F474623

General Info

Members Datasets Scaffolds Average Seq Length
678 326 1356 204

Family's Representative Sequence

Representative Sequence 3300002077|JGI24744J21845_10009119|JGI24744J21845_100091192
Length 232
Sequence MLSFRWPDSLLLVTQAVVRQSELHQREKEEEMPPISRGFRGRRRDDAPSDRVPPGQYVTDDFPVLSAGPTPHTPLDDWDLTITGEVDGLRRWSWDEFRALPSEPVTVDIHCVTKWSKLDSEWEGVSLDTLLDGVDTTAEYVVAFCDGGYTTNLPLEDLTEGKAWIAFAFDGEPLEPEHGGPARLLVPHLYFWKSAKWVRGLRLAATDEPGFWEQNGYHNYGDPWKEQRYWGD

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
115 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
183 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
184 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
185 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
209 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
210 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
211 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
214 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
215 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
216 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
217 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
218 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
219 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
225 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
231 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
232 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
237 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
238 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
239 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
240 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
241 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
242 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
243 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
244 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
245 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
246 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
250 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
252 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
255 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
256 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
257 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
258 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
259 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
260 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
289 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
300 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
306 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
307 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
320 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
323 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
324 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
325 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
326 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 1.33
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.62
Nodule 0
Rhizoplane 7.08
Rhizosphere 90.71
Stem 0
Stem Tuber 0.15
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10009119 3300002077 Bacteria 2038
2 2214900756 2209111006 Bacteria 1430
3 ARcpr5yngRDRAFT_c003336 3300000043 Bacteria 1593
4 ARSoilOldRDRAFT_c001721 3300000044 Bacteria 2009
5 ARCol0yngRDRAFT_1000604 3300000652 Bacteria 3843
6 JGI24742J22300_10019868 3300002244 Bacteria 1142
7 JGI25407J50210_10003194 3300003373 Bacteria 3900
8 JGI25407J50210_10005048 3300003373 Bacteria 3228
9 Ga0065716_1003252 3300005277 Bacteria 1290
10 Ga0070658_10287760 3300005327 Bacteria 1400
11 Ga0070658_10733611 3300005327 Bacteria 858
12 Ga0070683_100001370 3300005329 Bacteria 18667
13 Ga0070683_100039688 3300005329 Bacteria 4323
14 Ga0070683_100067579 3300005329 Bacteria 3329
15 Ga0070683_101003468 3300005329 Bacteria 801
16 Ga0070690_100037930 3300005330 Bacteria 3038
17 Ga0070670_100688595 3300005331 Bacteria 919
18 Ga0070666_10167704 3300005335 Bacteria 1537
19 Ga0070666_10398946 3300005335 Bacteria 989
20 Ga0070680_100026791 3300005336 Bacteria 4610
21 Ga0070680_100161238 3300005336 Bacteria 1885
22 Ga0068868_100035495 3300005338 Bacteria 3854
23 Ga0068868_100091875 3300005338 Bacteria 2446
24 Ga0070660_100053174 3300005339 Bacteria 3123
25 Ga0070660_100324309 3300005339 Bacteria 1265
26 Ga0070689_100005116 3300005340 Bacteria 8919
27 Ga0070691_10025012 3300005341 Bacteria 2779
28 Ga0070687_100118614 3300005343 Bacteria 1510
29 Ga0070661_100055833 3300005344 Bacteria 2892
30 Ga0070692_10034155 3300005345 Bacteria 2566
31 Ga0070692_10077486 3300005345 Bacteria 1783
32 Ga0070668_100066601 3300005347 Bacteria 2795
33 Ga0070671_100038904 3300005355 Bacteria 3947
34 Ga0070674_100068689 3300005356 Bacteria 2497
35 Ga0070673_100058371 3300005364 Bacteria 3051
36 Ga0070688_100088842 3300005365 Bacteria 2015
37 Ga0070688_100098489 3300005365 Bacteria 1924
38 Ga0070659_100120129 3300005366 Bacteria 2127
39 Ga0070659_100443271 3300005366 Bacteria 1100
40 Ga0070703_10017313 3300005406 Bacteria 2075
41 Ga0070703_10121984 3300005406 Bacteria 947
42 Ga0070709_10005906 3300005434 Bacteria 6642
43 Ga0070714_100000784 3300005435 Bacteria 22555
44 Ga0070714_100001536 3300005435 Bacteria 16839
45 Ga0070714_100200410 3300005435 Bacteria 1826
46 Ga0070713_100575513 3300005436 Bacteria 1068
47 Ga0070710_10005619 3300005437 Bacteria 5969
48 Ga0070710_10052616 3300005437 Bacteria 2291
49 Ga0070701_10002141 3300005438 Bacteria 7517
50 Ga0070711_100002059 3300005439 Bacteria 11337
51 Ga0070711_100006096 3300005439 Bacteria 7246
52 Ga0070711_100049296 3300005439 Bacteria 2884
53 Ga0070705_100087729 3300005440 Bacteria 1929
54 Ga0070700_100011551 3300005441 Bacteria 4894
55 Ga0070700_100097184 3300005441 Bacteria 1934
56 Ga0070700_100644130 3300005441 Bacteria 836
57 Ga0070694_100058848 3300005444 Bacteria 2616
58 Ga0070708_100001150 3300005445 Bacteria 20331
59 Ga0070708_100027099 3300005445 Bacteria 4913
60 Ga0070708_100704136 3300005445 Bacteria 950
61 Ga0070663_100027566 3300005455 Bacteria 3859
62 Ga0070663_100163815 3300005455 Bacteria 1713
63 Ga0070678_100100997 3300005456 Bacteria 2235
64 Ga0070678_100284862 3300005456 Bacteria 1399
65 Ga0070662_100093184 3300005457 Bacteria 2266
66 Ga0070681_10042504 3300005458 Bacteria 4554
67 Ga0070681_10090731 3300005458 Bacteria 3006
68 Ga0068867_100030518 3300005459 Bacteria 3888
69 Ga0068867_100209418 3300005459 Bacteria 1565
70 Ga0068867_100591024 3300005459 Bacteria 967
71 Ga0070685_10015121 3300005466 Bacteria 4096
72 Ga0070706_100000886 3300005467 Bacteria 32788
73 Ga0070706_100007989 3300005467 Bacteria 9871
74 Ga0070706_100146866 3300005467 Bacteria 2202
75 Ga0070707_100000368 3300005468 Bacteria 44585
76 Ga0070707_100004906 3300005468 Bacteria 12538
77 Ga0070707_100301695 3300005468 Bacteria 1556
78 Ga0070707_100550665 3300005468 Bacteria 1116
79 Ga0070698_100024242 3300005471 Bacteria 6331
80 Ga0070698_100171059 3300005471 Bacteria 2113
81 Ga0070698_100771625 3300005471 Bacteria 905
82 Ga0070698_100811525 3300005471 Bacteria 880
83 Ga0070699_100085146 3300005518 Bacteria 2759
84 Ga0070679_100507057 3300005530 Bacteria 1150
85 Ga0070684_100042421 3300005535 Bacteria 3927
86 Ga0070684_100195984 3300005535 Bacteria 1839
87 Ga0070684_100701183 3300005535 Bacteria 944
88 Ga0068853_100073941 3300005539 Bacteria 2973
89 Ga0068853_101148275 3300005539 Bacteria 749
90 Ga0070672_100122428 3300005543 Bacteria 2131
91 Ga0070672_100727635 3300005543 Bacteria 870
92 Ga0070686_100002779 3300005544 Bacteria 9638
93 Ga0070686_100070662 3300005544 Bacteria 2283
94 Ga0070686_100251648 3300005544 Bacteria 1291
95 Ga0070696_100009904 3300005546 Bacteria 6375
96 Ga0070696_100168488 3300005546 Bacteria 1618
97 Ga0070693_100027257 3300005547 Bacteria 3094
98 Ga0070693_100078429 3300005547 Bacteria 1963
99 Ga0070693_100107551 3300005547 Bacteria 1710
100 Ga0070665_100055414 3300005548 Bacteria 3976
101 Ga0070665_100802974 3300005548 Bacteria 954
102 Ga0068855_100229722 3300005563 Bacteria 2078
103 Ga0070664_100060207 3300005564 Bacteria 3232
104 Ga0070664_100123314 3300005564 Bacteria 2271
105 Ga0070664_100157679 3300005564 Bacteria 2006
106 Ga0070664_100697616 3300005564 Bacteria 945
107 Ga0068857_100272920 3300005577 Bacteria 1554
108 Ga0068857_100310495 3300005577 Bacteria 1455
109 Ga0068856_100061413 3300005614 Bacteria 3712
110 Ga0068856_100065147 3300005614 Bacteria 3600
111 Ga0068856_100157493 3300005614 Bacteria 2281
112 Ga0070702_100005514 3300005615 Bacteria 5906
113 Ga0070702_100069860 3300005615 Bacteria 2071
114 Ga0068852_100079967 3300005616 Bacteria 2897
115 Ga0068852_100316674 3300005616 Bacteria 1514
116 Ga0068852_100333983 3300005616 Bacteria 1475
117 Ga0068852_100588817 3300005616 Bacteria 1116
118 Ga0068859_100079366 3300005617 Bacteria 3322
119 Ga0068866_10006037 3300005718 Bacteria 5041
120 Ga0068861_100021468 3300005719 Bacteria 4640
121 Ga0068861_100801723 3300005719 Bacteria 884
122 Ga0068863_100010816 3300005841 Bacteria 8848
123 Ga0068862_100388511 3300005844 Bacteria 1303
124 Ga0081455_10015812 3300005937 Bacteria 7308
125 Ga0081455_10023437 3300005937 Bacteria 5743
126 Ga0081455_10031296 3300005937 Bacteria 4816
127 Ga0081538_10000305 3300005981 Bacteria 56642
128 Ga0081538_10000694 3300005981 Bacteria 37000
129 Ga0081538_10001618 3300005981 Bacteria 23120
130 Ga0081538_10001707 3300005981 Bacteria 22383
131 Ga0081538_10024639 3300005981 Bacteria 4280
132 Ga0081538_10027305 3300005981 Bacteria 3962
133 Ga0081538_10033115 3300005981 Bacteria 3446
134 Ga0081538_10033283 3300005981 Bacteria 3434
135 Ga0081538_10177946 3300005981 Bacteria 915
136 Ga0081539_10000015 3300005985 Bacteria 395781
137 Ga0081539_10000883 3300005985 Bacteria 57339
138 Ga0081539_10004197 3300005985 Bacteria 16280
139 Ga0081539_10054793 3300005985 Bacteria 2223
140 Ga0070717_10000039 3300006028 Bacteria 114756
141 Ga0070717_10019333 3300006028 Bacteria 5340
142 Ga0070717_10071746 3300006028 Bacteria 2890
143 Ga0070717_10147298 3300006028 Bacteria 2034
144 Ga0075365_10070745 3300006038 Bacteria 2347
145 Ga0075365_10097565 3300006038 Bacteria 2009
146 Ga0075368_10098956 3300006042 Bacteria 1196
147 Ga0075363_100107938 3300006048 Bacteria 1545
148 Ga0075364_10011611 3300006051 Bacteria 5356
149 Ga0075432_10002229 3300006058 Bacteria 6454
150 Ga0070712_100008258 3300006175 Bacteria 6542
151 Ga0070712_100111417 3300006175 Bacteria 2043
152 Ga0070712_100296775 3300006175 Bacteria 1307
153 Ga0097621_100016528 3300006237 Bacteria 5580
154 Ga0097621_100387177 3300006237 Bacteria 1250
155 Ga0068871_100011798 3300006358 Bacteria 6422
156 Ga0068871_100291766 3300006358 Bacteria 1429
157 Ga0068871_100491794 3300006358 Bacteria 1105
158 Ga0068871_100499825 3300006358 Bacteria 1096
159 Ga0075428_100011175 3300006844 Bacteria 9990
160 Ga0075428_100610264 3300006844 Bacteria 1165
161 Ga0075431_100663103 3300006847 Bacteria 1023
162 Ga0075431_100882355 3300006847 Bacteria 865
163 Ga0075433_10031600 3300006852 Bacteria 4527
164 Ga0075433_10242562 3300006852 Bacteria 1600
165 Ga0075433_10319792 3300006852 Bacteria 1373
166 Ga0075434_100000747 3300006871 Bacteria 25566
167 Ga0075434_100037578 3300006871 Bacteria 4794
168 Ga0075434_100051034 3300006871 Bacteria 4109
169 Ga0075434_100087194 3300006871 Bacteria 3122
170 Ga0075429_100012792 3300006880 Bacteria 7279
171 Ga0068865_100027152 3300006881 Bacteria 3778
172 Ga0068865_100049917 3300006881 Bacteria 2887
173 Ga0075436_100006058 3300006914 Bacteria 8302
174 Ga0075436_100068776 3300006914 Bacteria 2446
175 Ga0075436_100166630 3300006914 Bacteria 1555
176 Ga0097620_100079365 3300006931 Bacteria 3322
177 Ga0075435_100000846 3300007076 Bacteria 19132
178 Ga0075435_100006705 3300007076 Bacteria 8166
179 Ga0075435_100098673 3300007076 Bacteria 2418
180 Ga0075435_100106971 3300007076 Bacteria 2323
181 Ga0111539_10009880 3300009094 Bacteria 12042
182 Ga0111539_10108198 3300009094 Bacteria 3262
183 Ga0111539_10154546 3300009094 Bacteria 2685
184 Ga0111539_11617846 3300009094 Bacteria 751
185 Ga0105245_10009514 3300009098 Bacteria 8473
186 Ga0105245_10009949 3300009098 Bacteria 8281
187 Ga0105245_10089043 3300009098 Bacteria 2836
188 Ga0105245_10119595 3300009098 Bacteria 2459
189 Ga0105247_10164293 3300009101 Bacteria 1472
190 Ga0105247_10207109 3300009101 Bacteria 1321
191 Ga0114129_10030158 3300009147 Bacteria 7681
192 Ga0114129_10102582 3300009147 Bacteria 3956
193 Ga0114129_10124594 3300009147 Bacteria 3543
194 Ga0114129_10490267 3300009147 Bacteria 1606
195 Ga0114129_10508740 3300009147 Bacteria 1572
196 Ga0114129_10807615 3300009147 Bacteria 1196
197 Ga0105243_10037042 3300009148 Bacteria 3788
198 Ga0105243_10089157 3300009148 Bacteria 2535
199 Ga0105243_10094384 3300009148 Bacteria 2470
200 Ga0105243_10148376 3300009148 Bacteria 2009
201 Ga0105242_10014177 3300009176 Bacteria 6173
202 Ga0105242_10118947 3300009176 Bacteria 2264
203 Ga0105248_10008537 3300009177 Bacteria 11246
204 Ga0105248_10138489 3300009177 Bacteria 2745
205 Ga0105248_11610605 3300009177 Bacteria 736
206 Ga0105237_10044037 3300009545 Bacteria 4495
207 Ga0105238_10204227 3300009551 Bacteria 1952
208 Ga0105238_10662325 3300009551 Bacteria 1054
209 Ga0105249_10013625 3300009553 Bacteria 7179
210 Ga0105249_11298605 3300009553 Bacteria 799
211 Ga0105239_10295925 3300010375 Bacteria 1823
212 Ga0105246_10045912 3300011119 Bacteria 2978
213 Ga0105246_10572640 3300011119 Bacteria 971
214 Ga0105246_10710727 3300011119 Bacteria 882
215 Ga0157374_10158228 3300013296 Bacteria 2206
216 Ga0157378_10217809 3300013297 Bacteria 1814
217 Ga0157378_10762619 3300013297 Bacteria 991
218 Ga0163162_10028612 3300013306 Bacteria 5515
219 Ga0157372_10053046 3300013307 Bacteria 4518
220 Ga0157372_10125855 3300013307 Bacteria 2946
221 Ga0157372_10721500 3300013307 Bacteria 1159
222 Ga0157372_11385403 3300013307 Bacteria 811
223 Ga0157375_10006420 3300013308 Bacteria 10248
224 Ga0157375_10134867 3300013308 Bacteria 2591
225 Ga0157375_10152451 3300013308 Bacteria 2447
226 Ga0157375_11133809 3300013308 Bacteria 916
227 Ga0163163_10012050 3300014325 Bacteria 7865
228 Ga0163163_10123213 3300014325 Bacteria 2628
229 Ga0157380_10073970 3300014326 Bacteria 2765
230 Ga0157377_10017885 3300014745 Bacteria 3676
231 Ga0157379_10094665 3300014968 Bacteria 2680
232 Ga0157379_10407504 3300014968 Bacteria 1250
233 Ga0157379_10568475 3300014968 Bacteria 1056
234 Ga0157379_10632499 3300014968 Bacteria 1001
235 Ga0157376_10015327 3300014969 Bacteria 5788
236 Ga0157376_10965077 3300014969 Bacteria 873
237 Ga0163161_10060612 3300017792 Bacteria 2754
238 Ga0163161_10085861 3300017792 Bacteria 2322
239 Ga0206356_11755497 3300020070 Bacteria 848
240 Ga0206349_1655218 3300020075 Bacteria 673
241 Ga0206355_1721947 3300020076 Bacteria 980
242 Ga0206352_11291797 3300020078 Bacteria 876
243 Ga0206352_11308055 3300020078 Bacteria 806
244 Ga0206350_10264262 3300020080 Unclassified 2292
245 Ga0206354_10847231 3300020081 Bacteria 854
246 Ga0213872_10018272 3300021361 Bacteria 3234
247 Ga0224712_10016217 3300022467 Unclassified 2442
248 Ga0224712_10089674 3300022467 Bacteria 1286
249 Ga0207653_10029276 3300025885 Bacteria 1774
250 Ga0207692_10035878 3300025898 Bacteria 2413
251 Ga0207692_10051818 3300025898 Bacteria 2082
252 Ga0207692_10192517 3300025898 Bacteria 1194
253 Ga0207642_10019492 3300025899 Bacteria 2628
254 Ga0207688_10029233 3300025901 Bacteria 3033
255 Ga0207680_10103373 3300025903 Bacteria 1834
256 Ga0207680_10263295 3300025903 Bacteria 1194
257 Ga0207699_10011098 3300025906 Bacteria 4541
258 Ga0207645_10409285 3300025907 Bacteria 913
259 Ga0207705_10188379 3300025909 Bacteria 1559
260 Ga0207684_10007381 3300025910 Bacteria 9911
261 Ga0207684_10061378 3300025910 Bacteria 3192
262 Ga0207684_10122383 3300025910 Bacteria 2231
263 Ga0207707_10019388 3300025912 Bacteria 5937
264 Ga0207707_10427958 3300025912 Bacteria 1134
265 Ga0207671_10152046 3300025914 Bacteria 1788
266 Ga0207693_10000912 3300025915 Bacteria 26521
267 Ga0207693_10007252 3300025915 Bacteria 9124
268 Ga0207693_10737181 3300025915 Bacteria 762
269 Ga0207663_10011377 3300025916 Bacteria 4777
270 Ga0207663_10092989 3300025916 Bacteria 2006
271 Ga0207663_10145618 3300025916 Bacteria 1656
272 Ga0207663_10210458 3300025916 Bacteria 1409
273 Ga0207660_10267937 3300025917 Bacteria 1352
274 Ga0207662_10016620 3300025918 Bacteria 4155
275 Ga0207662_10138769 3300025918 Bacteria 1538
276 Ga0207657_10021456 3300025919 Bacteria 6076
277 Ga0207657_10033387 3300025919 Bacteria 4639
278 Ga0207649_10579299 3300025920 Bacteria 861
279 Ga0207652_10025144 3300025921 Bacteria 4948
280 Ga0207652_10281242 3300025921 Bacteria 1501
281 Ga0207646_10001148 3300025922 Bacteria 33753
282 Ga0207646_10017091 3300025922 Bacteria 6795
283 Ga0207646_10375523 3300025922 Bacteria 1284
284 Ga0207646_10500295 3300025922 Bacteria 1095
285 Ga0207646_10792596 3300025922 Bacteria 844
286 Ga0207687_10082986 3300025927 Bacteria 2319
287 Ga0207687_10086754 3300025927 Bacteria 2273
288 Ga0207687_10262830 3300025927 Bacteria 1377
289 Ga0207687_10734168 3300025927 Bacteria 840
290 Ga0207700_10017365 3300025928 Bacteria 4805
291 Ga0207700_10474886 3300025928 Bacteria 1104
292 Ga0207664_10069307 3300025929 Bacteria 2835
293 Ga0207664_10248720 3300025929 Bacteria 1551
294 Ga0207664_10269877 3300025929 Bacteria 1490
295 Ga0207644_10043907 3300025931 Bacteria 3174
296 Ga0207644_10112914 3300025931 Bacteria 2057
297 Ga0207690_10021037 3300025932 Bacteria 4041
298 Ga0207690_10361691 3300025932 Bacteria 1150
299 Ga0207706_10035511 3300025933 Bacteria 4431
300 Ga0207686_10084720 3300025934 Bacteria 2077
301 Ga0207686_10097060 3300025934 Bacteria 1960
302 Ga0207686_10550321 3300025934 Bacteria 902
303 Ga0207709_10015517 3300025935 Bacteria 4225
304 Ga0207709_10087505 3300025935 Bacteria 2025
305 Ga0207670_10788174 3300025936 Bacteria 791
306 Ga0207669_10395866 3300025937 Bacteria 1080
307 Ga0207704_10192684 3300025938 Bacteria 1484
308 Ga0207704_10322485 3300025938 Bacteria 1192
309 Ga0207691_10005940 3300025940 Bacteria 11790
310 Ga0207691_10172685 3300025940 Bacteria 1892
311 Ga0207711_10067493 3300025941 Bacteria 3096
312 Ga0207711_10396218 3300025941 Bacteria 1282
313 Ga0207689_10308989 3300025942 Bacteria 1311
314 Ga0207661_10013523 3300025944 Bacteria 5960
315 Ga0207661_10041664 3300025944 Bacteria 3616
316 Ga0207661_10371049 3300025944 Bacteria 1294
317 Ga0207679_10324386 3300025945 Bacteria 1334
318 Ga0207679_10548140 3300025945 Bacteria 1037
319 Ga0207651_10089444 3300025960 Bacteria 2248
320 Ga0207712_10569086 3300025961 Bacteria 977
321 Ga0207712_10866136 3300025961 Bacteria 797
322 Ga0207668_10033919 3300025972 Bacteria 3385
323 Ga0207668_10477057 3300025972 Bacteria 1069
324 Ga0207640_10323551 3300025981 Bacteria 1229
325 Ga0207640_10750900 3300025981 Bacteria 841
326 Ga0207658_10734311 3300025986 Bacteria 894
327 Ga0207677_10037950 3300026023 Bacteria 3153
328 Ga0207677_10209137 3300026023 Bacteria 1557
329 Ga0207677_10290102 3300026023 Bacteria 1347
330 Ga0207703_10240150 3300026035 Bacteria 1628
331 Ga0207703_10450800 3300026035 Bacteria 1202
332 Ga0207639_10406150 3300026041 Bacteria 1228
333 Ga0207639_10742651 3300026041 Bacteria 912
334 Ga0207678_10029365 3300026067 Bacteria 4799
335 Ga0207678_10114563 3300026067 Bacteria 2300
336 Ga0207678_10859661 3300026067 Bacteria 801
337 Ga0207708_10000064 3300026075 Bacteria 85366
338 Ga0207708_10006248 3300026075 Bacteria 8826
339 Ga0207708_10008528 3300026075 Bacteria 7586
340 Ga0207708_10100290 3300026075 Bacteria 2241
341 Ga0207708_10258415 3300026075 Bacteria 1405
342 Ga0207708_10721477 3300026075 Bacteria 853
343 Ga0207702_10071319 3300026078 Bacteria 2991
344 Ga0207702_10196264 3300026078 Bacteria 1868
345 Ga0207648_10004903 3300026089 Bacteria 13627
346 Ga0207648_10073052 3300026089 Bacteria 2990
347 Ga0207648_10097797 3300026089 Bacteria 2569
348 Ga0207676_10414061 3300026095 Bacteria 1262
349 Ga0207674_10010268 3300026116 Bacteria 10624
350 Ga0207674_10015312 3300026116 Bacteria 8429
351 Ga0207674_10064849 3300026116 Bacteria 3683
352 Ga0207674_10085724 3300026116 Bacteria 3144
353 Ga0207674_10608977 3300026116 Bacteria 1055
354 Ga0207675_100037269 3300026118 Bacteria 4537
355 Ga0207675_100095058 3300026118 Bacteria 2803
356 Ga0207675_100308693 3300026118 Bacteria 1542
357 Ga0207675_100355757 3300026118 Bacteria 1436
358 Ga0207675_100588513 3300026118 Bacteria 1115
359 Ga0207683_10003207 3300026121 Bacteria 14274
360 Ga0207683_10034325 3300026121 Bacteria 4408
361 Ga0207698_10096355 3300026142 Bacteria 2438
362 Ga0207698_10121265 3300026142 Bacteria 2214
363 Ga0207698_10231507 3300026142 Bacteria 1678
364 Ga0207698_10320985 3300026142 Bacteria 1450
365 Ga0209968_1014128 3300027526 Bacteria 1256
366 Ga0210002_1004733 3300027617 Bacteria 2032
367 Ga0209971_1067519 3300027682 Bacteria 867
368 Ga0209966_1009538 3300027695 Bacteria 1735
369 Ga0209998_10079297 3300027717 Bacteria 794
370 Ga0209974_10001658 3300027876 Bacteria 8053
371 Ga0207428_10005790 3300027907 Bacteria 11470
372 Ga0207428_10061726 3300027907 Bacteria 2966
373 Ga0207428_10233972 3300027907 Bacteria 1374
374 Ga0268266_10096765 3300028379 Bacteria 2595
375 Ga0268266_10264104 3300028379 Bacteria 1596
376 Ga0268265_10262637 3300028380 Bacteria 1536
377 Ga0268265_10385233 3300028380 Bacteria 1291
378 Ga0268264_10068819 3300028381 Bacteria 2993
379 Ga0265319_1017456 3300028563 Bacteria 2728
380 Ga0265318_10021143 3300028577 Bacteria 2617
381 Ga0265323_10042830 3300028653 Unclassified 1637
382 Ga0265320_10031594 3300031240 Bacteria 2718
383 Ga0307408_100414970 3300031548 Bacteria 1159
384 Ga0307408_100459590 3300031548 Bacteria 1106
385 Ga0307408_101121829 3300031548 Bacteria 730
386 Ga0307405_10073075 3300031731 Bacteria 2213
387 Ga0307405_10099853 3300031731 Bacteria 1944
388 Ga0307405_11049573 3300031731 Bacteria 698
389 Ga0307413_10003028 3300031824 Bacteria 6983
390 Ga0307410_10019989 3300031852 Bacteria 4087
391 Ga0307410_10081416 3300031852 Bacteria 2274
392 Ga0307410_10893958 3300031852 Bacteria 760
393 Ga0307406_10011447 3300031901 Bacteria 5036
394 Ga0307406_10025789 3300031901 Bacteria 3522
395 Ga0307406_10093040 3300031901 Bacteria 2034
396 Ga0307406_10109895 3300031901 Bacteria 1896
397 Ga0307406_10410727 3300031901 Bacteria 1076
398 Ga0307407_10030258 3300031903 Bacteria 2919
399 Ga0307407_10056061 3300031903 Bacteria 2280
400 Ga0307412_10054336 3300031911 Bacteria 2658
401 Ga0307409_100025450 3300031995 Bacteria 4151
402 Ga0307409_100033546 3300031995 Bacteria 3737
403 Ga0307409_101303107 3300031995 Bacteria 751
404 Ga0307416_100016982 3300032002 Bacteria 5076
405 Ga0307416_100033208 3300032002 Bacteria 3909
406 Ga0307416_100143304 3300032002 Bacteria 2176
407 Ga0307416_100209330 3300032002 Bacteria 1858
408 Ga0307414_10200098 3300032004 Bacteria 1624
409 Ga0307414_10642001 3300032004 Bacteria 956
410 Ga0307411_10023625 3300032005 Bacteria 3646
411 Ga0307415_100000128 3300032126 Bacteria 32744
412 Ga0307415_100001638 3300032126 Bacteria 10836
413 Ga0307415_100096912 3300032126 Bacteria 2151
414 Ga0307415_100148815 3300032126 Bacteria 1799
415 Ga0373942_0118595 3300035207 Bacteria 825
416 Ga0373947_0425485 3300035725 Bacteria 898
417 Ga0373937_0235925 3300036401 Bacteria 1723
418 Ga0395899_0017934 3300037312 Bacteria 5386
419 Ga0395899_0130127 3300037312 Bacteria 1798
420 Ga0395899_0138022 3300037312 Bacteria 1737
421 Ga0395899_0526967 3300037312 Bacteria 763
422 Ga0395900_0001348 3300037418 Bacteria 29694
423 Ga0395900_0010953 3300037418 Bacteria 9273
424 Ga0395900_0028613 3300037418 Bacteria 5711
425 Ga0395900_0167597 3300037418 Bacteria 2238
426 Ga0395900_0196751 3300037418 Bacteria 2042
427 Ga0395900_0251577 3300037418 Bacteria 1768
428 Ga0395900_0279237 3300037418 Bacteria 1663
429 Ga0395900_0280881 3300037418 Bacteria 1657
430 Ga0395900_0523889 3300037418 Bacteria 1133
431 Ga0395900_0690323 3300037418 Bacteria 955
432 Ga0395898_0002653 3300037466 Bacteria 20795
433 Ga0395898_0015283 3300037466 Bacteria 7876
434 Ga0395898_0019682 3300037466 Bacteria 6865
435 Ga0395898_0317507 3300037466 Bacteria 1486
436 Ga0395905_0008903 3300037471 Bacteria 9860
437 Ga0395905_0060761 3300037471 Bacteria 3534
438 Ga0395905_0267458 3300037471 Bacteria 1595
439 Ga0395905_0821430 3300037471 Bacteria 832
440 Ga0395905_0891290 3300037471 Bacteria 793
441 Ga0395905_0922329 3300037471 Bacteria 776
442 Ga0395901_0012910 3300038443 Bacteria 8472
443 Ga0395901_0014912 3300038443 Bacteria 7897
444 Ga0395901_0134727 3300038443 Bacteria 2596
445 Ga0395901_0227200 3300038443 Bacteria 1949
446 Ga0395901_0284643 3300038443 Bacteria 1717
447 Ga0395901_0411639 3300038443 Bacteria 1388
448 Ga0395901_0636319 3300038443 Bacteria 1072
449 Ga0395901_0663629 3300038443 Bacteria 1044
450 Ga0395901_1070170 3300038443 Bacteria 778
451 Ga0436365_1808896 3300039437 Bacteria 798
452 Ga0436361_0106306 3300039447 Bacteria 5009
453 Ga0439453_0005852 3300041408 Bacteria 1892
454 Ga0451793_1066652 3300041452 Bacteria 1079
455 Ga0451849_1243941 3300041505 Bacteria 2790
456 Ga0451851_0834699 3300041507 Bacteria 771
457 Ga0439448_0094247 3300042005 Bacteria 1013
458 Ga0439450_078890 3300042008 Bacteria 817
459 Ga0439451_011910 3300042009 Bacteria 1754
460 Ga0439454_012267 3300042011 Bacteria 1160
461 Ga0450888_013991 3300042126 Bacteria 967
462 Ga0450906_001996 3300042145 Bacteria 4457
463 Ga0439444_0089383 3300042437 Bacteria 685
464 Ga0450901_016897 3300042533 Bacteria 770
465 Ga0451577_0176118 3300042876 Bacteria 1928
466 Ga0439440_0011896 3300042993 Bacteria 1842
467 Ga0466969_0359937 3300044656 Bacteria 659
468 Ga0466963_0001189 3300044694 Bacteria 13695
469 Ga0466963_0003592 3300044694 Bacteria 8914
470 Ga0466963_0015493 3300044694 Bacteria 4723
471 Ga0466963_0032098 3300044694 Bacteria 3399
472 Ga0453684_0227523 3300044712 Bacteria 2155
473 Ga0453684_0328652 3300044712 Bacteria 1730
474 Ga0466971_0051381 3300044719 Bacteria 1855
475 Ga0466959_0197468 3300045049 Bacteria 1402
476 Ga0451576_0111915 3300045051 Bacteria 2841
477 Ga0451576_0121511 3300045051 Bacteria 2719
478 Ga0451576_0253299 3300045051 Bacteria 1840
479 Ga0451576_0449542 3300045051 Bacteria 1353
480 Ga0466958_0084115 3300045836 Bacteria 1962
481 Ga0466958_0124335 3300045836 Bacteria 1617
482 Ga0466967_0072959 3300045976 Bacteria 3078
483 Ga0466967_0106309 3300045976 Bacteria 2572
484 Ga0466967_0283492 3300045976 Bacteria 1590
485 Ga0466967_0384279 3300045976 Bacteria 1363
486 Ga0466967_0453645 3300045976 Bacteria 1253
487 Ga0466967_0519420 3300045976 Bacteria 1170
488 Ga0466967_0647971 3300045976 Bacteria 1044
489 Ga0495592_0277985 3300046454 Bacteria 1096
490 Ga0495603_0012697 3300046455 Bacteria 5096
491 Ga0495603_0071764 3300046455 Bacteria 2034
492 Ga0495641_0067127 3300046461 Bacteria 1613
493 Ga0495641_0086296 3300046461 Bacteria 1405
494 Ga0495580_0588554 3300046472 Bacteria 736
495 Ga0495605_0175956 3300046474 Bacteria 943
496 Ga0495639_0129202 3300046475 Bacteria 1209
497 Ga0495584_0087923 3300046491 Bacteria 1566
498 Ga0495594_0101102 3300046499 Bacteria 1622
499 Ga0495596_0044329 3300046500 Bacteria 1751
500 Ga0495616_0113349 3300046513 Bacteria 1258
501 Ga0495637_0043019 3300046520 Bacteria 1930
502 Ga0495644_0032147 3300046523 Bacteria 1983
503 Ga0495663_0062364 3300046525 Bacteria 1174
504 Ga0495642_0009987 3300046528 Bacteria 3637
505 Ga0495642_0099504 3300046528 Bacteria 1237
506 Ga0495642_0183194 3300046528 Bacteria 912
507 Ga0495598_0076391 3300046537 Bacteria 1066
508 Ga0495598_0181902 3300046537 Bacteria 750
509 Ga0495609_0120424 3300046538 Bacteria 1129
510 Ga0495597_0098099 3300046542 Bacteria 1238
511 Ga0495633_0104839 3300046558 Bacteria 1312
512 Ga0495656_0039868 3300046615 Bacteria 1954
513 Ga0495656_0046776 3300046615 Bacteria 1832
514 Ga0495668_0249420 3300046616 Bacteria 972
515 Ga0495659_0064532 3300046664 Bacteria 1360
516 Ga0495659_0116022 3300046664 Bacteria 1050
517 Ga0495647_0034808 3300046681 Bacteria 1888
518 Ga0495669_0390827 3300046684 Bacteria 674
519 Ga0495613_0312946 3300046689 Bacteria 1085
520 Ga0495589_0043994 3300046794 Bacteria 2222
521 Ga0495589_0091756 3300046794 Bacteria 1475
522 Ga0495660_0170165 3300046810 Bacteria 1062
523 Ga0495581_0006058 3300047315 Bacteria 7010
524 Ga0495636_0208661 3300047318 Bacteria 894
525 Ga0495683_0126851 3300047323 Bacteria 1207
526 Ga0495677_0023642 3300047445 Bacteria 2230
527 Ga0495677_0103215 3300047445 Bacteria 1081
528 Ga0495685_038612 3300047447 Bacteria 1636
529 Ga0496100_0199760 3300048903 Bacteria 1456
530 Ga0496101_0783326 3300048904 Bacteria 752
531 Ga0496102_0008205 3300048905 Bacteria 8939
532 Ga0496102_0129294 3300048905 Bacteria 2363
533 Ga0496102_0130319 3300048905 Bacteria 2353
534 Ga0496102_0275907 3300048905 Bacteria 1584
535 Ga0496102_0415039 3300048905 Bacteria 1264
536 Ga0496103_0020525 3300048906 Bacteria 3969
537 Ga0496103_0120733 3300048906 Bacteria 1669
538 Ga0496104_0211139 3300048907 Bacteria 1852
539 Ga0496104_0881907 3300048907 Bacteria 800
540 Ga0496105_0046955 3300048908 Bacteria 3564
541 Ga0496105_0175846 3300048908 Bacteria 1754
542 Ga0496106_0021012 3300048909 Bacteria 4845
543 Ga0496106_0219316 3300048909 Bacteria 1517
544 Ga0496107_0051408 3300048910 Bacteria 2972
545 Ga0496108_0004620 3300048911 Bacteria 11095
546 Ga0496108_0009220 3300048911 Bacteria 7988
547 Ga0496108_0055165 3300048911 Bacteria 3336
548 Ga0496108_0072491 3300048911 Bacteria 2907
549 Ga0496108_0508742 3300048911 Bacteria 1052
550 Ga0496109_0007304 3300048912 Bacteria 9340
551 Ga0496109_0016958 3300048912 Bacteria 6374
552 Ga0496109_0216024 3300048912 Bacteria 1803
553 Ga0496109_0368971 3300048912 Bacteria 1356
554 Ga0496110_0001290 3300048913 Bacteria 17966
555 Ga0496110_0003357 3300048913 Bacteria 12221
556 Ga0496110_0005264 3300048913 Bacteria 10126
557 Ga0496110_0466222 3300048913 Bacteria 1151
558 Ga0496111_0000461 3300048914 Bacteria 20660
559 Ga0496111_0006900 3300048914 Bacteria 7410
560 Ga0496111_0337096 3300048914 Bacteria 1116
561 Ga0496112_0005671 3300048915 Bacteria 10846
562 Ga0496112_0008488 3300048915 Bacteria 9208
563 Ga0496112_0038146 3300048915 Bacteria 4691
564 Ga0496112_0052472 3300048915 Bacteria 4002
565 Ga0496112_0234389 3300048915 Bacteria 1790
566 Ga0496112_0713305 3300048915 Bacteria 930
567 Ga0496113_0024431 3300048916 Bacteria 4296
568 Ga0496113_0174888 3300048916 Bacteria 1701
569 Ga0496113_0364667 3300048916 Bacteria 1159
570 Ga0496113_0603690 3300048916 Bacteria 879
571 Ga0496113_0756440 3300048916 Bacteria 773
572 Ga0496114_0083917 3300048917 Bacteria 2696
573 Ga0496114_0482068 3300048917 Bacteria 1097
574 Ga0496115_0003769 3300048918 Bacteria 10894
575 Ga0496115_0075430 3300048918 Bacteria 2739
576 Ga0501031_0006670 3300049568 Bacteria 7534
577 Ga0501033_0072893 3300049570 Bacteria 2521
578 Ga0501033_0083409 3300049570 Bacteria 2343
579 Ga0501036_0161167 3300049572 Bacteria 1891
580 Ga0501038_0038902 3300049574 Bacteria 4163
581 Ga0501039_0008879 3300049575 Bacteria 7658
582 Ga0501039_0017202 3300049575 Bacteria 5545
583 Ga0501040_0006430 3300049576 Bacteria 7632
584 Ga0501040_0053964 3300049576 Bacteria 2755
585 Ga0501040_0488707 3300049576 Bacteria 887
586 Ga0501041_0001610 3300049577 Bacteria 12596
587 Ga0501041_0002375 3300049577 Bacteria 10651
588 Ga0501042_0031700 3300049578 Bacteria 3740
589 Ga0501042_0076790 3300049578 Bacteria 2391
590 Ga0501043_0067369 3300049579 Bacteria 2811
591 Ga0501046_0005707 3300049580 Bacteria 11103
592 Ga0501046_0070604 3300049580 Bacteria 2715
593 Ga0501046_0483407 3300049580 Bacteria 888
594 Ga0501048_0029804 3300049582 Bacteria 3952
595 Ga0501067_0354194 3300049583 Bacteria 818
596 Ga0501068_0000003 3300049584 Bacteria 94842
597 Ga0501069_0000054 3300049585 Bacteria 69210
598 Ga0501070_0080568 3300049586 Bacteria 2694
599 Ga0501070_0201013 3300049586 Bacteria 1637
600 Ga0501071_0000089 3300049587 Bacteria 33992
601 Ga0501071_0019107 3300049587 Bacteria 4755
602 Ga0501072_0009544 3300049588 Bacteria 7380
603 Ga0501072_0016861 3300049588 Bacteria 5611
604 Ga0501072_0019019 3300049588 Bacteria 5303
605 Ga0501072_0529070 3300049588 Bacteria 932
606 Ga0501073_0031573 3300049589 Bacteria 3779
607 Ga0501073_0041330 3300049589 Bacteria 3258
608 Ga0501073_0093441 3300049589 Bacteria 2090
609 Ga0501074_0003078 3300049590 Bacteria 11770
610 Ga0501074_0015425 3300049590 Bacteria 5554
611 Ga0501074_0069429 3300049590 Bacteria 2534
612 Ga0501075_0006416 3300049591 Bacteria 8097
613 Ga0501075_0017985 3300049591 Bacteria 5109
614 Ga0501076_0003152 3300049592 Bacteria 11497
615 Ga0501076_0017215 3300049592 Bacteria 5489
616 Ga0501076_0545678 3300049592 Bacteria 956
617 Ga0501076_0664030 3300049592 Bacteria 860
618 Ga0501077_0000917 3300049593 Bacteria 17746
619 Ga0501077_0016660 3300049593 Bacteria 4632
620 Ga0501256_007331 3300049685 Bacteria 1011
621 Ga0501221_024966 3300049704 Bacteria 1204
622 Ga0501079_0000220 3300049741 Bacteria 33882
623 Ga0501079_0006505 3300049741 Bacteria 8777
624 Ga0501080_0003779 3300049742 Bacteria 13371
625 Ga0501080_0061229 3300049742 Bacteria 3505
626 Ga0501080_0083174 3300049742 Bacteria 2974
627 Ga0501081_0002500 3300049743 Bacteria 11590
628 Ga0501081_0003698 3300049743 Bacteria 9792
629 Ga0501083_0046879 3300049744 Bacteria 2922
630 Ga0501045_0002451 3300049824 Bacteria 12612
631 Ga0501045_0010332 3300049824 Bacteria 6538
632 nmdc:mga03n38_78508_c1 3300050490 Bacteria 1545
633 nmdc:mga00v17_34524_c1 3300050491 Bacteria 3005
634 nmdc:mga0yw44_70730_c1 3300050492 Bacteria 2164
635 nmdc:mga0yw44_983_c1 3300050492 Bacteria 10875
636 nmdc:mga04h51_251724_c1 3300050495 Bacteria 708
637 nmdc:mga05p37_157805_c1 3300050507 Bacteria 2772
638 nmdc:mga05p37_38598_c1 3300050507 Bacteria 5859
639 nmdc:mga05p37_432220_c1 3300050507 Bacteria 1529
640 nmdc:mga05p37_57483_c1 3300050507 Bacteria 4791
641 nmdc:mga05p37_621105_c1 3300050507 Bacteria 1216
642 nmdc:mga05p37_626975_c1 3300050507 Bacteria 1209
643 nmdc:mga05p37_82586_c1 3300050507 Bacteria 3959
644 nmdc:mga09592_28431_c1 3300050508 Bacteria 4644
645 nmdc:mga09592_351865_c1 3300050508 Bacteria 1275
646 nmdc:mga0qj67_920458_c1 3300050509 Bacteria 688
647 nmdc:mga06r32_305499_c1 3300050510 Bacteria 1576
648 nmdc:mga06r32_453812_c1 3300050510 Bacteria 1261
649 nmdc:mga08y16_144508_c1 3300050511 Bacteria 2473
650 nmdc:mga08y16_168772_c1 3300050511 Bacteria 2273
651 nmdc:mga08y16_20167_c1 3300050511 Bacteria 7035
652 nmdc:mga08y16_249144_c1 3300050511 Bacteria 1835
653 nmdc:mga08y16_501039_c1 3300050511 Bacteria 1234
654 nmdc:mga08y16_559957_c1 3300050511 Bacteria 1156
655 nmdc:mga0n895_15131_c1 3300050512 Bacteria 7030
656 nmdc:mga0n895_59370_c1 3300050512 Bacteria 3773
657 nmdc:mga0rr50_434314_c1 3300050513 Bacteria 1112
658 nmdc:mga0rr50_49031_c1 3300050513 Bacteria 3125
659 nmdc:mga0rr50_5555_c1 3300050513 Bacteria 7539
660 nmdc:mga08x19_44995_c1 3300050514 Bacteria 2820
661 nmdc:mga0a205_170553_c1 3300050515 Bacteria 2072
662 nmdc:mga0a205_61508_c1 3300050515 Bacteria 3627
663 nmdc:mga0a205_67509_c1 3300050515 Bacteria 3455
664 nmdc:mga0a205_80419_c1 3300050515 Bacteria 3149
665 Ga0495655_0020344 3300053083 Bacteria 1488
666 Ga0500641_0000754 3300053096 Bacteria 11744
667 Ga0501084_0006381 3300054114 Bacteria 9689
668 Ga0501084_0013770 3300054114 Bacteria 6693
669 Ga0501084_0248750 3300054114 Bacteria 1501
670 Ga0590077_029554 3300059426 Bacteria 1192
671 Ga0501082_0002502 3300060353 Bacteria 16095
672 Ga0501082_0004501 3300060353 Bacteria 12177
673 Ga0466962_0010629 3300061719 Bacteria 4428
674 Ga0530510_0001346 3300061734 Bacteria 16432
675 Ga0530510_0001751 3300061734 Bacteria 14792
676 Ga0530510_0012412 3300061734 Bacteria 5985
677 Ga0530510_0065350 3300061734 Bacteria 2636
678 2899372073 2899370129 Bacteria 6781179
679 JGI24744J21845_10009119
680 2214900756
681 ARcpr5yngRDRAFT_c003336
682 ARSoilOldRDRAFT_c001721
683 ARCol0yngRDRAFT_1000604
684 JGI24742J22300_10019868
685 JGI25407J50210_10003194
686 JGI25407J50210_10005048
687 Ga0065716_1003252
688 Ga0070658_10287760
689 Ga0070658_10733611
690 Ga0070683_100001370
691 Ga0070683_100039688
692 Ga0070683_100067579
693 Ga0070683_101003468
694 Ga0070690_100037930
695 Ga0070670_100688595
696 Ga0070666_10167704
697 Ga0070666_10398946
698 Ga0070680_100026791
699 Ga0070680_100161238
700 Ga0068868_100035495
701 Ga0068868_100091875
702 Ga0070660_100053174
703 Ga0070660_100324309
704 Ga0070689_100005116
705 Ga0070691_10025012
706 Ga0070687_100118614
707 Ga0070661_100055833
708 Ga0070692_10034155
709 Ga0070692_10077486
710 Ga0070668_100066601
711 Ga0070671_100038904
712 Ga0070674_100068689
713 Ga0070673_100058371
714 Ga0070688_100088842
715 Ga0070688_100098489
716 Ga0070659_100120129
717 Ga0070659_100443271
718 Ga0070703_10017313
719 Ga0070703_10121984
720 Ga0070709_10005906
721 Ga0070714_100000784
722 Ga0070714_100001536
723 Ga0070714_100200410
724 Ga0070713_100575513
725 Ga0070710_10005619
726 Ga0070710_10052616
727 Ga0070701_10002141
728 Ga0070711_100002059
729 Ga0070711_100006096
730 Ga0070711_100049296
731 Ga0070705_100087729
732 Ga0070700_100011551
733 Ga0070700_100097184
734 Ga0070700_100644130
735 Ga0070694_100058848
736 Ga0070708_100001150
737 Ga0070708_100027099
738 Ga0070708_100704136
739 Ga0070663_100027566
740 Ga0070663_100163815
741 Ga0070678_100100997
742 Ga0070678_100284862
743 Ga0070662_100093184
744 Ga0070681_10042504
745 Ga0070681_10090731
746 Ga0068867_100030518
747 Ga0068867_100209418
748 Ga0068867_100591024
749 Ga0070685_10015121
750 Ga0070706_100000886
751 Ga0070706_100007989
752 Ga0070706_100146866
753 Ga0070707_100000368
754 Ga0070707_100004906
755 Ga0070707_100301695
756 Ga0070707_100550665
757 Ga0070698_100024242
758 Ga0070698_100171059
759 Ga0070698_100771625
760 Ga0070698_100811525
761 Ga0070699_100085146
762 Ga0070679_100507057
763 Ga0070684_100042421
764 Ga0070684_100195984
765 Ga0070684_100701183
766 Ga0068853_100073941
767 Ga0068853_101148275
768 Ga0070672_100122428
769 Ga0070672_100727635
770 Ga0070686_100002779
771 Ga0070686_100070662
772 Ga0070686_100251648
773 Ga0070696_100009904
774 Ga0070696_100168488
775 Ga0070693_100027257
776 Ga0070693_100078429
777 Ga0070693_100107551
778 Ga0070665_100055414
779 Ga0070665_100802974
780 Ga0068855_100229722
781 Ga0070664_100060207
782 Ga0070664_100123314
783 Ga0070664_100157679
784 Ga0070664_100697616
785 Ga0068857_100272920
786 Ga0068857_100310495
787 Ga0068856_100061413
788 Ga0068856_100065147
789 Ga0068856_100157493
790 Ga0070702_100005514
791 Ga0070702_100069860
792 Ga0068852_100079967
793 Ga0068852_100316674
794 Ga0068852_100333983
795 Ga0068852_100588817
796 Ga0068859_100079366
797 Ga0068866_10006037
798 Ga0068861_100021468
799 Ga0068861_100801723
800 Ga0068863_100010816
801 Ga0068862_100388511
802 Ga0081455_10015812
803 Ga0081455_10023437
804 Ga0081455_10031296
805 Ga0081538_10000305
806 Ga0081538_10000694
807 Ga0081538_10001618
808 Ga0081538_10001707
809 Ga0081538_10024639
810 Ga0081538_10027305
811 Ga0081538_10033115
812 Ga0081538_10033283
813 Ga0081538_10177946
814 Ga0081539_10000015
815 Ga0081539_10000883
816 Ga0081539_10004197
817 Ga0081539_10054793
818 Ga0070717_10000039
819 Ga0070717_10019333
820 Ga0070717_10071746
821 Ga0070717_10147298
822 Ga0075365_10070745
823 Ga0075365_10097565
824 Ga0075368_10098956
825 Ga0075363_100107938
826 Ga0075364_10011611
827 Ga0075432_10002229
828 Ga0070712_100008258
829 Ga0070712_100111417
830 Ga0070712_100296775
831 Ga0097621_100016528
832 Ga0097621_100387177
833 Ga0068871_100011798
834 Ga0068871_100291766
835 Ga0068871_100491794
836 Ga0068871_100499825
837 Ga0075428_100011175
838 Ga0075428_100610264
839 Ga0075431_100663103
840 Ga0075431_100882355
841 Ga0075433_10031600
842 Ga0075433_10242562
843 Ga0075433_10319792
844 Ga0075434_100000747
845 Ga0075434_100037578
846 Ga0075434_100051034
847 Ga0075434_100087194
848 Ga0075429_100012792
849 Ga0068865_100027152
850 Ga0068865_100049917
851 Ga0075436_100006058
852 Ga0075436_100068776
853 Ga0075436_100166630
854 Ga0097620_100079365
855 Ga0075435_100000846
856 Ga0075435_100006705
857 Ga0075435_100098673
858 Ga0075435_100106971
859 Ga0111539_10009880
860 Ga0111539_10108198
861 Ga0111539_10154546
862 Ga0111539_11617846
863 Ga0105245_10009514
864 Ga0105245_10009949
865 Ga0105245_10089043
866 Ga0105245_10119595
867 Ga0105247_10164293
868 Ga0105247_10207109
869 Ga0114129_10030158
870 Ga0114129_10102582
871 Ga0114129_10124594
872 Ga0114129_10490267
873 Ga0114129_10508740
874 Ga0114129_10807615
875 Ga0105243_10037042
876 Ga0105243_10089157
877 Ga0105243_10094384
878 Ga0105243_10148376
879 Ga0105242_10014177
880 Ga0105242_10118947
881 Ga0105248_10008537
882 Ga0105248_10138489
883 Ga0105248_11610605
884 Ga0105237_10044037
885 Ga0105238_10204227
886 Ga0105238_10662325
887 Ga0105249_10013625
888 Ga0105249_11298605
889 Ga0105239_10295925
890 Ga0105246_10045912
891 Ga0105246_10572640
892 Ga0105246_10710727
893 Ga0157374_10158228
894 Ga0157378_10217809
895 Ga0157378_10762619
896 Ga0163162_10028612
897 Ga0157372_10053046
898 Ga0157372_10125855
899 Ga0157372_10721500
900 Ga0157372_11385403
901 Ga0157375_10006420
902 Ga0157375_10134867
903 Ga0157375_10152451
904 Ga0157375_11133809
905 Ga0163163_10012050
906 Ga0163163_10123213
907 Ga0157380_10073970
908 Ga0157377_10017885
909 Ga0157379_10094665
910 Ga0157379_10407504
911 Ga0157379_10568475
912 Ga0157379_10632499
913 Ga0157376_10015327
914 Ga0157376_10965077
915 Ga0163161_10060612
916 Ga0163161_10085861
917 Ga0206356_11755497
918 Ga0206349_1655218
919 Ga0206355_1721947
920 Ga0206352_11291797
921 Ga0206352_11308055
922 Ga0206350_10264262
923 Ga0206354_10847231
924 Ga0213872_10018272
925 Ga0224712_10016217
926 Ga0224712_10089674
927 Ga0207653_10029276
928 Ga0207692_10035878
929 Ga0207692_10051818
930 Ga0207692_10192517
931 Ga0207642_10019492
932 Ga0207688_10029233
933 Ga0207680_10103373
934 Ga0207680_10263295
935 Ga0207699_10011098
936 Ga0207645_10409285
937 Ga0207705_10188379
938 Ga0207684_10007381
939 Ga0207684_10061378
940 Ga0207684_10122383
941 Ga0207707_10019388
942 Ga0207707_10427958
943 Ga0207671_10152046
944 Ga0207693_10000912
945 Ga0207693_10007252
946 Ga0207693_10737181
947 Ga0207663_10011377
948 Ga0207663_10092989
949 Ga0207663_10145618
950 Ga0207663_10210458
951 Ga0207660_10267937
952 Ga0207662_10016620
953 Ga0207662_10138769
954 Ga0207657_10021456
955 Ga0207657_10033387
956 Ga0207649_10579299
957 Ga0207652_10025144
958 Ga0207652_10281242
959 Ga0207646_10001148
960 Ga0207646_10017091
961 Ga0207646_10375523
962 Ga0207646_10500295
963 Ga0207646_10792596
964 Ga0207687_10082986
965 Ga0207687_10086754
966 Ga0207687_10262830
967 Ga0207687_10734168
968 Ga0207700_10017365
969 Ga0207700_10474886
970 Ga0207664_10069307
971 Ga0207664_10248720
972 Ga0207664_10269877
973 Ga0207644_10043907
974 Ga0207644_10112914
975 Ga0207690_10021037
976 Ga0207690_10361691
977 Ga0207706_10035511
978 Ga0207686_10084720
979 Ga0207686_10097060
980 Ga0207686_10550321
981 Ga0207709_10015517
982 Ga0207709_10087505
983 Ga0207670_10788174
984 Ga0207669_10395866
985 Ga0207704_10192684
986 Ga0207704_10322485
987 Ga0207691_10005940
988 Ga0207691_10172685
989 Ga0207711_10067493
990 Ga0207711_10396218
991 Ga0207689_10308989
992 Ga0207661_10013523
993 Ga0207661_10041664
994 Ga0207661_10371049
995 Ga0207679_10324386
996 Ga0207679_10548140
997 Ga0207651_10089444
998 Ga0207712_10569086
999 Ga0207712_10866136
1000 Ga0207668_10033919
1001 Ga0207668_10477057
1002 Ga0207640_10323551
1003 Ga0207640_10750900
1004 Ga0207658_10734311
1005 Ga0207677_10037950
1006 Ga0207677_10209137
1007 Ga0207677_10290102
1008 Ga0207703_10240150
1009 Ga0207703_10450800
1010 Ga0207639_10406150
1011 Ga0207639_10742651
1012 Ga0207678_10029365
1013 Ga0207678_10114563
1014 Ga0207678_10859661
1015 Ga0207708_10000064
1016 Ga0207708_10006248
1017 Ga0207708_10008528
1018 Ga0207708_10100290
1019 Ga0207708_10258415
1020 Ga0207708_10721477
1021 Ga0207702_10071319
1022 Ga0207702_10196264
1023 Ga0207648_10004903
1024 Ga0207648_10073052
1025 Ga0207648_10097797
1026 Ga0207676_10414061
1027 Ga0207674_10010268
1028 Ga0207674_10015312
1029 Ga0207674_10064849
1030 Ga0207674_10085724
1031 Ga0207674_10608977
1032 Ga0207675_100037269
1033 Ga0207675_100095058
1034 Ga0207675_100308693
1035 Ga0207675_100355757
1036 Ga0207675_100588513
1037 Ga0207683_10003207
1038 Ga0207683_10034325
1039 Ga0207698_10096355
1040 Ga0207698_10121265
1041 Ga0207698_10231507
1042 Ga0207698_10320985
1043 Ga0209968_1014128
1044 Ga0210002_1004733
1045 Ga0209971_1067519
1046 Ga0209966_1009538
1047 Ga0209998_10079297
1048 Ga0209974_10001658
1049 Ga0207428_10005790
1050 Ga0207428_10061726
1051 Ga0207428_10233972
1052 Ga0268266_10096765
1053 Ga0268266_10264104
1054 Ga0268265_10262637
1055 Ga0268265_10385233
1056 Ga0268264_10068819
1057 Ga0265319_1017456
1058 Ga0265318_10021143
1059 Ga0265323_10042830
1060 Ga0265320_10031594
1061 Ga0307408_100414970
1062 Ga0307408_100459590
1063 Ga0307408_101121829
1064 Ga0307405_10073075
1065 Ga0307405_10099853
1066 Ga0307405_11049573
1067 Ga0307413_10003028
1068 Ga0307410_10019989
1069 Ga0307410_10081416
1070 Ga0307410_10893958
1071 Ga0307406_10011447
1072 Ga0307406_10025789
1073 Ga0307406_10093040
1074 Ga0307406_10109895
1075 Ga0307406_10410727
1076 Ga0307407_10030258
1077 Ga0307407_10056061
1078 Ga0307412_10054336
1079 Ga0307409_100025450
1080 Ga0307409_100033546
1081 Ga0307409_101303107
1082 Ga0307416_100016982
1083 Ga0307416_100033208
1084 Ga0307416_100143304
1085 Ga0307416_100209330
1086 Ga0307414_10200098
1087 Ga0307414_10642001
1088 Ga0307411_10023625
1089 Ga0307415_100000128
1090 Ga0307415_100001638
1091 Ga0307415_100096912
1092 Ga0307415_100148815
1093 Ga0373942_0118595
1094 Ga0373947_0425485
1095 Ga0373937_0235925
1096 Ga0395899_0017934
1097 Ga0395899_0130127
1098 Ga0395899_0138022
1099 Ga0395899_0526967
1100 Ga0395900_0001348
1101 Ga0395900_0010953
1102 Ga0395900_0028613
1103 Ga0395900_0167597
1104 Ga0395900_0196751
1105 Ga0395900_0251577
1106 Ga0395900_0279237
1107 Ga0395900_0280881
1108 Ga0395900_0523889
1109 Ga0395900_0690323
1110 Ga0395898_0002653
1111 Ga0395898_0015283
1112 Ga0395898_0019682
1113 Ga0395898_0317507
1114 Ga0395905_0008903
1115 Ga0395905_0060761
1116 Ga0395905_0267458
1117 Ga0395905_0821430
1118 Ga0395905_0891290
1119 Ga0395905_0922329
1120 Ga0395901_0012910
1121 Ga0395901_0014912
1122 Ga0395901_0134727
1123 Ga0395901_0227200
1124 Ga0395901_0284643
1125 Ga0395901_0411639
1126 Ga0395901_0636319
1127 Ga0395901_0663629
1128 Ga0395901_1070170
1129 Ga0436365_1808896
1130 Ga0436361_0106306
1131 Ga0439453_0005852
1132 Ga0451793_1066652
1133 Ga0451849_1243941
1134 Ga0451851_0834699
1135 Ga0439448_0094247
1136 Ga0439450_078890
1137 Ga0439451_011910
1138 Ga0439454_012267
1139 Ga0450888_013991
1140 Ga0450906_001996
1141 Ga0439444_0089383
1142 Ga0450901_016897
1143 Ga0451577_0176118
1144 Ga0439440_0011896
1145 Ga0466969_0359937
1146 Ga0466963_0001189
1147 Ga0466963_0003592
1148 Ga0466963_0015493
1149 Ga0466963_0032098
1150 Ga0453684_0227523
1151 Ga0453684_0328652
1152 Ga0466971_0051381
1153 Ga0466959_0197468
1154 Ga0451576_0111915
1155 Ga0451576_0121511
1156 Ga0451576_0253299
1157 Ga0451576_0449542
1158 Ga0466958_0084115
1159 Ga0466958_0124335
1160 Ga0466967_0072959
1161 Ga0466967_0106309
1162 Ga0466967_0283492
1163 Ga0466967_0384279
1164 Ga0466967_0453645
1165 Ga0466967_0519420
1166 Ga0466967_0647971
1167 Ga0495592_0277985
1168 Ga0495603_0012697
1169 Ga0495603_0071764
1170 Ga0495641_0067127
1171 Ga0495641_0086296
1172 Ga0495580_0588554
1173 Ga0495605_0175956
1174 Ga0495639_0129202
1175 Ga0495584_0087923
1176 Ga0495594_0101102
1177 Ga0495596_0044329
1178 Ga0495616_0113349
1179 Ga0495637_0043019
1180 Ga0495644_0032147
1181 Ga0495663_0062364
1182 Ga0495642_0009987
1183 Ga0495642_0099504
1184 Ga0495642_0183194
1185 Ga0495598_0076391
1186 Ga0495598_0181902
1187 Ga0495609_0120424
1188 Ga0495597_0098099
1189 Ga0495633_0104839
1190 Ga0495656_0039868
1191 Ga0495656_0046776
1192 Ga0495668_0249420
1193 Ga0495659_0064532
1194 Ga0495659_0116022
1195 Ga0495647_0034808
1196 Ga0495669_0390827
1197 Ga0495613_0312946
1198 Ga0495589_0043994
1199 Ga0495589_0091756
1200 Ga0495660_0170165
1201 Ga0495581_0006058
1202 Ga0495636_0208661
1203 Ga0495683_0126851
1204 Ga0495677_0023642
1205 Ga0495677_0103215
1206 Ga0495685_038612
1207 Ga0496100_0199760
1208 Ga0496101_0783326
1209 Ga0496102_0008205
1210 Ga0496102_0129294
1211 Ga0496102_0130319
1212 Ga0496102_0275907
1213 Ga0496102_0415039
1214 Ga0496103_0020525
1215 Ga0496103_0120733
1216 Ga0496104_0211139
1217 Ga0496104_0881907
1218 Ga0496105_0046955
1219 Ga0496105_0175846
1220 Ga0496106_0021012
1221 Ga0496106_0219316
1222 Ga0496107_0051408
1223 Ga0496108_0004620
1224 Ga0496108_0009220
1225 Ga0496108_0055165
1226 Ga0496108_0072491
1227 Ga0496108_0508742
1228 Ga0496109_0007304
1229 Ga0496109_0016958
1230 Ga0496109_0216024
1231 Ga0496109_0368971
1232 Ga0496110_0001290
1233 Ga0496110_0003357
1234 Ga0496110_0005264
1235 Ga0496110_0466222
1236 Ga0496111_0000461
1237 Ga0496111_0006900
1238 Ga0496111_0337096
1239 Ga0496112_0005671
1240 Ga0496112_0008488
1241 Ga0496112_0038146
1242 Ga0496112_0052472
1243 Ga0496112_0234389
1244 Ga0496112_0713305
1245 Ga0496113_0024431
1246 Ga0496113_0174888
1247 Ga0496113_0364667
1248 Ga0496113_0603690
1249 Ga0496113_0756440
1250 Ga0496114_0083917
1251 Ga0496114_0482068
1252 Ga0496115_0003769
1253 Ga0496115_0075430
1254 Ga0501031_0006670
1255 Ga0501033_0072893
1256 Ga0501033_0083409
1257 Ga0501036_0161167
1258 Ga0501038_0038902
1259 Ga0501039_0008879
1260 Ga0501039_0017202
1261 Ga0501040_0006430
1262 Ga0501040_0053964
1263 Ga0501040_0488707
1264 Ga0501041_0001610
1265 Ga0501041_0002375
1266 Ga0501042_0031700
1267 Ga0501042_0076790
1268 Ga0501043_0067369
1269 Ga0501046_0005707
1270 Ga0501046_0070604
1271 Ga0501046_0483407
1272 Ga0501048_0029804
1273 Ga0501067_0354194
1274 Ga0501068_0000003
1275 Ga0501069_0000054
1276 Ga0501070_0080568
1277 Ga0501070_0201013
1278 Ga0501071_0000089
1279 Ga0501071_0019107
1280 Ga0501072_0009544
1281 Ga0501072_0016861
1282 Ga0501072_0019019
1283 Ga0501072_0529070
1284 Ga0501073_0031573
1285 Ga0501073_0041330
1286 Ga0501073_0093441
1287 Ga0501074_0003078
1288 Ga0501074_0015425
1289 Ga0501074_0069429
1290 Ga0501075_0006416
1291 Ga0501075_0017985
1292 Ga0501076_0003152
1293 Ga0501076_0017215
1294 Ga0501076_0545678
1295 Ga0501076_0664030
1296 Ga0501077_0000917
1297 Ga0501077_0016660
1298 Ga0501256_007331
1299 Ga0501221_024966
1300 Ga0501079_0000220
1301 Ga0501079_0006505
1302 Ga0501080_0003779
1303 Ga0501080_0061229
1304 Ga0501080_0083174
1305 Ga0501081_0002500
1306 Ga0501081_0003698
1307 Ga0501083_0046879
1308 Ga0501045_0002451
1309 Ga0501045_0010332
1310 nmdc:mga03n38_78508_c1
1311 nmdc:mga00v17_34524_c1
1312 nmdc:mga0yw44_70730_c1
1313 nmdc:mga0yw44_983_c1
1314 nmdc:mga04h51_251724_c1
1315 nmdc:mga05p37_157805_c1
1316 nmdc:mga05p37_38598_c1
1317 nmdc:mga05p37_432220_c1
1318 nmdc:mga05p37_57483_c1
1319 nmdc:mga05p37_621105_c1
1320 nmdc:mga05p37_626975_c1
1321 nmdc:mga05p37_82586_c1
1322 nmdc:mga09592_28431_c1
1323 nmdc:mga09592_351865_c1
1324 nmdc:mga0qj67_920458_c1
1325 nmdc:mga06r32_305499_c1
1326 nmdc:mga06r32_453812_c1
1327 nmdc:mga08y16_144508_c1
1328 nmdc:mga08y16_168772_c1
1329 nmdc:mga08y16_20167_c1
1330 nmdc:mga08y16_249144_c1
1331 nmdc:mga08y16_501039_c1
1332 nmdc:mga08y16_559957_c1
1333 nmdc:mga0n895_15131_c1
1334 nmdc:mga0n895_59370_c1
1335 nmdc:mga0rr50_434314_c1
1336 nmdc:mga0rr50_49031_c1
1337 nmdc:mga0rr50_5555_c1
1338 nmdc:mga08x19_44995_c1
1339 nmdc:mga0a205_170553_c1
1340 nmdc:mga0a205_61508_c1
1341 nmdc:mga0a205_67509_c1
1342 nmdc:mga0a205_80419_c1
1343 Ga0495655_0020344
1344 Ga0500641_0000754
1345 Ga0501084_0006381
1346 Ga0501084_0013770
1347 Ga0501084_0248750
1348 Ga0590077_029554
1349 Ga0501082_0002502
1350 Ga0501082_0004501
1351 Ga0466962_0010629
1352 Ga0530510_0001346
1353 Ga0530510_0001751
1354 Ga0530510_0012412
1355 Ga0530510_0065350
1356 2899372073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

67

212

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.8916 47 191
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.8874 45 191
2xts-assembly1.cif.gz_C crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.8835 39 175
2bii-assembly1.cif.gz_A crystal structure of nitrate-reducing fragment of assimilatory nitrate reductase from pichia angusta 0.8807 37 182
1ogp-assembly3.cif.gz_E the crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals 0.8679 44 186
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8936 42 191 3.90.420.10
2xtsA01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8886 39 175 3.90.420.10
2biiB01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8806 37 182 3.90.420.10
af_I1N786_1_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8579 44 186 3.90.420.10
af_P11035_116_359_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8516 40 181 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A536DRT5-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9871 47 201
AF-A0A537VYY2-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.984 74 201
AF-A0A2V6AJT6-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9836 59 201
AF-A0A536DRT5-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9808 47 201
AF-A0A537VYY2-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9764 74 201

Map