bacteria | 114134 |
| 117 | Ga0068864_100000194 | 3300005618 | Bacteria | 55652 |
| 118 | Ga0068864_100000677 | 3300005618 | Bacteria | 28506 |
| 119 | Ga0068864_100007703 | 3300005618 | Bacteria | 8869 |
| 120 | Ga0068861_100000004 | 3300005719 | Bacteria | 105907 |
| 121 | Ga0068861_100003501 | 3300005719 | Bacteria | 10427 |
| 122 | Ga0068861_100004343 | 3300005719 | Bacteria | 9511 |
| 123 | Ga0068851_10038155 | 3300005834 | Bacteria | 2409 |
| 124 | Ga0068863_100000258 | 3300005841 | Bacteria | 55428 |
| 125 | Ga0068863_100000784 | 3300005841 | Bacteria | 31931 |
| 126 | Ga0068863_100004697 | 3300005841 | Bacteria | 13461 |
| 127 | Ga0068858_100001692 | 3300005842 | Bacteria | 22551 |
| 128 | Ga0068858_100002738 | 3300005842 | Bacteria | 17727 |
| 129 | Ga0068858_100004410 | 3300005842 | Bacteria | 13808 |
| 130 | Ga0068858_100017431 | 3300005842 | Bacteria | 6735 |
| 131 | Ga0068860_100000022 | 3300005843 | Bacteria | 279209 |
| 132 | Ga0068860_100004945 | 3300005843 | Bacteria | 13583 |
| 133 | Ga0068862_100000082 | 3300005844 | Bacteria | 113125 |
| 134 | Ga0068862_100000289 | 3300005844 | Bacteria | 55428 |
| 135 | Ga0068862_100001387 | 3300005844 | Bacteria | 22482 |
| 136 | Ga0075366_10321598 | 3300006195 | Bacteria | 948 |
| 137 | Ga0097621_100004543 | 3300006237 | Bacteria | 9677 |
| 138 | Ga0075370_10005832 | 3300006353 | Bacteria | 6152 |
| 139 | Ga0068871_100031338 | 3300006358 | Bacteria | 4193 |
| 140 | Ga0068865_100000006 | 3300006881 | Bacteria | 201186 |
| 141 | Ga0097620_100000162 | 3300006931 | Bacteria | 65033 |
| 142 | Ga0097620_100000623 | 3300006931 | Bacteria | 35426 |
| 143 | Ga0097620_100006621 | 3300006931 | Bacteria | 11765 |
| 144 | Ga0097620_100008763 | 3300006931 | Bacteria | 10215 |
| 145 | Ga0097620_100135635 | 3300006931 | Bacteria | 2534 |
| 146 | Ga0097620_100672254 | 3300006931 | Bacteria | 1127 |
| 147 | Ga0099794_10059802 | 3300007265 | Bacteria | 1849 |
| 148 | Ga0105251_10000815 | 3300009011 | Bacteria | 28051 |
| 149 | Ga0105240_10037440 | 3300009093 | Bacteria | 6235 |
| 150 | Ga0105240_10103626 | 3300009093 | Bacteria | 3456 |
| 151 | Ga0105240_10363867 | 3300009093 | Bacteria | 1637 |
| 152 | Ga0105240_10569847 | 3300009093 | Bacteria | 1250 |
| 153 | Ga0105245_10001073 | 3300009098 | Bacteria | 24782 |
| 154 | Ga0105247_10005540 | 3300009101 | Bacteria | 7940 |
| 155 | Ga0105247_10014575 | 3300009101 | Bacteria | 4715 |
| 156 | Ga0114129_10224777 | 3300009147 | Bacteria | 2531 |
| 157 | Ga0105243_10001033 | 3300009148 | Bacteria | 25571 |
| 158 | Ga0105243_10266655 | 3300009148 | Bacteria | 1536 |
| 159 | Ga0105243_10361067 | 3300009148 | Bacteria | 1337 |
| 160 | Ga0105241_10006361 | 3300009174 | Bacteria | 8705 |
| 161 | Ga0105242_10000413 | 3300009176 | Bacteria | 34034 |
| 162 | Ga0105248_10000012 | 3300009177 | Bacteria | 333963 |
| 163 | Ga0105248_10000101 | 3300009177 | Bacteria | 95328 |
| 164 | Ga0105248_10001646 | 3300009177 | Bacteria | 24849 |
| 165 | Ga0105248_10004784 | 3300009177 | Bacteria | 14984 |
| 166 | Ga0105248_10017707 | 3300009177 | Bacteria | 7859 |
| 167 | Ga0105248_10059784 | 3300009177 | Bacteria | 4281 |
| 168 | Ga0105237_10010466 | 3300009545 | Bacteria | 9859 |
| 169 | Ga0105237_10123855 | 3300009545 | Bacteria | 2580 |
| 170 | Ga0105237_10146187 | 3300009545 | Bacteria | 2359 |
| 171 | Ga0105237_10171493 | 3300009545 | Bacteria | 2170 |
| 172 | Ga0105238_10002527 | 3300009551 | Bacteria | 18281 |
| 173 | Ga0105238_10009256 | 3300009551 | Bacteria | 9859 |
| 174 | Ga0105238_10230820 | 3300009551 | Bacteria | 1827 |
| 175 | Ga0105238_10272150 | 3300009551 | Bacteria | 1674 |
| 176 | Ga0105238_10289467 | 3300009551 | Bacteria | 1620 |
| 177 | Ga0105249_10000014 | 3300009553 | Bacteria | 283274 |
| 178 | Ga0105249_10000099 | 3300009553 | Bacteria | 119885 |
| 179 | Ga0105249_10001061 | 3300009553 | Bacteria | 24372 |
| 180 | Ga0105249_10019332 | 3300009553 | Bacteria | 6076 |
| 181 | Ga0105249_10116554 | 3300009553 | Bacteria | 2532 |
| 182 | Ga0105249_10134027 | 3300009553 | Bacteria | 2368 |
| 183 | Ga0105148_100047 | 3300009978 | Bacteria | 18470 |
| 184 | Ga0105239_10100169 | 3300010375 | Bacteria | 3205 |
| 185 | Ga0105239_10143818 | 3300010375 | Bacteria | 2658 |
| 186 | Ga0105239_10384193 | 3300010375 | Bacteria | 1588 |
| 187 | Ga0105239_10388784 | 3300010375 | Bacteria | 1578 |
| 188 | Ga0105246_10002567 | 3300011119 | Bacteria | 10983 |
| 189 | Ga0157373_10007108 | 3300013100 | Bacteria | 8344 |
| 190 | Ga0157373_10229264 | 3300013100 | Bacteria | 1311 |
| 191 | Ga0157370_10000318 | 3300013104 | Bacteria | 60585 |
| 192 | Ga0157370_10080000 | 3300013104 | Bacteria | 3077 |
| 193 | Ga0157370_10145369 | 3300013104 | Bacteria | 2208 |
| 194 | Ga0157369_10033426 | 3300013105 | Bacteria | 5652 |
| 195 | Ga0157369_10070181 | 3300013105 | Bacteria | 3764 |
| 196 | Ga0157369_10540344 | 3300013105 | Bacteria | 1205 |
| 197 | Ga0157374_10004031 | 3300013296 | Bacteria | 12342 |
| 198 | Ga0157378_10001466 | 3300013297 | Bacteria | 21299 |
| 199 | Ga0157378_10057283 | 3300013297 | Bacteria | 3473 |
| 200 | Ga0157378_10077367 | 3300013297 | Bacteria | 2999 |
| 201 | Ga0163162_10000823 | 3300013306 | Bacteria | 28858 |
| 202 | Ga0163162_10001988 | 3300013306 | Bacteria | 19218 |
| 203 | Ga0163162_10004881 | 3300013306 | Bacteria | 12932 |
| 204 | Ga0163162_10392935 | 3300013306 | Bacteria | 1519 |
| 205 | Ga0157372_10136792 | 3300013307 | Bacteria | 2822 |
| 206 | Ga0157372_10172816 | 3300013307 | Bacteria | 2500 |
| 207 | Ga0157372_10367567 | 3300013307 | Bacteria | 1676 |
| 208 | Ga0157372_11233414 | 3300013307 | Bacteria | 864 |
| 209 | Ga0157375_10000586 | 3300013308 | Bacteria | 32467 |
| 210 | Ga0163163_10048705 | 3300014325 | Bacteria | 4168 |
| 211 | Ga0163163_10145827 | 3300014325 | Bacteria | 2411 |
| 212 | Ga0163163_10301890 | 3300014325 | Bacteria | 1653 |
| 213 | Ga0163163_10382115 | 3300014325 | Bacteria | 1466 |
| 214 | Ga0157380_10000681 | 3300014326 | Bacteria | 21070 |
| 215 | Ga0157380_10000793 | 3300014326 | Bacteria | 19836 |
| 216 | Ga0157380_10003492 | 3300014326 | Bacteria | 10795 |
| 217 | Ga0157380_10120630 | 3300014326 | Bacteria | 2220 |
| 218 | Ga0157377_10003736 | 3300014745 | Bacteria | 6905 |
| 219 | Ga0157379_10014310 | 3300014968 | Bacteria | 6960 |
| 220 | Ga0157379_10034191 | 3300014968 | Bacteria | 4530 |
| 221 | Ga0157379_10043366 | 3300014968 | Bacteria | 4016 |
| 222 | Ga0157376_10000347 | 3300014969 | Bacteria | 30895 |
| 223 | Ga0163161_10000186 | 3300017792 | Bacteria | 57200 |
| 224 | Ga0163161_10141108 | 3300017792 | Bacteria | 1825 |
| 225 | Ga0163161_10291672 | 3300017792 | Bacteria | 1282 |
| 226 | Ga0213875_10000636 | 3300021388 | Bacteria | 28040 |
| 227 | Ga0207672_1000697 | 3300025223 | Bacteria | 3837 |
| 228 | Ga0207427_101139 | 3300025231 | Bacteria | 10522 |
| 229 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 230 | Ga0207425_1006746 | 3300025245 | Bacteria | 3105 |
| 231 | Ga0209026_1002495 | 3300025250 | Bacteria | 6836 |
| 232 | Ga0209148_1000059 | 3300025254 | Bacteria | 350224 |
| 233 | Ga0209148_1001763 | 3300025254 | Bacteria | 9326 |
| 234 | Ga0209129_1001455 | 3300025258 | Bacteria | 13206 |
| 235 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 236 | Ga0209233_1000044 | 3300025261 | Bacteria | 489783 |
| 237 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 238 | Ga0209565_1000850 | 3300025263 | Bacteria | 17233 |
| 239 | Ga0209455_1000441 | 3300025272 | Bacteria | 32004 |
| 240 | Ga0209673_1020200 | 3300025273 | Bacteria | 2366 |
| 241 | Ga0209675_1000169 | 3300025291 | Bacteria | 78355 |
| 242 | Ga0209676_1000651 | 3300025292 | Bacteria | 49756 |
| 243 | Ga0209676_1000807 | 3300025292 | Bacteria | 41068 |
| 244 | Ga0209676_1001585 | 3300025292 | Bacteria | 20263 |
| 245 | Ga0209025_1000477 | 3300025294 | Bacteria | 77692 |
| 246 | Ga0209564_1001268 | 3300025295 | Bacteria | 27785 |
| 247 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 248 | Ga0209758_1011899 | 3300025297 | Bacteria | 4957 |
| 249 | Ga0209758_1031388 | 3300025297 | Bacteria | 2180 |
| 250 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 251 | Ga0209050_1000071 | 3300025298 | Bacteria | 295478 |
| 252 | Ga0209050_1000213 | 3300025298 | Bacteria | 129359 |
| 253 | Ga0209050_1000310 | 3300025298 | Bacteria | 99292 |
| 254 | Ga0209050_1008043 | 3300025298 | Bacteria | 5736 |
| 255 | Ga0209050_1008987 | 3300025298 | Bacteria | 5207 |
| 256 | Ga0209050_1030615 | 3300025298 | Bacteria | 1696 |
| 257 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 258 | Ga0207426_1027626 | 3300025302 | Bacteria | 1889 |
| 259 | Ga0209051_1001344 | 3300025303 | Bacteria | 21373 |
| 260 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 261 | Ga0209257_1000113 | 3300025304 | Bacteria | 233523 |
| 262 | Ga0209257_1000379 | 3300025304 | Bacteria | 88845 |
| 263 | Ga0209257_1007892 | 3300025304 | Bacteria | 6260 |
| 264 | Ga0209257_1010573 | 3300025304 | Bacteria | 4638 |
| 265 | Ga0209257_1016155 | 3300025304 | Bacteria | 3043 |
| 266 | Ga0207697_10003661 | 3300025315 | Bacteria | 7528 |
| 267 | Ga0207656_10002058 | 3300025321 | Bacteria | 6719 |
| 268 | Ga0207713_1011606 | 3300025735 | Bacteria | 4771 |
| 269 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 270 | Ga0207680_10000156 | 3300025903 | Bacteria | 33323 |
| 271 | Ga0207680_10005149 | 3300025903 | Bacteria | 6239 |
| 272 | Ga0207647_10000331 | 3300025904 | Bacteria | 38861 |
| 273 | Ga0207647_10011632 | 3300025904 | Bacteria | 6163 |
| 274 | Ga0207647_10049086 | 3300025904 | Bacteria | 2619 |
| 275 | Ga0207647_10167426 | 3300025904 | Bacteria | 1280 |
| 276 | Ga0207645_10003000 | 3300025907 | Bacteria | 13042 |
| 277 | Ga0207705_10000049 | 3300025909 | Bacteria | 170616 |
| 278 | Ga0207705_10000119 | 3300025909 | Bacteria | 88108 |
| 279 | Ga0207705_10000903 | 3300025909 | Bacteria | 24279 |
| 280 | Ga0207654_10003712 | 3300025911 | Bacteria | 7705 |
| 281 | Ga0207654_10147313 | 3300025911 | Bacteria | 1508 |
| 282 | Ga0207695_10001498 | 3300025913 | Bacteria | 38870 |
| 283 | Ga0207695_10026123 | 3300025913 | Bacteria | 6521 |
| 284 | Ga0207695_10046078 | 3300025913 | Bacteria | 4623 |
| 285 | Ga0207695_10500326 | 3300025913 | Bacteria | 1097 |
| 286 | Ga0207671_10000350 | 3300025914 | Bacteria | 66648 |
| 287 | Ga0207671_10008206 | 3300025914 | Bacteria | 8898 |
| 288 | Ga0207671_10181417 | 3300025914 | Bacteria | 1638 |
| 289 | Ga0207671_10310283 | 3300025914 | Bacteria | 1247 |
| 290 | Ga0207657_10002725 | 3300025919 | Bacteria | 19022 |
| 291 | Ga0207657_10012434 | 3300025919 | Bacteria | 8408 |
| 292 | Ga0207657_10090251 | 3300025919 | Bacteria | 2558 |
| 293 | Ga0207657_10138610 | 3300025919 | Bacteria | 1989 |
| 294 | Ga0207657_10249241 | 3300025919 | Bacteria | 1416 |
| 295 | Ga0207649_10030267 | 3300025920 | Bacteria | 3205 |
| 296 | Ga0207649_10248496 | 3300025920 | Bacteria | 1280 |
| 297 | Ga0207652_10000474 | 3300025921 | Bacteria | 41182 |
| 298 | Ga0207646_10406157 | 3300025922 | Bacteria | 1230 |
| 299 | Ga0207681_10000003 | 3300025923 | Bacteria | 713245 |
| 300 | Ga0207681_10000030 | 3300025923 | Bacteria | 173766 |
| 301 | Ga0207681_10000074 | 3300025923 | Bacteria | 89861 |
| 302 | Ga0207681_10045472 | 3300025923 | Bacteria | 2948 |
| 303 | Ga0207694_10000447 | 3300025924 | Bacteria | 38252 |
| 304 | Ga0207694_10001241 | 3300025924 | Bacteria | 22055 |
| 305 | Ga0207694_10006090 | 3300025924 | Bacteria | 9221 |
| 306 | Ga0207694_10218710 | 3300025924 | Bacteria | 1553 |
| 307 | Ga0207694_10238348 | 3300025924 | Bacteria | 1486 |
| 308 | Ga0207650_10000148 | 3300025925 | Bacteria | 85425 |
| 309 | Ga0207650_10000881 | 3300025925 | Bacteria | 22724 |
| 310 | Ga0207650_10002923 | 3300025925 | Bacteria | 11787 |
| 311 | Ga0207650_10014952 | 3300025925 | Bacteria | 5399 |
| 312 | Ga0207659_10007115 | 3300025926 | Bacteria | 6870 |
| 313 | Ga0207687_10000398 | 3300025927 | Bacteria | 29475 |
| 314 | Ga0207687_10004652 | 3300025927 | Bacteria | 9130 |
| 315 | Ga0207644_10000017 | 3300025931 | Bacteria | 177818 |
| 316 | Ga0207644_10099083 | 3300025931 | Bacteria | 2186 |
| 317 | Ga0207644_10124038 | 3300025931 | Bacteria | 1969 |
| 318 | Ga0207690_10007558 | 3300025932 | Bacteria | 6451 |
| 319 | Ga0207690_10080051 | 3300025932 | Bacteria | 2279 |
| 320 | Ga0207706_10005888 | 3300025933 | Bacteria | 11401 |
| 321 | Ga0207706_10025357 | 3300025933 | Bacteria | 5313 |
| 322 | Ga0207706_10074542 | 3300025933 | Bacteria | 2984 |
| 323 | Ga0207706_10162268 | 3300025933 | Bacteria | 1964 |
| 324 | Ga0207686_10004687 | 3300025934 | Bacteria | 7329 |
| 325 | Ga0207709_10000182 | 3300025935 | Bacteria | 83442 |
| 326 | Ga0207709_10116348 | 3300025935 | Bacteria | 1797 |
| 327 | Ga0207709_10212105 | 3300025935 | Bacteria | 1391 |
| 328 | Ga0207670_10003472 | 3300025936 | Bacteria | 8361 |
| 329 | Ga0207669_10344153 | 3300025937 | Bacteria | 1149 |
| 330 | Ga0207704_10000022 | 3300025938 | Bacteria | 146109 |
| 331 | Ga0207691_10139295 | 3300025940 | Bacteria | 2139 |
| 332 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 333 | Ga0207711_10002922 | 3300025941 | Bacteria | 14984 |
| 334 | Ga0207711_10005144 | 3300025941 | Bacteria | 11089 |
| 335 | Ga0207711_10011639 | 3300025941 | Bacteria | 7310 |
| 336 | Ga0207711_10014747 | 3300025941 | Bacteria | 6494 |
| 337 | Ga0207711_10046174 | 3300025941 | Bacteria | 3721 |
| 338 | Ga0207689_10000462 | 3300025942 | Bacteria | 38064 |
| 339 | Ga0207679_10254262 | 3300025945 | Bacteria | 1495 |
| 340 | Ga0207667_10000029 | 3300025949 | Bacteria | 329192 |
| 341 | Ga0207667_10007493 | 3300025949 | Bacteria | 13099 |
| 342 | Ga0207667_10029941 | 3300025949 | Bacteria | 5897 |
| 343 | Ga0207667_10045311 | 3300025949 | Bacteria | 4659 |
| 344 | Ga0207667_10071967 | 3300025949 | Bacteria | 3594 |
| 345 | Ga0207667_10088029 | 3300025949 | Bacteria | 3212 |
| 346 | Ga0207667_10242477 | 3300025949 | Bacteria | 1844 |
| 347 | Ga0207651_10000009 | 3300025960 | Bacteria | 199913 |
| 348 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 349 | Ga0207712_10000161 | 3300025961 | Bacteria | 69260 |
| 350 | Ga0207712_10008456 | 3300025961 | Bacteria | 6505 |
| 351 | Ga0207712_10042111 | 3300025961 | Bacteria | 3143 |
| 352 | Ga0207712_10122630 | 3300025961 | Bacteria | 1968 |
| 353 | Ga0207712_10188646 | 3300025961 | Bacteria | 1626 |
| 354 | Ga0207668_10000402 | 3300025972 | Bacteria | 27270 |
| 355 | Ga0207668_10013769 | 3300025972 | Bacteria | 4991 |
| 356 | Ga0207668_10042411 | 3300025972 | Bacteria | 3081 |
| 357 | Ga0207640_10000021 | 3300025981 | Bacteria | 168138 |
| 358 | Ga0207640_10010477 | 3300025981 | Bacteria | 5222 |
| 359 | Ga0207640_10011320 | 3300025981 | Bacteria | 5047 |
| 360 | Ga0207640_10022008 | 3300025981 | Bacteria | 3809 |
| 361 | Ga0207640_10086651 | 3300025981 | Bacteria | 2157 |
| 362 | Ga0207640_10111620 | 3300025981 | Bacteria | 1939 |
| 363 | Ga0207658_10000232 | 3300025986 | Bacteria | 58908 |
| 364 | Ga0207658_10000260 | 3300025986 | Bacteria | 55292 |
| 365 | Ga0207658_10006186 | 3300025986 | Bacteria | 8173 |
| 366 | Ga0207658_10075014 | 3300025986 | Bacteria | 2571 |
| 367 | Ga0207677_10000164 | 3300026023 | Bacteria | 52688 |
| 368 | Ga0207703_10000302 | 3300026035 | Bacteria | 54142 |
| 369 | Ga0207703_10001367 | 3300026035 | Bacteria | 22279 |
| 370 | Ga0207703_10003192 | 3300026035 | Bacteria | 13798 |
| 371 | Ga0207703_10011288 | 3300026035 | Bacteria | 6948 |
| 372 | Ga0207639_10001528 | 3300026041 | Bacteria | 15547 |
| 373 | Ga0207639_10004891 | 3300026041 | Bacteria | 9023 |
| 374 | Ga0207639_10006052 | 3300026041 | Bacteria | 8210 |
| 375 | Ga0207639_10023517 | 3300026041 | Bacteria | 4451 |
| 376 | Ga0207639_10030994 | 3300026041 | Bacteria | 3927 |
| 377 | Ga0207678_10000968 | 3300026067 | Bacteria | 26254 |
| 378 | Ga0207678_10028170 | 3300026067 | Bacteria | 4905 |
| 379 | Ga0207678_10476231 | 3300026067 | Bacteria | 1087 |
| 380 | Ga0207702_10000566 | 3300026078 | Bacteria | 41185 |
| 381 | Ga0207702_10004819 | 3300026078 | Bacteria | 11892 |
| 382 | Ga0207702_10010932 | 3300026078 | Bacteria | 7571 |
| 383 | Ga0207702_10048296 | 3300026078 | Bacteria | 3589 |
| 384 | Ga0207641_10000010 | 3300026088 | Bacteria | 402193 |
| 385 | Ga0207641_10000192 | 3300026088 | Bacteria | 83746 |
| 386 | Ga0207641_10002919 | 3300026088 | Bacteria | 15481 |
| 387 | Ga0207648_10000084 | 3300026089 | Bacteria | 88578 |
| 388 | Ga0207648_10165399 | 3300026089 | Bacteria | 1954 |
| 389 | Ga0207676_10000009 | 3300026095 | Bacteria | 545256 |
| 390 | Ga0207676_10000046 | 3300026095 | Bacteria | 149037 |
| 391 | Ga0207676_10000344 | 3300026095 | Bacteria | 39948 |
| 392 | Ga0207676_10001746 | 3300026095 | Bacteria | 15973 |
| 393 | Ga0207676_10014815 | 3300026095 | Bacteria | 5617 |
| 394 | Ga0207674_10004990 | 3300026116 | Bacteria | 15863 |
| 395 | Ga0207674_10009750 | 3300026116 | Bacteria | 10940 |
| 396 | Ga0207674_10013870 | 3300026116 | Bacteria | 8916 |
| 397 | Ga0207674_10352514 | 3300026116 | Bacteria | 1423 |
| 398 | Ga0207675_100000032 | 3300026118 | Bacteria | 108677 |
| 399 | Ga0207675_100000221 | 3300026118 | Bacteria | 53325 |
| 400 | Ga0207675_100000370 | 3300026118 | Bacteria | 43070 |
| 401 | Ga0207675_100001422 | 3300026118 | Bacteria | 23981 |
| 402 | Ga0207683_10002643 | 3300026121 | Bacteria | 15651 |
| 403 | Ga0207698_10002388 | 3300026142 | Bacteria | 11114 |
| 404 | Ga0207698_10009053 | 3300026142 | Bacteria | 6323 |
| 405 | Ga0209974_10052915 | 3300027876 | Bacteria | 1367 |
| 406 | Ga0268266_10000040 | 3300028379 | Bacteria | 323843 |
| 407 | Ga0268266_10001644 | 3300028379 | Bacteria | 25899 |
| 408 | Ga0268265_10000026 | 3300028380 | Bacteria | 246653 |
| 409 | Ga0268265_10000030 | 3300028380 | Bacteria | 228157 |
| 410 | Ga0268265_10000074 | 3300028380 | Bacteria | 127599 |
| 411 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 412 | Ga0268264_10000215 | 3300028381 | Bacteria | 113994 |
| 413 | Ga0307517_10166810 | 3300028786 | Bacteria | 1460 |
| 414 | Ga0307513_10306221 | 3300031456 | Bacteria | 1353 |
| 415 | Ga0307408_100063682 | 3300031548 | Bacteria | 2698 |
| 416 | Ga0307408_100171401 | 3300031548 | Bacteria | 1733 |
| 417 | Ga0307508_10000011 | 3300031616 | Bacteria | 248001 |
| 418 | Ga0307405_10007465 | 3300031731 | Bacteria | 5472 |
| 419 | Ga0307405_10094393 | 3300031731 | Bacteria | 1989 |
| 420 | Ga0307405_10111030 | 3300031731 | Bacteria | 1857 |
| 421 | Ga0307405_10393568 | 3300031731 | Bacteria | 1082 |
| 422 | Ga0307413_10063012 | 3300031824 | Bacteria | 2297 |
| 423 | Ga0307413_10220761 | 3300031824 | Bacteria | 1384 |
| 424 | Ga0307406_10004951 | 3300031901 | Bacteria | 7260 |
| 425 | Ga0307406_10101684 | 3300031901 | Bacteria | 1959 |
| 426 | Ga0307406_10262662 | 3300031901 | Bacteria | 1307 |
| 427 | Ga0307407_10256243 | 3300031903 | Bacteria | 1201 |
| 428 | Ga0307412_10000104 | 3300031911 | Bacteria | 67823 |
| 429 | Ga0307412_10004076 | 3300031911 | Bacteria | 8138 |
| 430 | Ga0307412_10008922 | 3300031911 | Bacteria | 5742 |
| 431 | Ga0307412_10012503 | 3300031911 | Bacteria | 4952 |
| 432 | Ga0307412_10026721 | 3300031911 | Bacteria | 3591 |
| 433 | Ga0307412_10029631 | 3300031911 | Bacteria | 3437 |
| 434 | Ga0307412_10170911 | 3300031911 | Bacteria | 1625 |
| 435 | Ga0307409_100220897 | 3300031995 | Bacteria | 1710 |
| 436 | Ga0307416_100008721 | 3300032002 | Bacteria | 6568 |
| 437 | Ga0307416_100068377 | 3300032002 | Bacteria | 2935 |
| 438 | Ga0307416_100102843 | 3300032002 | Bacteria | 2492 |
| 439 | Ga0307414_10008100 | 3300032004 | Bacteria | 5937 |
| 440 | Ga0307414_10024523 | 3300032004 | Bacteria | 3848 |
| 441 | Ga0307414_10071331 | 3300032004 | Bacteria | 2505 |
| 442 | Ga0307414_10084937 | 3300032004 | Bacteria | 2330 |
| 443 | Ga0307414_10108351 | 3300032004 | Bacteria | 2107 |
| 444 | Ga0307414_10121153 | 3300032004 | Bacteria | 2011 |
| 445 | Ga0307414_10190797 | 3300032004 | Bacteria | 1658 |
| 446 | Ga0307414_10199442 | 3300032004 | Bacteria | 1626 |
| 447 | Ga0307411_10072538 | 3300032005 | Bacteria | 2338 |
| 448 | Ga0307415_100242279 | 3300032126 | Bacteria | 1459 |
| 449 | Ga0395899_0005461 | 3300037312 | Bacteria | 9859 |
| 450 | Ga0395899_0062717 | 3300037312 | Bacteria | 2737 |
| 451 | Ga0395900_0054489 | 3300037418 | Bacteria | 4118 |
| 452 | Ga0395900_0100885 | 3300037418 | Bacteria | 2965 |
| 453 | Ga0395900_0813956 | 3300037418 | Bacteria | 861 |
| 454 | Ga0395905_0091855 | 3300037471 | Bacteria | 2846 |
| 455 | Ga0395905_0167588 | 3300037471 | Bacteria | 2064 |
| 456 | Ga0395905_0429420 | 3300037471 | Bacteria | 1218 |
| 457 | Ga0436364_0689048 | 3300037853 | Bacteria | 11902 |
| 458 | Ga0395901_0025734 | 3300038443 | Bacteria | 6041 |
| 459 | Ga0395901_0494653 | 3300038443 | Bacteria | 1246 |
| 460 | Ga0237819_03296 | 3300038705 | Bacteria | 2913 |
| 461 | Ga0237816_00927 | 3300039145 | Bacteria | 2402 |
| 462 | Ga0436365_0019219 | 3300039437 | Bacteria | 1711 |
| 463 | Ga0436363_0619851 | 3300039450 | Bacteria | 1419 |
| 464 | Ga0439461_0007070 | 3300041410 | Bacteria | 1975 |
| 465 | Ga0439466_0016932 | 3300041411 | Bacteria | 2630 |
| 466 | Ga0439465_0000722 | 3300041413 | Bacteria | 10202 |
| 467 | Ga0439465_0001868 | 3300041413 | Bacteria | 6883 |
| 468 | Ga0451806_247531 | 3300041462 | Bacteria | 2986 |
| 469 | Ga0451807_0951501 | 3300041486 | Bacteria | 1610 |
| 470 | Ga0439431_0031503 | 3300041997 | Bacteria | 1318 |
| 471 | Ga0439445_0004626 | 3300042004 | Bacteria | 3118 |
| 472 | Ga0439448_0002822 | 3300042005 | Bacteria | 4756 |
| 473 | Ga0439448_0003054 | 3300042005 | Bacteria | 4599 |
| 474 | Ga0439448_0018091 | 3300042005 | Bacteria | 2156 |
| 475 | Ga0439432_007156 | 3300042006 | Bacteria | 3965 |
| 476 | Ga0439450_019171 | 3300042008 | Bacteria | 1446 |
| 477 | Ga0439455_0002237 | 3300042012 | Bacteria | 3472 |
| 478 | Ga0439455_0003114 | 3300042012 | Bacteria | 3124 |
| 479 | Ga0439455_0020182 | 3300042012 | Bacteria | 1577 |
| 480 | Ga0439455_0021524 | 3300042012 | Bacteria | 1538 |
| 481 | Ga0439457_004596 | 3300042014 | Bacteria | 3575 |
| 482 | Ga0439462_0000844 | 3300042015 | Bacteria | 6416 |
| 483 | Ga0450923_042994 | 3300042125 | Bacteria | 954 |
| 484 | Ga0439458_0000069 | 3300042157 | Bacteria | 18709 |
| 485 | Ga0439458_0002139 | 3300042157 | Bacteria | 4882 |
| 486 | Ga0439434_0005415 | 3300042435 | Bacteria | 3737 |
| 487 | Ga0466963_0122715 | 3300044694 | Bacteria | 1789 |
| 488 | Ga0466964_0002062 | 3300044706 | Bacteria | 7070 |
| 489 | Ga0466971_0006379 | 3300044719 | Bacteria | 5122 |
| 490 | Ga0466968_0032144 | 3300044735 | Bacteria | 2181 |
| 491 | Ga0466970_0232189 | 3300044765 | Bacteria | 1031 |
| 492 | Ga0466957_0039253 | 3300044842 | Bacteria | 2856 |
| 493 | Ga0466957_0287732 | 3300044842 | Bacteria | 1101 |
| 494 | Ga0466960_0002581 | 3300044901 | Bacteria | 6810 |
| 495 | Ga0466958_0048262 | 3300045836 | Bacteria | 2572 |
| 496 | Ga0466967_0023868 | 3300045976 | Bacteria | 5019 |
| 497 | Ga0495627_022728 | 3300046453 | Bacteria | 2060 |
| 498 | Ga0495638_0000207 | 3300046460 | Bacteria | 83805 |
| 499 | Ga0495638_0136534 | 3300046460 | Bacteria | 1435 |
| 500 | Ga0495643_0125417 | 3300046522 | Bacteria | 1293 |
| 501 | Ga0495648_0012030 | 3300046524 | Bacteria | 6483 |
| 502 | Ga0495648_0065607 | 3300046524 | Bacteria | 2133 |
| 503 | Ga0495648_0103581 | 3300046524 | Bacteria | 1565 |
| 504 | Ga0495663_0008729 | 3300046525 | Bacteria | 2810 |
| 505 | Ga0495663_0025926 | 3300046525 | Bacteria | 1713 |
| 506 | Ga0495654_0001081 | 3300046530 | Bacteria | 19864 |
| 507 | Ga0495654_0026577 | 3300046530 | Bacteria | 2974 |
| 508 | Ga0495654_0058538 | 3300046530 | Bacteria | 1859 |
| 509 | Ga0495598_0011454 | 3300046537 | Bacteria | 2151 |
| 510 | Ga0495597_0010615 | 3300046542 | Bacteria | 4493 |
| 511 | Ga0495597_0038861 | 3300046542 | Bacteria | 2132 |
| 512 | Ga0495668_0000087 | 3300046616 | Bacteria | 151819 |
| 513 | Ga0495668_0001796 | 3300046616 | Bacteria | 19561 |
| 514 | Ga0495668_0016477 | 3300046616 | Bacteria | 4296 |
| 515 | Ga0495625_0000275 | 3300046660 | Bacteria | 80062 |
| 516 | Ga0495625_0001182 | 3300046660 | Bacteria | 33512 |
| 517 | Ga0495625_0004756 | 3300046660 | Bacteria | 12703 |
| 518 | Ga0495625_0130970 | 3300046660 | Bacteria | 1699 |
| 519 | Ga0495625_0237433 | 3300046660 | Bacteria | 1188 |
| 520 | Ga0495670_0000010 | 3300046691 | Bacteria | 174071 |
| 521 | Ga0495670_0214983 | 3300046691 | Bacteria | 1020 |
| 522 | Ga0495671_0015741 | 3300046692 | Bacteria | 4046 |
| 523 | Ga0495649_0153721 | 3300046694 | Bacteria | 1208 |
| 524 | Ga0495589_0038667 | 3300046794 | Bacteria | 2387 |
| 525 | Ga0495687_067576 | 3300047443 | Bacteria | 1446 |
| 526 | Ga0495681_0015143 | 3300047470 | Bacteria | 4375 |
| 527 | Ga0495686_0000273 | 3300047472 | Bacteria | 91936 |
| 528 | Ga0495686_0467578 | 3300047472 | Bacteria | 668 |
| 529 | Ga0496102_0010329 | 3300048905 | Bacteria | 8028 |
| 530 | Ga0496102_0177499 | 3300048905 | Bacteria | 2006 |
| 531 | Ga0496103_0001143 | 3300048906 | Bacteria | 18378 |
| 532 | Ga0496103_0001152 | 3300048906 | Bacteria | 18258 |
| 533 | Ga0496103_0035464 | 3300048906 | Bacteria | 3054 |
| 534 | Ga0496104_0067408 | 3300048907 | Bacteria | 3400 |
| 535 | Ga0496105_0077968 | 3300048908 | Bacteria | 2736 |
| 536 | Ga0496108_0374900 | 3300048911 | Bacteria | 1242 |
| 537 | Ga0496109_0017136 | 3300048912 | Bacteria | 6342 |
| 538 | Ga0496115_0000325 | 3300048918 | Bacteria | 40655 |
| 539 | Ga0496116_0003043 | 3300048919 | Bacteria | 16956 |
| 540 | Ga0496116_0008247 | 3300048919 | Bacteria | 9074 |
| 541 | Ga0496117_0002989 | 3300048920 | Bacteria | 20363 |
| 542 | Ga0496117_0003452 | 3300048920 | Bacteria | 18381 |
| 543 | Ga0496117_0007701 | 3300048920 | Bacteria | 10425 |
| 544 | Ga0496117_0022717 | 3300048920 | Bacteria | 5023 |
| 545 | Ga0496118_0001765 | 3300048921 | Bacteria | 31299 |
| 546 | Ga0496118_0003875 | 3300048921 | Bacteria | 18378 |
| 547 | Ga0496118_0029295 | 3300048921 | Bacteria | 4620 |
| 548 | Ga0496118_0058166 | 3300048921 | Bacteria | 2891 |
| 549 | Ga0496119_0032572 | 3300048922 | Bacteria | 3471 |
| 550 | Ga0496119_0143416 | 3300048922 | Bacteria | 1287 |
| 551 | Ga0496120_0036264 | 3300048923 | Bacteria | 2937 |
| 552 | Ga0496121_0010236 | 3300048924 | Bacteria | 10612 |
| 553 | Ga0496121_0170323 | 3300048924 | Bacteria | 1583 |
| 554 | Ga0496121_0380243 | 3300048924 | Bacteria | 931 |
| 555 | Ga0496122_0001166 | 3300048925 | Bacteria | 44916 |
| 556 | Ga0496122_0013706 | 3300048925 | Bacteria | 7909 |
| 557 | Ga0496123_0000542 | 3300048926 | Bacteria | 64858 |
| 558 | Ga0496123_0014602 | 3300048926 | Bacteria | 6495 |
| 559 | Ga0496123_0017741 | 3300048926 | Bacteria | 5706 |
| 560 | Ga0496123_0036942 | 3300048926 | Bacteria | 3455 |
| 561 | Ga0496124_0003726 | 3300048927 | Bacteria | 18378 |
| 562 | Ga0496124_0005643 | 3300048927 | Bacteria | 13989 |
| 563 | Ga0496124_0007335 | 3300048927 | Bacteria | 11745 |
| 564 | Ga0496124_0049758 | 3300048927 | Bacteria | 3574 |
| 565 | Ga0496124_0272070 | 3300048927 | Bacteria | 1240 |
| 566 | Ga0496125_0110184 | 3300048928 | Bacteria | 1997 |
| 567 | Ga0496126_0084156 | 3300048929 | Bacteria | 2806 |
| 568 | Ga0496126_0257002 | 3300048929 | Bacteria | 1454 |
| 569 | Ga0496126_0559122 | 3300048929 | Bacteria | 907 |
| 570 | Ga0501290_000134 | 3300049513 | Bacteria | 11572 |
| 571 | Ga0501292_000019 | 3300049515 | Bacteria | 55694 |
| 572 | Ga0501300_007160 | 3300049523 | Bacteria | 1634 |
| 573 | Ga0501031_0074400 | 3300049568 | Bacteria | 2212 |
| 574 | Ga0501032_0017922 | 3300049569 | Bacteria | 4968 |
| 575 | Ga0501033_0123213 | 3300049570 | Bacteria | 1880 |
| 576 | Ga0501033_0127794 | 3300049570 | Bacteria | 1842 |
| 577 | Ga0501033_0212457 | 3300049570 | Bacteria | 1379 |
| 578 | Ga0501033_0249752 | 3300049570 | Bacteria | 1257 |
| 579 | Ga0501034_0244326 | 3300049571 | Bacteria | 1740 |
| 580 | Ga0501036_0028055 | 3300049572 | Bacteria | 4758 |
| 581 | Ga0501037_0237802 | 3300049573 | Bacteria | 1277 |
| 582 | Ga0501038_0016764 | 3300049574 | Bacteria | 6635 |
| 583 | Ga0501038_0407101 | 3300049574 | Bacteria | 1051 |
| 584 | Ga0501039_0223381 | 3300049575 | Bacteria | 1480 |
| 585 | Ga0501043_0176864 | 3300049579 | Bacteria | 1663 |
| 586 | Ga0501047_0220752 | 3300049581 | Bacteria | 1752 |
| 587 | Ga0501047_0235122 | 3300049581 | Bacteria | 1684 |
| 588 | Ga0501202_002837 | 3300049652 | Bacteria | 2937 |
| 589 | Ga0501211_002397 | 3300049658 | Bacteria | 1985 |
| 590 | Ga0501222_002037 | 3300049662 | Bacteria | 2796 |
| 591 | Ga0501223_001879 | 3300049663 | Bacteria | 4734 |
| 592 | Ga0501261_000135 | 3300049690 | Bacteria | 10828 |
| 593 | Ga0501225_0008439 | 3300049705 | Bacteria | 2957 |
| 594 | Ga0501241_002254 | 3300049758 | Bacteria | 3762 |
| 595 | Ga0501279_000008 | 3300049775 | Bacteria | 125267 |
| 596 | Ga0501280_000477 | 3300049776 | Bacteria | 9513 |
| 597 | Ga0501281_00281 | 3300049777 | Bacteria | 5295 |
| 598 | Ga0501282_001448 | 3300049778 | Bacteria | 2629 |
| 599 | Ga0501035_0081680 | 3300049822 | Bacteria | 2852 |
| 600 | Ga0501044_0112215 | 3300049823 | Bacteria | 2733 |
| 601 | Ga0501044_0248689 | 3300049823 | Bacteria | 1720 |
| 602 | Ga0501044_0504232 | 3300049823 | Bacteria | 1111 |
| 603 | nmdc:mga0k408_132918_c1 | 3300050493 | Bacteria | 1477 |
| 604 | nmdc:mga05p37_769977_c1 | 3300050507 | Bacteria | 1058 |
| 605 | Ga0500643_000044 | 3300053087 | Bacteria | 155319 |
| 606 | Ga0500643_000134 | 3300053087 | Bacteria | 75321 |
| 607 | Ga0500643_000235 | 3300053087 | Bacteria | 51395 |
| 608 | Ga0500643_008448 | 3300053087 | Bacteria | 4042 |
| 609 | Ga0500643_011585 | 3300053087 | Bacteria | 3207 |
| 610 | Ga0500643_019055 | 3300053087 | Bacteria | 2265 |
| 611 | Ga0500643_041408 | 3300053087 | Bacteria | 1353 |
| 612 | Ga0500644_0024112 | 3300053088 | Bacteria | 1856 |
| 613 | Ga0500647_0022410 | 3300053091 | Bacteria | 2955 |
| 614 | Ga0500651_0017952 | 3300053093 | Bacteria | 4375 |
| 615 | Ga0500566_0000259 | 3300053094 | Bacteria | 28513 |
| 616 | Ga0500641_0006588 | 3300053096 | Bacteria | 4123 |
| 617 | Ga0500641_0139880 | 3300053096 | Bacteria | 1046 |
| 618 | Ga0500555_021622 | 3300053103 | Bacteria | 1853 |
| 619 | Ga0500556_0000053 | 3300053104 | Bacteria | 117389 |
| 620 | Ga0500562_003971 | 3300053108 | Bacteria | 3728 |
| 621 | Ga0500562_042123 | 3300053108 | Bacteria | 1214 |
| 622 | Ga0500562_060412 | 3300053108 | Bacteria | 1018 |
| 623 | Ga0500592_001009 | 3300053116 | Bacteria | 4592 |
| 624 | Ga0500592_003096 | 3300053116 | Bacteria | 2657 |
| 625 | Ga0500594_0008100 | 3300053118 | Bacteria | 2390 |
| 626 | Ga0500595_003619 | 3300053119 | Bacteria | 7164 |
| 627 | Ga0500608_018097 | 3300053122 | Bacteria | 3211 |
| 628 | Ga0500614_009206 | 3300053123 | Bacteria | 2104 |
| 629 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 630 | Ga0500642_0002793 | 3300053130 | Bacteria | 5177 |
| 631 | Ga0500655_000117 | 3300053133 | Bacteria | 20402 |
| 632 | Ga0500658_0001115 | 3300053134 | Bacteria | 10989 |
| 633 | Ga0500658_0001309 | 3300053134 | Bacteria | 10078 |
| 634 | Ga0500658_0081370 | 3300053134 | Bacteria | 1386 |
| 635 | Ga0500559_0003007 | 3300053136 | Bacteria | 8441 |
| 636 | Ga0500559_0043212 | 3300053136 | Bacteria | 1968 |
| 637 | Ga0500559_0066896 | 3300053136 | Bacteria | 1612 |
| 638 | Ga0500568_0006304 | 3300053139 | Bacteria | 5974 |
| 639 | Ga0500573_0000010 | 3300053140 | Bacteria | 210704 |
| 640 | Ga0500577_0017129 | 3300053142 | Bacteria | 2301 |
| 641 | Ga0500590_000141 | 3300053148 | Bacteria | 20020 |
| 642 | Ga0500604_0020108 | 3300053151 | Bacteria | 1876 |
| 643 | Ga0500624_000192 | 3300053157 | Bacteria | 24306 |
| 644 | Ga0500627_0000009 | 3300053158 | Bacteria | 153203 |
| 645 | Ga0500627_0000103 | 3300053158 | Bacteria | 28283 |
| 646 | Ga0500627_0002011 | 3300053158 | Bacteria | 5875 |
| 647 | Ga0500627_0006460 | 3300053158 | Bacteria | 3998 |
| 648 | Ga0500627_0061889 | 3300053158 | Bacteria | 1647 |
| 649 | Ga0500636_0008346 | 3300053177 | Bacteria | 6008 |
| 650 | Ga0500570_003990 | 3300053724 | Bacteria | 7701 |
| 651 | Ga0500645_000620 | 3300053730 | Bacteria | 22765 |
| 652 | Ga0500645_000784 | 3300053730 | Bacteria | 19194 |
| 653 | Ga0500596_007569 | 3300053735 | Bacteria | 1774 |
| 654 | Ga0500661_000700 | 3300055283 | Bacteria | 6261 |
| 655 | Ga0466962_0005832 | 3300061719 | Bacteria | 5918 |
| 656 | 2585261120 | 2582581305 | Bacteria | 4895574 |
| 657 | 2600202240 | 2599185354 | Bacteria | 4398675 |
| 658 | 2600228375 | 2599185359 | Bacteria | 4772316 |
| 659 | 2643819110 | 2643221560 | Bacteria | 4801179 |
| 660 | 2643835021 | 2643221563 | Bacteria | 4726935 |
| 661 | 2644039004 | 2643221605 | Bacteria | 4772303 |
| 662 | 2644055948 | 2643221608 | Bacteria | 4724829 |
| 663 | 2644127726 | 2643221622 | Bacteria | 4212502 |
| 664 | 2753766155 | 2751185897 | Bacteria | 5322941 |
| 665 | 2819715171 | 2818991466 | Bacteria | 4748179 |
| 666 | 2852653616 | 2852653556 | Bacteria | 4050083 |
| 667 | 2852683115 | 2852680915 | Bacteria | 4100189 |
| 668 | 2879163945 | 2879163058 | Bacteria | 4223965 |
| 669 | 2885432176 | 2885429604 | Bacteria | 3642894 |
| 670 | 2928029435 | 2928027323 | Bacteria | 4382488 |
| 671 | 2928528090 | 2928526807 | Bacteria | 4760224 |
| 672 | 2928971405 | 2928968154 | Bacteria | 4633371 |
| 673 | 2984556633 | 2984555340 | Bacteria | 4247089 |
| 674 | 2984565194 | 2984564862 | Bacteria | 4339992 |
| 675 | 2990268514 | 2990265787 | Bacteria | 3943888 |
| 676 | 2993356270 | 2993356040 | Bacteria | 4247105 |
| 677 | 2993696451 | 2993693658 | Bacteria | 4040749 |
| 678 | 3000867821 | 3000865235 | Bacteria | 3106258 |
| 679 | Ga0065704_10120400 | |||
| 680 | JGI24741J21665_1002093 | |||
| 681 | JGI24740J21852_10001545 | |||
| 682 | JGI24739J22299_10007692 | |||
| 683 | JGI24739J22299_10012970 | |||
| 684 | JGI24739J22299_10033187 | |||
| 685 | JGI24737J22298_10001850 | |||
| 686 | JGI24737J22298_10018216 | |||
| 687 | JGI24735J21928_10002160 | |||
| 688 | JGI24735J21928_10002466 | |||
| 689 | JGI24750J21931_1016035 | |||
| 690 | JGI24748J21848_1000053 | |||
| 691 | JGI24738J21930_10002840 | |||
| 692 | JGI24749J21850_1000019 | |||
| 693 | JGI24749J21850_1000152 | |||
| 694 | JGI24034J26672_10000036 | |||
| 695 | JGI24751J29686_10000519 | |||
| 696 | JGI25151J46595_10006038 | |||
| 697 | JGI25165J46597_1000106 | |||
| 698 | JGI25153J46596_10000073 | |||
| 699 | rootH2_10015355 | |||
| 700 | rootL2_10226620 | |||
| 701 | rootH1_10214361 | |||
| 702 | Ga0055526_1008485 | |||
| 703 | Ga0055537_1001577 | |||
| 704 | Ga0055537_1004584 | |||
| 705 | Ga0055524_1004959 | |||
| 706 | Ga0055536_1003303 | |||
| 707 | Ga0055536_1016127 | |||
| 708 | Ga0055530_10000919 | |||
| 709 | Ga0055540_1001791 | |||
| 710 | Ga0055531_10000727 | |||
| 711 | Ga0055531_10002471 | |||
| 712 | Ga0055531_10003687 | |||
| 713 | Ga0055531_10007054 | |||
| 714 | Ga0065165_1014363 | |||
| 715 | Ga0065707_10081960 | |||
| 716 | Ga0065707_10084228 | |||
| 717 | Ga0070658_10005193 | |||
| 718 | Ga0070658_10005573 | |||
| 719 | Ga0070658_10031587 | |||
| 720 | Ga0070658_10310037 | |||
| 721 | Ga0070676_10001299 | |||
| 722 | Ga0070690_100000093 | |||
| 723 | Ga0070670_100000060 | |||
| 724 | Ga0070670_100000202 | |||
| 725 | Ga0070670_100012257 | |||
| 726 | Ga0068869_100000134 | |||
| 727 | Ga0070666_10000009 | |||
| 728 | Ga0070666_10000476 | |||
| 729 | Ga0068868_100000596 | |||
| 730 | Ga0070660_100033451 | |||
| 731 | Ga0070660_100073908 | |||
| 732 | Ga0070689_100012983 | |||
| 733 | Ga0070661_100042425 | |||
| 734 | Ga0070668_100054655 | |||
| 735 | Ga0070668_100067396 | |||
| 736 | Ga0070669_100000053 | |||
| 737 | Ga0070669_100000096 | |||
| 738 | Ga0070669_100000103 | |||
| 739 | Ga0070669_100299079 | |||
| 740 | Ga0070675_100013296 | |||
| 741 | Ga0070671_100000045 | |||
| 742 | Ga0070671_100340534 | |||
| 743 | Ga0070671_100398326 | |||
| 744 | Ga0070674_100087507 | |||
| 745 | Ga0070673_100000004 | |||
| 746 | Ga0070688_100002603 | |||
| 747 | Ga0070659_100024801 | |||
| 748 | Ga0070659_100078374 | |||
| 749 | Ga0070659_100116264 | |||
| 750 | Ga0070667_100001658 | |||
| 751 | Ga0070667_100004131 | |||
| 752 | Ga0070667_100007570 | |||
| 753 | Ga0070667_100425227 | |||
| 754 | Ga0070708_100292320 | |||
| 755 | Ga0070663_100103577 | |||
| 756 | Ga0070678_100012107 | |||
| 757 | Ga0070662_100049945 | |||
| 758 | Ga0070662_100101113 | |||
| 759 | Ga0070681_10429176 | |||
| 760 | Ga0068867_100000028 | |||
| 761 | Ga0068867_100034485 | |||
| 762 | Ga0070685_10000076 | |||
| 763 | Ga0070707_100462071 | |||
| 764 | Ga0070679_100209119 | |||
| 765 | Ga0068853_100022149 | |||
| 766 | Ga0068853_100076589 | |||
| 767 | Ga0068853_100139907 | |||
| 768 | Ga0070672_100021658 | |||
| 769 | Ga0070686_100000018 | |||
| 770 | Ga0070665_100000071 | |||
| 771 | Ga0070665_100000849 | |||
| 772 | Ga0068855_100003904 | |||
| 773 | Ga0068855_100052461 | |||
| 774 | Ga0068855_100117567 | |||
| 775 | Ga0068855_100160648 | |||
| 776 | Ga0070664_100138478 | |||
| 777 | Ga0068857_100008705 | |||
| 778 | Ga0068857_100237878 | |||
| 779 | Ga0068854_100000881 | |||
| 780 | Ga0068854_100014919 | |||
| 781 | Ga0068854_100098220 | |||
| 782 | Ga0068854_100110532 | |||
| 783 | Ga0068856_100058850 | |||
| 784 | Ga0068852_100007489 | |||
| 785 | Ga0068852_100156634 | |||
| 786 | Ga0068852_100277914 | |||
| 787 | Ga0068852_100588814 | |||
| 788 | Ga0068859_100000162 | |||
| 789 | Ga0068859_100000623 | |||
| 790 | Ga0068859_100006620 | |||
| 791 | Ga0068859_100008763 | |||
| 792 | Ga0068859_100135635 | |||
| 793 | Ga0068859_100672187 | |||
| 794 | Ga0068864_100000069 | |||
| 795 | Ga0068864_100000194 | |||
| 796 | Ga0068864_100000677 | |||
| 797 | Ga0068864_100007703 | |||
| 798 | Ga0068861_100000004 | |||
| 799 | Ga0068861_100003501 | |||
| 800 | Ga0068861_100004343 | |||
| 801 | Ga0068851_10038155 | |||
| 802 | Ga0068863_100000258 | |||
| 803 | Ga0068863_100000784 | |||
| 804 | Ga0068863_100004697 | |||
| 805 | Ga0068858_100001692 | |||
| 806 | Ga0068858_100002738 | |||
| 807 | Ga0068858_100004410 | |||
| 808 | Ga0068858_100017431 | |||
| 809 | Ga0068860_100000022 | |||
| 810 | Ga0068860_100004945 | |||
| 811 | Ga0068862_100000082 | |||
| 812 | Ga0068862_100000289 | |||
| 813 | Ga0068862_100001387 | |||
| 814 | Ga0075366_10321598 | |||
| 815 | Ga0097621_100004543 | |||
| 816 | Ga0075370_10005832 | |||
| 817 | Ga0068871_100031338 | |||
| 818 | Ga0068865_100000006 | |||
| 819 | Ga0097620_100000162 | |||
| 820 | Ga0097620_100000623 | |||
| 821 | Ga0097620_100006621 | |||
| 822 | Ga0097620_100008763 | |||
| 823 | Ga0097620_100135635 | |||
| 824 | Ga0097620_100672254 | |||
| 825 | Ga0099794_10059802 | |||
| 826 | Ga0105251_10000815 | |||
| 827 | Ga0105240_10037440 | |||
| 828 | Ga0105240_10103626 | |||
| 829 | Ga0105240_10363867 | |||
| 830 | Ga0105240_10569847 | |||
| 831 | Ga0105245_10001073 | |||
| 832 | Ga0105247_10005540 | |||
| 833 | Ga0105247_10014575 | |||
| 834 | Ga0114129_10224777 | |||
| 835 | Ga0105243_10001033 | |||
| 836 | Ga0105243_10266655 | |||
| 837 | Ga0105243_10361067 | |||
| 838 | Ga0105241_10006361 | |||
| 839 | Ga0105242_10000413 | |||
| 840 | Ga0105248_10000012 | |||
| 841 | Ga0105248_10000101 | |||
| 842 | Ga0105248_10001646 | |||
| 843 | Ga0105248_10004784 | |||
| 844 | Ga0105248_10017707 | |||
| 845 | Ga0105248_10059784 | |||
| 846 | Ga0105237_10010466 | |||
| 847 | Ga0105237_10123855 | |||
| 848 | Ga0105237_10146187 | |||
| 849 | Ga0105237_10171493 | |||
| 850 | Ga0105238_10002527 | |||
| 851 | Ga0105238_10009256 | |||
| 852 | Ga0105238_10230820 | |||
| 853 | Ga0105238_10272150 | |||
| 854 | Ga0105238_10289467 | |||
| 855 | Ga0105249_10000014 | |||
| 856 | Ga0105249_10000099 | |||
| 857 | Ga0105249_10001061 | |||
| 858 | Ga0105249_10019332 | |||
| 859 | Ga0105249_10116554 | |||
| 860 | Ga0105249_10134027 | |||
| 861 | Ga0105148_100047 | |||
| 862 | Ga0105239_10100169 | |||
| 863 | Ga0105239_10143818 | |||
| 864 | Ga0105239_10384193 | |||
| 865 | Ga0105239_10388784 | |||
| 866 | Ga0105246_10002567 | |||
| 867 | Ga0157373_10007108 | |||
| 868 | Ga0157373_10229264 | |||
| 869 | Ga0157370_10000318 | |||
| 870 | Ga0157370_10080000 | |||
| 871 | Ga0157370_10145369 | |||
| 872 | Ga0157369_10033426 | |||
| 873 | Ga0157369_10070181 | |||
| 874 | Ga0157369_10540344 | |||
| 875 | Ga0157374_10004031 | |||
| 876 | Ga0157378_10001466 | |||
| 877 | Ga0157378_10057283 | |||
| 878 | Ga0157378_10077367 | |||
| 879 | Ga0163162_10000823 | |||
| 880 | Ga0163162_10001988 | |||
| 881 | Ga0163162_10004881 | |||
| 882 | Ga0163162_10392935 | |||
| 883 | Ga0157372_10136792 | |||
| 884 | Ga0157372_10172816 | |||
| 885 | Ga0157372_10367567 | |||
| 886 | Ga0157372_11233414 | |||
| 887 | Ga0157375_10000586 | |||
| 888 | Ga0163163_10048705 | |||
| 889 | Ga0163163_10145827 | |||
| 890 | Ga0163163_10301890 | |||
| 891 | Ga0163163_10382115 | |||
| 892 | Ga0157380_10000681 | |||
| 893 | Ga0157380_10000793 | |||
| 894 | Ga0157380_10003492 | |||
| 895 | Ga0157380_10120630 | |||
| 896 | Ga0157377_10003736 | |||
| 897 | Ga0157379_10014310 | |||
| 898 | Ga0157379_10034191 | |||
| 899 | Ga0157379_10043366 | |||
| 900 | Ga0157376_10000347 | |||
| 901 | Ga0163161_10000186 | |||
| 902 | Ga0163161_10141108 | |||
| 903 | Ga0163161_10291672 | |||
| 904 | Ga0213875_10000636 | |||
| 905 | Ga0207672_1000697 | |||
| 906 | Ga0207427_101139 | |||
| 907 | Ga0207425_1000005 | |||
| 908 | Ga0207425_1006746 | |||
| 909 | Ga0209026_1002495 | |||
| 910 | Ga0209148_1000059 | |||
| 911 | Ga0209148_1001763 | |||
| 912 | Ga0209129_1001455 | |||
| 913 | Ga0209233_1000003 | |||
| 914 | Ga0209233_1000044 | |||
| 915 | Ga0209565_1000007 | |||
| 916 | Ga0209565_1000850 | |||
| 917 | Ga0209455_1000441 | |||
| 918 | Ga0209673_1020200 | |||
| 919 | Ga0209675_1000169 | |||
| 920 | Ga0209676_1000651 | |||
| 921 | Ga0209676_1000807 | |||
| 922 | Ga0209676_1001585 | |||
| 923 | Ga0209025_1000477 | |||
| 924 | Ga0209564_1001268 | |||
| 925 | Ga0209758_1000002 | |||
| 926 | Ga0209758_1011899 | |||
| 927 | Ga0209758_1031388 | |||
| 928 | Ga0209050_1000001 | |||
| 929 | Ga0209050_1000071 | |||
| 930 | Ga0209050_1000213 | |||
| 931 | Ga0209050_1000310 | |||
| 932 | Ga0209050_1008043 | |||
| 933 | Ga0209050_1008987 | |||
| 934 | Ga0209050_1030615 | |||
| 935 | Ga0209256_1000008 | |||
| 936 | Ga0207426_1027626 | |||
| 937 | Ga0209051_1001344 | |||
| 938 | Ga0209257_1000027 | |||
| 939 | Ga0209257_1000113 | |||
| 940 | Ga0209257_1000379 | |||
| 941 | Ga0209257_1007892 | |||
| 942 | Ga0209257_1010573 | |||
| 943 | Ga0209257_1016155 | |||
| 944 | Ga0207697_10003661 | |||
| 945 | Ga0207656_10002058 | |||
| 946 | Ga0207713_1011606 | |||
| 947 | Ga0207680_10000007 | |||
| 948 | Ga0207680_10000156 | |||
| 949 | Ga0207680_10005149 | |||
| 950 | Ga0207647_10000331 | |||
| 951 | Ga0207647_10011632 | |||
| 952 | Ga0207647_10049086 | |||
| 953 | Ga0207647_10167426 | |||
| 954 | Ga0207645_10003000 | |||
| 955 | Ga0207705_10000049 | |||
| 956 | Ga0207705_10000119 | |||
| 957 | Ga0207705_10000903 | |||
| 958 | Ga0207654_10003712 | |||
| 959 | Ga0207654_10147313 | |||
| 960 | Ga0207695_10001498 | |||
| 961 | Ga0207695_10026123 | |||
| 962 | Ga0207695_10046078 | |||
| 963 | Ga0207695_10500326 | |||
| 964 | Ga0207671_10000350 | |||
| 965 | Ga0207671_10008206 | |||
| 966 | Ga0207671_10181417 | |||
| 967 | Ga0207671_10310283 | |||
| 968 | Ga0207657_10002725 | |||
| 969 | Ga0207657_10012434 | |||
| 970 | Ga0207657_10090251 | |||
| 971 | Ga0207657_10138610 | |||
| 972 | Ga0207657_10249241 | |||
| 973 | Ga0207649_10030267 | |||
| 974 | Ga0207649_10248496 | |||
| 975 | Ga0207652_10000474 | |||
| 976 | Ga0207646_10406157 | |||
| 977 | Ga0207681_10000003 | |||
| 978 | Ga0207681_10000030 | |||
| 979 | Ga0207681_10000074 | |||
| 980 | Ga0207681_10045472 | |||
| 981 | Ga0207694_10000447 | |||
| 982 | Ga0207694_10001241 | |||
| 983 | Ga0207694_10006090 | |||
| 984 | Ga0207694_10218710 | |||
| 985 | Ga0207694_10238348 | |||
| 986 | Ga0207650_10000148 | |||
| 987 | Ga0207650_10000881 | |||
| 988 | Ga0207650_10002923 | |||
| 989 | Ga0207650_10014952 | |||
| 990 | Ga0207659_10007115 | |||
| 991 | Ga0207687_10000398 | |||
| 992 | Ga0207687_10004652 | |||
| 993 | Ga0207644_10000017 | |||
| 994 | Ga0207644_10099083 | |||
| 995 | Ga0207644_10124038 | |||
| 996 | Ga0207690_10007558 | |||
| 997 | Ga0207690_10080051 | |||
| 998 | Ga0207706_10005888 | |||
| 999 | Ga0207706_10025357 | |||
| 1000 | Ga0207706_10074542 | |||
| 1001 | Ga0207706_10162268 | |||
| 1002 | Ga0207686_10004687 | |||
| 1003 | Ga0207709_10000182 | |||
| 1004 | Ga0207709_10116348 | |||
| 1005 | Ga0207709_10212105 | |||
| 1006 | Ga0207670_10003472 | |||
| 1007 | Ga0207669_10344153 | |||
| 1008 | Ga0207704_10000022 | |||
| 1009 | Ga0207691_10139295 | |||
| 1010 | Ga0207711_10000004 | |||
| 1011 | Ga0207711_10002922 | |||
| 1012 | Ga0207711_10005144 | |||
| 1013 | Ga0207711_10011639 | |||
| 1014 | Ga0207711_10014747 | |||
| 1015 | Ga0207711_10046174 | |||
| 1016 | Ga0207689_10000462 | |||
| 1017 | Ga0207679_10254262 | |||
| 1018 | Ga0207667_10000029 | |||
| 1019 | Ga0207667_10007493 | |||
| 1020 | Ga0207667_10029941 | |||
| 1021 | Ga0207667_10045311 | |||
| 1022 | Ga0207667_10071967 | |||
| 1023 | Ga0207667_10088029 | |||
| 1024 | Ga0207667_10242477 | |||
| 1025 | Ga0207651_10000009 | |||
| 1026 | Ga0207712_10000004 | |||
| 1027 | Ga0207712_10000161 | |||
| 1028 | Ga0207712_10008456 | |||
| 1029 | Ga0207712_10042111 | |||
| 1030 | Ga0207712_10122630 | |||
| 1031 | Ga0207712_10188646 | |||
| 1032 | Ga0207668_10000402 | |||
| 1033 | Ga0207668_10013769 | |||
| 1034 | Ga0207668_10042411 | |||
| 1035 | Ga0207640_10000021 | |||
| 1036 | Ga0207640_10010477 | |||
| 1037 | Ga0207640_10011320 | |||
| 1038 | Ga0207640_10022008 | |||
| 1039 | Ga0207640_10086651 | |||
| 1040 | Ga0207640_10111620 | |||
| 1041 | Ga0207658_10000232 | |||
| 1042 | Ga0207658_10000260 | |||
| 1043 | Ga0207658_10006186 | |||
| 1044 | Ga0207658_10075014 | |||
| 1045 | Ga0207677_10000164 | |||
| 1046 | Ga0207703_10000302 | |||
| 1047 | Ga0207703_10001367 | |||
| 1048 | Ga0207703_10003192 | |||
| 1049 | Ga0207703_10011288 | |||
| 1050 | Ga0207639_10001528 | |||
| 1051 | Ga0207639_10004891 | |||
| 1052 | Ga0207639_10006052 | |||
| 1053 | Ga0207639_10023517 | |||
| 1054 | Ga0207639_10030994 | |||
| 1055 | Ga0207678_10000968 | |||
| 1056 | Ga0207678_10028170 | |||
| 1057 | Ga0207678_10476231 | |||
| 1058 | Ga0207702_10000566 | |||
| 1059 | Ga0207702_10004819 | |||
| 1060 | Ga0207702_10010932 | |||
| 1061 | Ga0207702_10048296 | |||
| 1062 | Ga0207641_10000010 | |||
| 1063 | Ga0207641_10000192 | |||
| 1064 | Ga0207641_10002919 | |||
| 1065 | Ga0207648_10000084 | |||
| 1066 | Ga0207648_10165399 | |||
| 1067 | Ga0207676_10000009 | |||
| 1068 | Ga0207676_10000046 | |||
| 1069 | Ga0207676_10000344 | |||
| 1070 | Ga0207676_10001746 | |||
| 1071 | Ga0207676_10014815 | |||
| 1072 | Ga0207674_10004990 | |||
| 1073 | Ga0207674_10009750 | |||
| 1074 | Ga0207674_10013870 | |||
| 1075 | Ga0207674_10352514 | |||
| 1076 | Ga0207675_100000032 | |||
| 1077 | Ga0207675_100000221 | |||
| 1078 | Ga0207675_100000370 | |||
| 1079 | Ga0207675_100001422 | |||
| 1080 | Ga0207683_10002643 | |||
| 1081 | Ga0207698_10002388 | |||
| 1082 | Ga0207698_10009053 | |||
| 1083 | Ga0209974_10052915 | |||
| 1084 | Ga0268266_10000040 | |||
| 1085 | Ga0268266_10001644 | |||
| 1086 | Ga0268265_10000026 | |||
| 1087 | Ga0268265_10000030 | |||
| 1088 | Ga0268265_10000074 | |||
| 1089 | Ga0268264_10000003 | |||
| 1090 | Ga0268264_10000215 | |||
| 1091 | Ga0307517_10166810 | |||
| 1092 | Ga0307513_10306221 | |||
| 1093 | Ga0307408_100063682 | |||
| 1094 | Ga0307408_100171401 | |||
| 1095 | Ga0307508_10000011 | |||
| 1096 | Ga0307405_10007465 | |||
| 1097 | Ga0307405_10094393 | |||
| 1098 | Ga0307405_10111030 | |||
| 1099 | Ga0307405_10393568 | |||
| 1100 | Ga0307413_10063012 | |||
| 1101 | Ga0307413_10220761 | |||
| 1102 | Ga0307406_10004951 | |||
| 1103 | Ga0307406_10101684 | |||
| 1104 | Ga0307406_10262662 | |||
| 1105 | Ga0307407_10256243 | |||
| 1106 | Ga0307412_10000104 | |||
| 1107 | Ga0307412_10004076 | |||
| 1108 | Ga0307412_10008922 | |||
| 1109 | Ga0307412_10012503 | |||
| 1110 | Ga0307412_10026721 | |||
| 1111 | Ga0307412_10029631 | |||
| 1112 | Ga0307412_10170911 | |||
| 1113 | Ga0307409_100220897 | |||
| 1114 | Ga0307416_100008721 | |||
| 1115 | Ga0307416_100068377 | |||
| 1116 | Ga0307416_100102843 | |||
| 1117 | Ga0307414_10008100 | |||
| 1118 | Ga0307414_10024523 | |||
| 1119 | Ga0307414_10071331 | |||
| 1120 | Ga0307414_10084937 | |||
| 1121 | Ga0307414_10108351 | |||
| 1122 | Ga0307414_10121153 | |||
| 1123 | Ga0307414_10190797 | |||
| 1124 | Ga0307414_10199442 | |||
| 1125 | Ga0307411_10072538 | |||
| 1126 | Ga0307415_100242279 | |||
| 1127 | Ga0395899_0005461 | |||
| 1128 | Ga0395899_0062717 | |||
| 1129 | Ga0395900_0054489 | |||
| 1130 | Ga0395900_0100885 | |||
| 1131 | Ga0395900_0813956 | |||
| 1132 | Ga0395905_0091855 | |||
| 1133 | Ga0395905_0167588 | |||
| 1134 | Ga0395905_0429420 | |||
| 1135 | Ga0436364_0689048 | |||
| 1136 | Ga0395901_0025734 | |||
| 1137 | Ga0395901_0494653 | |||
| 1138 | Ga0237819_03296 | |||
| 1139 | Ga0237816_00927 | |||
| 1140 | Ga0436365_0019219 | |||
| 1141 | Ga0436363_0619851 | |||
| 1142 | Ga0439461_0007070 | |||
| 1143 | Ga0439466_0016932 | |||
| 1144 | Ga0439465_0000722 | |||
| 1145 | Ga0439465_0001868 | |||
| 1146 | Ga0451806_247531 | |||
| 1147 | Ga0451807_0951501 | |||
| 1148 | Ga0439431_0031503 | |||
| 1149 | Ga0439445_0004626 | |||
| 1150 | Ga0439448_0002822 | |||
| 1151 | Ga0439448_0003054 | |||
| 1152 | Ga0439448_0018091 | |||
| 1153 | Ga0439432_007156 | |||
| 1154 | Ga0439450_019171 | |||
| 1155 | Ga0439455_0002237 | |||
| 1156 | Ga0439455_0003114 | |||
| 1157 | Ga0439455_0020182 | |||
| 1158 | Ga0439455_0021524 | |||
| 1159 | Ga0439457_004596 | |||
| 1160 | Ga0439462_0000844 | |||
| 1161 | Ga0450923_042994 | |||
| 1162 | Ga0439458_0000069 | |||
| 1163 | Ga0439458_0002139 | |||
| 1164 | Ga0439434_0005415 | |||
| 1165 | Ga0466963_0122715 | |||
| 1166 | Ga0466964_0002062 | |||
| 1167 | Ga0466971_0006379 | |||
| 1168 | Ga0466968_0032144 | |||
| 1169 | Ga0466970_0232189 | |||
| 1170 | Ga0466957_0039253 | |||
| 1171 | Ga0466957_0287732 | |||
| 1172 | Ga0466960_0002581 | |||
| 1173 | Ga0466958_0048262 | |||
| 1174 | Ga0466967_0023868 | |||
| 1175 | Ga0495627_022728 | |||
| 1176 | Ga0495638_0000207 | |||
| 1177 | Ga0495638_0136534 | |||
| 1178 | Ga0495643_0125417 | |||
| 1179 | Ga0495648_0012030 | |||
| 1180 | Ga0495648_0065607 | |||
| 1181 | Ga0495648_0103581 | |||
| 1182 | Ga0495663_0008729 | |||
| 1183 | Ga0495663_0025926 | |||
| 1184 | Ga0495654_0001081 | |||
| 1185 | Ga0495654_0026577 | |||
| 1186 | Ga0495654_0058538 | |||
| 1187 | Ga0495598_0011454 | |||
| 1188 | Ga0495597_0010615 | |||
| 1189 | Ga0495597_0038861 | |||
| 1190 | Ga0495668_0000087 | |||
| 1191 | Ga0495668_0001796 | |||
| 1192 | Ga0495668_0016477 | |||
| 1193 | Ga0495625_0000275 | |||
| 1194 | Ga0495625_0001182 | |||
| 1195 | Ga0495625_0004756 | |||
| 1196 | Ga0495625_0130970 | |||
| 1197 | Ga0495625_0237433 | |||
| 1198 | Ga0495670_0000010 | |||
| 1199 | Ga0495670_0214983 | |||
| 1200 | Ga0495671_0015741 | |||
| 1201 | Ga0495649_0153721 | |||
| 1202 | Ga0495589_0038667 | |||
| 1203 | Ga0495687_067576 | |||
| 1204 | Ga0495681_0015143 | |||
| 1205 | Ga0495686_0000273 | |||
| 1206 | Ga0495686_0467578 | |||
| 1207 | Ga0496102_0010329 | |||
| 1208 | Ga0496102_0177499 | |||
| 1209 | Ga0496103_0001143 | |||
| 1210 | Ga0496103_0001152 | |||
| 1211 | Ga0496103_0035464 | |||
| 1212 | Ga0496104_0067408 | |||
| 1213 | Ga0496105_0077968 | |||
| 1214 | Ga0496108_0374900 | |||
| 1215 | Ga0496109_0017136 | |||
| 1216 | Ga0496115_0000325 | |||
| 1217 | Ga0496116_0003043 | |||
| 1218 | Ga0496116_0008247 | |||
| 1219 | Ga0496117_0002989 | |||
| 1220 | Ga0496117_0003452 | |||
| 1221 | Ga0496117_0007701 | |||
| 1222 | Ga0496117_0022717 | |||
| 1223 | Ga0496118_0001765 | |||
| 1224 | Ga0496118_0003875 | |||
| 1225 | Ga0496118_0029295 | |||
| 1226 | Ga0496118_0058166 | |||
| 1227 | Ga0496119_0032572 | |||
| 1228 | Ga0496119_0143416 | |||
| 1229 | Ga0496120_0036264 | |||
| 1230 | Ga0496121_0010236 | |||
| 1231 | Ga0496121_0170323 | |||
| 1232 | Ga0496121_0380243 | |||
| 1233 | Ga0496122_0001166 | |||
| 1234 | Ga0496122_0013706 | |||
| 1235 | Ga0496123_0000542 | |||
| 1236 | Ga0496123_0014602 | |||
| 1237 | Ga0496123_0017741 | |||
| 1238 | Ga0496123_0036942 | |||
| 1239 | Ga0496124_0003726 | |||
| 1240 | Ga0496124_0005643 | |||
| 1241 | Ga0496124_0007335 | |||
| 1242 | Ga0496124_0049758 | |||
| 1243 | Ga0496124_0272070 | |||
| 1244 | Ga0496125_0110184 | |||
| 1245 | Ga0496126_0084156 | |||
| 1246 | Ga0496126_0257002 | |||
| 1247 | Ga0496126_0559122 | |||
| 1248 | Ga0501290_000134 | |||
| 1249 | Ga0501292_000019 | |||
| 1250 | Ga0501300_007160 | |||
| 1251 | Ga0501031_0074400 | |||
| 1252 | Ga0501032_0017922 | |||
| 1253 | Ga0501033_0123213 | |||
| 1254 | Ga0501033_0127794 | |||
| 1255 | Ga0501033_0212457 | |||
| 1256 | Ga0501033_0249752 | |||
| 1257 | Ga0501034_0244326 | |||
| 1258 | Ga0501036_0028055 | |||
| 1259 | Ga0501037_0237802 | |||
| 1260 | Ga0501038_0016764 | |||
| 1261 | Ga0501038_0407101 | |||
| 1262 | Ga0501039_0223381 | |||
| 1263 | Ga0501043_0176864 | |||
| 1264 | Ga0501047_0220752 | |||
| 1265 | Ga0501047_0235122 | |||
| 1266 | Ga0501202_002837 | |||
| 1267 | Ga0501211_002397 | |||
| 1268 | Ga0501222_002037 | |||
| 1269 | Ga0501223_001879 | |||
| 1270 | Ga0501261_000135 | |||
| 1271 | Ga0501225_0008439 | |||
| 1272 | Ga0501241_002254 | |||
| 1273 | Ga0501279_000008 | |||
| 1274 | Ga0501280_000477 | |||
| 1275 | Ga0501281_00281 | |||
| 1276 | Ga0501282_001448 | |||
| 1277 | Ga0501035_0081680 | |||
| 1278 | Ga0501044_0112215 | |||
| 1279 | Ga0501044_0248689 | |||
| 1280 | Ga0501044_0504232 | |||
| 1281 | nmdc:mga0k408_132918_c1 | |||
| 1282 | nmdc:mga05p37_769977_c1 | |||
| 1283 | Ga0500643_000044 | |||
| 1284 | Ga0500643_000134 | |||
| 1285 | Ga0500643_000235 | |||
| 1286 | Ga0500643_008448 | |||
| 1287 | Ga0500643_011585 | |||
| 1288 | Ga0500643_019055 | |||
| 1289 | Ga0500643_041408 | |||
| 1290 | Ga0500644_0024112 | |||
| 1291 | Ga0500647_0022410 | |||
| 1292 | Ga0500651_0017952 | |||
| 1293 | Ga0500566_0000259 | |||
| 1294 | Ga0500641_0006588 | |||
| 1295 | Ga0500641_0139880 | |||
| 1296 | Ga0500555_021622 | |||
| 1297 | Ga0500556_0000053 | |||
| 1298 | Ga0500562_003971 | |||
| 1299 | Ga0500562_042123 | |||
| 1300 | Ga0500562_060412 | |||
| 1301 | Ga0500592_001009 | |||
| 1302 | Ga0500592_003096 | |||
| 1303 | Ga0500594_0008100 | |||
| 1304 | Ga0500595_003619 | |||
| 1305 | Ga0500608_018097 | |||
| 1306 | Ga0500614_009206 | |||
| 1307 | Ga0500642_0000001 | |||
| 1308 | Ga0500642_0002793 | |||
| 1309 | Ga0500655_000117 | |||
| 1310 | Ga0500658_0001115 | |||
| 1311 | Ga0500658_0001309 | |||
| 1312 | Ga0500658_0081370 | |||
| 1313 | Ga0500559_0003007 | |||
| 1314 | Ga0500559_0043212 | |||
| 1315 | Ga0500559_0066896 | |||
| 1316 | Ga0500568_0006304 | |||
| 1317 | Ga0500573_0000010 | |||
| 1318 | Ga0500577_0017129 | |||
| 1319 | Ga0500590_000141 | |||
| 1320 | Ga0500604_0020108 | |||
| 1321 | Ga0500624_000192 | |||
| 1322 | Ga0500627_0000009 | |||
| 1323 | Ga0500627_0000103 | |||
| 1324 | Ga0500627_0002011 | |||
| 1325 | Ga0500627_0006460 | |||
| 1326 | Ga0500627_0061889 | |||
| 1327 | Ga0500636_0008346 | |||
| 1328 | Ga0500570_003990 | |||
| 1329 | Ga0500645_000620 | |||
| 1330 | Ga0500645_000784 | |||
| 1331 | Ga0500596_007569 | |||
| 1332 | Ga0500661_000700 | |||
| 1333 | Ga0466962_0005832 | |||
| 1334 | 2585261120 | |||
| 1335 | 2600202240 | |||
| 1336 | 2600228375 | |||
| 1337 | 2643819110 | |||
| 1338 | 2643835021 | |||
| 1339 | 2644039004 | |||
| 1340 | 2644055948 | |||
| 1341 | 2644127726 | |||
| 1342 | 2753766155 | |||
| 1343 | 2819715171 | |||
| 1344 | 2852653616 | |||
| 1345 | 2852683115 | |||
| 1346 | 2879163945 | |||
| 1347 | 2885432176 | |||
| 1348 | 2928029435 | |||
| 1349 | 2928528090 | |||
| 1350 | 2928971405 | |||
| 1351 | 2984556633 | |||
| 1352 | 2984565194 | |||
| 1353 | 2990268514 | |||
| 1354 | 2993356270 | |||
| 1355 | 2993696451 | |||
| 1356 | 3000867821 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4n81-assembly1.cif.gz_A-2 | another flexible region at the active site of an inositol monophosphatase from zymomonas mobilis | 0.9444 | 1 | 254 |
| 4n81-assembly1.cif.gz_A-2 | another flexible region at the active site of an inositol monophosphatase from zymomonas mobilis | 0.9306 | 1 | 254 |
| 3lv0-assembly1.cif.gz_A | crystal structure of extragenic suppressor protein suhb from bartonella henselae, native | 0.9254 | 5 | 257 |
| 5zhh-assembly1.cif.gz_C | structure of inositol monophosphatase from anabaena (nostoc) sp. pcc 7120 | 0.9215 | 4 | 256 |
| 3lv0-assembly1.cif.gz_B | crystal structure of extragenic suppressor protein suhb from bartonella henselae, native | 0.9207 | 8 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4n81A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9964 | 141 | 254 | 3.40.190.80 |
| 4n81A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9627 | 141 | 254 | 3.40.190.80 |
| 5zhhC01 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.9534 | 4 | 139 | 3.30.540.10 |
| 3lv0B01 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.9332 | 8 | 138 | 3.30.540.10 |
| 2p3nA01 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.9248 | 5 | 139 | 3.30.540.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N8W0T6-F1-model_v4 | Histidinol-phosphatase (EC 3.1.3.15) | 0.9823 | 4 | 254 |
GO:0000105
GO:0004401 GO:0046872 |
| AF-S9S542-F1-model_v4 | Histidinol-phosphatase (EC 3.1.3.15) | 0.9818 | 5 | 255 |
GO:0000105
GO:0004401 GO:0046872 |
| AF-A0A2S6SCM8-F1-model_v4 | Fructose-1, 6-bisphosphatase/inositol-1-monophosphatase (EC 3.1.3.11) | 0.9786 | 4 | 256 |
GO:0000105
GO:0042132 GO:0046872 |
| AF-A0A2E3XDE0-F1-model_v4 | Histidinol-phosphatase (EC 3.1.3.15) | 0.9782 | 4 | 255 |
GO:0000105
GO:0004401 GO:0046872 |
| AF-A0A7V8F882-F1-model_v4 | Histidinol-phosphatase (EC 3.1.3.15) | 0.9775 | 4 | 256 |
GO:0000105
GO:0004401 GO:0046872 |