F474626

General Info

Members Datasets Scaffolds Average Seq Length
678 348 1356 258

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10120400|Ga0065704_101204003
Length 303
Sequence MRRRGRRQGSTNCYGIKARPADDCGKRIEGLAVRTCASNDATMTDDDIQLAQRLADAAGAAIRPFFRASYTTEIKGDASPVTEADRAAEAAIRAILEAERPGDGIIGEEYGIVREGASRRWVLDPIDGTRSFITGRPIFGTLIALIEETTPVLGIIDQPILRERWLGAAGQGTTFNGLRCRTRPCSELGEAHVGTTSPGLFDPDDKERFEAVATACSNTVWGGDCYSYAMVALGQLDIVIESGLKLYDFAALVPVVEGAGGRMCDWRGNPLGSNSEGHVIAAGDPALISAILERLGKASHSEL

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
114 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
115 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
204 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
208 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
209 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
210 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
211 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
212 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
213 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
214 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
215 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
216 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
217 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
218 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
219 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
220 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
221 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
222 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
225 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
226 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
227 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
236 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
237 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
238 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
239 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
244 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
245 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
268 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
269 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
281 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
282 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
283 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
284 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
285 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
286 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
287 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
288 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
289 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
290 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
296 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
297 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
298 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
299 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
300 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
301 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
302 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
303 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
304 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
305 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
306 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
307 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
308 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
309 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
310 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
311 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
312 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
313 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
314 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
315 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
316 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
317 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
318 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
319 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
320 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
321 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
322 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
323 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
324 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
325 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
326 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
327 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
328 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
329 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
330 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
331 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
332 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
333 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
334 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
335 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
336 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
337 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
338 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
339 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
340 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
341 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
342 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
343 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
344 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
345 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
346 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
347 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
348 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.61
Metatranscriptomes 0
Isolates 3.39

Biome Distribution

Category Percentage (%)
Aerial Root 0.74
Bulb 0
Endosphere 15.63
Nodule 0
Rhizoplane 2.06
Rhizosphere 73.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10120400 3300005289 Bacteria 1783
2 JGI24741J21665_1002093 3300001915 Bacteria 5328
3 JGI24740J21852_10001545 3300001979 Bacteria 10596
4 JGI24739J22299_10007692 3300001989 Bacteria 4031
5 JGI24739J22299_10012970 3300001989 Bacteria 3050
6 JGI24739J22299_10033187 3300001989 Bacteria 1769
7 JGI24737J22298_10001850 3300001990 Bacteria 7568
8 JGI24737J22298_10018216 3300001990 Bacteria 2255
9 JGI24735J21928_10002160 3300002067 Bacteria 6904
10 JGI24735J21928_10002466 3300002067 Bacteria 6428
11 JGI24750J21931_1016035 3300002070 Bacteria 1015
12 JGI24748J21848_1000053 3300002074 Bacteria 50665
13 JGI24738J21930_10002840 3300002075 Bacteria 4438
14 JGI24749J21850_1000019 3300002076 Bacteria 32251
15 JGI24749J21850_1000152 3300002076 Bacteria 11101
16 JGI24034J26672_10000036 3300002239 Bacteria 84333
17 JGI24751J29686_10000519 3300002459 Bacteria 11120
18 JGI25151J46595_10006038 3300003187 Bacteria 6165
19 JGI25165J46597_1000106 3300003214 Bacteria 151139
20 JGI25153J46596_10000073 3300003215 Bacteria 115166
21 rootH2_10015355 3300003320 Bacteria 1252
22 rootL2_10226620 3300003322 Bacteria 1244
23 rootH1_10214361 3300003323 Bacteria 1470
24 Ga0055526_1008485 3300003771 Bacteria 5122
25 Ga0055537_1001577 3300003773 Bacteria 8661
26 Ga0055537_1004584 3300003773 Bacteria 3919
27 Ga0055524_1004959 3300003775 Bacteria 6033
28 Ga0055536_1003303 3300003781 Bacteria 8727
29 Ga0055536_1016127 3300003781 Bacteria 2516
30 Ga0055530_10000919 3300003791 Bacteria 24154
31 Ga0055540_1001791 3300003792 Bacteria 12220
32 Ga0055531_10000727 3300003794 Bacteria 27870
33 Ga0055531_10002471 3300003794 Bacteria 12332
34 Ga0055531_10003687 3300003794 Bacteria 9647
35 Ga0055531_10007054 3300003794 Bacteria 6217
36 Ga0065165_1014363 3300005262 Bacteria 3080
37 Ga0065707_10081960 3300005295 Bacteria 27438
38 Ga0065707_10084228 3300005295 Bacteria 7485
39 Ga0070658_10005193 3300005327 Bacteria 10592
40 Ga0070658_10005573 3300005327 Bacteria 10214
41 Ga0070658_10031587 3300005327 Bacteria 4253
42 Ga0070658_10310037 3300005327 Bacteria 1346
43 Ga0070676_10001299 3300005328 Bacteria 12568
44 Ga0070690_100000093 3300005330 Bacteria 44990
45 Ga0070670_100000060 3300005331 Bacteria 113477
46 Ga0070670_100000202 3300005331 Bacteria 55420
47 Ga0070670_100012257 3300005331 Bacteria 7335
48 Ga0068869_100000134 3300005334 Bacteria 35796
49 Ga0070666_10000009 3300005335 Bacteria 279209
50 Ga0070666_10000476 3300005335 Bacteria 24221
51 Ga0068868_100000596 3300005338 Bacteria 24264
52 Ga0070660_100033451 3300005339 Bacteria 3876
53 Ga0070660_100073908 3300005339 Bacteria 2666
54 Ga0070689_100012983 3300005340 Bacteria 6018
55 Ga0070661_100042425 3300005344 Bacteria 3320
56 Ga0070668_100054655 3300005347 Bacteria 3080
57 Ga0070668_100067396 3300005347 Bacteria 2780
58 Ga0070669_100000053 3300005353 Bacteria 113601
59 Ga0070669_100000096 3300005353 Bacteria 86930
60 Ga0070669_100000103 3300005353 Bacteria 81387
61 Ga0070669_100299079 3300005353 Bacteria 1294
62 Ga0070675_100013296 3300005354 Bacteria 6468
63 Ga0070671_100000045 3300005355 Bacteria 85779
64 Ga0070671_100340534 3300005355 Bacteria 1279
65 Ga0070671_100398326 3300005355 Bacteria 1177
66 Ga0070674_100087507 3300005356 Bacteria 2240
67 Ga0070673_100000004 3300005364 Bacteria 199809
68 Ga0070688_100002603 3300005365 Bacteria 9152
69 Ga0070659_100024801 3300005366 Bacteria 4600
70 Ga0070659_100078374 3300005366 Bacteria 2636
71 Ga0070659_100116264 3300005366 Bacteria 2162
72 Ga0070667_100001658 3300005367 Bacteria 19885
73 Ga0070667_100004131 3300005367 Bacteria 12272
74 Ga0070667_100007570 3300005367 Bacteria 9011
75 Ga0070667_100425227 3300005367 Bacteria 1211
76 Ga0070708_100292320 3300005445 Bacteria 1534
77 Ga0070663_100103577 3300005455 Bacteria 2127
78 Ga0070678_100012107 3300005456 Bacteria 5348
79 Ga0070662_100049945 3300005457 Bacteria 3017
80 Ga0070662_100101113 3300005457 Bacteria 2182
81 Ga0070681_10429176 3300005458 Bacteria 1234
82 Ga0068867_100000028 3300005459 Bacteria 87716
83 Ga0068867_100034485 3300005459 Bacteria 3668
84 Ga0070685_10000076 3300005466 Bacteria 59090
85 Ga0070707_100462071 3300005468 Bacteria 1230
86 Ga0070679_100209119 3300005530 Bacteria 1915
87 Ga0068853_100022149 3300005539 Bacteria 5303
88 Ga0068853_100076589 3300005539 Bacteria 2921
89 Ga0068853_100139907 3300005539 Bacteria 2172
90 Ga0070672_100021658 3300005543 Bacteria 4708
91 Ga0070686_100000018 3300005544 Bacteria 140685
92 Ga0070665_100000071 3300005548 Bacteria 200675
93 Ga0070665_100000849 3300005548 Bacteria 39827
94 Ga0068855_100003904 3300005563 Bacteria 18210
95 Ga0068855_100052461 3300005563 Bacteria 4801
96 Ga0068855_100117567 3300005563 Bacteria 3046
97 Ga0068855_100160648 3300005563 Bacteria 2551
98 Ga0070664_100138478 3300005564 Bacteria 2141
99 Ga0068857_100008705 3300005577 Bacteria 8784
100 Ga0068857_100237878 3300005577 Bacteria 1667
101 Ga0068854_100000881 3300005578 Bacteria 18023
102 Ga0068854_100014919 3300005578 Bacteria 5131
103 Ga0068854_100098220 3300005578 Bacteria 2191
104 Ga0068854_100110532 3300005578 Bacteria 2072
105 Ga0068856_100058850 3300005614 Bacteria 3795
106 Ga0068852_100007489 3300005616 Bacteria 7968
107 Ga0068852_100156634 3300005616 Bacteria 2122
108 Ga0068852_100277914 3300005616 Bacteria 1613
109 Ga0068852_100588814 3300005616 Bacteria 1116
110 Ga0068859_100000162 3300005617 Bacteria 65033
111 Ga0068859_100000623 3300005617 Bacteria 35426
112 Ga0068859_100006620 3300005617 Bacteria 11765
113 Ga0068859_100008763 3300005617 Bacteria 10215
114 Ga0068859_100135635 3300005617 Bacteria 2534
115 Ga0068859_100672187 3300005617 Bacteria 1127
116 Ga0068864_100000069 3300005618 Bacteria 114134
117 Ga0068864_100000194 3300005618 Bacteria 55652
118 Ga0068864_100000677 3300005618 Bacteria 28506
119 Ga0068864_100007703 3300005618 Bacteria 8869
120 Ga0068861_100000004 3300005719 Bacteria 105907
121 Ga0068861_100003501 3300005719 Bacteria 10427
122 Ga0068861_100004343 3300005719 Bacteria 9511
123 Ga0068851_10038155 3300005834 Bacteria 2409
124 Ga0068863_100000258 3300005841 Bacteria 55428
125 Ga0068863_100000784 3300005841 Bacteria 31931
126 Ga0068863_100004697 3300005841 Bacteria 13461
127 Ga0068858_100001692 3300005842 Bacteria 22551
128 Ga0068858_100002738 3300005842 Bacteria 17727
129 Ga0068858_100004410 3300005842 Bacteria 13808
130 Ga0068858_100017431 3300005842 Bacteria 6735
131 Ga0068860_100000022 3300005843 Bacteria 279209
132 Ga0068860_100004945 3300005843 Bacteria 13583
133 Ga0068862_100000082 3300005844 Bacteria 113125
134 Ga0068862_100000289 3300005844 Bacteria 55428
135 Ga0068862_100001387 3300005844 Bacteria 22482
136 Ga0075366_10321598 3300006195 Bacteria 948
137 Ga0097621_100004543 3300006237 Bacteria 9677
138 Ga0075370_10005832 3300006353 Bacteria 6152
139 Ga0068871_100031338 3300006358 Bacteria 4193
140 Ga0068865_100000006 3300006881 Bacteria 201186
141 Ga0097620_100000162 3300006931 Bacteria 65033
142 Ga0097620_100000623 3300006931 Bacteria 35426
143 Ga0097620_100006621 3300006931 Bacteria 11765
144 Ga0097620_100008763 3300006931 Bacteria 10215
145 Ga0097620_100135635 3300006931 Bacteria 2534
146 Ga0097620_100672254 3300006931 Bacteria 1127
147 Ga0099794_10059802 3300007265 Bacteria 1849
148 Ga0105251_10000815 3300009011 Bacteria 28051
149 Ga0105240_10037440 3300009093 Bacteria 6235
150 Ga0105240_10103626 3300009093 Bacteria 3456
151 Ga0105240_10363867 3300009093 Bacteria 1637
152 Ga0105240_10569847 3300009093 Bacteria 1250
153 Ga0105245_10001073 3300009098 Bacteria 24782
154 Ga0105247_10005540 3300009101 Bacteria 7940
155 Ga0105247_10014575 3300009101 Bacteria 4715
156 Ga0114129_10224777 3300009147 Bacteria 2531
157 Ga0105243_10001033 3300009148 Bacteria 25571
158 Ga0105243_10266655 3300009148 Bacteria 1536
159 Ga0105243_10361067 3300009148 Bacteria 1337
160 Ga0105241_10006361 3300009174 Bacteria 8705
161 Ga0105242_10000413 3300009176 Bacteria 34034
162 Ga0105248_10000012 3300009177 Bacteria 333963
163 Ga0105248_10000101 3300009177 Bacteria 95328
164 Ga0105248_10001646 3300009177 Bacteria 24849
165 Ga0105248_10004784 3300009177 Bacteria 14984
166 Ga0105248_10017707 3300009177 Bacteria 7859
167 Ga0105248_10059784 3300009177 Bacteria 4281
168 Ga0105237_10010466 3300009545 Bacteria 9859
169 Ga0105237_10123855 3300009545 Bacteria 2580
170 Ga0105237_10146187 3300009545 Bacteria 2359
171 Ga0105237_10171493 3300009545 Bacteria 2170
172 Ga0105238_10002527 3300009551 Bacteria 18281
173 Ga0105238_10009256 3300009551 Bacteria 9859
174 Ga0105238_10230820 3300009551 Bacteria 1827
175 Ga0105238_10272150 3300009551 Bacteria 1674
176 Ga0105238_10289467 3300009551 Bacteria 1620
177 Ga0105249_10000014 3300009553 Bacteria 283274
178 Ga0105249_10000099 3300009553 Bacteria 119885
179 Ga0105249_10001061 3300009553 Bacteria 24372
180 Ga0105249_10019332 3300009553 Bacteria 6076
181 Ga0105249_10116554 3300009553 Bacteria 2532
182 Ga0105249_10134027 3300009553 Bacteria 2368
183 Ga0105148_100047 3300009978 Bacteria 18470
184 Ga0105239_10100169 3300010375 Bacteria 3205
185 Ga0105239_10143818 3300010375 Bacteria 2658
186 Ga0105239_10384193 3300010375 Bacteria 1588
187 Ga0105239_10388784 3300010375 Bacteria 1578
188 Ga0105246_10002567 3300011119 Bacteria 10983
189 Ga0157373_10007108 3300013100 Bacteria 8344
190 Ga0157373_10229264 3300013100 Bacteria 1311
191 Ga0157370_10000318 3300013104 Bacteria 60585
192 Ga0157370_10080000 3300013104 Bacteria 3077
193 Ga0157370_10145369 3300013104 Bacteria 2208
194 Ga0157369_10033426 3300013105 Bacteria 5652
195 Ga0157369_10070181 3300013105 Bacteria 3764
196 Ga0157369_10540344 3300013105 Bacteria 1205
197 Ga0157374_10004031 3300013296 Bacteria 12342
198 Ga0157378_10001466 3300013297 Bacteria 21299
199 Ga0157378_10057283 3300013297 Bacteria 3473
200 Ga0157378_10077367 3300013297 Bacteria 2999
201 Ga0163162_10000823 3300013306 Bacteria 28858
202 Ga0163162_10001988 3300013306 Bacteria 19218
203 Ga0163162_10004881 3300013306 Bacteria 12932
204 Ga0163162_10392935 3300013306 Bacteria 1519
205 Ga0157372_10136792 3300013307 Bacteria 2822
206 Ga0157372_10172816 3300013307 Bacteria 2500
207 Ga0157372_10367567 3300013307 Bacteria 1676
208 Ga0157372_11233414 3300013307 Bacteria 864
209 Ga0157375_10000586 3300013308 Bacteria 32467
210 Ga0163163_10048705 3300014325 Bacteria 4168
211 Ga0163163_10145827 3300014325 Bacteria 2411
212 Ga0163163_10301890 3300014325 Bacteria 1653
213 Ga0163163_10382115 3300014325 Bacteria 1466
214 Ga0157380_10000681 3300014326 Bacteria 21070
215 Ga0157380_10000793 3300014326 Bacteria 19836
216 Ga0157380_10003492 3300014326 Bacteria 10795
217 Ga0157380_10120630 3300014326 Bacteria 2220
218 Ga0157377_10003736 3300014745 Bacteria 6905
219 Ga0157379_10014310 3300014968 Bacteria 6960
220 Ga0157379_10034191 3300014968 Bacteria 4530
221 Ga0157379_10043366 3300014968 Bacteria 4016
222 Ga0157376_10000347 3300014969 Bacteria 30895
223 Ga0163161_10000186 3300017792 Bacteria 57200
224 Ga0163161_10141108 3300017792 Bacteria 1825
225 Ga0163161_10291672 3300017792 Bacteria 1282
226 Ga0213875_10000636 3300021388 Bacteria 28040
227 Ga0207672_1000697 3300025223 Bacteria 3837
228 Ga0207427_101139 3300025231 Bacteria 10522
229 Ga0207425_1000005 3300025245 Bacteria 900502
230 Ga0207425_1006746 3300025245 Bacteria 3105
231 Ga0209026_1002495 3300025250 Bacteria 6836
232 Ga0209148_1000059 3300025254 Bacteria 350224
233 Ga0209148_1001763 3300025254 Bacteria 9326
234 Ga0209129_1001455 3300025258 Bacteria 13206
235 Ga0209233_1000003 3300025261 Bacteria 1607366
236 Ga0209233_1000044 3300025261 Bacteria 489783
237 Ga0209565_1000007 3300025263 Bacteria 784361
238 Ga0209565_1000850 3300025263 Bacteria 17233
239 Ga0209455_1000441 3300025272 Bacteria 32004
240 Ga0209673_1020200 3300025273 Bacteria 2366
241 Ga0209675_1000169 3300025291 Bacteria 78355
242 Ga0209676_1000651 3300025292 Bacteria 49756
243 Ga0209676_1000807 3300025292 Bacteria 41068
244 Ga0209676_1001585 3300025292 Bacteria 20263
245 Ga0209025_1000477 3300025294 Bacteria 77692
246 Ga0209564_1001268 3300025295 Bacteria 27785
247 Ga0209758_1000002 3300025297 Bacteria 1400310
248 Ga0209758_1011899 3300025297 Bacteria 4957
249 Ga0209758_1031388 3300025297 Bacteria 2180
250 Ga0209050_1000001 3300025298 Bacteria 3563507
251 Ga0209050_1000071 3300025298 Bacteria 295478
252 Ga0209050_1000213 3300025298 Bacteria 129359
253 Ga0209050_1000310 3300025298 Bacteria 99292
254 Ga0209050_1008043 3300025298 Bacteria 5736
255 Ga0209050_1008987 3300025298 Bacteria 5207
256 Ga0209050_1030615 3300025298 Bacteria 1696
257 Ga0209256_1000008 3300025299 Bacteria 975723
258 Ga0207426_1027626 3300025302 Bacteria 1889
259 Ga0209051_1001344 3300025303 Bacteria 21373
260 Ga0209257_1000027 3300025304 Bacteria 703541
261 Ga0209257_1000113 3300025304 Bacteria 233523
262 Ga0209257_1000379 3300025304 Bacteria 88845
263 Ga0209257_1007892 3300025304 Bacteria 6260
264 Ga0209257_1010573 3300025304 Bacteria 4638
265 Ga0209257_1016155 3300025304 Bacteria 3043
266 Ga0207697_10003661 3300025315 Bacteria 7528
267 Ga0207656_10002058 3300025321 Bacteria 6719
268 Ga0207713_1011606 3300025735 Bacteria 4771
269 Ga0207680_10000007 3300025903 Bacteria 623574
270 Ga0207680_10000156 3300025903 Bacteria 33323
271 Ga0207680_10005149 3300025903 Bacteria 6239
272 Ga0207647_10000331 3300025904 Bacteria 38861
273 Ga0207647_10011632 3300025904 Bacteria 6163
274 Ga0207647_10049086 3300025904 Bacteria 2619
275 Ga0207647_10167426 3300025904 Bacteria 1280
276 Ga0207645_10003000 3300025907 Bacteria 13042
277 Ga0207705_10000049 3300025909 Bacteria 170616
278 Ga0207705_10000119 3300025909 Bacteria 88108
279 Ga0207705_10000903 3300025909 Bacteria 24279
280 Ga0207654_10003712 3300025911 Bacteria 7705
281 Ga0207654_10147313 3300025911 Bacteria 1508
282 Ga0207695_10001498 3300025913 Bacteria 38870
283 Ga0207695_10026123 3300025913 Bacteria 6521
284 Ga0207695_10046078 3300025913 Bacteria 4623
285 Ga0207695_10500326 3300025913 Bacteria 1097
286 Ga0207671_10000350 3300025914 Bacteria 66648
287 Ga0207671_10008206 3300025914 Bacteria 8898
288 Ga0207671_10181417 3300025914 Bacteria 1638
289 Ga0207671_10310283 3300025914 Bacteria 1247
290 Ga0207657_10002725 3300025919 Bacteria 19022
291 Ga0207657_10012434 3300025919 Bacteria 8408
292 Ga0207657_10090251 3300025919 Bacteria 2558
293 Ga0207657_10138610 3300025919 Bacteria 1989
294 Ga0207657_10249241 3300025919 Bacteria 1416
295 Ga0207649_10030267 3300025920 Bacteria 3205
296 Ga0207649_10248496 3300025920 Bacteria 1280
297 Ga0207652_10000474 3300025921 Bacteria 41182
298 Ga0207646_10406157 3300025922 Bacteria 1230
299 Ga0207681_10000003 3300025923 Bacteria 713245
300 Ga0207681_10000030 3300025923 Bacteria 173766
301 Ga0207681_10000074 3300025923 Bacteria 89861
302 Ga0207681_10045472 3300025923 Bacteria 2948
303 Ga0207694_10000447 3300025924 Bacteria 38252
304 Ga0207694_10001241 3300025924 Bacteria 22055
305 Ga0207694_10006090 3300025924 Bacteria 9221
306 Ga0207694_10218710 3300025924 Bacteria 1553
307 Ga0207694_10238348 3300025924 Bacteria 1486
308 Ga0207650_10000148 3300025925 Bacteria 85425
309 Ga0207650_10000881 3300025925 Bacteria 22724
310 Ga0207650_10002923 3300025925 Bacteria 11787
311 Ga0207650_10014952 3300025925 Bacteria 5399
312 Ga0207659_10007115 3300025926 Bacteria 6870
313 Ga0207687_10000398 3300025927 Bacteria 29475
314 Ga0207687_10004652 3300025927 Bacteria 9130
315 Ga0207644_10000017 3300025931 Bacteria 177818
316 Ga0207644_10099083 3300025931 Bacteria 2186
317 Ga0207644_10124038 3300025931 Bacteria 1969
318 Ga0207690_10007558 3300025932 Bacteria 6451
319 Ga0207690_10080051 3300025932 Bacteria 2279
320 Ga0207706_10005888 3300025933 Bacteria 11401
321 Ga0207706_10025357 3300025933 Bacteria 5313
322 Ga0207706_10074542 3300025933 Bacteria 2984
323 Ga0207706_10162268 3300025933 Bacteria 1964
324 Ga0207686_10004687 3300025934 Bacteria 7329
325 Ga0207709_10000182 3300025935 Bacteria 83442
326 Ga0207709_10116348 3300025935 Bacteria 1797
327 Ga0207709_10212105 3300025935 Bacteria 1391
328 Ga0207670_10003472 3300025936 Bacteria 8361
329 Ga0207669_10344153 3300025937 Bacteria 1149
330 Ga0207704_10000022 3300025938 Bacteria 146109
331 Ga0207691_10139295 3300025940 Bacteria 2139
332 Ga0207711_10000004 3300025941 Bacteria 870636
333 Ga0207711_10002922 3300025941 Bacteria 14984
334 Ga0207711_10005144 3300025941 Bacteria 11089
335 Ga0207711_10011639 3300025941 Bacteria 7310
336 Ga0207711_10014747 3300025941 Bacteria 6494
337 Ga0207711_10046174 3300025941 Bacteria 3721
338 Ga0207689_10000462 3300025942 Bacteria 38064
339 Ga0207679_10254262 3300025945 Bacteria 1495
340 Ga0207667_10000029 3300025949 Bacteria 329192
341 Ga0207667_10007493 3300025949 Bacteria 13099
342 Ga0207667_10029941 3300025949 Bacteria 5897
343 Ga0207667_10045311 3300025949 Bacteria 4659
344 Ga0207667_10071967 3300025949 Bacteria 3594
345 Ga0207667_10088029 3300025949 Bacteria 3212
346 Ga0207667_10242477 3300025949 Bacteria 1844
347 Ga0207651_10000009 3300025960 Bacteria 199913
348 Ga0207712_10000004 3300025961 Bacteria 614655
349 Ga0207712_10000161 3300025961 Bacteria 69260
350 Ga0207712_10008456 3300025961 Bacteria 6505
351 Ga0207712_10042111 3300025961 Bacteria 3143
352 Ga0207712_10122630 3300025961 Bacteria 1968
353 Ga0207712_10188646 3300025961 Bacteria 1626
354 Ga0207668_10000402 3300025972 Bacteria 27270
355 Ga0207668_10013769 3300025972 Bacteria 4991
356 Ga0207668_10042411 3300025972 Bacteria 3081
357 Ga0207640_10000021 3300025981 Bacteria 168138
358 Ga0207640_10010477 3300025981 Bacteria 5222
359 Ga0207640_10011320 3300025981 Bacteria 5047
360 Ga0207640_10022008 3300025981 Bacteria 3809
361 Ga0207640_10086651 3300025981 Bacteria 2157
362 Ga0207640_10111620 3300025981 Bacteria 1939
363 Ga0207658_10000232 3300025986 Bacteria 58908
364 Ga0207658_10000260 3300025986 Bacteria 55292
365 Ga0207658_10006186 3300025986 Bacteria 8173
366 Ga0207658_10075014 3300025986 Bacteria 2571
367 Ga0207677_10000164 3300026023 Bacteria 52688
368 Ga0207703_10000302 3300026035 Bacteria 54142
369 Ga0207703_10001367 3300026035 Bacteria 22279
370 Ga0207703_10003192 3300026035 Bacteria 13798
371 Ga0207703_10011288 3300026035 Bacteria 6948
372 Ga0207639_10001528 3300026041 Bacteria 15547
373 Ga0207639_10004891 3300026041 Bacteria 9023
374 Ga0207639_10006052 3300026041 Bacteria 8210
375 Ga0207639_10023517 3300026041 Bacteria 4451
376 Ga0207639_10030994 3300026041 Bacteria 3927
377 Ga0207678_10000968 3300026067 Bacteria 26254
378 Ga0207678_10028170 3300026067 Bacteria 4905
379 Ga0207678_10476231 3300026067 Bacteria 1087
380 Ga0207702_10000566 3300026078 Bacteria 41185
381 Ga0207702_10004819 3300026078 Bacteria 11892
382 Ga0207702_10010932 3300026078 Bacteria 7571
383 Ga0207702_10048296 3300026078 Bacteria 3589
384 Ga0207641_10000010 3300026088 Bacteria 402193
385 Ga0207641_10000192 3300026088 Bacteria 83746
386 Ga0207641_10002919 3300026088 Bacteria 15481
387 Ga0207648_10000084 3300026089 Bacteria 88578
388 Ga0207648_10165399 3300026089 Bacteria 1954
389 Ga0207676_10000009 3300026095 Bacteria 545256
390 Ga0207676_10000046 3300026095 Bacteria 149037
391 Ga0207676_10000344 3300026095 Bacteria 39948
392 Ga0207676_10001746 3300026095 Bacteria 15973
393 Ga0207676_10014815 3300026095 Bacteria 5617
394 Ga0207674_10004990 3300026116 Bacteria 15863
395 Ga0207674_10009750 3300026116 Bacteria 10940
396 Ga0207674_10013870 3300026116 Bacteria 8916
397 Ga0207674_10352514 3300026116 Bacteria 1423
398 Ga0207675_100000032 3300026118 Bacteria 108677
399 Ga0207675_100000221 3300026118 Bacteria 53325
400 Ga0207675_100000370 3300026118 Bacteria 43070
401 Ga0207675_100001422 3300026118 Bacteria 23981
402 Ga0207683_10002643 3300026121 Bacteria 15651
403 Ga0207698_10002388 3300026142 Bacteria 11114
404 Ga0207698_10009053 3300026142 Bacteria 6323
405 Ga0209974_10052915 3300027876 Bacteria 1367
406 Ga0268266_10000040 3300028379 Bacteria 323843
407 Ga0268266_10001644 3300028379 Bacteria 25899
408 Ga0268265_10000026 3300028380 Bacteria 246653
409 Ga0268265_10000030 3300028380 Bacteria 228157
410 Ga0268265_10000074 3300028380 Bacteria 127599
411 Ga0268264_10000003 3300028381 Bacteria 1141976
412 Ga0268264_10000215 3300028381 Bacteria 113994
413 Ga0307517_10166810 3300028786 Bacteria 1460
414 Ga0307513_10306221 3300031456 Bacteria 1353
415 Ga0307408_100063682 3300031548 Bacteria 2698
416 Ga0307408_100171401 3300031548 Bacteria 1733
417 Ga0307508_10000011 3300031616 Bacteria 248001
418 Ga0307405_10007465 3300031731 Bacteria 5472
419 Ga0307405_10094393 3300031731 Bacteria 1989
420 Ga0307405_10111030 3300031731 Bacteria 1857
421 Ga0307405_10393568 3300031731 Bacteria 1082
422 Ga0307413_10063012 3300031824 Bacteria 2297
423 Ga0307413_10220761 3300031824 Bacteria 1384
424 Ga0307406_10004951 3300031901 Bacteria 7260
425 Ga0307406_10101684 3300031901 Bacteria 1959
426 Ga0307406_10262662 3300031901 Bacteria 1307
427 Ga0307407_10256243 3300031903 Bacteria 1201
428 Ga0307412_10000104 3300031911 Bacteria 67823
429 Ga0307412_10004076 3300031911 Bacteria 8138
430 Ga0307412_10008922 3300031911 Bacteria 5742
431 Ga0307412_10012503 3300031911 Bacteria 4952
432 Ga0307412_10026721 3300031911 Bacteria 3591
433 Ga0307412_10029631 3300031911 Bacteria 3437
434 Ga0307412_10170911 3300031911 Bacteria 1625
435 Ga0307409_100220897 3300031995 Bacteria 1710
436 Ga0307416_100008721 3300032002 Bacteria 6568
437 Ga0307416_100068377 3300032002 Bacteria 2935
438 Ga0307416_100102843 3300032002 Bacteria 2492
439 Ga0307414_10008100 3300032004 Bacteria 5937
440 Ga0307414_10024523 3300032004 Bacteria 3848
441 Ga0307414_10071331 3300032004 Bacteria 2505
442 Ga0307414_10084937 3300032004 Bacteria 2330
443 Ga0307414_10108351 3300032004 Bacteria 2107
444 Ga0307414_10121153 3300032004 Bacteria 2011
445 Ga0307414_10190797 3300032004 Bacteria 1658
446 Ga0307414_10199442 3300032004 Bacteria 1626
447 Ga0307411_10072538 3300032005 Bacteria 2338
448 Ga0307415_100242279 3300032126 Bacteria 1459
449 Ga0395899_0005461 3300037312 Bacteria 9859
450 Ga0395899_0062717 3300037312 Bacteria 2737
451 Ga0395900_0054489 3300037418 Bacteria 4118
452 Ga0395900_0100885 3300037418 Bacteria 2965
453 Ga0395900_0813956 3300037418 Bacteria 861
454 Ga0395905_0091855 3300037471 Bacteria 2846
455 Ga0395905_0167588 3300037471 Bacteria 2064
456 Ga0395905_0429420 3300037471 Bacteria 1218
457 Ga0436364_0689048 3300037853 Bacteria 11902
458 Ga0395901_0025734 3300038443 Bacteria 6041
459 Ga0395901_0494653 3300038443 Bacteria 1246
460 Ga0237819_03296 3300038705 Bacteria 2913
461 Ga0237816_00927 3300039145 Bacteria 2402
462 Ga0436365_0019219 3300039437 Bacteria 1711
463 Ga0436363_0619851 3300039450 Bacteria 1419
464 Ga0439461_0007070 3300041410 Bacteria 1975
465 Ga0439466_0016932 3300041411 Bacteria 2630
466 Ga0439465_0000722 3300041413 Bacteria 10202
467 Ga0439465_0001868 3300041413 Bacteria 6883
468 Ga0451806_247531 3300041462 Bacteria 2986
469 Ga0451807_0951501 3300041486 Bacteria 1610
470 Ga0439431_0031503 3300041997 Bacteria 1318
471 Ga0439445_0004626 3300042004 Bacteria 3118
472 Ga0439448_0002822 3300042005 Bacteria 4756
473 Ga0439448_0003054 3300042005 Bacteria 4599
474 Ga0439448_0018091 3300042005 Bacteria 2156
475 Ga0439432_007156 3300042006 Bacteria 3965
476 Ga0439450_019171 3300042008 Bacteria 1446
477 Ga0439455_0002237 3300042012 Bacteria 3472
478 Ga0439455_0003114 3300042012 Bacteria 3124
479 Ga0439455_0020182 3300042012 Bacteria 1577
480 Ga0439455_0021524 3300042012 Bacteria 1538
481 Ga0439457_004596 3300042014 Bacteria 3575
482 Ga0439462_0000844 3300042015 Bacteria 6416
483 Ga0450923_042994 3300042125 Bacteria 954
484 Ga0439458_0000069 3300042157 Bacteria 18709
485 Ga0439458_0002139 3300042157 Bacteria 4882
486 Ga0439434_0005415 3300042435 Bacteria 3737
487 Ga0466963_0122715 3300044694 Bacteria 1789
488 Ga0466964_0002062 3300044706 Bacteria 7070
489 Ga0466971_0006379 3300044719 Bacteria 5122
490 Ga0466968_0032144 3300044735 Bacteria 2181
491 Ga0466970_0232189 3300044765 Bacteria 1031
492 Ga0466957_0039253 3300044842 Bacteria 2856
493 Ga0466957_0287732 3300044842 Bacteria 1101
494 Ga0466960_0002581 3300044901 Bacteria 6810
495 Ga0466958_0048262 3300045836 Bacteria 2572
496 Ga0466967_0023868 3300045976 Bacteria 5019
497 Ga0495627_022728 3300046453 Bacteria 2060
498 Ga0495638_0000207 3300046460 Bacteria 83805
499 Ga0495638_0136534 3300046460 Bacteria 1435
500 Ga0495643_0125417 3300046522 Bacteria 1293
501 Ga0495648_0012030 3300046524 Bacteria 6483
502 Ga0495648_0065607 3300046524 Bacteria 2133
503 Ga0495648_0103581 3300046524 Bacteria 1565
504 Ga0495663_0008729 3300046525 Bacteria 2810
505 Ga0495663_0025926 3300046525 Bacteria 1713
506 Ga0495654_0001081 3300046530 Bacteria 19864
507 Ga0495654_0026577 3300046530 Bacteria 2974
508 Ga0495654_0058538 3300046530 Bacteria 1859
509 Ga0495598_0011454 3300046537 Bacteria 2151
510 Ga0495597_0010615 3300046542 Bacteria 4493
511 Ga0495597_0038861 3300046542 Bacteria 2132
512 Ga0495668_0000087 3300046616 Bacteria 151819
513 Ga0495668_0001796 3300046616 Bacteria 19561
514 Ga0495668_0016477 3300046616 Bacteria 4296
515 Ga0495625_0000275 3300046660 Bacteria 80062
516 Ga0495625_0001182 3300046660 Bacteria 33512
517 Ga0495625_0004756 3300046660 Bacteria 12703
518 Ga0495625_0130970 3300046660 Bacteria 1699
519 Ga0495625_0237433 3300046660 Bacteria 1188
520 Ga0495670_0000010 3300046691 Bacteria 174071
521 Ga0495670_0214983 3300046691 Bacteria 1020
522 Ga0495671_0015741 3300046692 Bacteria 4046
523 Ga0495649_0153721 3300046694 Bacteria 1208
524 Ga0495589_0038667 3300046794 Bacteria 2387
525 Ga0495687_067576 3300047443 Bacteria 1446
526 Ga0495681_0015143 3300047470 Bacteria 4375
527 Ga0495686_0000273 3300047472 Bacteria 91936
528 Ga0495686_0467578 3300047472 Bacteria 668
529 Ga0496102_0010329 3300048905 Bacteria 8028
530 Ga0496102_0177499 3300048905 Bacteria 2006
531 Ga0496103_0001143 3300048906 Bacteria 18378
532 Ga0496103_0001152 3300048906 Bacteria 18258
533 Ga0496103_0035464 3300048906 Bacteria 3054
534 Ga0496104_0067408 3300048907 Bacteria 3400
535 Ga0496105_0077968 3300048908 Bacteria 2736
536 Ga0496108_0374900 3300048911 Bacteria 1242
537 Ga0496109_0017136 3300048912 Bacteria 6342
538 Ga0496115_0000325 3300048918 Bacteria 40655
539 Ga0496116_0003043 3300048919 Bacteria 16956
540 Ga0496116_0008247 3300048919 Bacteria 9074
541 Ga0496117_0002989 3300048920 Bacteria 20363
542 Ga0496117_0003452 3300048920 Bacteria 18381
543 Ga0496117_0007701 3300048920 Bacteria 10425
544 Ga0496117_0022717 3300048920 Bacteria 5023
545 Ga0496118_0001765 3300048921 Bacteria 31299
546 Ga0496118_0003875 3300048921 Bacteria 18378
547 Ga0496118_0029295 3300048921 Bacteria 4620
548 Ga0496118_0058166 3300048921 Bacteria 2891
549 Ga0496119_0032572 3300048922 Bacteria 3471
550 Ga0496119_0143416 3300048922 Bacteria 1287
551 Ga0496120_0036264 3300048923 Bacteria 2937
552 Ga0496121_0010236 3300048924 Bacteria 10612
553 Ga0496121_0170323 3300048924 Bacteria 1583
554 Ga0496121_0380243 3300048924 Bacteria 931
555 Ga0496122_0001166 3300048925 Bacteria 44916
556 Ga0496122_0013706 3300048925 Bacteria 7909
557 Ga0496123_0000542 3300048926 Bacteria 64858
558 Ga0496123_0014602 3300048926 Bacteria 6495
559 Ga0496123_0017741 3300048926 Bacteria 5706
560 Ga0496123_0036942 3300048926 Bacteria 3455
561 Ga0496124_0003726 3300048927 Bacteria 18378
562 Ga0496124_0005643 3300048927 Bacteria 13989
563 Ga0496124_0007335 3300048927 Bacteria 11745
564 Ga0496124_0049758 3300048927 Bacteria 3574
565 Ga0496124_0272070 3300048927 Bacteria 1240
566 Ga0496125_0110184 3300048928 Bacteria 1997
567 Ga0496126_0084156 3300048929 Bacteria 2806
568 Ga0496126_0257002 3300048929 Bacteria 1454
569 Ga0496126_0559122 3300048929 Bacteria 907
570 Ga0501290_000134 3300049513 Bacteria 11572
571 Ga0501292_000019 3300049515 Bacteria 55694
572 Ga0501300_007160 3300049523 Bacteria 1634
573 Ga0501031_0074400 3300049568 Bacteria 2212
574 Ga0501032_0017922 3300049569 Bacteria 4968
575 Ga0501033_0123213 3300049570 Bacteria 1880
576 Ga0501033_0127794 3300049570 Bacteria 1842
577 Ga0501033_0212457 3300049570 Bacteria 1379
578 Ga0501033_0249752 3300049570 Bacteria 1257
579 Ga0501034_0244326 3300049571 Bacteria 1740
580 Ga0501036_0028055 3300049572 Bacteria 4758
581 Ga0501037_0237802 3300049573 Bacteria 1277
582 Ga0501038_0016764 3300049574 Bacteria 6635
583 Ga0501038_0407101 3300049574 Bacteria 1051
584 Ga0501039_0223381 3300049575 Bacteria 1480
585 Ga0501043_0176864 3300049579 Bacteria 1663
586 Ga0501047_0220752 3300049581 Bacteria 1752
587 Ga0501047_0235122 3300049581 Bacteria 1684
588 Ga0501202_002837 3300049652 Bacteria 2937
589 Ga0501211_002397 3300049658 Bacteria 1985
590 Ga0501222_002037 3300049662 Bacteria 2796
591 Ga0501223_001879 3300049663 Bacteria 4734
592 Ga0501261_000135 3300049690 Bacteria 10828
593 Ga0501225_0008439 3300049705 Bacteria 2957
594 Ga0501241_002254 3300049758 Bacteria 3762
595 Ga0501279_000008 3300049775 Bacteria 125267
596 Ga0501280_000477 3300049776 Bacteria 9513
597 Ga0501281_00281 3300049777 Bacteria 5295
598 Ga0501282_001448 3300049778 Bacteria 2629
599 Ga0501035_0081680 3300049822 Bacteria 2852
600 Ga0501044_0112215 3300049823 Bacteria 2733
601 Ga0501044_0248689 3300049823 Bacteria 1720
602 Ga0501044_0504232 3300049823 Bacteria 1111
603 nmdc:mga0k408_132918_c1 3300050493 Bacteria 1477
604 nmdc:mga05p37_769977_c1 3300050507 Bacteria 1058
605 Ga0500643_000044 3300053087 Bacteria 155319
606 Ga0500643_000134 3300053087 Bacteria 75321
607 Ga0500643_000235 3300053087 Bacteria 51395
608 Ga0500643_008448 3300053087 Bacteria 4042
609 Ga0500643_011585 3300053087 Bacteria 3207
610 Ga0500643_019055 3300053087 Bacteria 2265
611 Ga0500643_041408 3300053087 Bacteria 1353
612 Ga0500644_0024112 3300053088 Bacteria 1856
613 Ga0500647_0022410 3300053091 Bacteria 2955
614 Ga0500651_0017952 3300053093 Bacteria 4375
615 Ga0500566_0000259 3300053094 Bacteria 28513
616 Ga0500641_0006588 3300053096 Bacteria 4123
617 Ga0500641_0139880 3300053096 Bacteria 1046
618 Ga0500555_021622 3300053103 Bacteria 1853
619 Ga0500556_0000053 3300053104 Bacteria 117389
620 Ga0500562_003971 3300053108 Bacteria 3728
621 Ga0500562_042123 3300053108 Bacteria 1214
622 Ga0500562_060412 3300053108 Bacteria 1018
623 Ga0500592_001009 3300053116 Bacteria 4592
624 Ga0500592_003096 3300053116 Bacteria 2657
625 Ga0500594_0008100 3300053118 Bacteria 2390
626 Ga0500595_003619 3300053119 Bacteria 7164
627 Ga0500608_018097 3300053122 Bacteria 3211
628 Ga0500614_009206 3300053123 Bacteria 2104
629 Ga0500642_0000001 3300053130 Bacteria 1468402
630 Ga0500642_0002793 3300053130 Bacteria 5177
631 Ga0500655_000117 3300053133 Bacteria 20402
632 Ga0500658_0001115 3300053134 Bacteria 10989
633 Ga0500658_0001309 3300053134 Bacteria 10078
634 Ga0500658_0081370 3300053134 Bacteria 1386
635 Ga0500559_0003007 3300053136 Bacteria 8441
636 Ga0500559_0043212 3300053136 Bacteria 1968
637 Ga0500559_0066896 3300053136 Bacteria 1612
638 Ga0500568_0006304 3300053139 Bacteria 5974
639 Ga0500573_0000010 3300053140 Bacteria 210704
640 Ga0500577_0017129 3300053142 Bacteria 2301
641 Ga0500590_000141 3300053148 Bacteria 20020
642 Ga0500604_0020108 3300053151 Bacteria 1876
643 Ga0500624_000192 3300053157 Bacteria 24306
644 Ga0500627_0000009 3300053158 Bacteria 153203
645 Ga0500627_0000103 3300053158 Bacteria 28283
646 Ga0500627_0002011 3300053158 Bacteria 5875
647 Ga0500627_0006460 3300053158 Bacteria 3998
648 Ga0500627_0061889 3300053158 Bacteria 1647
649 Ga0500636_0008346 3300053177 Bacteria 6008
650 Ga0500570_003990 3300053724 Bacteria 7701
651 Ga0500645_000620 3300053730 Bacteria 22765
652 Ga0500645_000784 3300053730 Bacteria 19194
653 Ga0500596_007569 3300053735 Bacteria 1774
654 Ga0500661_000700 3300055283 Bacteria 6261
655 Ga0466962_0005832 3300061719 Bacteria 5918
656 2585261120 2582581305 Bacteria 4895574
657 2600202240 2599185354 Bacteria 4398675
658 2600228375 2599185359 Bacteria 4772316
659 2643819110 2643221560 Bacteria 4801179
660 2643835021 2643221563 Bacteria 4726935
661 2644039004 2643221605 Bacteria 4772303
662 2644055948 2643221608 Bacteria 4724829
663 2644127726 2643221622 Bacteria 4212502
664 2753766155 2751185897 Bacteria 5322941
665 2819715171 2818991466 Bacteria 4748179
666 2852653616 2852653556 Bacteria 4050083
667 2852683115 2852680915 Bacteria 4100189
668 2879163945 2879163058 Bacteria 4223965
669 2885432176 2885429604 Bacteria 3642894
670 2928029435 2928027323 Bacteria 4382488
671 2928528090 2928526807 Bacteria 4760224
672 2928971405 2928968154 Bacteria 4633371
673 2984556633 2984555340 Bacteria 4247089
674 2984565194 2984564862 Bacteria 4339992
675 2990268514 2990265787 Bacteria 3943888
676 2993356270 2993356040 Bacteria 4247105
677 2993696451 2993693658 Bacteria 4040749
678 3000867821 3000865235 Bacteria 3106258
679 Ga0065704_10120400
680 JGI24741J21665_1002093
681 JGI24740J21852_10001545
682 JGI24739J22299_10007692
683 JGI24739J22299_10012970
684 JGI24739J22299_10033187
685 JGI24737J22298_10001850
686 JGI24737J22298_10018216
687 JGI24735J21928_10002160
688 JGI24735J21928_10002466
689 JGI24750J21931_1016035
690 JGI24748J21848_1000053
691 JGI24738J21930_10002840
692 JGI24749J21850_1000019
693 JGI24749J21850_1000152
694 JGI24034J26672_10000036
695 JGI24751J29686_10000519
696 JGI25151J46595_10006038
697 JGI25165J46597_1000106
698 JGI25153J46596_10000073
699 rootH2_10015355
700 rootL2_10226620
701 rootH1_10214361
702 Ga0055526_1008485
703 Ga0055537_1001577
704 Ga0055537_1004584
705 Ga0055524_1004959
706 Ga0055536_1003303
707 Ga0055536_1016127
708 Ga0055530_10000919
709 Ga0055540_1001791
710 Ga0055531_10000727
711 Ga0055531_10002471
712 Ga0055531_10003687
713 Ga0055531_10007054
714 Ga0065165_1014363
715 Ga0065707_10081960
716 Ga0065707_10084228
717 Ga0070658_10005193
718 Ga0070658_10005573
719 Ga0070658_10031587
720 Ga0070658_10310037
721 Ga0070676_10001299
722 Ga0070690_100000093
723 Ga0070670_100000060
724 Ga0070670_100000202
725 Ga0070670_100012257
726 Ga0068869_100000134
727 Ga0070666_10000009
728 Ga0070666_10000476
729 Ga0068868_100000596
730 Ga0070660_100033451
731 Ga0070660_100073908
732 Ga0070689_100012983
733 Ga0070661_100042425
734 Ga0070668_100054655
735 Ga0070668_100067396
736 Ga0070669_100000053
737 Ga0070669_100000096
738 Ga0070669_100000103
739 Ga0070669_100299079
740 Ga0070675_100013296
741 Ga0070671_100000045
742 Ga0070671_100340534
743 Ga0070671_100398326
744 Ga0070674_100087507
745 Ga0070673_100000004
746 Ga0070688_100002603
747 Ga0070659_100024801
748 Ga0070659_100078374
749 Ga0070659_100116264
750 Ga0070667_100001658
751 Ga0070667_100004131
752 Ga0070667_100007570
753 Ga0070667_100425227
754 Ga0070708_100292320
755 Ga0070663_100103577
756 Ga0070678_100012107
757 Ga0070662_100049945
758 Ga0070662_100101113
759 Ga0070681_10429176
760 Ga0068867_100000028
761 Ga0068867_100034485
762 Ga0070685_10000076
763 Ga0070707_100462071
764 Ga0070679_100209119
765 Ga0068853_100022149
766 Ga0068853_100076589
767 Ga0068853_100139907
768 Ga0070672_100021658
769 Ga0070686_100000018
770 Ga0070665_100000071
771 Ga0070665_100000849
772 Ga0068855_100003904
773 Ga0068855_100052461
774 Ga0068855_100117567
775 Ga0068855_100160648
776 Ga0070664_100138478
777 Ga0068857_100008705
778 Ga0068857_100237878
779 Ga0068854_100000881
780 Ga0068854_100014919
781 Ga0068854_100098220
782 Ga0068854_100110532
783 Ga0068856_100058850
784 Ga0068852_100007489
785 Ga0068852_100156634
786 Ga0068852_100277914
787 Ga0068852_100588814
788 Ga0068859_100000162
789 Ga0068859_100000623
790 Ga0068859_100006620
791 Ga0068859_100008763
792 Ga0068859_100135635
793 Ga0068859_100672187
794 Ga0068864_100000069
795 Ga0068864_100000194
796 Ga0068864_100000677
797 Ga0068864_100007703
798 Ga0068861_100000004
799 Ga0068861_100003501
800 Ga0068861_100004343
801 Ga0068851_10038155
802 Ga0068863_100000258
803 Ga0068863_100000784
804 Ga0068863_100004697
805 Ga0068858_100001692
806 Ga0068858_100002738
807 Ga0068858_100004410
808 Ga0068858_100017431
809 Ga0068860_100000022
810 Ga0068860_100004945
811 Ga0068862_100000082
812 Ga0068862_100000289
813 Ga0068862_100001387
814 Ga0075366_10321598
815 Ga0097621_100004543
816 Ga0075370_10005832
817 Ga0068871_100031338
818 Ga0068865_100000006
819 Ga0097620_100000162
820 Ga0097620_100000623
821 Ga0097620_100006621
822 Ga0097620_100008763
823 Ga0097620_100135635
824 Ga0097620_100672254
825 Ga0099794_10059802
826 Ga0105251_10000815
827 Ga0105240_10037440
828 Ga0105240_10103626
829 Ga0105240_10363867
830 Ga0105240_10569847
831 Ga0105245_10001073
832 Ga0105247_10005540
833 Ga0105247_10014575
834 Ga0114129_10224777
835 Ga0105243_10001033
836 Ga0105243_10266655
837 Ga0105243_10361067
838 Ga0105241_10006361
839 Ga0105242_10000413
840 Ga0105248_10000012
841 Ga0105248_10000101
842 Ga0105248_10001646
843 Ga0105248_10004784
844 Ga0105248_10017707
845 Ga0105248_10059784
846 Ga0105237_10010466
847 Ga0105237_10123855
848 Ga0105237_10146187
849 Ga0105237_10171493
850 Ga0105238_10002527
851 Ga0105238_10009256
852 Ga0105238_10230820
853 Ga0105238_10272150
854 Ga0105238_10289467
855 Ga0105249_10000014
856 Ga0105249_10000099
857 Ga0105249_10001061
858 Ga0105249_10019332
859 Ga0105249_10116554
860 Ga0105249_10134027
861 Ga0105148_100047
862 Ga0105239_10100169
863 Ga0105239_10143818
864 Ga0105239_10384193
865 Ga0105239_10388784
866 Ga0105246_10002567
867 Ga0157373_10007108
868 Ga0157373_10229264
869 Ga0157370_10000318
870 Ga0157370_10080000
871 Ga0157370_10145369
872 Ga0157369_10033426
873 Ga0157369_10070181
874 Ga0157369_10540344
875 Ga0157374_10004031
876 Ga0157378_10001466
877 Ga0157378_10057283
878 Ga0157378_10077367
879 Ga0163162_10000823
880 Ga0163162_10001988
881 Ga0163162_10004881
882 Ga0163162_10392935
883 Ga0157372_10136792
884 Ga0157372_10172816
885 Ga0157372_10367567
886 Ga0157372_11233414
887 Ga0157375_10000586
888 Ga0163163_10048705
889 Ga0163163_10145827
890 Ga0163163_10301890
891 Ga0163163_10382115
892 Ga0157380_10000681
893 Ga0157380_10000793
894 Ga0157380_10003492
895 Ga0157380_10120630
896 Ga0157377_10003736
897 Ga0157379_10014310
898 Ga0157379_10034191
899 Ga0157379_10043366
900 Ga0157376_10000347
901 Ga0163161_10000186
902 Ga0163161_10141108
903 Ga0163161_10291672
904 Ga0213875_10000636
905 Ga0207672_1000697
906 Ga0207427_101139
907 Ga0207425_1000005
908 Ga0207425_1006746
909 Ga0209026_1002495
910 Ga0209148_1000059
911 Ga0209148_1001763
912 Ga0209129_1001455
913 Ga0209233_1000003
914 Ga0209233_1000044
915 Ga0209565_1000007
916 Ga0209565_1000850
917 Ga0209455_1000441
918 Ga0209673_1020200
919 Ga0209675_1000169
920 Ga0209676_1000651
921 Ga0209676_1000807
922 Ga0209676_1001585
923 Ga0209025_1000477
924 Ga0209564_1001268
925 Ga0209758_1000002
926 Ga0209758_1011899
927 Ga0209758_1031388
928 Ga0209050_1000001
929 Ga0209050_1000071
930 Ga0209050_1000213
931 Ga0209050_1000310
932 Ga0209050_1008043
933 Ga0209050_1008987
934 Ga0209050_1030615
935 Ga0209256_1000008
936 Ga0207426_1027626
937 Ga0209051_1001344
938 Ga0209257_1000027
939 Ga0209257_1000113
940 Ga0209257_1000379
941 Ga0209257_1007892
942 Ga0209257_1010573
943 Ga0209257_1016155
944 Ga0207697_10003661
945 Ga0207656_10002058
946 Ga0207713_1011606
947 Ga0207680_10000007
948 Ga0207680_10000156
949 Ga0207680_10005149
950 Ga0207647_10000331
951 Ga0207647_10011632
952 Ga0207647_10049086
953 Ga0207647_10167426
954 Ga0207645_10003000
955 Ga0207705_10000049
956 Ga0207705_10000119
957 Ga0207705_10000903
958 Ga0207654_10003712
959 Ga0207654_10147313
960 Ga0207695_10001498
961 Ga0207695_10026123
962 Ga0207695_10046078
963 Ga0207695_10500326
964 Ga0207671_10000350
965 Ga0207671_10008206
966 Ga0207671_10181417
967 Ga0207671_10310283
968 Ga0207657_10002725
969 Ga0207657_10012434
970 Ga0207657_10090251
971 Ga0207657_10138610
972 Ga0207657_10249241
973 Ga0207649_10030267
974 Ga0207649_10248496
975 Ga0207652_10000474
976 Ga0207646_10406157
977 Ga0207681_10000003
978 Ga0207681_10000030
979 Ga0207681_10000074
980 Ga0207681_10045472
981 Ga0207694_10000447
982 Ga0207694_10001241
983 Ga0207694_10006090
984 Ga0207694_10218710
985 Ga0207694_10238348
986 Ga0207650_10000148
987 Ga0207650_10000881
988 Ga0207650_10002923
989 Ga0207650_10014952
990 Ga0207659_10007115
991 Ga0207687_10000398
992 Ga0207687_10004652
993 Ga0207644_10000017
994 Ga0207644_10099083
995 Ga0207644_10124038
996 Ga0207690_10007558
997 Ga0207690_10080051
998 Ga0207706_10005888
999 Ga0207706_10025357
1000 Ga0207706_10074542
1001 Ga0207706_10162268
1002 Ga0207686_10004687
1003 Ga0207709_10000182
1004 Ga0207709_10116348
1005 Ga0207709_10212105
1006 Ga0207670_10003472
1007 Ga0207669_10344153
1008 Ga0207704_10000022
1009 Ga0207691_10139295
1010 Ga0207711_10000004
1011 Ga0207711_10002922
1012 Ga0207711_10005144
1013 Ga0207711_10011639
1014 Ga0207711_10014747
1015 Ga0207711_10046174
1016 Ga0207689_10000462
1017 Ga0207679_10254262
1018 Ga0207667_10000029
1019 Ga0207667_10007493
1020 Ga0207667_10029941
1021 Ga0207667_10045311
1022 Ga0207667_10071967
1023 Ga0207667_10088029
1024 Ga0207667_10242477
1025 Ga0207651_10000009
1026 Ga0207712_10000004
1027 Ga0207712_10000161
1028 Ga0207712_10008456
1029 Ga0207712_10042111
1030 Ga0207712_10122630
1031 Ga0207712_10188646
1032 Ga0207668_10000402
1033 Ga0207668_10013769
1034 Ga0207668_10042411
1035 Ga0207640_10000021
1036 Ga0207640_10010477
1037 Ga0207640_10011320
1038 Ga0207640_10022008
1039 Ga0207640_10086651
1040 Ga0207640_10111620
1041 Ga0207658_10000232
1042 Ga0207658_10000260
1043 Ga0207658_10006186
1044 Ga0207658_10075014
1045 Ga0207677_10000164
1046 Ga0207703_10000302
1047 Ga0207703_10001367
1048 Ga0207703_10003192
1049 Ga0207703_10011288
1050 Ga0207639_10001528
1051 Ga0207639_10004891
1052 Ga0207639_10006052
1053 Ga0207639_10023517
1054 Ga0207639_10030994
1055 Ga0207678_10000968
1056 Ga0207678_10028170
1057 Ga0207678_10476231
1058 Ga0207702_10000566
1059 Ga0207702_10004819
1060 Ga0207702_10010932
1061 Ga0207702_10048296
1062 Ga0207641_10000010
1063 Ga0207641_10000192
1064 Ga0207641_10002919
1065 Ga0207648_10000084
1066 Ga0207648_10165399
1067 Ga0207676_10000009
1068 Ga0207676_10000046
1069 Ga0207676_10000344
1070 Ga0207676_10001746
1071 Ga0207676_10014815
1072 Ga0207674_10004990
1073 Ga0207674_10009750
1074 Ga0207674_10013870
1075 Ga0207674_10352514
1076 Ga0207675_100000032
1077 Ga0207675_100000221
1078 Ga0207675_100000370
1079 Ga0207675_100001422
1080 Ga0207683_10002643
1081 Ga0207698_10002388
1082 Ga0207698_10009053
1083 Ga0209974_10052915
1084 Ga0268266_10000040
1085 Ga0268266_10001644
1086 Ga0268265_10000026
1087 Ga0268265_10000030
1088 Ga0268265_10000074
1089 Ga0268264_10000003
1090 Ga0268264_10000215
1091 Ga0307517_10166810
1092 Ga0307513_10306221
1093 Ga0307408_100063682
1094 Ga0307408_100171401
1095 Ga0307508_10000011
1096 Ga0307405_10007465
1097 Ga0307405_10094393
1098 Ga0307405_10111030
1099 Ga0307405_10393568
1100 Ga0307413_10063012
1101 Ga0307413_10220761
1102 Ga0307406_10004951
1103 Ga0307406_10101684
1104 Ga0307406_10262662
1105 Ga0307407_10256243
1106 Ga0307412_10000104
1107 Ga0307412_10004076
1108 Ga0307412_10008922
1109 Ga0307412_10012503
1110 Ga0307412_10026721
1111 Ga0307412_10029631
1112 Ga0307412_10170911
1113 Ga0307409_100220897
1114 Ga0307416_100008721
1115 Ga0307416_100068377
1116 Ga0307416_100102843
1117 Ga0307414_10008100
1118 Ga0307414_10024523
1119 Ga0307414_10071331
1120 Ga0307414_10084937
1121 Ga0307414_10108351
1122 Ga0307414_10121153
1123 Ga0307414_10190797
1124 Ga0307414_10199442
1125 Ga0307411_10072538
1126 Ga0307415_100242279
1127 Ga0395899_0005461
1128 Ga0395899_0062717
1129 Ga0395900_0054489
1130 Ga0395900_0100885
1131 Ga0395900_0813956
1132 Ga0395905_0091855
1133 Ga0395905_0167588
1134 Ga0395905_0429420
1135 Ga0436364_0689048
1136 Ga0395901_0025734
1137 Ga0395901_0494653
1138 Ga0237819_03296
1139 Ga0237816_00927
1140 Ga0436365_0019219
1141 Ga0436363_0619851
1142 Ga0439461_0007070
1143 Ga0439466_0016932
1144 Ga0439465_0000722
1145 Ga0439465_0001868
1146 Ga0451806_247531
1147 Ga0451807_0951501
1148 Ga0439431_0031503
1149 Ga0439445_0004626
1150 Ga0439448_0002822
1151 Ga0439448_0003054
1152 Ga0439448_0018091
1153 Ga0439432_007156
1154 Ga0439450_019171
1155 Ga0439455_0002237
1156 Ga0439455_0003114
1157 Ga0439455_0020182
1158 Ga0439455_0021524
1159 Ga0439457_004596
1160 Ga0439462_0000844
1161 Ga0450923_042994
1162 Ga0439458_0000069
1163 Ga0439458_0002139
1164 Ga0439434_0005415
1165 Ga0466963_0122715
1166 Ga0466964_0002062
1167 Ga0466971_0006379
1168 Ga0466968_0032144
1169 Ga0466970_0232189
1170 Ga0466957_0039253
1171 Ga0466957_0287732
1172 Ga0466960_0002581
1173 Ga0466958_0048262
1174 Ga0466967_0023868
1175 Ga0495627_022728
1176 Ga0495638_0000207
1177 Ga0495638_0136534
1178 Ga0495643_0125417
1179 Ga0495648_0012030
1180 Ga0495648_0065607
1181 Ga0495648_0103581
1182 Ga0495663_0008729
1183 Ga0495663_0025926
1184 Ga0495654_0001081
1185 Ga0495654_0026577
1186 Ga0495654_0058538
1187 Ga0495598_0011454
1188 Ga0495597_0010615
1189 Ga0495597_0038861
1190 Ga0495668_0000087
1191 Ga0495668_0001796
1192 Ga0495668_0016477
1193 Ga0495625_0000275
1194 Ga0495625_0001182
1195 Ga0495625_0004756
1196 Ga0495625_0130970
1197 Ga0495625_0237433
1198 Ga0495670_0000010
1199 Ga0495670_0214983
1200 Ga0495671_0015741
1201 Ga0495649_0153721
1202 Ga0495589_0038667
1203 Ga0495687_067576
1204 Ga0495681_0015143
1205 Ga0495686_0000273
1206 Ga0495686_0467578
1207 Ga0496102_0010329
1208 Ga0496102_0177499
1209 Ga0496103_0001143
1210 Ga0496103_0001152
1211 Ga0496103_0035464
1212 Ga0496104_0067408
1213 Ga0496105_0077968
1214 Ga0496108_0374900
1215 Ga0496109_0017136
1216 Ga0496115_0000325
1217 Ga0496116_0003043
1218 Ga0496116_0008247
1219 Ga0496117_0002989
1220 Ga0496117_0003452
1221 Ga0496117_0007701
1222 Ga0496117_0022717
1223 Ga0496118_0001765
1224 Ga0496118_0003875
1225 Ga0496118_0029295
1226 Ga0496118_0058166
1227 Ga0496119_0032572
1228 Ga0496119_0143416
1229 Ga0496120_0036264
1230 Ga0496121_0010236
1231 Ga0496121_0170323
1232 Ga0496121_0380243
1233 Ga0496122_0001166
1234 Ga0496122_0013706
1235 Ga0496123_0000542
1236 Ga0496123_0014602
1237 Ga0496123_0017741
1238 Ga0496123_0036942
1239 Ga0496124_0003726
1240 Ga0496124_0005643
1241 Ga0496124_0007335
1242 Ga0496124_0049758
1243 Ga0496124_0272070
1244 Ga0496125_0110184
1245 Ga0496126_0084156
1246 Ga0496126_0257002
1247 Ga0496126_0559122
1248 Ga0501290_000134
1249 Ga0501292_000019
1250 Ga0501300_007160
1251 Ga0501031_0074400
1252 Ga0501032_0017922
1253 Ga0501033_0123213
1254 Ga0501033_0127794
1255 Ga0501033_0212457
1256 Ga0501033_0249752
1257 Ga0501034_0244326
1258 Ga0501036_0028055
1259 Ga0501037_0237802
1260 Ga0501038_0016764
1261 Ga0501038_0407101
1262 Ga0501039_0223381
1263 Ga0501043_0176864
1264 Ga0501047_0220752
1265 Ga0501047_0235122
1266 Ga0501202_002837
1267 Ga0501211_002397
1268 Ga0501222_002037
1269 Ga0501223_001879
1270 Ga0501261_000135
1271 Ga0501225_0008439
1272 Ga0501241_002254
1273 Ga0501279_000008
1274 Ga0501280_000477
1275 Ga0501281_00281
1276 Ga0501282_001448
1277 Ga0501035_0081680
1278 Ga0501044_0112215
1279 Ga0501044_0248689
1280 Ga0501044_0504232
1281 nmdc:mga0k408_132918_c1
1282 nmdc:mga05p37_769977_c1
1283 Ga0500643_000044
1284 Ga0500643_000134
1285 Ga0500643_000235
1286 Ga0500643_008448
1287 Ga0500643_011585
1288 Ga0500643_019055
1289 Ga0500643_041408
1290 Ga0500644_0024112
1291 Ga0500647_0022410
1292 Ga0500651_0017952
1293 Ga0500566_0000259
1294 Ga0500641_0006588
1295 Ga0500641_0139880
1296 Ga0500555_021622
1297 Ga0500556_0000053
1298 Ga0500562_003971
1299 Ga0500562_042123
1300 Ga0500562_060412
1301 Ga0500592_001009
1302 Ga0500592_003096
1303 Ga0500594_0008100
1304 Ga0500595_003619
1305 Ga0500608_018097
1306 Ga0500614_009206
1307 Ga0500642_0000001
1308 Ga0500642_0002793
1309 Ga0500655_000117
1310 Ga0500658_0001115
1311 Ga0500658_0001309
1312 Ga0500658_0081370
1313 Ga0500559_0003007
1314 Ga0500559_0043212
1315 Ga0500559_0066896
1316 Ga0500568_0006304
1317 Ga0500573_0000010
1318 Ga0500577_0017129
1319 Ga0500590_000141
1320 Ga0500604_0020108
1321 Ga0500624_000192
1322 Ga0500627_0000009
1323 Ga0500627_0000103
1324 Ga0500627_0002011
1325 Ga0500627_0006460
1326 Ga0500627_0061889
1327 Ga0500636_0008346
1328 Ga0500570_003990
1329 Ga0500645_000620
1330 Ga0500645_000784
1331 Ga0500596_007569
1332 Ga0500661_000700
1333 Ga0466962_0005832
1334 2585261120
1335 2600202240
1336 2600228375
1337 2643819110
1338 2643835021
1339 2644039004
1340 2644055948
1341 2644127726
1342 2753766155
1343 2819715171
1344 2852653616
1345 2852683115
1346 2879163945
1347 2885432176
1348 2928029435
1349 2928528090
1350 2928971405
1351 2984556633
1352 2984565194
1353 2990268514
1354 2993356270
1355 2993696451
1356 3000867821

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

43

300

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n81-assembly1.cif.gz_A-2 another flexible region at the active site of an inositol monophosphatase from zymomonas mobilis 0.9444 1 254
4n81-assembly1.cif.gz_A-2 another flexible region at the active site of an inositol monophosphatase from zymomonas mobilis 0.9306 1 254
3lv0-assembly1.cif.gz_A crystal structure of extragenic suppressor protein suhb from bartonella henselae, native 0.9254 5 257
5zhh-assembly1.cif.gz_C structure of inositol monophosphatase from anabaena (nostoc) sp. pcc 7120 0.9215 4 256
3lv0-assembly1.cif.gz_B crystal structure of extragenic suppressor protein suhb from bartonella henselae, native 0.9207 8 257
ID Description Score Start End Superfamily
4n81A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9964 141 254 3.40.190.80
4n81A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9627 141 254 3.40.190.80
5zhhC01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9534 4 139 3.30.540.10
3lv0B01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9332 8 138 3.30.540.10
2p3nA01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9248 5 139 3.30.540.10
ID Description Score Start End GO Terms
AF-A0A6N8W0T6-F1-model_v4 Histidinol-phosphatase (EC 3.1.3.15) 0.9823 4 254 GO:0000105
GO:0004401
GO:0046872
AF-S9S542-F1-model_v4 Histidinol-phosphatase (EC 3.1.3.15) 0.9818 5 255 GO:0000105
GO:0004401
GO:0046872
AF-A0A2S6SCM8-F1-model_v4 Fructose-1, 6-bisphosphatase/inositol-1-monophosphatase (EC 3.1.3.11) 0.9786 4 256 GO:0000105
GO:0042132
GO:0046872
AF-A0A2E3XDE0-F1-model_v4 Histidinol-phosphatase (EC 3.1.3.15) 0.9782 4 255 GO:0000105
GO:0004401
GO:0046872
AF-A0A7V8F882-F1-model_v4 Histidinol-phosphatase (EC 3.1.3.15) 0.9775 4 256 GO:0000105
GO:0004401
GO:0046872

Map