F474040
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 669 | 329 | 655 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300048909|Ga0496106_0219403|Ga0496106_0219403_139_828 |
| Length | 229 |
| Sequence | VSGAAFISLCGAKWYHAGIGLILFDVARIPYSTAMRQAEITRNTLETQITVRLNLDGTGVSKLQTGIGFLDHMLDQIARHGLIDLEVDAKGDLHIDGHHTVEDIGISIGQALAKAWGDKKGLRRYGHAYVPLDEALSRVVIDLSGRPGLEYHVPFTRSMIGELDVDLVYEFFQGLVNHAGATLHIDNLRGINSHHQAETVFKAFGRALRMAVEVDPRMAGVIPSTKGSL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 2 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 3 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 4 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 5 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 6 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 7 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 8 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 9 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 10 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 11 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 12 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 13 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 14 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 15 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 120 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 188 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 189 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 194 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 200 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 201 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 203 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 204 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 207 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 214 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 215 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 224 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 229 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 232 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 233 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 234 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 235 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 236 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 237 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 238 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 239 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 240 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 241 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 242 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 243 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 246 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 247 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 248 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 249 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 250 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 251 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 270 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 273 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 276 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 277 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 278 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 312 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 320 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 321 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 322 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 324 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 325 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 327 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 328 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.16 |
| Metatranscriptomes | 0.75 |
| Isolates | 2.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.84 |
| Nodule | 0 |
| Rhizoplane | 2.09 |
| Rhizosphere | 90.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055538_1000038 | 3300003751 | Bacteria | 186588 |
| 2 | Ga0055539_1000049 | 3300003752 | Bacteria | 186588 |
| 3 | Ga0055533_1000060 | 3300003756 | Bacteria | 186588 |
| 4 | Ga0055525_1000068 | 3300003759 | Bacteria | 186588 |
| 5 | Ga0055541_1000036 | 3300003841 | Bacteria | 186588 |
| 6 | Ga0070676_10007085 | 3300005328 | Bacteria | 6003 |
| 7 | Ga0070670_100006889 | 3300005331 | Bacteria | 9631 |
| 8 | Ga0070670_100016600 | 3300005331 | Bacteria | 6318 |
| 9 | Ga0070670_100051454 | 3300005331 | Bacteria | 3537 |
| 10 | Ga0070670_100140615 | 3300005331 | Bacteria | 2087 |
| 11 | Ga0070670_100265135 | 3300005331 | Bacteria | 1498 |
| 12 | Ga0070670_100330054 | 3300005331 | Bacteria | 1338 |
| 13 | Ga0070670_100351953 | 3300005331 | Bacteria | 1294 |
| 14 | Ga0070670_100460511 | 3300005331 | Bacteria | 1128 |
| 15 | Ga0070670_100545016 | 3300005331 | Bacteria | 1035 |
| 16 | Ga0068869_100007578 | 3300005334 | Bacteria | 6945 |
| 17 | Ga0068869_100008290 | 3300005334 | Bacteria | 6694 |
| 18 | Ga0068869_100407832 | 3300005334 | Bacteria | 1119 |
| 19 | Ga0068869_100547133 | 3300005334 | Bacteria | 972 |
| 20 | Ga0068869_101059741 | 3300005334 | Bacteria | 708 |
| 21 | Ga0070666_10049642 | 3300005335 | Bacteria | 2820 |
| 22 | Ga0070680_100063149 | 3300005336 | Bacteria | 3033 |
| 23 | Ga0070682_100425772 | 3300005337 | Bacteria | 1010 |
| 24 | Ga0068868_100043354 | 3300005338 | Bacteria | 3514 |
| 25 | Ga0068868_100047324 | 3300005338 | Bacteria | 3370 |
| 26 | Ga0068868_100090657 | 3300005338 | Bacteria | 2462 |
| 27 | Ga0070660_100351838 | 3300005339 | Bacteria | 1213 |
| 28 | Ga0070689_100013740 | 3300005340 | Bacteria | 5866 |
| 29 | Ga0070689_100352155 | 3300005340 | Bacteria | 1235 |
| 30 | Ga0070691_10338831 | 3300005341 | Bacteria | 832 |
| 31 | Ga0070661_100029556 | 3300005344 | Bacteria | 3956 |
| 32 | Ga0070668_100039737 | 3300005347 | Bacteria | 3598 |
| 33 | Ga0070669_100011337 | 3300005353 | Bacteria | 6327 |
| 34 | Ga0070669_100022069 | 3300005353 | Bacteria | 4553 |
| 35 | Ga0070669_100197570 | 3300005353 | Bacteria | 1581 |
| 36 | Ga0070675_100000345 | 3300005354 | Bacteria | 31378 |
| 37 | Ga0070675_100026716 | 3300005354 | Bacteria | 4632 |
| 38 | Ga0070675_100128969 | 3300005354 | Bacteria | 2154 |
| 39 | Ga0070671_100004354 | 3300005355 | Bacteria | 11196 |
| 40 | Ga0070671_100230216 | 3300005355 | Bacteria | 1573 |
| 41 | Ga0070671_100298584 | 3300005355 | Bacteria | 1371 |
| 42 | Ga0070671_100418935 | 3300005355 | Bacteria | 1147 |
| 43 | Ga0070674_100007024 | 3300005356 | Bacteria | 6616 |
| 44 | Ga0070674_100017660 | 3300005356 | Bacteria | 4495 |
| 45 | Ga0070674_100271873 | 3300005356 | Bacteria | 1339 |
| 46 | Ga0070674_100430987 | 3300005356 | Bacteria | 1084 |
| 47 | Ga0070674_100824499 | 3300005356 | Bacteria | 803 |
| 48 | Ga0070673_100054198 | 3300005364 | Bacteria | 3154 |
| 49 | Ga0070673_100272128 | 3300005364 | Bacteria | 1483 |
| 50 | Ga0070673_100344370 | 3300005364 | Bacteria | 1321 |
| 51 | Ga0070673_101190370 | 3300005364 | Bacteria | 714 |
| 52 | Ga0070688_100327212 | 3300005365 | Bacteria | 1115 |
| 53 | Ga0070667_100002153 | 3300005367 | Bacteria | 17348 |
| 54 | Ga0070667_100055691 | 3300005367 | Bacteria | 3339 |
| 55 | Ga0070667_100063550 | 3300005367 | Bacteria | 3129 |
| 56 | Ga0070667_100137227 | 3300005367 | Bacteria | 2139 |
| 57 | Ga0070667_100214749 | 3300005367 | Bacteria | 1711 |
| 58 | Ga0070667_100405091 | 3300005367 | Bacteria | 1242 |
| 59 | Ga0070714_100016095 | 3300005435 | Bacteria | 6029 |
| 60 | Ga0070711_100076373 | 3300005439 | Bacteria | 2375 |
| 61 | Ga0070705_100098308 | 3300005440 | Bacteria | 1841 |
| 62 | Ga0070694_100194439 | 3300005444 | Bacteria | 1508 |
| 63 | Ga0070708_100249928 | 3300005445 | Bacteria | 1666 |
| 64 | Ga0070678_100002860 | 3300005456 | Bacteria | 9558 |
| 65 | Ga0070678_100013673 | 3300005456 | Bacteria | 5099 |
| 66 | Ga0070678_100450889 | 3300005456 | Bacteria | 1127 |
| 67 | Ga0070678_100655736 | 3300005456 | Bacteria | 942 |
| 68 | Ga0070678_100960374 | 3300005456 | Bacteria | 784 |
| 69 | Ga0070678_101225191 | 3300005456 | Bacteria | 696 |
| 70 | Ga0070662_100125520 | 3300005457 | Bacteria | 1972 |
| 71 | Ga0070681_10056629 | 3300005458 | Bacteria | 3901 |
| 72 | Ga0070681_10507030 | 3300005458 | Bacteria | 1120 |
| 73 | Ga0068867_100004068 | 3300005459 | Bacteria | 10294 |
| 74 | Ga0068867_100005656 | 3300005459 | Bacteria | 8863 |
| 75 | Ga0068867_100042758 | 3300005459 | Bacteria | 3316 |
| 76 | Ga0068867_100387254 | 3300005459 | Bacteria | 1176 |
| 77 | Ga0068867_100754424 | 3300005459 | Bacteria | 864 |
| 78 | Ga0070706_100256514 | 3300005467 | Bacteria | 1632 |
| 79 | Ga0070706_100414112 | 3300005467 | Bacteria | 1255 |
| 80 | Ga0070707_100456444 | 3300005468 | Bacteria | 1238 |
| 81 | Ga0070707_100828959 | 3300005468 | Bacteria | 889 |
| 82 | Ga0070698_100126714 | 3300005471 | Bacteria | 2510 |
| 83 | Ga0070699_100582674 | 3300005518 | Bacteria | 1019 |
| 84 | Ga0070679_100005476 | 3300005530 | Bacteria | 11765 |
| 85 | Ga0070679_100007684 | 3300005530 | Bacteria | 10093 |
| 86 | Ga0070679_100121699 | 3300005530 | Bacteria | 2594 |
| 87 | Ga0070679_100201319 | 3300005530 | Bacteria | 1957 |
| 88 | Ga0070684_100229658 | 3300005535 | Bacteria | 1694 |
| 89 | Ga0070697_100143990 | 3300005536 | Bacteria | 2005 |
| 90 | Ga0068853_100035271 | 3300005539 | Bacteria | 4248 |
| 91 | Ga0068853_100041016 | 3300005539 | Bacteria | 3952 |
| 92 | Ga0068853_100044550 | 3300005539 | Bacteria | 3798 |
| 93 | Ga0070672_100000229 | 3300005543 | Bacteria | 31255 |
| 94 | Ga0070672_100016634 | 3300005543 | Bacteria | 5272 |
| 95 | Ga0070672_100089040 | 3300005543 | Bacteria | 2486 |
| 96 | Ga0070686_100829095 | 3300005544 | Bacteria | 747 |
| 97 | Ga0070696_100127459 | 3300005546 | Bacteria | 1848 |
| 98 | Ga0070693_100011883 | 3300005547 | Bacteria | 4394 |
| 99 | Ga0070665_100010396 | 3300005548 | Bacteria | 9417 |
| 100 | Ga0070665_100025954 | 3300005548 | Bacteria | 5901 |
| 101 | Ga0070665_100291717 | 3300005548 | Bacteria | 1633 |
| 102 | Ga0070665_100962925 | 3300005548 | Bacteria | 866 |
| 103 | Ga0068855_100001111 | 3300005563 | Bacteria | 33458 |
| 104 | Ga0068855_100393806 | 3300005563 | Bacteria | 1519 |
| 105 | Ga0070664_100142688 | 3300005564 | Bacteria | 2110 |
| 106 | Ga0070664_100157118 | 3300005564 | Bacteria | 2010 |
| 107 | Ga0070664_100393780 | 3300005564 | Bacteria | 1266 |
| 108 | Ga0070664_100636031 | 3300005564 | Bacteria | 991 |
| 109 | Ga0068857_100144104 | 3300005577 | Bacteria | 2155 |
| 110 | Ga0068854_100007750 | 3300005578 | Bacteria | 6865 |
| 111 | Ga0070702_100365321 | 3300005615 | Bacteria | 1021 |
| 112 | Ga0068852_100717265 | 3300005616 | Bacteria | 1011 |
| 113 | Ga0068852_100781724 | 3300005616 | Bacteria | 968 |
| 114 | Ga0068859_100011041 | 3300005617 | Bacteria | 9087 |
| 115 | Ga0068859_100306702 | 3300005617 | Bacteria | 1681 |
| 116 | Ga0068859_100594582 | 3300005617 | Bacteria | 1200 |
| 117 | Ga0068864_100000221 | 3300005618 | Bacteria | 51532 |
| 118 | Ga0068864_100002948 | 3300005618 | Bacteria | 14063 |
| 119 | Ga0068864_100008010 | 3300005618 | Bacteria | 8715 |
| 120 | Ga0068864_100171650 | 3300005618 | Bacteria | 1977 |
| 121 | Ga0068864_100534554 | 3300005618 | Bacteria | 1131 |
| 122 | Ga0068866_10573592 | 3300005718 | Bacteria | 758 |
| 123 | Ga0068861_100013833 | 3300005719 | Bacteria | 5655 |
| 124 | Ga0068861_100082970 | 3300005719 | Bacteria | 2513 |
| 125 | Ga0068851_10143536 | 3300005834 | Bacteria | 1300 |
| 126 | Ga0068870_10039828 | 3300005840 | Bacteria | 2433 |
| 127 | Ga0068863_100002529 | 3300005841 | Bacteria | 18145 |
| 128 | Ga0068863_100041895 | 3300005841 | Bacteria | 4352 |
| 129 | Ga0068863_100051123 | 3300005841 | Bacteria | 3917 |
| 130 | Ga0068863_100071732 | 3300005841 | Bacteria | 3276 |
| 131 | Ga0068863_100104886 | 3300005841 | Bacteria | 2689 |
| 132 | Ga0068863_100143263 | 3300005841 | Bacteria | 2285 |
| 133 | Ga0068863_100285752 | 3300005841 | Bacteria | 1599 |
| 134 | Ga0068858_100102803 | 3300005842 | Bacteria | 2665 |
| 135 | Ga0068858_100145995 | 3300005842 | Bacteria | 2222 |
| 136 | Ga0068858_100160232 | 3300005842 | Bacteria | 2118 |
| 137 | Ga0068860_100010046 | 3300005843 | Bacteria | 9379 |
| 138 | Ga0068862_100065861 | 3300005844 | Bacteria | 3121 |
| 139 | Ga0068862_100559616 | 3300005844 | Bacteria | 1093 |
| 140 | Ga0081539_10015819 | 3300005985 | Bacteria | 5447 |
| 141 | Ga0070716_100008565 | 3300006173 | Bacteria | 5080 |
| 142 | Ga0075366_10008305 | 3300006195 | Bacteria | 5768 |
| 143 | Ga0097621_100010473 | 3300006237 | Bacteria | 6789 |
| 144 | Ga0097621_100015272 | 3300006237 | Bacteria | 5774 |
| 145 | Ga0097621_100026255 | 3300006237 | Bacteria | 4566 |
| 146 | Ga0097621_100070108 | 3300006237 | Bacteria | 2894 |
| 147 | Ga0097621_100420253 | 3300006237 | Bacteria | 1200 |
| 148 | Ga0075370_10271332 | 3300006353 | Bacteria | 1007 |
| 149 | Ga0068871_100011074 | 3300006358 | Bacteria | 6610 |
| 150 | Ga0068871_100018023 | 3300006358 | Bacteria | 5358 |
| 151 | Ga0068871_100067154 | 3300006358 | Bacteria | 2941 |
| 152 | Ga0068871_100073876 | 3300006358 | Bacteria | 2812 |
| 153 | Ga0068871_100120239 | 3300006358 | Bacteria | 2218 |
| 154 | Ga0075428_100000089 | 3300006844 | Bacteria | 75097 |
| 155 | Ga0075430_100036111 | 3300006846 | Bacteria | 4191 |
| 156 | Ga0075431_100000766 | 3300006847 | Bacteria | 27825 |
| 157 | Ga0075431_100355902 | 3300006847 | Bacteria | 1471 |
| 158 | Ga0075433_10048009 | 3300006852 | Bacteria | 3712 |
| 159 | Ga0075434_100012989 | 3300006871 | Bacteria | 7910 |
| 160 | Ga0075429_100034099 | 3300006880 | Bacteria | 4423 |
| 161 | Ga0068865_100162558 | 3300006881 | Bacteria | 1705 |
| 162 | Ga0097620_100011041 | 3300006931 | Bacteria | 9087 |
| 163 | Ga0097620_100306695 | 3300006931 | Bacteria | 1681 |
| 164 | Ga0097620_100594609 | 3300006931 | Bacteria | 1200 |
| 165 | Ga0075435_100021557 | 3300007076 | Bacteria | 4957 |
| 166 | Ga0075435_100152759 | 3300007076 | Bacteria | 1942 |
| 167 | Ga0075435_100710534 | 3300007076 | Bacteria | 874 |
| 168 | Ga0105240_10080514 | 3300009093 | Bacteria | 4005 |
| 169 | Ga0105240_10282157 | 3300009093 | Bacteria | 1907 |
| 170 | Ga0111539_10001921 | 3300009094 | Bacteria | 27677 |
| 171 | Ga0111539_10049803 | 3300009094 | Bacteria | 4992 |
| 172 | Ga0111539_10083256 | 3300009094 | Bacteria | 3762 |
| 173 | Ga0105245_10457993 | 3300009098 | Bacteria | 1285 |
| 174 | Ga0105247_10022891 | 3300009101 | Bacteria | 3763 |
| 175 | Ga0114129_10194455 | 3300009147 | Bacteria | 2752 |
| 176 | Ga0114129_10776949 | 3300009147 | Bacteria | 1224 |
| 177 | Ga0105241_10008396 | 3300009174 | Bacteria | 7599 |
| 178 | Ga0105242_10193740 | 3300009176 | Bacteria | 1801 |
| 179 | Ga0105248_10043136 | 3300009177 | Bacteria | 5058 |
| 180 | Ga0105248_10252992 | 3300009177 | Bacteria | 1983 |
| 181 | Ga0105248_11099611 | 3300009177 | Bacteria | 898 |
| 182 | Ga0105237_10019528 | 3300009545 | Bacteria | 7000 |
| 183 | Ga0105237_10177610 | 3300009545 | Bacteria | 2130 |
| 184 | Ga0105238_10000037 | 3300009551 | Bacteria | 163954 |
| 185 | Ga0105249_10050241 | 3300009553 | Bacteria | 3802 |
| 186 | Ga0105249_10636697 | 3300009553 | Bacteria | 1123 |
| 187 | Ga0105249_10695340 | 3300009553 | Bacteria | 1077 |
| 188 | Ga0099796_10032235 | 3300010159 | Bacteria | 1715 |
| 189 | Ga0105239_10003694 | 3300010375 | Bacteria | 18647 |
| 190 | Ga0105239_10126821 | 3300010375 | Bacteria | 2837 |
| 191 | Ga0105239_10309750 | 3300010375 | Bacteria | 1779 |
| 192 | Ga0105246_10058629 | 3300011119 | Bacteria | 2668 |
| 193 | Ga0157373_10002101 | 3300013100 | Bacteria | 15084 |
| 194 | Ga0157371_10420569 | 3300013102 | Bacteria | 980 |
| 195 | Ga0157370_10006761 | 3300013104 | Bacteria | 12580 |
| 196 | Ga0157370_10062128 | 3300013104 | Bacteria | 3543 |
| 197 | Ga0157370_10170980 | 3300013104 | Bacteria | 2020 |
| 198 | Ga0157374_10002909 | 3300013296 | Bacteria | 14341 |
| 199 | Ga0157374_10063782 | 3300013296 | Bacteria | 3456 |
| 200 | Ga0157378_10025647 | 3300013297 | Bacteria | 5190 |
| 201 | Ga0157378_10154075 | 3300013297 | Bacteria | 2143 |
| 202 | Ga0157378_10302282 | 3300013297 | Bacteria | 1549 |
| 203 | Ga0163162_10046879 | 3300013306 | Bacteria | 4333 |
| 204 | Ga0163162_10222600 | 3300013306 | Bacteria | 2017 |
| 205 | Ga0157372_10186251 | 3300013307 | Bacteria | 2404 |
| 206 | Ga0157372_10207503 | 3300013307 | Bacteria | 2270 |
| 207 | Ga0157372_10943907 | 3300013307 | Bacteria | 1000 |
| 208 | Ga0157375_10057467 | 3300013308 | Bacteria | 3846 |
| 209 | Ga0157375_11055736 | 3300013308 | Bacteria | 950 |
| 210 | Ga0157375_11219164 | 3300013308 | Bacteria | 883 |
| 211 | Ga0157375_11420214 | 3300013308 | Bacteria | 818 |
| 212 | Ga0163163_10148511 | 3300014325 | Bacteria | 2388 |
| 213 | Ga0163163_10200793 | 3300014325 | Bacteria | 2042 |
| 214 | Ga0163163_10285183 | 3300014325 | Bacteria | 1703 |
| 215 | Ga0163163_10415524 | 3300014325 | Bacteria | 1404 |
| 216 | Ga0157380_10039424 | 3300014326 | Bacteria | 3673 |
| 217 | Ga0157380_10122177 | 3300014326 | Bacteria | 2207 |
| 218 | Ga0157380_10397101 | 3300014326 | Bacteria | 1307 |
| 219 | Ga0157379_10050073 | 3300014968 | Bacteria | 3728 |
| 220 | Ga0157379_10954228 | 3300014968 | Bacteria | 816 |
| 221 | Ga0157376_10041971 | 3300014969 | Bacteria | 3748 |
| 222 | Ga0157376_10085189 | 3300014969 | Bacteria | 2723 |
| 223 | Ga0163161_10001851 | 3300017792 | Bacteria | 15456 |
| 224 | Ga0163161_10034675 | 3300017792 | Bacteria | 3610 |
| 225 | Ga0163161_10144297 | 3300017792 | Bacteria | 1805 |
| 226 | Ga0213872_10000532 | 3300021361 | Bacteria | 29832 |
| 227 | Ga0213872_10001257 | 3300021361 | Bacteria | 17069 |
| 228 | Ga0213872_10004111 | 3300021361 | Bacteria | 7831 |
| 229 | Ga0213872_10028863 | 3300021361 | Bacteria | 2544 |
| 230 | Ga0213872_10075631 | 3300021361 | Bacteria | 1515 |
| 231 | Ga0209784_100021 | 3300025224 | Bacteria | 408534 |
| 232 | Ga0209566_100039 | 3300025225 | Bacteria | 303368 |
| 233 | Ga0209674_100036 | 3300025226 | Bacteria | 408534 |
| 234 | Ga0209563_100040 | 3300025230 | Bacteria | 408534 |
| 235 | Ga0209677_100023 | 3300025253 | Bacteria | 408534 |
| 236 | Ga0207697_10005049 | 3300025315 | Bacteria | 6184 |
| 237 | Ga0207682_10098547 | 3300025893 | Bacteria | 1275 |
| 238 | Ga0207682_10258890 | 3300025893 | Bacteria | 811 |
| 239 | Ga0207692_10500181 | 3300025898 | Bacteria | 771 |
| 240 | Ga0207642_10383436 | 3300025899 | Bacteria | 837 |
| 241 | Ga0207688_10219330 | 3300025901 | Bacteria | 1145 |
| 242 | Ga0207645_10000283 | 3300025907 | Bacteria | 42259 |
| 243 | Ga0207643_10033806 | 3300025908 | Bacteria | 2861 |
| 244 | Ga0207643_10149304 | 3300025908 | Bacteria | 1400 |
| 245 | Ga0207643_10365801 | 3300025908 | Bacteria | 907 |
| 246 | Ga0207684_10045540 | 3300025910 | Bacteria | 3720 |
| 247 | Ga0207684_10064876 | 3300025910 | Bacteria | 3100 |
| 248 | Ga0207707_10023156 | 3300025912 | Bacteria | 5434 |
| 249 | Ga0207707_10963092 | 3300025912 | Bacteria | 702 |
| 250 | Ga0207695_10004822 | 3300025913 | Bacteria | 18234 |
| 251 | Ga0207695_10123126 | 3300025913 | Bacteria | 2559 |
| 252 | Ga0207671_10029655 | 3300025914 | Bacteria | 4084 |
| 253 | Ga0207671_10041878 | 3300025914 | Bacteria | 3390 |
| 254 | Ga0207663_10182289 | 3300025916 | Bacteria | 1501 |
| 255 | Ga0207660_10046173 | 3300025917 | Bacteria | 3072 |
| 256 | Ga0207660_10330678 | 3300025917 | Bacteria | 1218 |
| 257 | Ga0207662_10042449 | 3300025918 | Bacteria | 2681 |
| 258 | Ga0207657_10268658 | 3300025919 | Bacteria | 1356 |
| 259 | Ga0207657_10368070 | 3300025919 | Bacteria | 1132 |
| 260 | Ga0207652_10026700 | 3300025921 | Bacteria | 4812 |
| 261 | Ga0207652_10197973 | 3300025921 | Bacteria | 1808 |
| 262 | Ga0207681_10019329 | 3300025923 | Bacteria | 4303 |
| 263 | Ga0207681_10030135 | 3300025923 | Bacteria | 3534 |
| 264 | Ga0207681_10387273 | 3300025923 | Bacteria | 1126 |
| 265 | Ga0207681_10537378 | 3300025923 | Bacteria | 961 |
| 266 | Ga0207694_10000054 | 3300025924 | Bacteria | 152124 |
| 267 | Ga0207650_10000230 | 3300025925 | Bacteria | 62576 |
| 268 | Ga0207650_10000403 | 3300025925 | Bacteria | 38821 |
| 269 | Ga0207650_10028029 | 3300025925 | Bacteria | 4036 |
| 270 | Ga0207650_10130214 | 3300025925 | Bacteria | 1968 |
| 271 | Ga0207650_10140211 | 3300025925 | Bacteria | 1900 |
| 272 | Ga0207650_10198753 | 3300025925 | Bacteria | 1605 |
| 273 | Ga0207650_10392283 | 3300025925 | Bacteria | 1148 |
| 274 | Ga0207650_10548575 | 3300025925 | Bacteria | 969 |
| 275 | Ga0207650_10603642 | 3300025925 | Bacteria | 923 |
| 276 | Ga0207650_10656347 | 3300025925 | Bacteria | 884 |
| 277 | Ga0207659_10002004 | 3300025926 | Bacteria | 12070 |
| 278 | Ga0207659_10039071 | 3300025926 | Bacteria | 3306 |
| 279 | Ga0207659_10067334 | 3300025926 | Bacteria | 2601 |
| 280 | Ga0207659_10507312 | 3300025926 | Bacteria | 1022 |
| 281 | Ga0207687_10058566 | 3300025927 | Bacteria | 2711 |
| 282 | Ga0207687_10140591 | 3300025927 | Bacteria | 1831 |
| 283 | Ga0207664_10018372 | 3300025929 | Bacteria | 5145 |
| 284 | Ga0207644_10142054 | 3300025931 | Bacteria | 1849 |
| 285 | Ga0207644_10142605 | 3300025931 | Bacteria | 1846 |
| 286 | Ga0207644_10640179 | 3300025931 | Bacteria | 884 |
| 287 | Ga0207690_10035471 | 3300025932 | Bacteria | 3222 |
| 288 | Ga0207706_10021527 | 3300025933 | Bacteria | 5788 |
| 289 | Ga0207686_10014249 | 3300025934 | Bacteria | 4421 |
| 290 | Ga0207686_10120182 | 3300025934 | Bacteria | 1787 |
| 291 | Ga0207670_10040216 | 3300025936 | Bacteria | 3068 |
| 292 | Ga0207670_10477256 | 3300025936 | Bacteria | 1009 |
| 293 | Ga0207669_10004262 | 3300025937 | Bacteria | 6280 |
| 294 | Ga0207669_10864731 | 3300025937 | Bacteria | 753 |
| 295 | Ga0207704_10021622 | 3300025938 | Bacteria | 3431 |
| 296 | Ga0207704_10099209 | 3300025938 | Bacteria | 1937 |
| 297 | Ga0207704_10113690 | 3300025938 | Bacteria | 1836 |
| 298 | Ga0207704_10346583 | 3300025938 | Bacteria | 1155 |
| 299 | Ga0207691_10000681 | 3300025940 | Bacteria | 33590 |
| 300 | Ga0207691_10011116 | 3300025940 | Bacteria | 8640 |
| 301 | Ga0207691_10027496 | 3300025940 | Bacteria | 5332 |
| 302 | Ga0207691_10073729 | 3300025940 | Bacteria | 3079 |
| 303 | Ga0207691_10093390 | 3300025940 | Bacteria | 2694 |
| 304 | Ga0207711_10066450 | 3300025941 | Bacteria | 3118 |
| 305 | Ga0207711_10218069 | 3300025941 | Bacteria | 1744 |
| 306 | Ga0207689_10004785 | 3300025942 | Bacteria | 12207 |
| 307 | Ga0207689_10016386 | 3300025942 | Bacteria | 6275 |
| 308 | Ga0207689_10368332 | 3300025942 | Bacteria | 1195 |
| 309 | Ga0207689_10395647 | 3300025942 | Bacteria | 1151 |
| 310 | Ga0207689_10837095 | 3300025942 | Bacteria | 777 |
| 311 | Ga0207679_10133213 | 3300025945 | Bacteria | 1997 |
| 312 | Ga0207679_10195988 | 3300025945 | Bacteria | 1683 |
| 313 | Ga0207679_10839760 | 3300025945 | Bacteria | 839 |
| 314 | Ga0207667_10000043 | 3300025949 | Bacteria | 261426 |
| 315 | Ga0207667_10254072 | 3300025949 | Bacteria | 1798 |
| 316 | Ga0207651_10030166 | 3300025960 | Bacteria | 3448 |
| 317 | Ga0207651_10057679 | 3300025960 | Bacteria | 2679 |
| 318 | Ga0207651_10086881 | 3300025960 | Bacteria | 2275 |
| 319 | Ga0207651_10120789 | 3300025960 | Bacteria | 1986 |
| 320 | Ga0207712_10150185 | 3300025961 | Bacteria | 1799 |
| 321 | Ga0207668_10007674 | 3300025972 | Bacteria | 6419 |
| 322 | Ga0207668_10011071 | 3300025972 | Bacteria | 5470 |
| 323 | Ga0207640_10258913 | 3300025981 | Bacteria | 1355 |
| 324 | Ga0207658_10001079 | 3300025986 | Bacteria | 22086 |
| 325 | Ga0207658_10009685 | 3300025986 | Bacteria | 6538 |
| 326 | Ga0207658_10044220 | 3300025986 | Bacteria | 3242 |
| 327 | Ga0207658_10149890 | 3300025986 | Bacteria | 1899 |
| 328 | Ga0207677_10009684 | 3300026023 | Bacteria | 5428 |
| 329 | Ga0207677_10145963 | 3300026023 | Bacteria | 1818 |
| 330 | Ga0207703_10011411 | 3300026035 | Bacteria | 6910 |
| 331 | Ga0207703_10065587 | 3300026035 | Bacteria | 2984 |
| 332 | Ga0207703_10088049 | 3300026035 | Bacteria | 2605 |
| 333 | Ga0207703_10291833 | 3300026035 | Bacteria | 1484 |
| 334 | Ga0207639_10023614 | 3300026041 | Bacteria | 4441 |
| 335 | Ga0207639_10040678 | 3300026041 | Bacteria | 3471 |
| 336 | Ga0207639_10286592 | 3300026041 | Bacteria | 1450 |
| 337 | Ga0207702_10638676 | 3300026078 | Bacteria | 1046 |
| 338 | Ga0207641_10001602 | 3300026088 | Bacteria | 22081 |
| 339 | Ga0207641_10082878 | 3300026088 | Bacteria | 2787 |
| 340 | Ga0207641_10268040 | 3300026088 | Bacteria | 1601 |
| 341 | Ga0207648_10000564 | 3300026089 | Bacteria | 41549 |
| 342 | Ga0207648_10010337 | 3300026089 | Bacteria | 8850 |
| 343 | Ga0207648_10059099 | 3300026089 | Bacteria | 3344 |
| 344 | Ga0207648_10074201 | 3300026089 | Bacteria | 2965 |
| 345 | Ga0207648_10855858 | 3300026089 | Bacteria | 848 |
| 346 | Ga0207676_10003750 | 3300026095 | Bacteria | 10737 |
| 347 | Ga0207676_10093767 | 3300026095 | Bacteria | 2472 |
| 348 | Ga0207676_10306740 | 3300026095 | Bacteria | 1451 |
| 349 | Ga0207676_10336881 | 3300026095 | Bacteria | 1390 |
| 350 | Ga0207676_10510748 | 3300026095 | Bacteria | 1142 |
| 351 | Ga0207674_10032531 | 3300026116 | Bacteria | 5470 |
| 352 | Ga0207674_10067908 | 3300026116 | Bacteria | 3588 |
| 353 | Ga0207675_100061483 | 3300026118 | Bacteria | 3506 |
| 354 | Ga0207675_100110730 | 3300026118 | Bacteria | 2591 |
| 355 | Ga0207675_100398854 | 3300026118 | Bacteria | 1355 |
| 356 | Ga0207675_100712269 | 3300026118 | Bacteria | 1013 |
| 357 | Ga0207683_10000424 | 3300026121 | Bacteria | 39012 |
| 358 | Ga0207683_10004300 | 3300026121 | Bacteria | 12301 |
| 359 | Ga0207683_10050559 | 3300026121 | Bacteria | 3641 |
| 360 | Ga0207683_11015420 | 3300026121 | Bacteria | 770 |
| 361 | Ga0207698_10463773 | 3300026142 | Bacteria | 1226 |
| 362 | Ga0207698_10722742 | 3300026142 | Bacteria | 993 |
| 363 | Ga0209969_1012582 | 3300027360 | Bacteria | 1221 |
| 364 | Ga0209971_1008768 | 3300027682 | Bacteria | 2398 |
| 365 | Ga0207428_10011825 | 3300027907 | Bacteria | 7691 |
| 366 | Ga0207428_10073354 | 3300027907 | Bacteria | 2685 |
| 367 | Ga0207428_10195804 | 3300027907 | Bacteria | 1522 |
| 368 | Ga0268266_10040066 | 3300028379 | Bacteria | 3991 |
| 369 | Ga0268266_10051870 | 3300028379 | Bacteria | 3522 |
| 370 | Ga0268265_10029817 | 3300028380 | Bacteria | 3923 |
| 371 | Ga0268265_10139293 | 3300028380 | Bacteria | 2029 |
| 372 | Ga0268265_10142597 | 3300028380 | Bacteria | 2008 |
| 373 | Ga0268265_11064964 | 3300028380 | Bacteria | 801 |
| 374 | Ga0268264_10039780 | 3300028381 | Bacteria | 3885 |
| 375 | Ga0268264_10170987 | 3300028381 | Bacteria | 1965 |
| 376 | Ga0268264_10659479 | 3300028381 | Bacteria | 1036 |
| 377 | Ga0265336_10000938 | 3300028666 | Bacteria | 14744 |
| 378 | Ga0307515_10017584 | 3300028794 | Bacteria | 13005 |
| 379 | Ga0265338_10071896 | 3300028800 | Bacteria | 2956 |
| 380 | Ga0265324_10000023 | 3300029957 | Bacteria | 164128 |
| 381 | Ga0265324_10000147 | 3300029957 | Bacteria | 54400 |
| 382 | Ga0265324_10030156 | 3300029957 | Bacteria | 1904 |
| 383 | Ga0265324_10054166 | 3300029957 | Bacteria | 1377 |
| 384 | Ga0265330_10000044 | 3300031235 | Bacteria | 113679 |
| 385 | Ga0265330_10027481 | 3300031235 | Bacteria | 2570 |
| 386 | Ga0265332_10000046 | 3300031238 | Bacteria | 113777 |
| 387 | Ga0265332_10000058 | 3300031238 | Bacteria | 102565 |
| 388 | Ga0265332_10000453 | 3300031238 | Bacteria | 28825 |
| 389 | Ga0265328_10000252 | 3300031239 | Bacteria | 24700 |
| 390 | Ga0265328_10071701 | 3300031239 | Bacteria | 1273 |
| 391 | Ga0265325_10001509 | 3300031241 | Bacteria | 16357 |
| 392 | Ga0265325_10005336 | 3300031241 | Bacteria | 7952 |
| 393 | Ga0265325_10015088 | 3300031241 | Bacteria | 4354 |
| 394 | Ga0265325_10111259 | 3300031241 | Bacteria | 1330 |
| 395 | Ga0265329_10002052 | 3300031242 | Bacteria | 9399 |
| 396 | Ga0265331_10000050 | 3300031250 | Bacteria | 181286 |
| 397 | Ga0265331_10001285 | 3300031250 | Bacteria | 18719 |
| 398 | Ga0265331_10006402 | 3300031250 | Bacteria | 6965 |
| 399 | Ga0265327_10000109 | 3300031251 | Bacteria | 181275 |
| 400 | Ga0265327_10001001 | 3300031251 | Bacteria | 40152 |
| 401 | Ga0265327_10041296 | 3300031251 | Bacteria | 2487 |
| 402 | Ga0265316_10024222 | 3300031344 | Bacteria | 5092 |
| 403 | Ga0265316_10041696 | 3300031344 | Bacteria | 3672 |
| 404 | Ga0265316_10134566 | 3300031344 | Bacteria | 1860 |
| 405 | Ga0307513_10047590 | 3300031456 | Bacteria | 4663 |
| 406 | Ga0307509_10000054 | 3300031507 | Bacteria | 163301 |
| 407 | Ga0307509_10377373 | 3300031507 | Bacteria | 1132 |
| 408 | Ga0307408_100067213 | 3300031548 | Bacteria | 2635 |
| 409 | Ga0265313_10031376 | 3300031595 | Bacteria | 2725 |
| 410 | Ga0265314_10000130 | 3300031711 | Bacteria | 113776 |
| 411 | Ga0265314_10000451 | 3300031711 | Bacteria | 54865 |
| 412 | Ga0265314_10026077 | 3300031711 | Bacteria | 4398 |
| 413 | Ga0265314_10040315 | 3300031711 | Bacteria | 3353 |
| 414 | Ga0265314_10058091 | 3300031711 | Bacteria | 2652 |
| 415 | Ga0265342_10064500 | 3300031712 | Bacteria | 2149 |
| 416 | Ga0265342_10224754 | 3300031712 | Bacteria | 1010 |
| 417 | Ga0316576_10034871 | 3300031727 | Bacteria | 3589 |
| 418 | Ga0316578_10002871 | 3300031728 | Bacteria | 7704 |
| 419 | Ga0316578_10004419 | 3300031728 | Bacteria | 6639 |
| 420 | Ga0316578_10104105 | 3300031728 | Bacteria | 1702 |
| 421 | Ga0316578_10210115 | 3300031728 | Bacteria | 1171 |
| 422 | Ga0307405_10327612 | 3300031731 | Bacteria | 1172 |
| 423 | Ga0307405_11174055 | 3300031731 | Bacteria | 663 |
| 424 | Ga0316577_10035139 | 3300031733 | Bacteria | 2801 |
| 425 | Ga0307413_10005043 | 3300031824 | Bacteria | 5834 |
| 426 | Ga0307413_10087397 | 3300031824 | Bacteria | 2019 |
| 427 | Ga0307410_10023014 | 3300031852 | Bacteria | 3864 |
| 428 | Ga0307410_10052900 | 3300031852 | Bacteria | 2745 |
| 429 | Ga0307406_10003493 | 3300031901 | Bacteria | 8555 |
| 430 | Ga0307406_10007624 | 3300031901 | Bacteria | 6009 |
| 431 | Ga0307407_10233252 | 3300031903 | Bacteria | 1251 |
| 432 | Ga0307412_10008031 | 3300031911 | Bacteria | 6013 |
| 433 | Ga0307412_10244122 | 3300031911 | Bacteria | 1391 |
| 434 | Ga0307412_10613775 | 3300031911 | Bacteria | 923 |
| 435 | Ga0307409_100076998 | 3300031995 | Bacteria | 2677 |
| 436 | Ga0307409_100136874 | 3300031995 | Bacteria | 2103 |
| 437 | Ga0307409_100139543 | 3300031995 | Bacteria | 2086 |
| 438 | Ga0307416_100028019 | 3300032002 | Bacteria | 4182 |
| 439 | Ga0307416_100124624 | 3300032002 | Bacteria | 2305 |
| 440 | Ga0307414_10013961 | 3300032004 | Bacteria | 4798 |
| 441 | Ga0307411_10000874 | 3300032005 | Bacteria | 11374 |
| 442 | Ga0307411_10372593 | 3300032005 | Bacteria | 1171 |
| 443 | Ga0307415_100050306 | 3300032126 | Bacteria | 2823 |
| 444 | Ga0307415_100533906 | 3300032126 | Bacteria | 1032 |
| 445 | Ga0316583_10002919 | 3300032133 | Bacteria | 6005 |
| 446 | Ga0316580_10001537 | 3300032139 | Bacteria | 6072 |
| 447 | Ga0316580_10044229 | 3300032139 | Bacteria | 1374 |
| 448 | Ga0316593_10046355 | 3300032168 | Bacteria | 1459 |
| 449 | Ga0316593_10106258 | 3300032168 | Bacteria | 1000 |
| 450 | Ga0316593_10166873 | 3300032168 | Bacteria | 806 |
| 451 | Ga0316588_1083180 | 3300033528 | Bacteria | 794 |
| 452 | Ga0316596_1000679 | 3300033541 | Bacteria | 6149 |
| 453 | Ga0373952_0000149 | 3300035092 | Bacteria | 10342 |
| 454 | Ga0373956_0063309 | 3300035119 | Bacteria | 1678 |
| 455 | Ga0373956_0141093 | 3300035119 | Bacteria | 1131 |
| 456 | Ga0373960_0006955 | 3300035121 | Bacteria | 2667 |
| 457 | Ga0373942_0006992 | 3300035207 | Bacteria | 2608 |
| 458 | Ga0373961_0046875 | 3300035241 | Bacteria | 1268 |
| 459 | Ga0316574_0396730 | 3300035398 | Bacteria | 869 |
| 460 | Ga0373924_0383177 | 3300035410 | Bacteria | 628 |
| 461 | Ga0373927_0091782 | 3300035695 | Bacteria | 1973 |
| 462 | Ga0373933_0084809 | 3300035724 | Bacteria | 1947 |
| 463 | Ga0373947_0145684 | 3300035725 | Bacteria | 1522 |
| 464 | Ga0316582_0004958 | 3300036647 | Bacteria | 6802 |
| 465 | Ga0316582_0010780 | 3300036647 | Bacteria | 5022 |
| 466 | Ga0316582_0578169 | 3300036647 | Bacteria | 774 |
| 467 | Ga0316584_0008439 | 3300036712 | Bacteria | 7100 |
| 468 | Ga0316584_0095107 | 3300036712 | Bacteria | 2230 |
| 469 | Ga0316584_0219362 | 3300036712 | Bacteria | 1398 |
| 470 | Ga0373925_0158374 | 3300037068 | Bacteria | 1782 |
| 471 | Ga0436364_1012154 | 3300037853 | Bacteria | 926 |
| 472 | Ga0400490_26241 | 3300038726 | Bacteria | 19510 |
| 473 | Ga0400490_36198 | 3300038726 | Bacteria | 20353 |
| 474 | Ga0400490_56340 | 3300038726 | Bacteria | 26381 |
| 475 | Ga0400491_09522 | 3300038727 | Bacteria | 1568 |
| 476 | Ga0400485_06298 | 3300038735 | Bacteria | 1484 |
| 477 | Ga0400485_19789 | 3300038735 | Bacteria | 1960 |
| 478 | Ga0400486_02326 | 3300038742 | Bacteria | 3485 |
| 479 | Ga0400483_066832 | 3300039062 | Bacteria | 4146 |
| 480 | Ga0400483_095062 | 3300039062 | Bacteria | 1740 |
| 481 | Ga0400483_184140 | 3300039062 | Bacteria | 2320 |
| 482 | Ga0400483_201100 | 3300039062 | Bacteria | 1033 |
| 483 | Ga0400483_256413 | 3300039062 | Bacteria | 5726 |
| 484 | Ga0400489_43087 | 3300039093 | Bacteria | 5816 |
| 485 | Ga0400489_55584 | 3300039093 | Bacteria | 2812 |
| 486 | Ga0400487_42385 | 3300039110 | Bacteria | 4392 |
| 487 | Ga0436361_0197834 | 3300039447 | Bacteria | 2857 |
| 488 | Ga0436361_0293841 | 3300039447 | Bacteria | 85519 |
| 489 | Ga0436361_0632156 | 3300039447 | Bacteria | 31235 |
| 490 | Ga0436361_0704696 | 3300039447 | Bacteria | 13555 |
| 491 | Ga0436361_0921278 | 3300039447 | Bacteria | 22626 |
| 492 | Ga0436361_1128421 | 3300039447 | Bacteria | 3851 |
| 493 | Ga0439441_002768 | 3300042001 | Bacteria | 2506 |
| 494 | Ga0450896_024162 | 3300042133 | Bacteria | 900 |
| 495 | Ga0450899_009089 | 3300042135 | Bacteria | 1092 |
| 496 | Ga0439446_0009364 | 3300042156 | Bacteria | 2622 |
| 497 | Ga0451577_0062653 | 3300042876 | Bacteria | 3317 |
| 498 | Ga0451577_0121300 | 3300042876 | Bacteria | 2342 |
| 499 | Ga0451577_0191895 | 3300042876 | Bacteria | 1843 |
| 500 | Ga0451577_1071569 | 3300042876 | Bacteria | 722 |
| 501 | Ga0466969_0006652 | 3300044656 | Bacteria | 6141 |
| 502 | Ga0453683_0089392 | 3300044673 | Bacteria | 1931 |
| 503 | Ga0453683_0113604 | 3300044673 | Bacteria | 1704 |
| 504 | Ga0466965_0005697 | 3300044683 | Bacteria | 5618 |
| 505 | Ga0466965_0268405 | 3300044683 | Bacteria | 919 |
| 506 | Ga0466966_0011833 | 3300044684 | Bacteria | 5778 |
| 507 | Ga0466961_0001619 | 3300044693 | Bacteria | 13959 |
| 508 | Ga0466964_0175705 | 3300044706 | Bacteria | 1012 |
| 509 | Ga0453684_0006657 | 3300044712 | Bacteria | 21817 |
| 510 | Ga0453684_0843899 | 3300044712 | Bacteria | 985 |
| 511 | Ga0466959_0019116 | 3300045049 | Bacteria | 5036 |
| 512 | Ga0466959_0036551 | 3300045049 | Bacteria | 3629 |
| 513 | Ga0451576_0000060 | 3300045051 | Bacteria | 290345 |
| 514 | Ga0451576_0000239 | 3300045051 | Bacteria | 134323 |
| 515 | Ga0451576_0090389 | 3300045051 | Bacteria | 3185 |
| 516 | Ga0451576_0134107 | 3300045051 | Bacteria | 2582 |
| 517 | Ga0451576_0891281 | 3300045051 | Bacteria | 933 |
| 518 | Ga0466967_0008116 | 3300045976 | Bacteria | 7660 |
| 519 | Ga0495580_0031053 | 3300046472 | Bacteria | 3864 |
| 520 | Ga0495580_0117159 | 3300046472 | Bacteria | 1850 |
| 521 | Ga0495639_0112986 | 3300046475 | Bacteria | 1291 |
| 522 | Ga0495606_0025241 | 3300046507 | Bacteria | 4260 |
| 523 | Ga0495632_0009066 | 3300046519 | Bacteria | 6026 |
| 524 | Ga0495648_0169559 | 3300046524 | Bacteria | 1120 |
| 525 | Ga0495642_0057037 | 3300046528 | Bacteria | 1614 |
| 526 | Ga0495598_0054314 | 3300046537 | Bacteria | 1216 |
| 527 | Ga0495598_0150252 | 3300046537 | Bacteria | 812 |
| 528 | Ga0495621_0036484 | 3300046539 | Bacteria | 1706 |
| 529 | Ga0495636_0178283 | 3300047318 | Bacteria | 963 |
| 530 | Ga0495615_0061311 | 3300048090 | Bacteria | 993 |
| 531 | Ga0496101_0403119 | 3300048904 | Bacteria | 1077 |
| 532 | Ga0496101_0915618 | 3300048904 | Bacteria | 690 |
| 533 | Ga0496102_0283160 | 3300048905 | Bacteria | 1562 |
| 534 | Ga0496103_0148425 | 3300048906 | Bacteria | 1501 |
| 535 | Ga0496106_0094040 | 3300048909 | Bacteria | 2317 |
| 536 | Ga0496106_0219403 | 3300048909 | Bacteria | 1516 |
| 537 | Ga0496107_0025418 | 3300048910 | Bacteria | 4193 |
| 538 | Ga0496108_0236469 | 3300048911 | Bacteria | 1589 |
| 539 | Ga0496108_0419652 | 3300048911 | Bacteria | 1168 |
| 540 | Ga0496109_0176591 | 3300048912 | Bacteria | 2005 |
| 541 | Ga0496110_1159396 | 3300048913 | Bacteria | 681 |
| 542 | Ga0496111_0044269 | 3300048914 | Bacteria | 3199 |
| 543 | Ga0496114_0037516 | 3300048917 | Bacteria | 4008 |
| 544 | Ga0496114_0532137 | 3300048917 | Bacteria | 1039 |
| 545 | Ga0496124_0004049 | 3300048927 | Bacteria | 17382 |
| 546 | Ga0496126_0076463 | 3300048929 | Bacteria | 2970 |
| 547 | Ga0501303_014689 | 3300049526 | Bacteria | 777 |
| 548 | Ga0501031_0002629 | 3300049568 | Bacteria | 11429 |
| 549 | Ga0501031_0004277 | 3300049568 | Bacteria | 9231 |
| 550 | Ga0501031_0006864 | 3300049568 | Bacteria | 7429 |
| 551 | Ga0501032_0000851 | 3300049569 | Bacteria | 24758 |
| 552 | Ga0501032_0005458 | 3300049569 | Bacteria | 9438 |
| 553 | Ga0501032_0008735 | 3300049569 | Bacteria | 7379 |
| 554 | Ga0501032_0296896 | 3300049569 | Bacteria | 1045 |
| 555 | Ga0501033_0004717 | 3300049570 | Bacteria | 10908 |
| 556 | Ga0501033_0014684 | 3300049570 | Bacteria | 5945 |
| 557 | Ga0501033_0043036 | 3300049570 | Bacteria | 3364 |
| 558 | Ga0501033_0417930 | 3300049570 | Bacteria | 934 |
| 559 | Ga0501034_0012065 | 3300049571 | Bacteria | 8933 |
| 560 | Ga0501034_0070908 | 3300049571 | Bacteria | 3495 |
| 561 | Ga0501036_0004087 | 3300049572 | Bacteria | 11744 |
| 562 | Ga0501036_0007132 | 3300049572 | Bacteria | 9100 |
| 563 | Ga0501036_0019041 | 3300049572 | Bacteria | 5760 |
| 564 | Ga0501036_0054905 | 3300049572 | Bacteria | 3375 |
| 565 | Ga0501037_0005227 | 3300049573 | Bacteria | 9438 |
| 566 | Ga0501038_0002842 | 3300049574 | Bacteria | 16112 |
| 567 | Ga0501038_0003593 | 3300049574 | Bacteria | 14430 |
| 568 | Ga0501038_0008551 | 3300049574 | Bacteria | 9398 |
| 569 | Ga0501038_0022931 | 3300049574 | Bacteria | 5587 |
| 570 | Ga0501038_0063354 | 3300049574 | Bacteria | 3156 |
| 571 | Ga0501038_0065687 | 3300049574 | Bacteria | 3090 |
| 572 | Ga0501038_0442498 | 3300049574 | Bacteria | 1000 |
| 573 | Ga0501039_0003352 | 3300049575 | Bacteria | 11972 |
| 574 | Ga0501039_0007003 | 3300049575 | Bacteria | 8585 |
| 575 | Ga0501039_0007282 | 3300049575 | Bacteria | 8427 |
| 576 | Ga0501039_0129412 | 3300049575 | Bacteria | 1981 |
| 577 | Ga0501039_0215223 | 3300049575 | Bacteria | 1511 |
| 578 | Ga0501039_0395063 | 3300049575 | Bacteria | 1086 |
| 579 | Ga0501040_0042221 | 3300049576 | Bacteria | 3106 |
| 580 | Ga0501040_0225602 | 3300049576 | Bacteria | 1333 |
| 581 | Ga0501041_0003981 | 3300049577 | Bacteria | 8525 |
| 582 | Ga0501042_0002271 | 3300049578 | Bacteria | 11737 |
| 583 | Ga0501042_0045093 | 3300049578 | Bacteria | 3142 |
| 584 | Ga0501043_0000590 | 3300049579 | Bacteria | 32162 |
| 585 | Ga0501043_0011488 | 3300049579 | Bacteria | 6931 |
| 586 | Ga0501043_0011693 | 3300049579 | Bacteria | 6871 |
| 587 | Ga0501043_0018409 | 3300049579 | Bacteria | 5478 |
| 588 | Ga0501043_0272298 | 3300049579 | Bacteria | 1299 |
| 589 | Ga0501043_0510725 | 3300049579 | Bacteria | 897 |
| 590 | Ga0501046_0003768 | 3300049580 | Bacteria | 13880 |
| 591 | Ga0501046_0016345 | 3300049580 | Bacteria | 6217 |
| 592 | Ga0501046_0432739 | 3300049580 | Bacteria | 947 |
| 593 | Ga0501047_0004747 | 3300049581 | Bacteria | 12779 |
| 594 | Ga0501047_0063680 | 3300049581 | Bacteria | 3557 |
| 595 | Ga0501047_0073274 | 3300049581 | Bacteria | 3297 |
| 596 | Ga0501048_0010447 | 3300049582 | Bacteria | 6931 |
| 597 | Ga0501067_0011417 | 3300049583 | Bacteria | 4918 |
| 598 | Ga0501067_0304943 | 3300049583 | Bacteria | 887 |
| 599 | Ga0501068_0001005 | 3300049584 | Bacteria | 14851 |
| 600 | Ga0501069_0154663 | 3300049585 | Bacteria | 1319 |
| 601 | Ga0501070_0009606 | 3300049586 | Bacteria | 8172 |
| 602 | Ga0501070_0116295 | 3300049586 | Bacteria | 2209 |
| 603 | Ga0501071_0016352 | 3300049587 | Bacteria | 5100 |
| 604 | Ga0501072_0051532 | 3300049588 | Bacteria | 3240 |
| 605 | Ga0501072_0054968 | 3300049588 | Bacteria | 3138 |
| 606 | Ga0501073_0041281 | 3300049589 | Bacteria | 3260 |
| 607 | Ga0501074_0035869 | 3300049590 | Bacteria | 3593 |
| 608 | Ga0501075_0041398 | 3300049591 | Bacteria | 3452 |
| 609 | Ga0501075_0150057 | 3300049591 | Bacteria | 1777 |
| 610 | Ga0501076_0002058 | 3300049592 | Bacteria | 13780 |
| 611 | Ga0501076_0118778 | 3300049592 | Bacteria | 2141 |
| 612 | Ga0501076_0763679 | 3300049592 | Bacteria | 798 |
| 613 | Ga0501077_0015273 | 3300049593 | Bacteria | 4832 |
| 614 | Ga0501077_0277538 | 3300049593 | Bacteria | 1066 |
| 615 | Ga0501079_0000800 | 3300049741 | Bacteria | 21428 |
| 616 | Ga0501080_0003066 | 3300049742 | Bacteria | 14752 |
| 617 | Ga0501080_0018069 | 3300049742 | Bacteria | 6527 |
| 618 | Ga0501080_0519210 | 3300049742 | Bacteria | 1063 |
| 619 | Ga0501081_0001026 | 3300049743 | Bacteria | 16686 |
| 620 | Ga0501083_0017528 | 3300049744 | Bacteria | 4993 |
| 621 | Ga0501035_0007605 | 3300049822 | Bacteria | 10121 |
| 622 | Ga0501035_0007618 | 3300049822 | Bacteria | 10114 |
| 623 | Ga0501035_0012793 | 3300049822 | Bacteria | 7750 |
| 624 | Ga0501035_0130208 | 3300049822 | Bacteria | 2194 |
| 625 | Ga0501044_0000326 | 3300049823 | Bacteria | 60246 |
| 626 | Ga0501044_0001129 | 3300049823 | Bacteria | 31721 |
| 627 | Ga0501044_0035724 | 3300049823 | Bacteria | 5202 |
| 628 | Ga0501044_0231089 | 3300049823 | Bacteria | 1797 |
| 629 | Ga0501044_0558689 | 3300049823 | Bacteria | 1041 |
| 630 | Ga0501045_0001357 | 3300049824 | Bacteria | 16252 |
| 631 | Ga0501045_0049710 | 3300049824 | Bacteria | 3058 |
| 632 | nmdc:mga0k408_1893_c1 | 3300050493 | Bacteria | 11203 |
| 633 | nmdc:mga09592_2590_c1 | 3300050508 | Bacteria | 14645 |
| 634 | nmdc:mga0qj67_22237_c1 | 3300050509 | Bacteria | 4870 |
| 635 | nmdc:mga0qj67_312902_c1 | 3300050509 | Bacteria | 1271 |
| 636 | nmdc:mga06r32_10171_c1 | 3300050510 | Bacteria | 8492 |
| 637 | nmdc:mga08y16_663_c1 | 3300050511 | Bacteria | 32446 |
| 638 | nmdc:mga08y16_68226_c1 | 3300050511 | Bacteria | 3708 |
| 639 | nmdc:mga0n895_191951_c1 | 3300050512 | Bacteria | 2074 |
| 640 | nmdc:mga0rr50_384634_c1 | 3300050513 | Bacteria | 1184 |
| 641 | nmdc:mga0rr50_700904_c1 | 3300050513 | Bacteria | 864 |
| 642 | Ga0495619_0454059 | 3300053085 | Bacteria | 883 |
| 643 | Ga0500607_014149 | 3300053121 | Bacteria | 4635 |
| 644 | Ga0500559_0040709 | 3300053136 | Bacteria | 2024 |
| 645 | Ga0500622_0000029 | 3300053156 | Bacteria | 213762 |
| 646 | Ga0500636_0020843 | 3300053177 | Bacteria | 3879 |
| 647 | Ga0500637_0009892 | 3300053178 | Bacteria | 4878 |
| 648 | Ga0500587_003796 | 3300053739 | Bacteria | 2098 |
| 649 | Ga0501084_0054540 | 3300054114 | Bacteria | 3344 |
| 650 | Ga0590074_013965 | 3300059423 | Bacteria | 1358 |
| 651 | Ga0590075_061970 | 3300059424 | Bacteria | 964 |
| 652 | Ga0501082_0001997 | 3300060353 | Bacteria | 17925 |
| 653 | Ga0501082_0152463 | 3300060353 | Bacteria | 2008 |
| 654 | Ga0501082_0152523 | 3300060353 | Bacteria | 2007 |
| 655 | Ga0530510_0066669 | 3300061734 | Bacteria | 2611 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025898 | Ga0207692_10500181 | Ga0207692_105001812 | 163 |
| 2 | 3300042135 | Ga0450899_009089 | Ga0450899_009089_371_934 | 182 |
| 3 | 3300005530 | Ga0070679_100007684 | Ga0070679_1000076843 | 183 |
| 4 | 3300013104 | Ga0157370_10170980 | Ga0157370_101709803 | 183 |
| 5 | 3300038726 | Ga0400490_36198 | Ga0400490_36198_1751_2341 | 185 |
| 6 | 3300038727 | Ga0400491_09522 | Ga0400491_09522_321_911 | 185 |
| 7 | 3300049568 | Ga0501031_0004277 | Ga0501031_0004277_5390_6013 | 188 |
| 8 | 3300013306 | Ga0163162_10222600 | Ga0163162_102226002 | 190 |
| 9 | iso_pu_bacteria | 2547132103 | 2547376146 | 191 |
| 10 | iso_pu_bacteria | 2547132512 | 2548848699 | 191 |
| 11 | iso_pu_bacteria | 2843690924 | 2843695247 | 191 |
| 12 | iso_pu_bacteria | 2998344455 | 2998345333 | 191 |
| 13 | iso_pu_bacteria | 2744054655 | 2745159768 | 193 |
| 14 | 3300005331 | Ga0070670_100006889 | Ga0070670_1000068896 | 194 |
| 15 | 3300005331 | Ga0070670_100051454 | Ga0070670_1000514543 | 194 |
| 16 | 3300005331 | Ga0070670_100351953 | Ga0070670_1003519531 | 194 |
| 17 | 3300005337 | Ga0070682_100425772 | Ga0070682_1004257721 | 194 |
| 18 | 3300005347 | Ga0070668_100039737 | Ga0070668_1000397374 | 194 |
| 19 | 3300005354 | Ga0070675_100128969 | Ga0070675_1001289693 | 194 |
| 20 | 3300005364 | Ga0070673_100054198 | Ga0070673_1000541983 | 194 |
| 21 | 3300005367 | Ga0070667_100405091 | Ga0070667_1004050911 | 194 |
| 22 | 3300005456 | Ga0070678_100960374 | Ga0070678_1009603741 | 194 |
| 23 | 3300005457 | Ga0070662_100125520 | Ga0070662_1001255201 | 194 |
| 24 | 3300005543 | Ga0070672_100016634 | Ga0070672_1000166343 | 194 |
| 25 | 3300005543 | Ga0070672_100089040 | Ga0070672_1000890402 | 194 |
| 26 | 3300005564 | Ga0070664_100393780 | Ga0070664_1003937802 | 194 |
| 27 | 3300005564 | Ga0070664_100636031 | Ga0070664_1006360312 | 194 |
| 28 | 3300005618 | Ga0068864_100000221 | Ga0068864_10000022121 | 194 |
| 29 | 3300005618 | Ga0068864_100171650 | Ga0068864_1001716503 | 194 |
| 30 | 3300005618 | Ga0068864_100534554 | Ga0068864_1005345541 | 194 |
| 31 | 3300005719 | Ga0068861_100013833 | Ga0068861_1000138333 | 194 |
| 32 | 3300005840 | Ga0068870_10039828 | Ga0068870_100398282 | 194 |
| 33 | 3300005841 | Ga0068863_100002529 | Ga0068863_10000252911 | 194 |
| 34 | 3300005841 | Ga0068863_100041895 | Ga0068863_1000418952 | 194 |
| 35 | 3300005841 | Ga0068863_100051123 | Ga0068863_1000511233 | 194 |
| 36 | 3300005841 | Ga0068863_100285752 | Ga0068863_1002857522 | 194 |
| 37 | 3300005985 | Ga0081539_10015819 | Ga0081539_100158192 | 194 |
| 38 | 3300006237 | Ga0097621_100010473 | Ga0097621_1000104732 | 194 |
| 39 | 3300006237 | Ga0097621_100420253 | Ga0097621_1004202532 | 194 |
| 40 | 3300006358 | Ga0068871_100011074 | Ga0068871_1000110741 | 194 |
| 41 | 3300006844 | Ga0075428_100000089 | Ga0075428_10000008919 | 194 |
| 42 | 3300006880 | Ga0075429_100034099 | Ga0075429_1000340992 | 194 |
| 43 | 3300007076 | Ga0075435_100710534 | Ga0075435_1007105342 | 194 |
| 44 | 3300009094 | Ga0111539_10001921 | Ga0111539_1000192127 | 194 |
| 45 | 3300009147 | Ga0114129_10194455 | Ga0114129_101944551 | 194 |
| 46 | 3300009177 | Ga0105248_10252992 | Ga0105248_102529923 | 194 |
| 47 | 3300009553 | Ga0105249_10050241 | Ga0105249_100502414 | 194 |
| 48 | 3300014325 | Ga0163163_10148511 | Ga0163163_101485112 | 194 |
| 49 | 3300014325 | Ga0163163_10285183 | Ga0163163_102851832 | 194 |
| 50 | 3300014969 | Ga0157376_10085189 | Ga0157376_100851893 | 194 |
| 51 | 3300017792 | Ga0163161_10144297 | Ga0163161_101442972 | 194 |
| 52 | 3300025908 | Ga0207643_10033806 | Ga0207643_100338063 | 194 |
| 53 | 3300025908 | Ga0207643_10365801 | Ga0207643_103658012 | 194 |
| 54 | 3300025912 | Ga0207707_10963092 | Ga0207707_109630921 | 194 |
| 55 | 3300025923 | Ga0207681_10387273 | Ga0207681_103872731 | 194 |
| 56 | 3300025925 | Ga0207650_10000403 | Ga0207650_1000040311 | 194 |
| 57 | 3300025925 | Ga0207650_10028029 | Ga0207650_100280293 | 194 |
| 58 | 3300025925 | Ga0207650_10130214 | Ga0207650_101302142 | 194 |
| 59 | 3300025925 | Ga0207650_10140211 | Ga0207650_101402111 | 194 |
| 60 | 3300025926 | Ga0207659_10067334 | Ga0207659_100673343 | 194 |
| 61 | 3300025926 | Ga0207659_10507312 | Ga0207659_105073121 | 194 |
| 62 | 3300025933 | Ga0207706_10021527 | Ga0207706_100215276 | 194 |
| 63 | 3300025940 | Ga0207691_10011116 | Ga0207691_100111165 | 194 |
| 64 | 3300025940 | Ga0207691_10093390 | Ga0207691_100933903 | 194 |
| 65 | 3300025942 | Ga0207689_10368332 | Ga0207689_103683321 | 194 |
| 66 | 3300025960 | Ga0207651_10030166 | Ga0207651_100301663 | 194 |
| 67 | 3300025961 | Ga0207712_10150185 | Ga0207712_101501852 | 194 |
| 68 | 3300025972 | Ga0207668_10011071 | Ga0207668_100110716 | 194 |
| 69 | 3300026088 | Ga0207641_10001602 | Ga0207641_1000160212 | 194 |
| 70 | 3300026088 | Ga0207641_10268040 | Ga0207641_102680402 | 194 |
| 71 | 3300026095 | Ga0207676_10003750 | Ga0207676_100037505 | 194 |
| 72 | 3300026095 | Ga0207676_10306740 | Ga0207676_103067402 | 194 |
| 73 | 3300026095 | Ga0207676_10510748 | Ga0207676_105107481 | 194 |
| 74 | 3300026118 | Ga0207675_100061483 | Ga0207675_1000614833 | 194 |
| 75 | 3300026121 | Ga0207683_10004300 | Ga0207683_100043009 | 194 |
| 76 | 3300027907 | Ga0207428_10011825 | Ga0207428_100118253 | 194 |
| 77 | 3300028380 | Ga0268265_10029817 | Ga0268265_100298175 | 194 |
| 78 | 3300028380 | Ga0268265_10142597 | Ga0268265_101425971 | 194 |
| 79 | 3300029957 | Ga0265324_10054166 | Ga0265324_100541662 | 194 |
| 80 | 3300031251 | Ga0265327_10041296 | Ga0265327_100412964 | 194 |
| 81 | 3300031344 | Ga0265316_10134566 | Ga0265316_101345662 | 194 |
| 82 | 3300044712 | Ga0453684_0843899 | Ga0453684_0843899_146_730 | 194 |
| 83 | 3300045051 | Ga0451576_0134107 | Ga0451576_0134107_958_1542 | 194 |
| 84 | 3300046537 | Ga0495598_0054314 | Ga0495598_0054314_131_715 | 194 |
| 85 | 3300049572 | Ga0501036_0054905 | Ga0501036_0054905_1186_1770 | 194 |
| 86 | 3300049575 | Ga0501039_0003352 | Ga0501039_0003352_7292_7876 | 194 |
| 87 | 3300049576 | Ga0501040_0042221 | Ga0501040_0042221_1565_2149 | 194 |
| 88 | 3300049577 | Ga0501041_0003981 | Ga0501041_0003981_6196_6780 | 194 |
| 89 | 3300049578 | Ga0501042_0045093 | Ga0501042_0045093_1134_1718 | 194 |
| 90 | 3300049579 | Ga0501043_0018409 | Ga0501043_0018409_1837_2421 | 194 |
| 91 | 3300049580 | Ga0501046_0432739 | Ga0501046_0432739_232_816 | 194 |
| 92 | 3300049585 | Ga0501069_0154663 | Ga0501069_0154663_470_1054 | 194 |
| 93 | 3300049587 | Ga0501071_0016352 | Ga0501071_0016352_3054_3638 | 194 |
| 94 | 3300049588 | Ga0501072_0054968 | Ga0501072_0054968_1255_1839 | 194 |
| 95 | 3300049591 | Ga0501075_0041398 | Ga0501075_0041398_2195_2779 | 194 |
| 96 | 3300049592 | Ga0501076_0002058 | Ga0501076_0002058_4612_5196 | 194 |
| 97 | 3300049593 | Ga0501077_0015273 | Ga0501077_0015273_1008_1592 | 194 |
| 98 | 3300049741 | Ga0501079_0000800 | Ga0501079_0000800_11935_12519 | 194 |
| 99 | 3300049742 | Ga0501080_0003066 | Ga0501080_0003066_7173_7757 | 194 |
| 100 | 3300049743 | Ga0501081_0001026 | Ga0501081_0001026_764_1348 | 194 |
| 101 | 3300050508 | nmdc:mga09592_2590_c1 | nmdc:mga09592_2590_c1_7176_7760 | 194 |
| 102 | 3300050509 | nmdc:mga0qj67_312902_c1 | nmdc:mga0qj67_312902_c1_10_594 | 194 |
| 103 | 3300050511 | nmdc:mga08y16_663_c1 | nmdc:mga08y16_663_c1_27701_28285 | 194 |
| 104 | 3300050513 | nmdc:mga0rr50_700904_c1 | nmdc:mga0rr50_700904_c1_71_655 | 194 |
| 105 | 3300053121 | Ga0500607_014149 | Ga0500607_014149_2984_3568 | 194 |
| 106 | 3300053136 | Ga0500559_0040709 | Ga0500559_0040709_510_1094 | 194 |
| 107 | 3300053177 | Ga0500636_0020843 | Ga0500636_0020843_3066_3650 | 194 |
| 108 | 3300053178 | Ga0500637_0009892 | Ga0500637_0009892_2251_2835 | 194 |
| 109 | 3300054114 | Ga0501084_0054540 | Ga0501084_0054540_1528_2112 | 194 |
| 110 | 3300060353 | Ga0501082_0001997 | Ga0501082_0001997_13496_14080 | 194 |
| 111 | 3300060353 | Ga0501082_0152523 | Ga0501082_0152523_479_1063 | 194 |
| 112 | 3300061734 | Ga0530510_0066669 | Ga0530510_0066669_1369_1953 | 194 |
| 113 | iso_pu_bacteria | 2521172590 | 2521560065 | 194 |
| 114 | iso_pu_bacteria | 2818991449 | 2819616428 | 194 |
| 115 | iso_pu_bacteria | 2904439833 | 2904440901 | 194 |
| 116 | iso_pu_bacteria | 2904530477 | 2904535503 | 194 |
| 117 | iso_pu_bacteria | 2904584206 | 2904588356 | 194 |
| 118 | iso_pu_bacteria | 2904589729 | 2904594756 | 194 |
| 119 | iso_pu_bacteria | 2904601388 | 2904606019 | 194 |
| 120 | iso_pu_bacteria | 2919079590 | 2919084677 | 194 |
| 121 | iso_pu_bacteria | 2928130867 | 2928134364 | 194 |
| 122 | 3300005331 | Ga0070670_100460511 | Ga0070670_1004605111 | 195 |
| 123 | 3300005336 | Ga0070680_100063149 | Ga0070680_1000631492 | 195 |
| 124 | 3300005339 | Ga0070660_100351838 | Ga0070660_1003518382 | 195 |
| 125 | 3300005340 | Ga0070689_100352155 | Ga0070689_1003521552 | 195 |
| 126 | 3300005341 | Ga0070691_10338831 | Ga0070691_103388311 | 195 |
| 127 | 3300005435 | Ga0070714_100016095 | Ga0070714_1000160952 | 195 |
| 128 | 3300005444 | Ga0070694_100194439 | Ga0070694_1001944392 | 195 |
| 129 | 3300005456 | Ga0070678_100450889 | Ga0070678_1004508892 | 195 |
| 130 | 3300005467 | Ga0070706_100414112 | Ga0070706_1004141122 | 195 |
| 131 | 3300005530 | Ga0070679_100121699 | Ga0070679_1001216993 | 195 |
| 132 | 3300005530 | Ga0070679_100201319 | Ga0070679_1002013192 | 195 |
| 133 | 3300005535 | Ga0070684_100229658 | Ga0070684_1002296582 | 195 |
| 134 | 3300005539 | Ga0068853_100044550 | Ga0068853_1000445504 | 195 |
| 135 | 3300005544 | Ga0070686_100829095 | Ga0070686_1008290951 | 195 |
| 136 | 3300005546 | Ga0070696_100127459 | Ga0070696_1001274592 | 195 |
| 137 | 3300005547 | Ga0070693_100011883 | Ga0070693_1000118833 | 195 |
| 138 | 3300005563 | Ga0068855_100393806 | Ga0068855_1003938062 | 195 |
| 139 | 3300005564 | Ga0070664_100142688 | Ga0070664_1001426883 | 195 |
| 140 | 3300005577 | Ga0068857_100144104 | Ga0068857_1001441043 | 195 |
| 141 | 3300005718 | Ga0068866_10573592 | Ga0068866_105735921 | 195 |
| 142 | 3300005834 | Ga0068851_10143536 | Ga0068851_101435362 | 195 |
| 143 | 3300005841 | Ga0068863_100071732 | Ga0068863_1000717322 | 195 |
| 144 | 3300006358 | Ga0068871_100073876 | Ga0068871_1000738763 | 195 |
| 145 | 3300006846 | Ga0075430_100036111 | Ga0075430_1000361113 | 195 |
| 146 | 3300006847 | Ga0075431_100000766 | Ga0075431_10000076615 | 195 |
| 147 | 3300006847 | Ga0075431_100355902 | Ga0075431_1003559022 | 195 |
| 148 | 3300006881 | Ga0068865_100162558 | Ga0068865_1001625582 | 195 |
| 149 | 3300009094 | Ga0111539_10049803 | Ga0111539_100498035 | 195 |
| 150 | 3300009098 | Ga0105245_10457993 | Ga0105245_104579932 | 195 |
| 151 | 3300009101 | Ga0105247_10022891 | Ga0105247_100228913 | 195 |
| 152 | 3300009147 | Ga0114129_10776949 | Ga0114129_107769492 | 195 |
| 153 | 3300009174 | Ga0105241_10008396 | Ga0105241_100083969 | 195 |
| 154 | 3300009177 | Ga0105248_10043136 | Ga0105248_100431362 | 195 |
| 155 | 3300009545 | Ga0105237_10019528 | Ga0105237_100195285 | 195 |
| 156 | 3300009553 | Ga0105249_10636697 | Ga0105249_106366972 | 195 |
| 157 | 3300010375 | Ga0105239_10309750 | Ga0105239_103097503 | 195 |
| 158 | 3300013104 | Ga0157370_10006761 | Ga0157370_100067616 | 195 |
| 159 | 3300013296 | Ga0157374_10002909 | Ga0157374_1000290922 | 195 |
| 160 | 3300013297 | Ga0157378_10025647 | Ga0157378_100256479 | 195 |
| 161 | 3300013297 | Ga0157378_10302282 | Ga0157378_103022822 | 195 |
| 162 | 3300013307 | Ga0157372_10207503 | Ga0157372_102075032 | 195 |
| 163 | 3300013308 | Ga0157375_10057467 | Ga0157375_100574672 | 195 |
| 164 | 3300013308 | Ga0157375_11219164 | Ga0157375_112191642 | 195 |
| 165 | 3300014968 | Ga0157379_10954228 | Ga0157379_109542281 | 195 |
| 166 | 3300014969 | Ga0157376_10041971 | Ga0157376_100419712 | 195 |
| 167 | 3300021361 | Ga0213872_10001257 | Ga0213872_1000125719 | 195 |
| 168 | 3300021361 | Ga0213872_10004111 | Ga0213872_100041113 | 195 |
| 169 | 3300025914 | Ga0207671_10041878 | Ga0207671_100418781 | 195 |
| 170 | 3300025917 | Ga0207660_10046173 | Ga0207660_100461734 | 195 |
| 171 | 3300025917 | Ga0207660_10330678 | Ga0207660_103306782 | 195 |
| 172 | 3300025918 | Ga0207662_10042449 | Ga0207662_100424493 | 195 |
| 173 | 3300025919 | Ga0207657_10268658 | Ga0207657_102686582 | 195 |
| 174 | 3300025919 | Ga0207657_10368070 | Ga0207657_103680702 | 195 |
| 175 | 3300025921 | Ga0207652_10197973 | Ga0207652_101979732 | 195 |
| 176 | 3300025925 | Ga0207650_10548575 | Ga0207650_105485751 | 195 |
| 177 | 3300025929 | Ga0207664_10018372 | Ga0207664_100183725 | 195 |
| 178 | 3300025932 | Ga0207690_10035471 | Ga0207690_100354712 | 195 |
| 179 | 3300025936 | Ga0207670_10477256 | Ga0207670_104772562 | 195 |
| 180 | 3300025938 | Ga0207704_10113690 | Ga0207704_101136902 | 195 |
| 181 | 3300025938 | Ga0207704_10346583 | Ga0207704_103465832 | 195 |
| 182 | 3300025941 | Ga0207711_10218069 | Ga0207711_102180692 | 195 |
| 183 | 3300025949 | Ga0207667_10254072 | Ga0207667_102540722 | 195 |
| 184 | 3300025986 | Ga0207658_10149890 | Ga0207658_101498902 | 195 |
| 185 | 3300026041 | Ga0207639_10040678 | Ga0207639_100406782 | 195 |
| 186 | 3300026089 | Ga0207648_10059099 | Ga0207648_100590992 | 195 |
| 187 | 3300026116 | Ga0207674_10032531 | Ga0207674_100325317 | 195 |
| 188 | 3300026118 | Ga0207675_100110730 | Ga0207675_1001107302 | 195 |
| 189 | 3300026121 | Ga0207683_11015420 | Ga0207683_110154202 | 195 |
| 190 | 3300027360 | Ga0209969_1012582 | Ga0209969_10125822 | 195 |
| 191 | 3300027907 | Ga0207428_10073354 | Ga0207428_100733543 | 195 |
| 192 | 3300027907 | Ga0207428_10195804 | Ga0207428_101958041 | 195 |
| 193 | 3300028380 | Ga0268265_10139293 | Ga0268265_101392932 | 195 |
| 194 | 3300028381 | Ga0268264_10659479 | Ga0268264_106594791 | 195 |
| 195 | 3300028666 | Ga0265336_10000938 | Ga0265336_100009382 | 195 |
| 196 | 3300028800 | Ga0265338_10071896 | Ga0265338_100718963 | 195 |
| 197 | 3300029957 | Ga0265324_10000023 | Ga0265324_1000002392 | 195 |
| 198 | 3300029957 | Ga0265324_10000147 | Ga0265324_1000014756 | 195 |
| 199 | 3300029957 | Ga0265324_10030156 | Ga0265324_100301562 | 195 |
| 200 | 3300031238 | Ga0265332_10000058 | Ga0265332_1000005876 | 195 |
| 201 | 3300031239 | Ga0265328_10000252 | Ga0265328_1000025217 | 195 |
| 202 | 3300031241 | Ga0265325_10001509 | Ga0265325_100015096 | 195 |
| 203 | 3300031241 | Ga0265325_10111259 | Ga0265325_101112591 | 195 |
| 204 | 3300031250 | Ga0265331_10000050 | Ga0265331_10000050176 | 195 |
| 205 | 3300031250 | Ga0265331_10006402 | Ga0265331_100064024 | 195 |
| 206 | 3300031251 | Ga0265327_10000109 | Ga0265327_1000010949 | 195 |
| 207 | 3300031344 | Ga0265316_10041696 | Ga0265316_100416962 | 195 |
| 208 | 3300031507 | Ga0307509_10000054 | Ga0307509_1000005441 | 195 |
| 209 | 3300031711 | Ga0265314_10000451 | Ga0265314_1000045156 | 195 |
| 210 | 3300031711 | Ga0265314_10026077 | Ga0265314_100260774 | 195 |
| 211 | 3300031711 | Ga0265314_10040315 | Ga0265314_100403154 | 195 |
| 212 | 3300031728 | Ga0316578_10104105 | Ga0316578_101041053 | 195 |
| 213 | 3300031824 | Ga0307413_10087397 | Ga0307413_100873973 | 195 |
| 214 | 3300031852 | Ga0307410_10052900 | Ga0307410_100529003 | 195 |
| 215 | 3300031901 | Ga0307406_10007624 | Ga0307406_100076246 | 195 |
| 216 | 3300031903 | Ga0307407_10233252 | Ga0307407_102332522 | 195 |
| 217 | 3300031911 | Ga0307412_10244122 | Ga0307412_102441222 | 195 |
| 218 | 3300031995 | Ga0307409_100136874 | Ga0307409_1001368742 | 195 |
| 219 | 3300031995 | Ga0307409_100139543 | Ga0307409_1001395432 | 195 |
| 220 | 3300032002 | Ga0307416_100028019 | Ga0307416_1000280194 | 195 |
| 221 | 3300032005 | Ga0307411_10372593 | Ga0307411_103725931 | 195 |
| 222 | 3300032126 | Ga0307415_100533906 | Ga0307415_1005339061 | 195 |
| 223 | 3300032133 | Ga0316583_10002919 | Ga0316583_100029196 | 195 |
| 224 | 3300033541 | Ga0316596_1000679 | Ga0316596_10006795 | 195 |
| 225 | 3300035092 | Ga0373952_0000149 | Ga0373952_0000149_1157_1744 | 195 |
| 226 | 3300035119 | Ga0373956_0141093 | Ga0373956_0141093_282_869 | 195 |
| 227 | 3300035121 | Ga0373960_0006955 | Ga0373960_0006955_1705_2292 | 195 |
| 228 | 3300035207 | Ga0373942_0006992 | Ga0373942_0006992_820_1407 | 195 |
| 229 | 3300035241 | Ga0373961_0046875 | Ga0373961_0046875_354_941 | 195 |
| 230 | 3300035398 | Ga0316574_0396730 | Ga0316574_0396730_243_833 | 195 |
| 231 | 3300035724 | Ga0373933_0084809 | Ga0373933_0084809_933_1520 | 195 |
| 232 | 3300038726 | Ga0400490_26241 | Ga0400490_26241_9601_10191 | 195 |
| 233 | 3300038726 | Ga0400490_56340 | Ga0400490_56340_17909_18499 | 195 |
| 234 | 3300038735 | Ga0400485_06298 | Ga0400485_06298_350_940 | 195 |
| 235 | 3300038735 | Ga0400485_19789 | Ga0400485_19789_1320_1910 | 195 |
| 236 | 3300038742 | Ga0400486_02326 | Ga0400486_02326_1816_2406 | 195 |
| 237 | 3300039062 | Ga0400483_066832 | Ga0400483_066832_1726_2316 | 195 |
| 238 | 3300039062 | Ga0400483_095062 | Ga0400483_095062_622_1212 | 195 |
| 239 | 3300039062 | Ga0400483_184140 | Ga0400483_184140_902_1492 | 195 |
| 240 | 3300039062 | Ga0400483_256413 | Ga0400483_256413_2862_3452 | 195 |
| 241 | 3300039093 | Ga0400489_43087 | Ga0400489_43087_64_654 | 195 |
| 242 | 3300039093 | Ga0400489_55584 | Ga0400489_55584_1704_2294 | 195 |
| 243 | 3300039110 | Ga0400487_42385 | Ga0400487_42385_1143_1733 | 195 |
| 244 | 3300039447 | Ga0436361_0293841 | Ga0436361_0293841_61146_61739 | 195 |
| 245 | 3300039447 | Ga0436361_0921278 | Ga0436361_0921278_7258_7851 | 195 |
| 246 | 3300042001 | Ga0439441_002768 | Ga0439441_002768_880_1467 | 195 |
| 247 | 3300042133 | Ga0450896_024162 | Ga0450896_024162_103_705 | 195 |
| 248 | 3300042876 | Ga0451577_0062653 | Ga0451577_0062653_2685_3272 | 195 |
| 249 | 3300042876 | Ga0451577_0191895 | Ga0451577_0191895_946_1560 | 195 |
| 250 | 3300044656 | Ga0466969_0006652 | Ga0466969_0006652_3840_4433 | 195 |
| 251 | 3300044683 | Ga0466965_0005697 | Ga0466965_0005697_2618_3211 | 195 |
| 252 | 3300044684 | Ga0466966_0011833 | Ga0466966_0011833_938_1531 | 195 |
| 253 | 3300044693 | Ga0466961_0001619 | Ga0466961_0001619_10612_11205 | 195 |
| 254 | 3300044706 | Ga0466964_0175705 | Ga0466964_0175705_147_740 | 195 |
| 255 | 3300044712 | Ga0453684_0006657 | Ga0453684_0006657_11678_12265 | 195 |
| 256 | 3300045049 | Ga0466959_0019116 | Ga0466959_0019116_3966_4559 | 195 |
| 257 | 3300045049 | Ga0466959_0036551 | Ga0466959_0036551_478_1071 | 195 |
| 258 | 3300045051 | Ga0451576_0000060 | Ga0451576_0000060_157823_158410 | 195 |
| 259 | 3300045051 | Ga0451576_0000239 | Ga0451576_0000239_78437_79024 | 195 |
| 260 | 3300045051 | Ga0451576_0891281 | Ga0451576_0891281_217_804 | 195 |
| 261 | 3300045976 | Ga0466967_0008116 | Ga0466967_0008116_1438_2031 | 195 |
| 262 | 3300047318 | Ga0495636_0178283 | Ga0495636_0178283_229_816 | 195 |
| 263 | 3300049526 | Ga0501303_014689 | Ga0501303_014689_62_649 | 195 |
| 264 | 3300049568 | Ga0501031_0002629 | Ga0501031_0002629_7333_7920 | 195 |
| 265 | 3300049568 | Ga0501031_0006864 | Ga0501031_0006864_5790_6377 | 195 |
| 266 | 3300049569 | Ga0501032_0000851 | Ga0501032_0000851_11067_11654 | 195 |
| 267 | 3300049569 | Ga0501032_0005458 | Ga0501032_0005458_7843_8430 | 195 |
| 268 | 3300049569 | Ga0501032_0008735 | Ga0501032_0008735_1262_1849 | 195 |
| 269 | 3300049569 | Ga0501032_0296896 | Ga0501032_0296896_212_799 | 195 |
| 270 | 3300049570 | Ga0501033_0004717 | Ga0501033_0004717_2478_3065 | 195 |
| 271 | 3300049570 | Ga0501033_0014684 | Ga0501033_0014684_1009_1596 | 195 |
| 272 | 3300049570 | Ga0501033_0043036 | Ga0501033_0043036_1140_1727 | 195 |
| 273 | 3300049570 | Ga0501033_0417930 | Ga0501033_0417930_296_883 | 195 |
| 274 | 3300049571 | Ga0501034_0012065 | Ga0501034_0012065_3371_3958 | 195 |
| 275 | 3300049572 | Ga0501036_0004087 | Ga0501036_0004087_3315_3902 | 195 |
| 276 | 3300049572 | Ga0501036_0007132 | Ga0501036_0007132_420_1007 | 195 |
| 277 | 3300049572 | Ga0501036_0019041 | Ga0501036_0019041_1860_2447 | 195 |
| 278 | 3300049573 | Ga0501037_0005227 | Ga0501037_0005227_7843_8430 | 195 |
| 279 | 3300049574 | Ga0501038_0002842 | Ga0501038_0002842_7734_8321 | 195 |
| 280 | 3300049574 | Ga0501038_0003593 | Ga0501038_0003593_6678_7265 | 195 |
| 281 | 3300049574 | Ga0501038_0008551 | Ga0501038_0008551_2471_3058 | 195 |
| 282 | 3300049574 | Ga0501038_0022931 | Ga0501038_0022931_1854_2441 | 195 |
| 283 | 3300049574 | Ga0501038_0063354 | Ga0501038_0063354_862_1449 | 195 |
| 284 | 3300049574 | Ga0501038_0065687 | Ga0501038_0065687_685_1272 | 195 |
| 285 | 3300049574 | Ga0501038_0442498 | Ga0501038_0442498_133_720 | 195 |
| 286 | 3300049575 | Ga0501039_0007003 | Ga0501039_0007003_7754_8341 | 195 |
| 287 | 3300049575 | Ga0501039_0007282 | Ga0501039_0007282_4092_4679 | 195 |
| 288 | 3300049575 | Ga0501039_0129412 | Ga0501039_0129412_355_942 | 195 |
| 289 | 3300049575 | Ga0501039_0395063 | Ga0501039_0395063_292_879 | 195 |
| 290 | 3300049576 | Ga0501040_0225602 | Ga0501040_0225602_367_954 | 195 |
| 291 | 3300049578 | Ga0501042_0002271 | Ga0501042_0002271_3314_3901 | 195 |
| 292 | 3300049579 | Ga0501043_0000590 | Ga0501043_0000590_7843_8430 | 195 |
| 293 | 3300049579 | Ga0501043_0011488 | Ga0501043_0011488_1482_2069 | 195 |
| 294 | 3300049579 | Ga0501043_0011693 | Ga0501043_0011693_390_977 | 195 |
| 295 | 3300049579 | Ga0501043_0272298 | Ga0501043_0272298_31_618 | 195 |
| 296 | 3300049579 | Ga0501043_0510725 | Ga0501043_0510725_109_696 | 195 |
| 297 | 3300049580 | Ga0501046_0003768 | Ga0501046_0003768_7835_8422 | 195 |
| 298 | 3300049580 | Ga0501046_0016345 | Ga0501046_0016345_3448_4035 | 195 |
| 299 | 3300049581 | Ga0501047_0004747 | Ga0501047_0004747_4350_4937 | 195 |
| 300 | 3300049581 | Ga0501047_0063680 | Ga0501047_0063680_1542_2129 | 195 |
| 301 | 3300049582 | Ga0501048_0010447 | Ga0501048_0010447_3423_4010 | 195 |
| 302 | 3300049583 | Ga0501067_0304943 | Ga0501067_0304943_236_823 | 195 |
| 303 | 3300049584 | Ga0501068_0001005 | Ga0501068_0001005_7793_8380 | 195 |
| 304 | 3300049591 | Ga0501075_0150057 | Ga0501075_0150057_1134_1721 | 195 |
| 305 | 3300049593 | Ga0501077_0277538 | Ga0501077_0277538_337_924 | 195 |
| 306 | 3300049742 | Ga0501080_0519210 | Ga0501080_0519210_457_1044 | 195 |
| 307 | 3300049822 | Ga0501035_0007605 | Ga0501035_0007605_1431_2018 | 195 |
| 308 | 3300049822 | Ga0501035_0007618 | Ga0501035_0007618_3187_3774 | 195 |
| 309 | 3300049822 | Ga0501035_0012793 | Ga0501035_0012793_1632_2219 | 195 |
| 310 | 3300049823 | Ga0501044_0000326 | Ga0501044_0000326_8107_8694 | 195 |
| 311 | 3300049823 | Ga0501044_0001129 | Ga0501044_0001129_7843_8430 | 195 |
| 312 | 3300049823 | Ga0501044_0035724 | Ga0501044_0035724_1525_2112 | 195 |
| 313 | 3300049823 | Ga0501044_0231089 | Ga0501044_0231089_430_1017 | 195 |
| 314 | 3300049823 | Ga0501044_0558689 | Ga0501044_0558689_311_898 | 195 |
| 315 | 3300049824 | Ga0501045_0001357 | Ga0501045_0001357_7843_8430 | 195 |
| 316 | 3300049824 | Ga0501045_0049710 | Ga0501045_0049710_100_687 | 195 |
| 317 | 3300050509 | nmdc:mga0qj67_22237_c1 | nmdc:mga0qj67_22237_c1_3864_4451 | 195 |
| 318 | 3300050510 | nmdc:mga06r32_10171_c1 | nmdc:mga06r32_10171_c1_1714_2301 | 195 |
| 319 | 3300053085 | Ga0495619_0454059 | Ga0495619_0454059_128_715 | 195 |
| 320 | 3300053156 | Ga0500622_0000029 | Ga0500622_0000029_28004_28591 | 195 |
| 321 | 3300060353 | Ga0501082_0152463 | Ga0501082_0152463_577_1164 | 195 |
| 322 | 3300005334 | Ga0068869_101059741 | Ga0068869_1010597411 | 196 |
| 323 | 3300005344 | Ga0070661_100029556 | Ga0070661_1000295563 | 196 |
| 324 | 3300005458 | Ga0070681_10056629 | Ga0070681_100566292 | 196 |
| 325 | 3300005530 | Ga0070679_100005476 | Ga0070679_10000547614 | 196 |
| 326 | 3300005539 | Ga0068853_100035271 | Ga0068853_1000352713 | 196 |
| 327 | 3300006195 | Ga0075366_10008305 | Ga0075366_100083052 | 196 |
| 328 | 3300013100 | Ga0157373_10002101 | Ga0157373_1000210116 | 196 |
| 329 | 3300013104 | Ga0157370_10062128 | Ga0157370_100621285 | 196 |
| 330 | 3300013307 | Ga0157372_10186251 | Ga0157372_101862512 | 196 |
| 331 | 3300025912 | Ga0207707_10023156 | Ga0207707_100231563 | 196 |
| 332 | 3300025921 | Ga0207652_10026700 | Ga0207652_100267002 | 196 |
| 333 | 3300026041 | Ga0207639_10023614 | Ga0207639_100236144 | 196 |
| 334 | 3300026142 | Ga0207698_10722742 | Ga0207698_107227422 | 196 |
| 335 | 3300028794 | Ga0307515_10017584 | Ga0307515_1001758415 | 196 |
| 336 | 3300031731 | Ga0307405_11174055 | Ga0307405_111740551 | 196 |
| 337 | 3300037853 | Ga0436364_1012154 | Ga0436364_1012154_263_853 | 196 |
| 338 | 3300046519 | Ga0495632_0009066 | Ga0495632_0009066_1202_1795 | 196 |
| 339 | 3300048090 | Ga0495615_0061311 | Ga0495615_0061311_146_736 | 196 |
| 340 | 3300048904 | Ga0496101_0403119 | Ga0496101_0403119_433_1023 | 196 |
| 341 | 3300048910 | Ga0496107_0025418 | Ga0496107_0025418_1557_2147 | 196 |
| 342 | 3300048911 | Ga0496108_0419652 | Ga0496108_0419652_43_633 | 196 |
| 343 | 3300048912 | Ga0496109_0176591 | Ga0496109_0176591_739_1329 | 196 |
| 344 | 3300048914 | Ga0496111_0044269 | Ga0496111_0044269_679_1269 | 196 |
| 345 | 3300049571 | Ga0501034_0070908 | Ga0501034_0070908_150_764 | 196 |
| 346 | 3300049575 | Ga0501039_0215223 | Ga0501039_0215223_710_1315 | 196 |
| 347 | 3300049581 | Ga0501047_0073274 | Ga0501047_0073274_1030_1644 | 196 |
| 348 | 3300049583 | Ga0501067_0011417 | Ga0501067_0011417_2749_3363 | 196 |
| 349 | 3300049586 | Ga0501070_0009606 | Ga0501070_0009606_2043_2657 | 196 |
| 350 | 3300049586 | Ga0501070_0116295 | Ga0501070_0116295_279_893 | 196 |
| 351 | 3300049588 | Ga0501072_0051532 | Ga0501072_0051532_2117_2731 | 196 |
| 352 | 3300049589 | Ga0501073_0041281 | Ga0501073_0041281_653_1267 | 196 |
| 353 | 3300049590 | Ga0501074_0035869 | Ga0501074_0035869_2082_2696 | 196 |
| 354 | 3300049592 | Ga0501076_0118778 | Ga0501076_0118778_344_949 | 196 |
| 355 | 3300049742 | Ga0501080_0018069 | Ga0501080_0018069_5358_5972 | 196 |
| 356 | 3300049744 | Ga0501083_0017528 | Ga0501083_0017528_1748_2362 | 196 |
| 357 | 3300049822 | Ga0501035_0130208 | Ga0501035_0130208_329_943 | 196 |
| 358 | 3300050493 | nmdc:mga0k408_1893_c1 | nmdc:mga0k408_1893_c1_504_1097 | 196 |
| 359 | 3300053739 | Ga0500587_003796 | Ga0500587_003796_1107_1700 | 196 |
| 360 | 3300059423 | Ga0590074_013965 | Ga0590074_013965_625_1215 | 196 |
| 361 | 3300059424 | Ga0590075_061970 | Ga0590075_061970_54_644 | 196 |
| 362 | 3300005331 | Ga0070670_100016600 | Ga0070670_1000166007 | 197 |
| 363 | 3300005331 | Ga0070670_100265135 | Ga0070670_1002651352 | 197 |
| 364 | 3300005331 | Ga0070670_100330054 | Ga0070670_1003300542 | 197 |
| 365 | 3300005334 | Ga0068869_100407832 | Ga0068869_1004078322 | 197 |
| 366 | 3300005338 | Ga0068868_100043354 | Ga0068868_1000433543 | 197 |
| 367 | 3300005338 | Ga0068868_100090657 | Ga0068868_1000906573 | 197 |
| 368 | 3300005353 | Ga0070669_100022069 | Ga0070669_1000220694 | 197 |
| 369 | 3300005354 | Ga0070675_100000345 | Ga0070675_1000003459 | 197 |
| 370 | 3300005355 | Ga0070671_100004354 | Ga0070671_1000043545 | 197 |
| 371 | 3300005355 | Ga0070671_100230216 | Ga0070671_1002302162 | 197 |
| 372 | 3300005355 | Ga0070671_100418935 | Ga0070671_1004189352 | 197 |
| 373 | 3300005356 | Ga0070674_100007024 | Ga0070674_1000070243 | 197 |
| 374 | 3300005356 | Ga0070674_100017660 | Ga0070674_1000176603 | 197 |
| 375 | 3300005356 | Ga0070674_100824499 | Ga0070674_1008244991 | 197 |
| 376 | 3300005364 | Ga0070673_101190370 | Ga0070673_1011903701 | 197 |
| 377 | 3300005367 | Ga0070667_100002153 | Ga0070667_1000021534 | 197 |
| 378 | 3300005367 | Ga0070667_100063550 | Ga0070667_1000635503 | 197 |
| 379 | 3300005440 | Ga0070705_100098308 | Ga0070705_1000983081 | 197 |
| 380 | 3300005456 | Ga0070678_100002860 | Ga0070678_1000028609 | 197 |
| 381 | 3300005456 | Ga0070678_100655736 | Ga0070678_1006557362 | 197 |
| 382 | 3300005459 | Ga0068867_100004068 | Ga0068867_1000040684 | 197 |
| 383 | 3300005459 | Ga0068867_100042758 | Ga0068867_1000427583 | 197 |
| 384 | 3300005459 | Ga0068867_100754424 | Ga0068867_1007544241 | 197 |
| 385 | 3300005467 | Ga0070706_100256514 | Ga0070706_1002565142 | 197 |
| 386 | 3300005468 | Ga0070707_100456444 | Ga0070707_1004564441 | 197 |
| 387 | 3300005468 | Ga0070707_100828959 | Ga0070707_1008289591 | 197 |
| 388 | 3300005471 | Ga0070698_100126714 | Ga0070698_1001267143 | 197 |
| 389 | 3300005518 | Ga0070699_100582674 | Ga0070699_1005826741 | 197 |
| 390 | 3300005536 | Ga0070697_100143990 | Ga0070697_1001439902 | 197 |
| 391 | 3300005543 | Ga0070672_100000229 | Ga0070672_10000022922 | 197 |
| 392 | 3300005548 | Ga0070665_100291717 | Ga0070665_1002917172 | 197 |
| 393 | 3300005564 | Ga0070664_100157118 | Ga0070664_1001571182 | 197 |
| 394 | 3300005615 | Ga0070702_100365321 | Ga0070702_1003653212 | 197 |
| 395 | 3300005616 | Ga0068852_100717265 | Ga0068852_1007172652 | 197 |
| 396 | 3300005616 | Ga0068852_100781724 | Ga0068852_1007817242 | 197 |
| 397 | 3300005617 | Ga0068859_100306702 | Ga0068859_1003067021 | 197 |
| 398 | 3300005618 | Ga0068864_100002948 | Ga0068864_1000029489 | 197 |
| 399 | 3300005841 | Ga0068863_100143263 | Ga0068863_1001432633 | 197 |
| 400 | 3300005842 | Ga0068858_100160232 | Ga0068858_1001602322 | 197 |
| 401 | 3300006173 | Ga0070716_100008565 | Ga0070716_1000085655 | 197 |
| 402 | 3300006353 | Ga0075370_10271332 | Ga0075370_102713321 | 197 |
| 403 | 3300006358 | Ga0068871_100120239 | Ga0068871_1001202392 | 197 |
| 404 | 3300006852 | Ga0075433_10048009 | Ga0075433_100480093 | 197 |
| 405 | 3300006871 | Ga0075434_100012989 | Ga0075434_1000129898 | 197 |
| 406 | 3300006931 | Ga0097620_100306695 | Ga0097620_1003066951 | 197 |
| 407 | 3300007076 | Ga0075435_100021557 | Ga0075435_1000215574 | 197 |
| 408 | 3300007076 | Ga0075435_100152759 | Ga0075435_1001527592 | 197 |
| 409 | 3300009094 | Ga0111539_10083256 | Ga0111539_100832565 | 197 |
| 410 | 3300009177 | Ga0105248_11099611 | Ga0105248_110996112 | 197 |
| 411 | 3300013306 | Ga0163162_10046879 | Ga0163162_100468792 | 197 |
| 412 | 3300013307 | Ga0157372_10943907 | Ga0157372_109439071 | 197 |
| 413 | 3300013308 | Ga0157375_11055736 | Ga0157375_110557362 | 197 |
| 414 | 3300014325 | Ga0163163_10200793 | Ga0163163_102007932 | 197 |
| 415 | 3300014326 | Ga0157380_10397101 | Ga0157380_103971012 | 197 |
| 416 | 3300017792 | Ga0163161_10001851 | Ga0163161_100018514 | 197 |
| 417 | 3300025315 | Ga0207697_10005049 | Ga0207697_100050497 | 197 |
| 418 | 3300025899 | Ga0207642_10383436 | Ga0207642_103834362 | 197 |
| 419 | 3300025910 | Ga0207684_10045540 | Ga0207684_100455403 | 197 |
| 420 | 3300025910 | Ga0207684_10064876 | Ga0207684_100648763 | 197 |
| 421 | 3300025923 | Ga0207681_10019329 | Ga0207681_100193292 | 197 |
| 422 | 3300025923 | Ga0207681_10537378 | Ga0207681_105373781 | 197 |
| 423 | 3300025925 | Ga0207650_10000230 | Ga0207650_1000023036 | 197 |
| 424 | 3300025925 | Ga0207650_10198753 | Ga0207650_101987532 | 197 |
| 425 | 3300025926 | Ga0207659_10002004 | Ga0207659_100020049 | 197 |
| 426 | 3300025927 | Ga0207687_10058566 | Ga0207687_100585664 | 197 |
| 427 | 3300025931 | Ga0207644_10142054 | Ga0207644_101420542 | 197 |
| 428 | 3300025931 | Ga0207644_10142605 | Ga0207644_101426052 | 197 |
| 429 | 3300025937 | Ga0207669_10004262 | Ga0207669_100042622 | 197 |
| 430 | 3300025938 | Ga0207704_10099209 | Ga0207704_100992092 | 197 |
| 431 | 3300025940 | Ga0207691_10000681 | Ga0207691_1000068126 | 197 |
| 432 | 3300025942 | Ga0207689_10395647 | Ga0207689_103956471 | 197 |
| 433 | 3300025945 | Ga0207679_10133213 | Ga0207679_101332132 | 197 |
| 434 | 3300025945 | Ga0207679_10195988 | Ga0207679_101959882 | 197 |
| 435 | 3300025945 | Ga0207679_10839760 | Ga0207679_108397601 | 197 |
| 436 | 3300025960 | Ga0207651_10057679 | Ga0207651_100576792 | 197 |
| 437 | 3300025981 | Ga0207640_10258913 | Ga0207640_102589131 | 197 |
| 438 | 3300025986 | Ga0207658_10001079 | Ga0207658_1000107919 | 197 |
| 439 | 3300025986 | Ga0207658_10044220 | Ga0207658_100442203 | 197 |
| 440 | 3300026023 | Ga0207677_10009684 | Ga0207677_100096845 | 197 |
| 441 | 3300026023 | Ga0207677_10145963 | Ga0207677_101459632 | 197 |
| 442 | 3300026035 | Ga0207703_10291833 | Ga0207703_102918333 | 197 |
| 443 | 3300026089 | Ga0207648_10074201 | Ga0207648_100742013 | 197 |
| 444 | 3300026095 | Ga0207676_10336881 | Ga0207676_103368812 | 197 |
| 445 | 3300026118 | Ga0207675_100712269 | Ga0207675_1007122692 | 197 |
| 446 | 3300026142 | Ga0207698_10463773 | Ga0207698_104637732 | 197 |
| 447 | 3300028379 | Ga0268266_10040066 | Ga0268266_100400664 | 197 |
| 448 | 3300028381 | Ga0268264_10039780 | Ga0268264_100397803 | 197 |
| 449 | 3300031235 | Ga0265330_10027481 | Ga0265330_100274812 | 197 |
| 450 | 3300031238 | Ga0265332_10000453 | Ga0265332_1000045313 | 197 |
| 451 | 3300031239 | Ga0265328_10071701 | Ga0265328_100717012 | 197 |
| 452 | 3300031241 | Ga0265325_10015088 | Ga0265325_100150884 | 197 |
| 453 | 3300031242 | Ga0265329_10002052 | Ga0265329_100020524 | 197 |
| 454 | 3300031250 | Ga0265331_10001285 | Ga0265331_1000128516 | 197 |
| 455 | 3300031251 | Ga0265327_10001001 | Ga0265327_1000100127 | 197 |
| 456 | 3300031344 | Ga0265316_10024222 | Ga0265316_100242224 | 197 |
| 457 | 3300031456 | Ga0307513_10047590 | Ga0307513_100475903 | 197 |
| 458 | 3300031507 | Ga0307509_10377373 | Ga0307509_103773732 | 197 |
| 459 | 3300031548 | Ga0307408_100067213 | Ga0307408_1000672132 | 197 |
| 460 | 3300031595 | Ga0265313_10031376 | Ga0265313_100313762 | 197 |
| 461 | 3300031711 | Ga0265314_10058091 | Ga0265314_100580913 | 197 |
| 462 | 3300031712 | Ga0265342_10064500 | Ga0265342_100645002 | 197 |
| 463 | 3300031727 | Ga0316576_10034871 | Ga0316576_100348712 | 197 |
| 464 | 3300031728 | Ga0316578_10002871 | Ga0316578_100028717 | 197 |
| 465 | 3300031728 | Ga0316578_10004419 | Ga0316578_100044194 | 197 |
| 466 | 3300031731 | Ga0307405_10327612 | Ga0307405_103276122 | 197 |
| 467 | 3300031733 | Ga0316577_10035139 | Ga0316577_100351393 | 197 |
| 468 | 3300031824 | Ga0307413_10005043 | Ga0307413_100050433 | 197 |
| 469 | 3300031852 | Ga0307410_10023014 | Ga0307410_100230142 | 197 |
| 470 | 3300031901 | Ga0307406_10003493 | Ga0307406_100034934 | 197 |
| 471 | 3300031911 | Ga0307412_10008031 | Ga0307412_100080317 | 197 |
| 472 | 3300031995 | Ga0307409_100076998 | Ga0307409_1000769983 | 197 |
| 473 | 3300032002 | Ga0307416_100124624 | Ga0307416_1001246243 | 197 |
| 474 | 3300032004 | Ga0307414_10013961 | Ga0307414_100139618 | 197 |
| 475 | 3300032005 | Ga0307411_10000874 | Ga0307411_1000087412 | 197 |
| 476 | 3300032126 | Ga0307415_100050306 | Ga0307415_1000503063 | 197 |
| 477 | 3300032139 | Ga0316580_10001537 | Ga0316580_100015375 | 197 |
| 478 | 3300032139 | Ga0316580_10044229 | Ga0316580_100442292 | 197 |
| 479 | 3300032168 | Ga0316593_10106258 | Ga0316593_101062581 | 197 |
| 480 | 3300032168 | Ga0316593_10166873 | Ga0316593_101668732 | 197 |
| 481 | 3300033528 | Ga0316588_1083180 | Ga0316588_10831801 | 197 |
| 482 | 3300035119 | Ga0373956_0063309 | Ga0373956_0063309_398_994 | 197 |
| 483 | 3300035410 | Ga0373924_0383177 | Ga0373924_0383177_19_615 | 197 |
| 484 | 3300035695 | Ga0373927_0091782 | Ga0373927_0091782_1024_1650 | 197 |
| 485 | 3300035725 | Ga0373947_0145684 | Ga0373947_0145684_574_1194 | 197 |
| 486 | 3300036647 | Ga0316582_0004958 | Ga0316582_0004958_5332_5937 | 197 |
| 487 | 3300036647 | Ga0316582_0010780 | Ga0316582_0010780_1677_2270 | 197 |
| 488 | 3300036712 | Ga0316584_0008439 | Ga0316584_0008439_3040_3645 | 197 |
| 489 | 3300036712 | Ga0316584_0095107 | Ga0316584_0095107_858_1451 | 197 |
| 490 | 3300036712 | Ga0316584_0219362 | Ga0316584_0219362_25_630 | 197 |
| 491 | 3300037068 | Ga0373925_0158374 | Ga0373925_0158374_64_660 | 197 |
| 492 | 3300042876 | Ga0451577_1071569 | Ga0451577_1071569_94_687 | 197 |
| 493 | 3300044673 | Ga0453683_0113604 | Ga0453683_0113604_626_1231 | 197 |
| 494 | 3300044683 | Ga0466965_0268405 | Ga0466965_0268405_83_676 | 197 |
| 495 | 3300046472 | Ga0495580_0031053 | Ga0495580_0031053_3143_3763 | 197 |
| 496 | 3300046472 | Ga0495580_0117159 | Ga0495580_0117159_757_1353 | 197 |
| 497 | 3300046524 | Ga0495648_0169559 | Ga0495648_0169559_367_969 | 197 |
| 498 | 3300046537 | Ga0495598_0150252 | Ga0495598_0150252_148_744 | 197 |
| 499 | 3300048904 | Ga0496101_0915618 | Ga0496101_0915618_15_614 | 197 |
| 500 | 3300048909 | Ga0496106_0094040 | Ga0496106_0094040_706_1305 | 197 |
| 501 | 3300048911 | Ga0496108_0236469 | Ga0496108_0236469_551_1150 | 197 |
| 502 | 3300048917 | Ga0496114_0037516 | Ga0496114_0037516_181_780 | 197 |
| 503 | 3300049592 | Ga0501076_0763679 | Ga0501076_0763679_141_734 | 197 |
| 504 | 3300050511 | nmdc:mga08y16_68226_c1 | nmdc:mga08y16_68226_c1_409_1008 | 197 |
| 505 | 3300050512 | nmdc:mga0n895_191951_c1 | nmdc:mga0n895_191951_c1_236_856 | 197 |
| 506 | 3300050513 | nmdc:mga0rr50_384634_c1 | nmdc:mga0rr50_384634_c1_346_966 | 197 |
| 507 | 3300003751 | Ga0055538_1000038 | Ga0055538_1000038119 | 198 |
| 508 | 3300003752 | Ga0055539_1000049 | Ga0055539_1000049119 | 198 |
| 509 | 3300003756 | Ga0055533_1000060 | Ga0055533_1000060119 | 198 |
| 510 | 3300003759 | Ga0055525_1000068 | Ga0055525_100006876 | 198 |
| 511 | 3300003841 | Ga0055541_1000036 | Ga0055541_100003676 | 198 |
| 512 | 3300005328 | Ga0070676_10007085 | Ga0070676_100070852 | 198 |
| 513 | 3300005331 | Ga0070670_100140615 | Ga0070670_1001406152 | 198 |
| 514 | 3300005331 | Ga0070670_100545016 | Ga0070670_1005450162 | 198 |
| 515 | 3300005334 | Ga0068869_100007578 | Ga0068869_1000075788 | 198 |
| 516 | 3300005334 | Ga0068869_100008290 | Ga0068869_1000082905 | 198 |
| 517 | 3300005334 | Ga0068869_100547133 | Ga0068869_1005471331 | 198 |
| 518 | 3300005335 | Ga0070666_10049642 | Ga0070666_100496422 | 198 |
| 519 | 3300005338 | Ga0068868_100047324 | Ga0068868_1000473242 | 198 |
| 520 | 3300005340 | Ga0070689_100013740 | Ga0070689_1000137406 | 198 |
| 521 | 3300005353 | Ga0070669_100011337 | Ga0070669_10001133711 | 198 |
| 522 | 3300005353 | Ga0070669_100197570 | Ga0070669_1001975702 | 198 |
| 523 | 3300005354 | Ga0070675_100026716 | Ga0070675_1000267163 | 198 |
| 524 | 3300005355 | Ga0070671_100298584 | Ga0070671_1002985842 | 198 |
| 525 | 3300005356 | Ga0070674_100271873 | Ga0070674_1002718731 | 198 |
| 526 | 3300005356 | Ga0070674_100430987 | Ga0070674_1004309871 | 198 |
| 527 | 3300005364 | Ga0070673_100272128 | Ga0070673_1002721282 | 198 |
| 528 | 3300005364 | Ga0070673_100344370 | Ga0070673_1003443702 | 198 |
| 529 | 3300005365 | Ga0070688_100327212 | Ga0070688_1003272121 | 198 |
| 530 | 3300005367 | Ga0070667_100055691 | Ga0070667_1000556912 | 198 |
| 531 | 3300005367 | Ga0070667_100137227 | Ga0070667_1001372272 | 198 |
| 532 | 3300005367 | Ga0070667_100214749 | Ga0070667_1002147492 | 198 |
| 533 | 3300005439 | Ga0070711_100076373 | Ga0070711_1000763734 | 198 |
| 534 | 3300005445 | Ga0070708_100249928 | Ga0070708_1002499282 | 198 |
| 535 | 3300005456 | Ga0070678_100013673 | Ga0070678_1000136737 | 198 |
| 536 | 3300005456 | Ga0070678_101225191 | Ga0070678_1012251911 | 198 |
| 537 | 3300005458 | Ga0070681_10507030 | Ga0070681_105070302 | 198 |
| 538 | 3300005459 | Ga0068867_100005656 | Ga0068867_1000056564 | 198 |
| 539 | 3300005459 | Ga0068867_100387254 | Ga0068867_1003872542 | 198 |
| 540 | 3300005539 | Ga0068853_100041016 | Ga0068853_1000410163 | 198 |
| 541 | 3300005548 | Ga0070665_100010396 | Ga0070665_1000103962 | 198 |
| 542 | 3300005548 | Ga0070665_100025954 | Ga0070665_1000259544 | 198 |
| 543 | 3300005548 | Ga0070665_100962925 | Ga0070665_1009629252 | 198 |
| 544 | 3300005563 | Ga0068855_100001111 | Ga0068855_10000111133 | 198 |
| 545 | 3300005578 | Ga0068854_100007750 | Ga0068854_1000077502 | 198 |
| 546 | 3300005617 | Ga0068859_100011041 | Ga0068859_1000110413 | 198 |
| 547 | 3300005617 | Ga0068859_100594582 | Ga0068859_1005945821 | 198 |
| 548 | 3300005618 | Ga0068864_100008010 | Ga0068864_1000080104 | 198 |
| 549 | 3300005719 | Ga0068861_100082970 | Ga0068861_1000829703 | 198 |
| 550 | 3300005841 | Ga0068863_100104886 | Ga0068863_1001048863 | 198 |
| 551 | 3300005842 | Ga0068858_100102803 | Ga0068858_1001028033 | 198 |
| 552 | 3300005842 | Ga0068858_100145995 | Ga0068858_1001459951 | 198 |
| 553 | 3300005843 | Ga0068860_100010046 | Ga0068860_1000100463 | 198 |
| 554 | 3300005844 | Ga0068862_100065861 | Ga0068862_1000658614 | 198 |
| 555 | 3300005844 | Ga0068862_100559616 | Ga0068862_1005596162 | 198 |
| 556 | 3300006237 | Ga0097621_100015272 | Ga0097621_1000152723 | 198 |
| 557 | 3300006237 | Ga0097621_100026255 | Ga0097621_1000262552 | 198 |
| 558 | 3300006237 | Ga0097621_100070108 | Ga0097621_1000701084 | 198 |
| 559 | 3300006358 | Ga0068871_100018023 | Ga0068871_1000180237 | 198 |
| 560 | 3300006358 | Ga0068871_100067154 | Ga0068871_1000671542 | 198 |
| 561 | 3300006931 | Ga0097620_100011041 | Ga0097620_1000110413 | 198 |
| 562 | 3300006931 | Ga0097620_100594609 | Ga0097620_1005946092 | 198 |
| 563 | 3300009093 | Ga0105240_10080514 | Ga0105240_100805144 | 198 |
| 564 | 3300009093 | Ga0105240_10282157 | Ga0105240_102821571 | 198 |
| 565 | 3300009176 | Ga0105242_10193740 | Ga0105242_101937402 | 198 |
| 566 | 3300009545 | Ga0105237_10177610 | Ga0105237_101776102 | 198 |
| 567 | 3300009551 | Ga0105238_10000037 | Ga0105238_1000003722 | 198 |
| 568 | 3300009553 | Ga0105249_10695340 | Ga0105249_106953402 | 198 |
| 569 | 3300010159 | Ga0099796_10032235 | Ga0099796_100322352 | 198 |
| 570 | 3300010375 | Ga0105239_10003694 | Ga0105239_1000369421 | 198 |
| 571 | 3300010375 | Ga0105239_10126821 | Ga0105239_101268212 | 198 |
| 572 | 3300011119 | Ga0105246_10058629 | Ga0105246_100586292 | 198 |
| 573 | 3300013102 | Ga0157371_10420569 | Ga0157371_104205691 | 198 |
| 574 | 3300013296 | Ga0157374_10063782 | Ga0157374_100637822 | 198 |
| 575 | 3300013297 | Ga0157378_10154075 | Ga0157378_101540753 | 198 |
| 576 | 3300013308 | Ga0157375_11420214 | Ga0157375_114202142 | 198 |
| 577 | 3300014325 | Ga0163163_10415524 | Ga0163163_104155241 | 198 |
| 578 | 3300014326 | Ga0157380_10039424 | Ga0157380_100394242 | 198 |
| 579 | 3300014326 | Ga0157380_10122177 | Ga0157380_101221772 | 198 |
| 580 | 3300014968 | Ga0157379_10050073 | Ga0157379_100500733 | 198 |
| 581 | 3300017792 | Ga0163161_10034675 | Ga0163161_100346754 | 198 |
| 582 | 3300021361 | Ga0213872_10000532 | Ga0213872_100005324 | 198 |
| 583 | 3300021361 | Ga0213872_10028863 | Ga0213872_100288633 | 198 |
| 584 | 3300021361 | Ga0213872_10075631 | Ga0213872_100756313 | 198 |
| 585 | 3300025224 | Ga0209784_100021 | Ga0209784_100021219 | 198 |
| 586 | 3300025225 | Ga0209566_100039 | Ga0209566_100039220 | 198 |
| 587 | 3300025226 | Ga0209674_100036 | Ga0209674_100036219 | 198 |
| 588 | 3300025230 | Ga0209563_100040 | Ga0209563_100040219 | 198 |
| 589 | 3300025253 | Ga0209677_100023 | Ga0209677_100023219 | 198 |
| 590 | 3300025893 | Ga0207682_10098547 | Ga0207682_100985472 | 198 |
| 591 | 3300025893 | Ga0207682_10258890 | Ga0207682_102588902 | 198 |
| 592 | 3300025901 | Ga0207688_10219330 | Ga0207688_102193302 | 198 |
| 593 | 3300025907 | Ga0207645_10000283 | Ga0207645_1000028310 | 198 |
| 594 | 3300025908 | Ga0207643_10149304 | Ga0207643_101493041 | 198 |
| 595 | 3300025913 | Ga0207695_10004822 | Ga0207695_1000482210 | 198 |
| 596 | 3300025913 | Ga0207695_10123126 | Ga0207695_101231263 | 198 |
| 597 | 3300025914 | Ga0207671_10029655 | Ga0207671_100296556 | 198 |
| 598 | 3300025916 | Ga0207663_10182289 | Ga0207663_101822891 | 198 |
| 599 | 3300025923 | Ga0207681_10030135 | Ga0207681_100301351 | 198 |
| 600 | 3300025924 | Ga0207694_10000054 | Ga0207694_1000005423 | 198 |
| 601 | 3300025925 | Ga0207650_10392283 | Ga0207650_103922832 | 198 |
| 602 | 3300025925 | Ga0207650_10603642 | Ga0207650_106036421 | 198 |
| 603 | 3300025925 | Ga0207650_10656347 | Ga0207650_106563472 | 198 |
| 604 | 3300025926 | Ga0207659_10039071 | Ga0207659_100390713 | 198 |
| 605 | 3300025927 | Ga0207687_10140591 | Ga0207687_101405911 | 198 |
| 606 | 3300025931 | Ga0207644_10640179 | Ga0207644_106401792 | 198 |
| 607 | 3300025934 | Ga0207686_10014249 | Ga0207686_100142493 | 198 |
| 608 | 3300025934 | Ga0207686_10120182 | Ga0207686_101201822 | 198 |
| 609 | 3300025936 | Ga0207670_10040216 | Ga0207670_100402162 | 198 |
| 610 | 3300025937 | Ga0207669_10864731 | Ga0207669_108647311 | 198 |
| 611 | 3300025938 | Ga0207704_10021622 | Ga0207704_100216222 | 198 |
| 612 | 3300025940 | Ga0207691_10027496 | Ga0207691_100274964 | 198 |
| 613 | 3300025940 | Ga0207691_10073729 | Ga0207691_100737293 | 198 |
| 614 | 3300025941 | Ga0207711_10066450 | Ga0207711_100664501 | 198 |
| 615 | 3300025942 | Ga0207689_10004785 | Ga0207689_1000478511 | 198 |
| 616 | 3300025942 | Ga0207689_10016386 | Ga0207689_100163864 | 198 |
| 617 | 3300025942 | Ga0207689_10837095 | Ga0207689_108370951 | 198 |
| 618 | 3300025949 | Ga0207667_10000043 | Ga0207667_1000004322 | 198 |
| 619 | 3300025960 | Ga0207651_10086881 | Ga0207651_100868813 | 198 |
| 620 | 3300025960 | Ga0207651_10120789 | Ga0207651_101207893 | 198 |
| 621 | 3300025972 | Ga0207668_10007674 | Ga0207668_100076742 | 198 |
| 622 | 3300025986 | Ga0207658_10009685 | Ga0207658_100096853 | 198 |
| 623 | 3300026035 | Ga0207703_10011411 | Ga0207703_1001141111 | 198 |
| 624 | 3300026035 | Ga0207703_10065587 | Ga0207703_100655873 | 198 |
| 625 | 3300026035 | Ga0207703_10088049 | Ga0207703_100880492 | 198 |
| 626 | 3300026041 | Ga0207639_10286592 | Ga0207639_102865922 | 198 |
| 627 | 3300026078 | Ga0207702_10638676 | Ga0207702_106386762 | 198 |
| 628 | 3300026088 | Ga0207641_10082878 | Ga0207641_100828784 | 198 |
| 629 | 3300026089 | Ga0207648_10000564 | Ga0207648_1000056447 | 198 |
| 630 | 3300026089 | Ga0207648_10010337 | Ga0207648_100103375 | 198 |
| 631 | 3300026089 | Ga0207648_10855858 | Ga0207648_108558581 | 198 |
| 632 | 3300026095 | Ga0207676_10093767 | Ga0207676_100937672 | 198 |
| 633 | 3300026116 | Ga0207674_10067908 | Ga0207674_100679082 | 198 |
| 634 | 3300026118 | Ga0207675_100398854 | Ga0207675_1003988542 | 198 |
| 635 | 3300026121 | Ga0207683_10000424 | Ga0207683_100004249 | 198 |
| 636 | 3300026121 | Ga0207683_10050559 | Ga0207683_100505592 | 198 |
| 637 | 3300027682 | Ga0209971_1008768 | Ga0209971_10087682 | 198 |
| 638 | 3300028379 | Ga0268266_10051870 | Ga0268266_100518704 | 198 |
| 639 | 3300028380 | Ga0268265_11064964 | Ga0268265_110649641 | 198 |
| 640 | 3300028381 | Ga0268264_10170987 | Ga0268264_101709873 | 198 |
| 641 | 3300031235 | Ga0265330_10000044 | Ga0265330_1000004476 | 198 |
| 642 | 3300031238 | Ga0265332_10000046 | Ga0265332_1000004620 | 198 |
| 643 | 3300031241 | Ga0265325_10005336 | Ga0265325_100053367 | 198 |
| 644 | 3300031711 | Ga0265314_10000130 | Ga0265314_1000013076 | 198 |
| 645 | 3300031712 | Ga0265342_10224754 | Ga0265342_102247542 | 198 |
| 646 | 3300031728 | Ga0316578_10210115 | Ga0316578_102101151 | 198 |
| 647 | 3300031911 | Ga0307412_10613775 | Ga0307412_106137752 | 198 |
| 648 | 3300032168 | Ga0316593_10046355 | Ga0316593_100463553 | 198 |
| 649 | 3300036647 | Ga0316582_0578169 | Ga0316582_0578169_25_648 | 198 |
| 650 | 3300039062 | Ga0400483_201100 | Ga0400483_201100_304_909 | 198 |
| 651 | 3300039447 | Ga0436361_0197834 | Ga0436361_0197834_1706_2314 | 198 |
| 652 | 3300039447 | Ga0436361_0632156 | Ga0436361_0632156_7403_8026 | 198 |
| 653 | 3300039447 | Ga0436361_0704696 | Ga0436361_0704696_12926_13522 | 198 |
| 654 | 3300039447 | Ga0436361_1128421 | Ga0436361_1128421_2749_3360 | 198 |
| 655 | 3300042156 | Ga0439446_0009364 | Ga0439446_0009364_1609_2244 | 198 |
| 656 | 3300042876 | Ga0451577_0121300 | Ga0451577_0121300_1685_2281 | 198 |
| 657 | 3300044673 | Ga0453683_0089392 | Ga0453683_0089392_179_802 | 198 |
| 658 | 3300045051 | Ga0451576_0090389 | Ga0451576_0090389_509_1132 | 198 |
| 659 | 3300046475 | Ga0495639_0112986 | Ga0495639_0112986_310_906 | 198 |
| 660 | 3300046507 | Ga0495606_0025241 | Ga0495606_0025241_1250_1846 | 198 |
| 661 | 3300046528 | Ga0495642_0057037 | Ga0495642_0057037_198_794 | 198 |
| 662 | 3300046539 | Ga0495621_0036484 | Ga0495621_0036484_550_1146 | 198 |
| 663 | 3300048905 | Ga0496102_0283160 | Ga0496102_0283160_874_1470 | 198 |
| 664 | 3300048906 | Ga0496103_0148425 | Ga0496103_0148425_571_1167 | 198 |
| 665 | 3300048909 | Ga0496106_0219403 | Ga0496106_0219403_139_828 | 198 |
| 666 | 3300048913 | Ga0496110_1159396 | Ga0496110_1159396_41_643 | 198 |
| 667 | 3300048917 | Ga0496114_0532137 | Ga0496114_0532137_229_888 | 198 |
| 668 | 3300048927 | Ga0496124_0004049 | Ga0496124_0004049_4267_4869 | 198 |
| 669 | 3300048929 | Ga0496126_0076463 | Ga0496126_0076463_520_1161 | 198 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f1d-assembly1.cif.gz_D | x-ray structure of imidazoleglycerol-phosphate dehydratase | 0.991 | 5 | 186 |
| 7oj5-assembly1.cif.gz_A | cryo-em structure of medicago truncatula hisn5 protein | 0.9861 | 5 | 186 |
| 2f1d-assembly1.cif.gz_D | x-ray structure of imidazoleglycerol-phosphate dehydratase | 0.9803 | 5 | 186 |
| 7oj5-assembly1.cif.gz_A | cryo-em structure of medicago truncatula hisn5 protein | 0.9703 | 5 | 186 |
| 6fwh-assembly1.cif.gz_A | acanthamoeba igpd in complex with r-c348 to 1.7a resolution | 0.9662 | 4 | 196 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ae8A02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.986 | 93 | 182 | 3.30.230.40 |
| 4qnkD01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9837 | 3 | 91 | 3.30.230.40 |
| 2f1dA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9825 | 93 | 186 | 3.30.230.40 |
| af_C6T988_68_169_3.30.230.40 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9815 | 2 | 91 | 3.30.230.40 |
| 2f1dA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9723 | 93 | 186 | 3.30.230.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0LTM6-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 1.009 | 6 | 73 |
GO:0000105
GO:0004424 |
| AF-A0A1Z9GWE8-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 1.005 | 5 | 86 |
GO:0000105
GO:0004424 |
| AF-A0A3S4I3K5-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19) | 1.004 | 5 | 78 |
GO:0000105
GO:0004424 |
| AF-A0A522GSK4-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 1.004 | 6 | 80 |
GO:0000105
GO:0004424 |
| AF-A0A2E4EWP6-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 1.004 | 6 | 68 |
GO:0000105
GO:0004424 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar