F474040

General Info

Members Datasets Scaffolds Average Seq Length
669 329 655 200

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0219403|Ga0496106_0219403_139_828
Length 229
Sequence VSGAAFISLCGAKWYHAGIGLILFDVARIPYSTAMRQAEITRNTLETQITVRLNLDGTGVSKLQTGIGFLDHMLDQIARHGLIDLEVDAKGDLHIDGHHTVEDIGISIGQALAKAWGDKKGLRRYGHAYVPLDEALSRVVIDLSGRPGLEYHVPFTRSMIGELDVDLVYEFFQGLVNHAGATLHIDNLRGINSHHQAETVFKAFGRALRMAVEVDPRMAGVIPSTKGSL

Samples

Sample ID Description Type Environment
1 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
2 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
3 2547132512 Azospira oryzae 6a3 Isolate Unclassified
4 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
5 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
6 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
7 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
8 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
9 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
10 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
11 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
12 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
13 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
14 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
185 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
186 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
187 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
200 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
214 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
215 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
221 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
229 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
232 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
233 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
234 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
235 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
236 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
237 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
238 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
239 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
240 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
241 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
242 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
243 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
246 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
247 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
250 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
251 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
261 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
262 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
263 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
264 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
295 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
299 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
300 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
301 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
307 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
311 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
314 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
320 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
321 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
322 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
323 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
324 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
325 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
326 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
327 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
328 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
329 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 0.75
Isolates 2.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.84
Nodule 0
Rhizoplane 2.09
Rhizosphere 90.58
Stem 0
Stem Tuber 0
Unclassified 4.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055538_1000038 3300003751 Bacteria 186588
2 Ga0055539_1000049 3300003752 Bacteria 186588
3 Ga0055533_1000060 3300003756 Bacteria 186588
4 Ga0055525_1000068 3300003759 Bacteria 186588
5 Ga0055541_1000036 3300003841 Bacteria 186588
6 Ga0070676_10007085 3300005328 Bacteria 6003
7 Ga0070670_100006889 3300005331 Bacteria 9631
8 Ga0070670_100016600 3300005331 Bacteria 6318
9 Ga0070670_100051454 3300005331 Bacteria 3537
10 Ga0070670_100140615 3300005331 Bacteria 2087
11 Ga0070670_100265135 3300005331 Bacteria 1498
12 Ga0070670_100330054 3300005331 Bacteria 1338
13 Ga0070670_100351953 3300005331 Bacteria 1294
14 Ga0070670_100460511 3300005331 Bacteria 1128
15 Ga0070670_100545016 3300005331 Bacteria 1035
16 Ga0068869_100007578 3300005334 Bacteria 6945
17 Ga0068869_100008290 3300005334 Bacteria 6694
18 Ga0068869_100407832 3300005334 Bacteria 1119
19 Ga0068869_100547133 3300005334 Bacteria 972
20 Ga0068869_101059741 3300005334 Bacteria 708
21 Ga0070666_10049642 3300005335 Bacteria 2820
22 Ga0070680_100063149 3300005336 Bacteria 3033
23 Ga0070682_100425772 3300005337 Bacteria 1010
24 Ga0068868_100043354 3300005338 Bacteria 3514
25 Ga0068868_100047324 3300005338 Bacteria 3370
26 Ga0068868_100090657 3300005338 Bacteria 2462
27 Ga0070660_100351838 3300005339 Bacteria 1213
28 Ga0070689_100013740 3300005340 Bacteria 5866
29 Ga0070689_100352155 3300005340 Bacteria 1235
30 Ga0070691_10338831 3300005341 Bacteria 832
31 Ga0070661_100029556 3300005344 Bacteria 3956
32 Ga0070668_100039737 3300005347 Bacteria 3598
33 Ga0070669_100011337 3300005353 Bacteria 6327
34 Ga0070669_100022069 3300005353 Bacteria 4553
35 Ga0070669_100197570 3300005353 Bacteria 1581
36 Ga0070675_100000345 3300005354 Bacteria 31378
37 Ga0070675_100026716 3300005354 Bacteria 4632
38 Ga0070675_100128969 3300005354 Bacteria 2154
39 Ga0070671_100004354 3300005355 Bacteria 11196
40 Ga0070671_100230216 3300005355 Bacteria 1573
41 Ga0070671_100298584 3300005355 Bacteria 1371
42 Ga0070671_100418935 3300005355 Bacteria 1147
43 Ga0070674_100007024 3300005356 Bacteria 6616
44 Ga0070674_100017660 3300005356 Bacteria 4495
45 Ga0070674_100271873 3300005356 Bacteria 1339
46 Ga0070674_100430987 3300005356 Bacteria 1084
47 Ga0070674_100824499 3300005356 Bacteria 803
48 Ga0070673_100054198 3300005364 Bacteria 3154
49 Ga0070673_100272128 3300005364 Bacteria 1483
50 Ga0070673_100344370 3300005364 Bacteria 1321
51 Ga0070673_101190370 3300005364 Bacteria 714
52 Ga0070688_100327212 3300005365 Bacteria 1115
53 Ga0070667_100002153 3300005367 Bacteria 17348
54 Ga0070667_100055691 3300005367 Bacteria 3339
55 Ga0070667_100063550 3300005367 Bacteria 3129
56 Ga0070667_100137227 3300005367 Bacteria 2139
57 Ga0070667_100214749 3300005367 Bacteria 1711
58 Ga0070667_100405091 3300005367 Bacteria 1242
59 Ga0070714_100016095 3300005435 Bacteria 6029
60 Ga0070711_100076373 3300005439 Bacteria 2375
61 Ga0070705_100098308 3300005440 Bacteria 1841
62 Ga0070694_100194439 3300005444 Bacteria 1508
63 Ga0070708_100249928 3300005445 Bacteria 1666
64 Ga0070678_100002860 3300005456 Bacteria 9558
65 Ga0070678_100013673 3300005456 Bacteria 5099
66 Ga0070678_100450889 3300005456 Bacteria 1127
67 Ga0070678_100655736 3300005456 Bacteria 942
68 Ga0070678_100960374 3300005456 Bacteria 784
69 Ga0070678_101225191 3300005456 Bacteria 696
70 Ga0070662_100125520 3300005457 Bacteria 1972
71 Ga0070681_10056629 3300005458 Bacteria 3901
72 Ga0070681_10507030 3300005458 Bacteria 1120
73 Ga0068867_100004068 3300005459 Bacteria 10294
74 Ga0068867_100005656 3300005459 Bacteria 8863
75 Ga0068867_100042758 3300005459 Bacteria 3316
76 Ga0068867_100387254 3300005459 Bacteria 1176
77 Ga0068867_100754424 3300005459 Bacteria 864
78 Ga0070706_100256514 3300005467 Bacteria 1632
79 Ga0070706_100414112 3300005467 Bacteria 1255
80 Ga0070707_100456444 3300005468 Bacteria 1238
81 Ga0070707_100828959 3300005468 Bacteria 889
82 Ga0070698_100126714 3300005471 Bacteria 2510
83 Ga0070699_100582674 3300005518 Bacteria 1019
84 Ga0070679_100005476 3300005530 Bacteria 11765
85 Ga0070679_100007684 3300005530 Bacteria 10093
86 Ga0070679_100121699 3300005530 Bacteria 2594
87 Ga0070679_100201319 3300005530 Bacteria 1957
88 Ga0070684_100229658 3300005535 Bacteria 1694
89 Ga0070697_100143990 3300005536 Bacteria 2005
90 Ga0068853_100035271 3300005539 Bacteria 4248
91 Ga0068853_100041016 3300005539 Bacteria 3952
92 Ga0068853_100044550 3300005539 Bacteria 3798
93 Ga0070672_100000229 3300005543 Bacteria 31255
94 Ga0070672_100016634 3300005543 Bacteria 5272
95 Ga0070672_100089040 3300005543 Bacteria 2486
96 Ga0070686_100829095 3300005544 Bacteria 747
97 Ga0070696_100127459 3300005546 Bacteria 1848
98 Ga0070693_100011883 3300005547 Bacteria 4394
99 Ga0070665_100010396 3300005548 Bacteria 9417
100 Ga0070665_100025954 3300005548 Bacteria 5901
101 Ga0070665_100291717 3300005548 Bacteria 1633
102 Ga0070665_100962925 3300005548 Bacteria 866
103 Ga0068855_100001111 3300005563 Bacteria 33458
104 Ga0068855_100393806 3300005563 Bacteria 1519
105 Ga0070664_100142688 3300005564 Bacteria 2110
106 Ga0070664_100157118 3300005564 Bacteria 2010
107 Ga0070664_100393780 3300005564 Bacteria 1266
108 Ga0070664_100636031 3300005564 Bacteria 991
109 Ga0068857_100144104 3300005577 Bacteria 2155
110 Ga0068854_100007750 3300005578 Bacteria 6865
111 Ga0070702_100365321 3300005615 Bacteria 1021
112 Ga0068852_100717265 3300005616 Bacteria 1011
113 Ga0068852_100781724 3300005616 Bacteria 968
114 Ga0068859_100011041 3300005617 Bacteria 9087
115 Ga0068859_100306702 3300005617 Bacteria 1681
116 Ga0068859_100594582 3300005617 Bacteria 1200
117 Ga0068864_100000221 3300005618 Bacteria 51532
118 Ga0068864_100002948 3300005618 Bacteria 14063
119 Ga0068864_100008010 3300005618 Bacteria 8715
120 Ga0068864_100171650 3300005618 Bacteria 1977
121 Ga0068864_100534554 3300005618 Bacteria 1131
122 Ga0068866_10573592 3300005718 Bacteria 758
123 Ga0068861_100013833 3300005719 Bacteria 5655
124 Ga0068861_100082970 3300005719 Bacteria 2513
125 Ga0068851_10143536 3300005834 Bacteria 1300
126 Ga0068870_10039828 3300005840 Bacteria 2433
127 Ga0068863_100002529 3300005841 Bacteria 18145
128 Ga0068863_100041895 3300005841 Bacteria 4352
129 Ga0068863_100051123 3300005841 Bacteria 3917
130 Ga0068863_100071732 3300005841 Bacteria 3276
131 Ga0068863_100104886 3300005841 Bacteria 2689
132 Ga0068863_100143263 3300005841 Bacteria 2285
133 Ga0068863_100285752 3300005841 Bacteria 1599
134 Ga0068858_100102803 3300005842 Bacteria 2665
135 Ga0068858_100145995 3300005842 Bacteria 2222
136 Ga0068858_100160232 3300005842 Bacteria 2118
137 Ga0068860_100010046 3300005843 Bacteria 9379
138 Ga0068862_100065861 3300005844 Bacteria 3121
139 Ga0068862_100559616 3300005844 Bacteria 1093
140 Ga0081539_10015819 3300005985 Bacteria 5447
141 Ga0070716_100008565 3300006173 Bacteria 5080
142 Ga0075366_10008305 3300006195 Bacteria 5768
143 Ga0097621_100010473 3300006237 Bacteria 6789
144 Ga0097621_100015272 3300006237 Bacteria 5774
145 Ga0097621_100026255 3300006237 Bacteria 4566
146 Ga0097621_100070108 3300006237 Bacteria 2894
147 Ga0097621_100420253 3300006237 Bacteria 1200
148 Ga0075370_10271332 3300006353 Bacteria 1007
149 Ga0068871_100011074 3300006358 Bacteria 6610
150 Ga0068871_100018023 3300006358 Bacteria 5358
151 Ga0068871_100067154 3300006358 Bacteria 2941
152 Ga0068871_100073876 3300006358 Bacteria 2812
153 Ga0068871_100120239 3300006358 Bacteria 2218
154 Ga0075428_100000089 3300006844 Bacteria 75097
155 Ga0075430_100036111 3300006846 Bacteria 4191
156 Ga0075431_100000766 3300006847 Bacteria 27825
157 Ga0075431_100355902 3300006847 Bacteria 1471
158 Ga0075433_10048009 3300006852 Bacteria 3712
159 Ga0075434_100012989 3300006871 Bacteria 7910
160 Ga0075429_100034099 3300006880 Bacteria 4423
161 Ga0068865_100162558 3300006881 Bacteria 1705
162 Ga0097620_100011041 3300006931 Bacteria 9087
163 Ga0097620_100306695 3300006931 Bacteria 1681
164 Ga0097620_100594609 3300006931 Bacteria 1200
165 Ga0075435_100021557 3300007076 Bacteria 4957
166 Ga0075435_100152759 3300007076 Bacteria 1942
167 Ga0075435_100710534 3300007076 Bacteria 874
168 Ga0105240_10080514 3300009093 Bacteria 4005
169 Ga0105240_10282157 3300009093 Bacteria 1907
170 Ga0111539_10001921 3300009094 Bacteria 27677
171 Ga0111539_10049803 3300009094 Bacteria 4992
172 Ga0111539_10083256 3300009094 Bacteria 3762
173 Ga0105245_10457993 3300009098 Bacteria 1285
174 Ga0105247_10022891 3300009101 Bacteria 3763
175 Ga0114129_10194455 3300009147 Bacteria 2752
176 Ga0114129_10776949 3300009147 Bacteria 1224
177 Ga0105241_10008396 3300009174 Bacteria 7599
178 Ga0105242_10193740 3300009176 Bacteria 1801
179 Ga0105248_10043136 3300009177 Bacteria 5058
180 Ga0105248_10252992 3300009177 Bacteria 1983
181 Ga0105248_11099611 3300009177 Bacteria 898
182 Ga0105237_10019528 3300009545 Bacteria 7000
183 Ga0105237_10177610 3300009545 Bacteria 2130
184 Ga0105238_10000037 3300009551 Bacteria 163954
185 Ga0105249_10050241 3300009553 Bacteria 3802
186 Ga0105249_10636697 3300009553 Bacteria 1123
187 Ga0105249_10695340 3300009553 Bacteria 1077
188 Ga0099796_10032235 3300010159 Bacteria 1715
189 Ga0105239_10003694 3300010375 Bacteria 18647
190 Ga0105239_10126821 3300010375 Bacteria 2837
191 Ga0105239_10309750 3300010375 Bacteria 1779
192 Ga0105246_10058629 3300011119 Bacteria 2668
193 Ga0157373_10002101 3300013100 Bacteria 15084
194 Ga0157371_10420569 3300013102 Bacteria 980
195 Ga0157370_10006761 3300013104 Bacteria 12580
196 Ga0157370_10062128 3300013104 Bacteria 3543
197 Ga0157370_10170980 3300013104 Bacteria 2020
198 Ga0157374_10002909 3300013296 Bacteria 14341
199 Ga0157374_10063782 3300013296 Bacteria 3456
200 Ga0157378_10025647 3300013297 Bacteria 5190
201 Ga0157378_10154075 3300013297 Bacteria 2143
202 Ga0157378_10302282 3300013297 Bacteria 1549
203 Ga0163162_10046879 3300013306 Bacteria 4333
204 Ga0163162_10222600 3300013306 Bacteria 2017
205 Ga0157372_10186251 3300013307 Bacteria 2404
206 Ga0157372_10207503 3300013307 Bacteria 2270
207 Ga0157372_10943907 3300013307 Bacteria 1000
208 Ga0157375_10057467 3300013308 Bacteria 3846
209 Ga0157375_11055736 3300013308 Bacteria 950
210 Ga0157375_11219164 3300013308 Bacteria 883
211 Ga0157375_11420214 3300013308 Bacteria 818
212 Ga0163163_10148511 3300014325 Bacteria 2388
213 Ga0163163_10200793 3300014325 Bacteria 2042
214 Ga0163163_10285183 3300014325 Bacteria 1703
215 Ga0163163_10415524 3300014325 Bacteria 1404
216 Ga0157380_10039424 3300014326 Bacteria 3673
217 Ga0157380_10122177 3300014326 Bacteria 2207
218 Ga0157380_10397101 3300014326 Bacteria 1307
219 Ga0157379_10050073 3300014968 Bacteria 3728
220 Ga0157379_10954228 3300014968 Bacteria 816
221 Ga0157376_10041971 3300014969 Bacteria 3748
222 Ga0157376_10085189 3300014969 Bacteria 2723
223 Ga0163161_10001851 3300017792 Bacteria 15456
224 Ga0163161_10034675 3300017792 Bacteria 3610
225 Ga0163161_10144297 3300017792 Bacteria 1805
226 Ga0213872_10000532 3300021361 Bacteria 29832
227 Ga0213872_10001257 3300021361 Bacteria 17069
228 Ga0213872_10004111 3300021361 Bacteria 7831
229 Ga0213872_10028863 3300021361 Bacteria 2544
230 Ga0213872_10075631 3300021361 Bacteria 1515
231 Ga0209784_100021 3300025224 Bacteria 408534
232 Ga0209566_100039 3300025225 Bacteria 303368
233 Ga0209674_100036 3300025226 Bacteria 408534
234 Ga0209563_100040 3300025230 Bacteria 408534
235 Ga0209677_100023 3300025253 Bacteria 408534
236 Ga0207697_10005049 3300025315 Bacteria 6184
237 Ga0207682_10098547 3300025893 Bacteria 1275
238 Ga0207682_10258890 3300025893 Bacteria 811
239 Ga0207692_10500181 3300025898 Bacteria 771
240 Ga0207642_10383436 3300025899 Bacteria 837
241 Ga0207688_10219330 3300025901 Bacteria 1145
242 Ga0207645_10000283 3300025907 Bacteria 42259
243 Ga0207643_10033806 3300025908 Bacteria 2861
244 Ga0207643_10149304 3300025908 Bacteria 1400
245 Ga0207643_10365801 3300025908 Bacteria 907
246 Ga0207684_10045540 3300025910 Bacteria 3720
247 Ga0207684_10064876 3300025910 Bacteria 3100
248 Ga0207707_10023156 3300025912 Bacteria 5434
249 Ga0207707_10963092 3300025912 Bacteria 702
250 Ga0207695_10004822 3300025913 Bacteria 18234
251 Ga0207695_10123126 3300025913 Bacteria 2559
252 Ga0207671_10029655 3300025914 Bacteria 4084
253 Ga0207671_10041878 3300025914 Bacteria 3390
254 Ga0207663_10182289 3300025916 Bacteria 1501
255 Ga0207660_10046173 3300025917 Bacteria 3072
256 Ga0207660_10330678 3300025917 Bacteria 1218
257 Ga0207662_10042449 3300025918 Bacteria 2681
258 Ga0207657_10268658 3300025919 Bacteria 1356
259 Ga0207657_10368070 3300025919 Bacteria 1132
260 Ga0207652_10026700 3300025921 Bacteria 4812
261 Ga0207652_10197973 3300025921 Bacteria 1808
262 Ga0207681_10019329 3300025923 Bacteria 4303
263 Ga0207681_10030135 3300025923 Bacteria 3534
264 Ga0207681_10387273 3300025923 Bacteria 1126
265 Ga0207681_10537378 3300025923 Bacteria 961
266 Ga0207694_10000054 3300025924 Bacteria 152124
267 Ga0207650_10000230 3300025925 Bacteria 62576
268 Ga0207650_10000403 3300025925 Bacteria 38821
269 Ga0207650_10028029 3300025925 Bacteria 4036
270 Ga0207650_10130214 3300025925 Bacteria 1968
271 Ga0207650_10140211 3300025925 Bacteria 1900
272 Ga0207650_10198753 3300025925 Bacteria 1605
273 Ga0207650_10392283 3300025925 Bacteria 1148
274 Ga0207650_10548575 3300025925 Bacteria 969
275 Ga0207650_10603642 3300025925 Bacteria 923
276 Ga0207650_10656347 3300025925 Bacteria 884
277 Ga0207659_10002004 3300025926 Bacteria 12070
278 Ga0207659_10039071 3300025926 Bacteria 3306
279 Ga0207659_10067334 3300025926 Bacteria 2601
280 Ga0207659_10507312 3300025926 Bacteria 1022
281 Ga0207687_10058566 3300025927 Bacteria 2711
282 Ga0207687_10140591 3300025927 Bacteria 1831
283 Ga0207664_10018372 3300025929 Bacteria 5145
284 Ga0207644_10142054 3300025931 Bacteria 1849
285 Ga0207644_10142605 3300025931 Bacteria 1846
286 Ga0207644_10640179 3300025931 Bacteria 884
287 Ga0207690_10035471 3300025932 Bacteria 3222
288 Ga0207706_10021527 3300025933 Bacteria 5788
289 Ga0207686_10014249 3300025934 Bacteria 4421
290 Ga0207686_10120182 3300025934 Bacteria 1787
291 Ga0207670_10040216 3300025936 Bacteria 3068
292 Ga0207670_10477256 3300025936 Bacteria 1009
293 Ga0207669_10004262 3300025937 Bacteria 6280
294 Ga0207669_10864731 3300025937 Bacteria 753
295 Ga0207704_10021622 3300025938 Bacteria 3431
296 Ga0207704_10099209 3300025938 Bacteria 1937
297 Ga0207704_10113690 3300025938 Bacteria 1836
298 Ga0207704_10346583 3300025938 Bacteria 1155
299 Ga0207691_10000681 3300025940 Bacteria 33590
300 Ga0207691_10011116 3300025940 Bacteria 8640
301 Ga0207691_10027496 3300025940 Bacteria 5332
302 Ga0207691_10073729 3300025940 Bacteria 3079
303 Ga0207691_10093390 3300025940 Bacteria 2694
304 Ga0207711_10066450 3300025941 Bacteria 3118
305 Ga0207711_10218069 3300025941 Bacteria 1744
306 Ga0207689_10004785 3300025942 Bacteria 12207
307 Ga0207689_10016386 3300025942 Bacteria 6275
308 Ga0207689_10368332 3300025942 Bacteria 1195
309 Ga0207689_10395647 3300025942 Bacteria 1151
310 Ga0207689_10837095 3300025942 Bacteria 777
311 Ga0207679_10133213 3300025945 Bacteria 1997
312 Ga0207679_10195988 3300025945 Bacteria 1683
313 Ga0207679_10839760 3300025945 Bacteria 839
314 Ga0207667_10000043 3300025949 Bacteria 261426
315 Ga0207667_10254072 3300025949 Bacteria 1798
316 Ga0207651_10030166 3300025960 Bacteria 3448
317 Ga0207651_10057679 3300025960 Bacteria 2679
318 Ga0207651_10086881 3300025960 Bacteria 2275
319 Ga0207651_10120789 3300025960 Bacteria 1986
320 Ga0207712_10150185 3300025961 Bacteria 1799
321 Ga0207668_10007674 3300025972 Bacteria 6419
322 Ga0207668_10011071 3300025972 Bacteria 5470
323 Ga0207640_10258913 3300025981 Bacteria 1355
324 Ga0207658_10001079 3300025986 Bacteria 22086
325 Ga0207658_10009685 3300025986 Bacteria 6538
326 Ga0207658_10044220 3300025986 Bacteria 3242
327 Ga0207658_10149890 3300025986 Bacteria 1899
328 Ga0207677_10009684 3300026023 Bacteria 5428
329 Ga0207677_10145963 3300026023 Bacteria 1818
330 Ga0207703_10011411 3300026035 Bacteria 6910
331 Ga0207703_10065587 3300026035 Bacteria 2984
332 Ga0207703_10088049 3300026035 Bacteria 2605
333 Ga0207703_10291833 3300026035 Bacteria 1484
334 Ga0207639_10023614 3300026041 Bacteria 4441
335 Ga0207639_10040678 3300026041 Bacteria 3471
336 Ga0207639_10286592 3300026041 Bacteria 1450
337 Ga0207702_10638676 3300026078 Bacteria 1046
338 Ga0207641_10001602 3300026088 Bacteria 22081
339 Ga0207641_10082878 3300026088 Bacteria 2787
340 Ga0207641_10268040 3300026088 Bacteria 1601
341 Ga0207648_10000564 3300026089 Bacteria 41549
342 Ga0207648_10010337 3300026089 Bacteria 8850
343 Ga0207648_10059099 3300026089 Bacteria 3344
344 Ga0207648_10074201 3300026089 Bacteria 2965
345 Ga0207648_10855858 3300026089 Bacteria 848
346 Ga0207676_10003750 3300026095 Bacteria 10737
347 Ga0207676_10093767 3300026095 Bacteria 2472
348 Ga0207676_10306740 3300026095 Bacteria 1451
349 Ga0207676_10336881 3300026095 Bacteria 1390
350 Ga0207676_10510748 3300026095 Bacteria 1142
351 Ga0207674_10032531 3300026116 Bacteria 5470
352 Ga0207674_10067908 3300026116 Bacteria 3588
353 Ga0207675_100061483 3300026118 Bacteria 3506
354 Ga0207675_100110730 3300026118 Bacteria 2591
355 Ga0207675_100398854 3300026118 Bacteria 1355
356 Ga0207675_100712269 3300026118 Bacteria 1013
357 Ga0207683_10000424 3300026121 Bacteria 39012
358 Ga0207683_10004300 3300026121 Bacteria 12301
359 Ga0207683_10050559 3300026121 Bacteria 3641
360 Ga0207683_11015420 3300026121 Bacteria 770
361 Ga0207698_10463773 3300026142 Bacteria 1226
362 Ga0207698_10722742 3300026142 Bacteria 993
363 Ga0209969_1012582 3300027360 Bacteria 1221
364 Ga0209971_1008768 3300027682 Bacteria 2398
365 Ga0207428_10011825 3300027907 Bacteria 7691
366 Ga0207428_10073354 3300027907 Bacteria 2685
367 Ga0207428_10195804 3300027907 Bacteria 1522
368 Ga0268266_10040066 3300028379 Bacteria 3991
369 Ga0268266_10051870 3300028379 Bacteria 3522
370 Ga0268265_10029817 3300028380 Bacteria 3923
371 Ga0268265_10139293 3300028380 Bacteria 2029
372 Ga0268265_10142597 3300028380 Bacteria 2008
373 Ga0268265_11064964 3300028380 Bacteria 801
374 Ga0268264_10039780 3300028381 Bacteria 3885
375 Ga0268264_10170987 3300028381 Bacteria 1965
376 Ga0268264_10659479 3300028381 Bacteria 1036
377 Ga0265336_10000938 3300028666 Bacteria 14744
378 Ga0307515_10017584 3300028794 Bacteria 13005
379 Ga0265338_10071896 3300028800 Bacteria 2956
380 Ga0265324_10000023 3300029957 Bacteria 164128
381 Ga0265324_10000147 3300029957 Bacteria 54400
382 Ga0265324_10030156 3300029957 Bacteria 1904
383 Ga0265324_10054166 3300029957 Bacteria 1377
384 Ga0265330_10000044 3300031235 Bacteria 113679
385 Ga0265330_10027481 3300031235 Bacteria 2570
386 Ga0265332_10000046 3300031238 Bacteria 113777
387 Ga0265332_10000058 3300031238 Bacteria 102565
388 Ga0265332_10000453 3300031238 Bacteria 28825
389 Ga0265328_10000252 3300031239 Bacteria 24700
390 Ga0265328_10071701 3300031239 Bacteria 1273
391 Ga0265325_10001509 3300031241 Bacteria 16357
392 Ga0265325_10005336 3300031241 Bacteria 7952
393 Ga0265325_10015088 3300031241 Bacteria 4354
394 Ga0265325_10111259 3300031241 Bacteria 1330
395 Ga0265329_10002052 3300031242 Bacteria 9399
396 Ga0265331_10000050 3300031250 Bacteria 181286
397 Ga0265331_10001285 3300031250 Bacteria 18719
398 Ga0265331_10006402 3300031250 Bacteria 6965
399 Ga0265327_10000109 3300031251 Bacteria 181275
400 Ga0265327_10001001 3300031251 Bacteria 40152
401 Ga0265327_10041296 3300031251 Bacteria 2487
402 Ga0265316_10024222 3300031344 Bacteria 5092
403 Ga0265316_10041696 3300031344 Bacteria 3672
404 Ga0265316_10134566 3300031344 Bacteria 1860
405 Ga0307513_10047590 3300031456 Bacteria 4663
406 Ga0307509_10000054 3300031507 Bacteria 163301
407 Ga0307509_10377373 3300031507 Bacteria 1132
408 Ga0307408_100067213 3300031548 Bacteria 2635
409 Ga0265313_10031376 3300031595 Bacteria 2725
410 Ga0265314_10000130 3300031711 Bacteria 113776
411 Ga0265314_10000451 3300031711 Bacteria 54865
412 Ga0265314_10026077 3300031711 Bacteria 4398
413 Ga0265314_10040315 3300031711 Bacteria 3353
414 Ga0265314_10058091 3300031711 Bacteria 2652
415 Ga0265342_10064500 3300031712 Bacteria 2149
416 Ga0265342_10224754 3300031712 Bacteria 1010
417 Ga0316576_10034871 3300031727 Bacteria 3589
418 Ga0316578_10002871 3300031728 Bacteria 7704
419 Ga0316578_10004419 3300031728 Bacteria 6639
420 Ga0316578_10104105 3300031728 Bacteria 1702
421 Ga0316578_10210115 3300031728 Bacteria 1171
422 Ga0307405_10327612 3300031731 Bacteria 1172
423 Ga0307405_11174055 3300031731 Bacteria 663
424 Ga0316577_10035139 3300031733 Bacteria 2801
425 Ga0307413_10005043 3300031824 Bacteria 5834
426 Ga0307413_10087397 3300031824 Bacteria 2019
427 Ga0307410_10023014 3300031852 Bacteria 3864
428 Ga0307410_10052900 3300031852 Bacteria 2745
429 Ga0307406_10003493 3300031901 Bacteria 8555
430 Ga0307406_10007624 3300031901 Bacteria 6009
431 Ga0307407_10233252 3300031903 Bacteria 1251
432 Ga0307412_10008031 3300031911 Bacteria 6013
433 Ga0307412_10244122 3300031911 Bacteria 1391
434 Ga0307412_10613775 3300031911 Bacteria 923
435 Ga0307409_100076998 3300031995 Bacteria 2677
436 Ga0307409_100136874 3300031995 Bacteria 2103
437 Ga0307409_100139543 3300031995 Bacteria 2086
438 Ga0307416_100028019 3300032002 Bacteria 4182
439 Ga0307416_100124624 3300032002 Bacteria 2305
440 Ga0307414_10013961 3300032004 Bacteria 4798
441 Ga0307411_10000874 3300032005 Bacteria 11374
442 Ga0307411_10372593 3300032005 Bacteria 1171
443 Ga0307415_100050306 3300032126 Bacteria 2823
444 Ga0307415_100533906 3300032126 Bacteria 1032
445 Ga0316583_10002919 3300032133 Bacteria 6005
446 Ga0316580_10001537 3300032139 Bacteria 6072
447 Ga0316580_10044229 3300032139 Bacteria 1374
448 Ga0316593_10046355 3300032168 Bacteria 1459
449 Ga0316593_10106258 3300032168 Bacteria 1000
450 Ga0316593_10166873 3300032168 Bacteria 806
451 Ga0316588_1083180 3300033528 Bacteria 794
452 Ga0316596_1000679 3300033541 Bacteria 6149
453 Ga0373952_0000149 3300035092 Bacteria 10342
454 Ga0373956_0063309 3300035119 Bacteria 1678
455 Ga0373956_0141093 3300035119 Bacteria 1131
456 Ga0373960_0006955 3300035121 Bacteria 2667
457 Ga0373942_0006992 3300035207 Bacteria 2608
458 Ga0373961_0046875 3300035241 Bacteria 1268
459 Ga0316574_0396730 3300035398 Bacteria 869
460 Ga0373924_0383177 3300035410 Bacteria 628
461 Ga0373927_0091782 3300035695 Bacteria 1973
462 Ga0373933_0084809 3300035724 Bacteria 1947
463 Ga0373947_0145684 3300035725 Bacteria 1522
464 Ga0316582_0004958 3300036647 Bacteria 6802
465 Ga0316582_0010780 3300036647 Bacteria 5022
466 Ga0316582_0578169 3300036647 Bacteria 774
467 Ga0316584_0008439 3300036712 Bacteria 7100
468 Ga0316584_0095107 3300036712 Bacteria 2230
469 Ga0316584_0219362 3300036712 Bacteria 1398
470 Ga0373925_0158374 3300037068 Bacteria 1782
471 Ga0436364_1012154 3300037853 Bacteria 926
472 Ga0400490_26241 3300038726 Bacteria 19510
473 Ga0400490_36198 3300038726 Bacteria 20353
474 Ga0400490_56340 3300038726 Bacteria 26381
475 Ga0400491_09522 3300038727 Bacteria 1568
476 Ga0400485_06298 3300038735 Bacteria 1484
477 Ga0400485_19789 3300038735 Bacteria 1960
478 Ga0400486_02326 3300038742 Bacteria 3485
479 Ga0400483_066832 3300039062 Bacteria 4146
480 Ga0400483_095062 3300039062 Bacteria 1740
481 Ga0400483_184140 3300039062 Bacteria 2320
482 Ga0400483_201100 3300039062 Bacteria 1033
483 Ga0400483_256413 3300039062 Bacteria 5726
484 Ga0400489_43087 3300039093 Bacteria 5816
485 Ga0400489_55584 3300039093 Bacteria 2812
486 Ga0400487_42385 3300039110 Bacteria 4392
487 Ga0436361_0197834 3300039447 Bacteria 2857
488 Ga0436361_0293841 3300039447 Bacteria 85519
489 Ga0436361_0632156 3300039447 Bacteria 31235
490 Ga0436361_0704696 3300039447 Bacteria 13555
491 Ga0436361_0921278 3300039447 Bacteria 22626
492 Ga0436361_1128421 3300039447 Bacteria 3851
493 Ga0439441_002768 3300042001 Bacteria 2506
494 Ga0450896_024162 3300042133 Bacteria 900
495 Ga0450899_009089 3300042135 Bacteria 1092
496 Ga0439446_0009364 3300042156 Bacteria 2622
497 Ga0451577_0062653 3300042876 Bacteria 3317
498 Ga0451577_0121300 3300042876 Bacteria 2342
499 Ga0451577_0191895 3300042876 Bacteria 1843
500 Ga0451577_1071569 3300042876 Bacteria 722
501 Ga0466969_0006652 3300044656 Bacteria 6141
502 Ga0453683_0089392 3300044673 Bacteria 1931
503 Ga0453683_0113604 3300044673 Bacteria 1704
504 Ga0466965_0005697 3300044683 Bacteria 5618
505 Ga0466965_0268405 3300044683 Bacteria 919
506 Ga0466966_0011833 3300044684 Bacteria 5778
507 Ga0466961_0001619 3300044693 Bacteria 13959
508 Ga0466964_0175705 3300044706 Bacteria 1012
509 Ga0453684_0006657 3300044712 Bacteria 21817
510 Ga0453684_0843899 3300044712 Bacteria 985
511 Ga0466959_0019116 3300045049 Bacteria 5036
512 Ga0466959_0036551 3300045049 Bacteria 3629
513 Ga0451576_0000060 3300045051 Bacteria 290345
514 Ga0451576_0000239 3300045051 Bacteria 134323
515 Ga0451576_0090389 3300045051 Bacteria 3185
516 Ga0451576_0134107 3300045051 Bacteria 2582
517 Ga0451576_0891281 3300045051 Bacteria 933
518 Ga0466967_0008116 3300045976 Bacteria 7660
519 Ga0495580_0031053 3300046472 Bacteria 3864
520 Ga0495580_0117159 3300046472 Bacteria 1850
521 Ga0495639_0112986 3300046475 Bacteria 1291
522 Ga0495606_0025241 3300046507 Bacteria 4260
523 Ga0495632_0009066 3300046519 Bacteria 6026
524 Ga0495648_0169559 3300046524 Bacteria 1120
525 Ga0495642_0057037 3300046528 Bacteria 1614
526 Ga0495598_0054314 3300046537 Bacteria 1216
527 Ga0495598_0150252 3300046537 Bacteria 812
528 Ga0495621_0036484 3300046539 Bacteria 1706
529 Ga0495636_0178283 3300047318 Bacteria 963
530 Ga0495615_0061311 3300048090 Bacteria 993
531 Ga0496101_0403119 3300048904 Bacteria 1077
532 Ga0496101_0915618 3300048904 Bacteria 690
533 Ga0496102_0283160 3300048905 Bacteria 1562
534 Ga0496103_0148425 3300048906 Bacteria 1501
535 Ga0496106_0094040 3300048909 Bacteria 2317
536 Ga0496106_0219403 3300048909 Bacteria 1516
537 Ga0496107_0025418 3300048910 Bacteria 4193
538 Ga0496108_0236469 3300048911 Bacteria 1589
539 Ga0496108_0419652 3300048911 Bacteria 1168
540 Ga0496109_0176591 3300048912 Bacteria 2005
541 Ga0496110_1159396 3300048913 Bacteria 681
542 Ga0496111_0044269 3300048914 Bacteria 3199
543 Ga0496114_0037516 3300048917 Bacteria 4008
544 Ga0496114_0532137 3300048917 Bacteria 1039
545 Ga0496124_0004049 3300048927 Bacteria 17382
546 Ga0496126_0076463 3300048929 Bacteria 2970
547 Ga0501303_014689 3300049526 Bacteria 777
548 Ga0501031_0002629 3300049568 Bacteria 11429
549 Ga0501031_0004277 3300049568 Bacteria 9231
550 Ga0501031_0006864 3300049568 Bacteria 7429
551 Ga0501032_0000851 3300049569 Bacteria 24758
552 Ga0501032_0005458 3300049569 Bacteria 9438
553 Ga0501032_0008735 3300049569 Bacteria 7379
554 Ga0501032_0296896 3300049569 Bacteria 1045
555 Ga0501033_0004717 3300049570 Bacteria 10908
556 Ga0501033_0014684 3300049570 Bacteria 5945
557 Ga0501033_0043036 3300049570 Bacteria 3364
558 Ga0501033_0417930 3300049570 Bacteria 934
559 Ga0501034_0012065 3300049571 Bacteria 8933
560 Ga0501034_0070908 3300049571 Bacteria 3495
561 Ga0501036_0004087 3300049572 Bacteria 11744
562 Ga0501036_0007132 3300049572 Bacteria 9100
563 Ga0501036_0019041 3300049572 Bacteria 5760
564 Ga0501036_0054905 3300049572 Bacteria 3375
565 Ga0501037_0005227 3300049573 Bacteria 9438
566 Ga0501038_0002842 3300049574 Bacteria 16112
567 Ga0501038_0003593 3300049574 Bacteria 14430
568 Ga0501038_0008551 3300049574 Bacteria 9398
569 Ga0501038_0022931 3300049574 Bacteria 5587
570 Ga0501038_0063354 3300049574 Bacteria 3156
571 Ga0501038_0065687 3300049574 Bacteria 3090
572 Ga0501038_0442498 3300049574 Bacteria 1000
573 Ga0501039_0003352 3300049575 Bacteria 11972
574 Ga0501039_0007003 3300049575 Bacteria 8585
575 Ga0501039_0007282 3300049575 Bacteria 8427
576 Ga0501039_0129412 3300049575 Bacteria 1981
577 Ga0501039_0215223 3300049575 Bacteria 1511
578 Ga0501039_0395063 3300049575 Bacteria 1086
579 Ga0501040_0042221 3300049576 Bacteria 3106
580 Ga0501040_0225602 3300049576 Bacteria 1333
581 Ga0501041_0003981 3300049577 Bacteria 8525
582 Ga0501042_0002271 3300049578 Bacteria 11737
583 Ga0501042_0045093 3300049578 Bacteria 3142
584 Ga0501043_0000590 3300049579 Bacteria 32162
585 Ga0501043_0011488 3300049579 Bacteria 6931
586 Ga0501043_0011693 3300049579 Bacteria 6871
587 Ga0501043_0018409 3300049579 Bacteria 5478
588 Ga0501043_0272298 3300049579 Bacteria 1299
589 Ga0501043_0510725 3300049579 Bacteria 897
590 Ga0501046_0003768 3300049580 Bacteria 13880
591 Ga0501046_0016345 3300049580 Bacteria 6217
592 Ga0501046_0432739 3300049580 Bacteria 947
593 Ga0501047_0004747 3300049581 Bacteria 12779
594 Ga0501047_0063680 3300049581 Bacteria 3557
595 Ga0501047_0073274 3300049581 Bacteria 3297
596 Ga0501048_0010447 3300049582 Bacteria 6931
597 Ga0501067_0011417 3300049583 Bacteria 4918
598 Ga0501067_0304943 3300049583 Bacteria 887
599 Ga0501068_0001005 3300049584 Bacteria 14851
600 Ga0501069_0154663 3300049585 Bacteria 1319
601 Ga0501070_0009606 3300049586 Bacteria 8172
602 Ga0501070_0116295 3300049586 Bacteria 2209
603 Ga0501071_0016352 3300049587 Bacteria 5100
604 Ga0501072_0051532 3300049588 Bacteria 3240
605 Ga0501072_0054968 3300049588 Bacteria 3138
606 Ga0501073_0041281 3300049589 Bacteria 3260
607 Ga0501074_0035869 3300049590 Bacteria 3593
608 Ga0501075_0041398 3300049591 Bacteria 3452
609 Ga0501075_0150057 3300049591 Bacteria 1777
610 Ga0501076_0002058 3300049592 Bacteria 13780
611 Ga0501076_0118778 3300049592 Bacteria 2141
612 Ga0501076_0763679 3300049592 Bacteria 798
613 Ga0501077_0015273 3300049593 Bacteria 4832
614 Ga0501077_0277538 3300049593 Bacteria 1066
615 Ga0501079_0000800 3300049741 Bacteria 21428
616 Ga0501080_0003066 3300049742 Bacteria 14752
617 Ga0501080_0018069 3300049742 Bacteria 6527
618 Ga0501080_0519210 3300049742 Bacteria 1063
619 Ga0501081_0001026 3300049743 Bacteria 16686
620 Ga0501083_0017528 3300049744 Bacteria 4993
621 Ga0501035_0007605 3300049822 Bacteria 10121
622 Ga0501035_0007618 3300049822 Bacteria 10114
623 Ga0501035_0012793 3300049822 Bacteria 7750
624 Ga0501035_0130208 3300049822 Bacteria 2194
625 Ga0501044_0000326 3300049823 Bacteria 60246
626 Ga0501044_0001129 3300049823 Bacteria 31721
627 Ga0501044_0035724 3300049823 Bacteria 5202
628 Ga0501044_0231089 3300049823 Bacteria 1797
629 Ga0501044_0558689 3300049823 Bacteria 1041
630 Ga0501045_0001357 3300049824 Bacteria 16252
631 Ga0501045_0049710 3300049824 Bacteria 3058
632 nmdc:mga0k408_1893_c1 3300050493 Bacteria 11203
633 nmdc:mga09592_2590_c1 3300050508 Bacteria 14645
634 nmdc:mga0qj67_22237_c1 3300050509 Bacteria 4870
635 nmdc:mga0qj67_312902_c1 3300050509 Bacteria 1271
636 nmdc:mga06r32_10171_c1 3300050510 Bacteria 8492
637 nmdc:mga08y16_663_c1 3300050511 Bacteria 32446
638 nmdc:mga08y16_68226_c1 3300050511 Bacteria 3708
639 nmdc:mga0n895_191951_c1 3300050512 Bacteria 2074
640 nmdc:mga0rr50_384634_c1 3300050513 Bacteria 1184
641 nmdc:mga0rr50_700904_c1 3300050513 Bacteria 864
642 Ga0495619_0454059 3300053085 Bacteria 883
643 Ga0500607_014149 3300053121 Bacteria 4635
644 Ga0500559_0040709 3300053136 Bacteria 2024
645 Ga0500622_0000029 3300053156 Bacteria 213762
646 Ga0500636_0020843 3300053177 Bacteria 3879
647 Ga0500637_0009892 3300053178 Bacteria 4878
648 Ga0500587_003796 3300053739 Bacteria 2098
649 Ga0501084_0054540 3300054114 Bacteria 3344
650 Ga0590074_013965 3300059423 Bacteria 1358
651 Ga0590075_061970 3300059424 Bacteria 964
652 Ga0501082_0001997 3300060353 Bacteria 17925
653 Ga0501082_0152463 3300060353 Bacteria 2008
654 Ga0501082_0152523 3300060353 Bacteria 2007
655 Ga0530510_0066669 3300061734 Bacteria 2611

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025898 Ga0207692_10500181 Ga0207692_105001812 163
2 3300042135 Ga0450899_009089 Ga0450899_009089_371_934 182
3 3300005530 Ga0070679_100007684 Ga0070679_1000076843 183
4 3300013104 Ga0157370_10170980 Ga0157370_101709803 183
5 3300038726 Ga0400490_36198 Ga0400490_36198_1751_2341 185
6 3300038727 Ga0400491_09522 Ga0400491_09522_321_911 185
7 3300049568 Ga0501031_0004277 Ga0501031_0004277_5390_6013 188
8 3300013306 Ga0163162_10222600 Ga0163162_102226002 190
9 iso_pu_bacteria 2547132103 2547376146 191
10 iso_pu_bacteria 2547132512 2548848699 191
11 iso_pu_bacteria 2843690924 2843695247 191
12 iso_pu_bacteria 2998344455 2998345333 191
13 iso_pu_bacteria 2744054655 2745159768 193
14 3300005331 Ga0070670_100006889 Ga0070670_1000068896 194
15 3300005331 Ga0070670_100051454 Ga0070670_1000514543 194
16 3300005331 Ga0070670_100351953 Ga0070670_1003519531 194
17 3300005337 Ga0070682_100425772 Ga0070682_1004257721 194
18 3300005347 Ga0070668_100039737 Ga0070668_1000397374 194
19 3300005354 Ga0070675_100128969 Ga0070675_1001289693 194
20 3300005364 Ga0070673_100054198 Ga0070673_1000541983 194
21 3300005367 Ga0070667_100405091 Ga0070667_1004050911 194
22 3300005456 Ga0070678_100960374 Ga0070678_1009603741 194
23 3300005457 Ga0070662_100125520 Ga0070662_1001255201 194
24 3300005543 Ga0070672_100016634 Ga0070672_1000166343 194
25 3300005543 Ga0070672_100089040 Ga0070672_1000890402 194
26 3300005564 Ga0070664_100393780 Ga0070664_1003937802 194
27 3300005564 Ga0070664_100636031 Ga0070664_1006360312 194
28 3300005618 Ga0068864_100000221 Ga0068864_10000022121 194
29 3300005618 Ga0068864_100171650 Ga0068864_1001716503 194
30 3300005618 Ga0068864_100534554 Ga0068864_1005345541 194
31 3300005719 Ga0068861_100013833 Ga0068861_1000138333 194
32 3300005840 Ga0068870_10039828 Ga0068870_100398282 194
33 3300005841 Ga0068863_100002529 Ga0068863_10000252911 194
34 3300005841 Ga0068863_100041895 Ga0068863_1000418952 194
35 3300005841 Ga0068863_100051123 Ga0068863_1000511233 194
36 3300005841 Ga0068863_100285752 Ga0068863_1002857522 194
37 3300005985 Ga0081539_10015819 Ga0081539_100158192 194
38 3300006237 Ga0097621_100010473 Ga0097621_1000104732 194
39 3300006237 Ga0097621_100420253 Ga0097621_1004202532 194
40 3300006358 Ga0068871_100011074 Ga0068871_1000110741 194
41 3300006844 Ga0075428_100000089 Ga0075428_10000008919 194
42 3300006880 Ga0075429_100034099 Ga0075429_1000340992 194
43 3300007076 Ga0075435_100710534 Ga0075435_1007105342 194
44 3300009094 Ga0111539_10001921 Ga0111539_1000192127 194
45 3300009147 Ga0114129_10194455 Ga0114129_101944551 194
46 3300009177 Ga0105248_10252992 Ga0105248_102529923 194
47 3300009553 Ga0105249_10050241 Ga0105249_100502414 194
48 3300014325 Ga0163163_10148511 Ga0163163_101485112 194
49 3300014325 Ga0163163_10285183 Ga0163163_102851832 194
50 3300014969 Ga0157376_10085189 Ga0157376_100851893 194
51 3300017792 Ga0163161_10144297 Ga0163161_101442972 194
52 3300025908 Ga0207643_10033806 Ga0207643_100338063 194
53 3300025908 Ga0207643_10365801 Ga0207643_103658012 194
54 3300025912 Ga0207707_10963092 Ga0207707_109630921 194
55 3300025923 Ga0207681_10387273 Ga0207681_103872731 194
56 3300025925 Ga0207650_10000403 Ga0207650_1000040311 194
57 3300025925 Ga0207650_10028029 Ga0207650_100280293 194
58 3300025925 Ga0207650_10130214 Ga0207650_101302142 194
59 3300025925 Ga0207650_10140211 Ga0207650_101402111 194
60 3300025926 Ga0207659_10067334 Ga0207659_100673343 194
61 3300025926 Ga0207659_10507312 Ga0207659_105073121 194
62 3300025933 Ga0207706_10021527 Ga0207706_100215276 194
63 3300025940 Ga0207691_10011116 Ga0207691_100111165 194
64 3300025940 Ga0207691_10093390 Ga0207691_100933903 194
65 3300025942 Ga0207689_10368332 Ga0207689_103683321 194
66 3300025960 Ga0207651_10030166 Ga0207651_100301663 194
67 3300025961 Ga0207712_10150185 Ga0207712_101501852 194
68 3300025972 Ga0207668_10011071 Ga0207668_100110716 194
69 3300026088 Ga0207641_10001602 Ga0207641_1000160212 194
70 3300026088 Ga0207641_10268040 Ga0207641_102680402 194
71 3300026095 Ga0207676_10003750 Ga0207676_100037505 194
72 3300026095 Ga0207676_10306740 Ga0207676_103067402 194
73 3300026095 Ga0207676_10510748 Ga0207676_105107481 194
74 3300026118 Ga0207675_100061483 Ga0207675_1000614833 194
75 3300026121 Ga0207683_10004300 Ga0207683_100043009 194
76 3300027907 Ga0207428_10011825 Ga0207428_100118253 194
77 3300028380 Ga0268265_10029817 Ga0268265_100298175 194
78 3300028380 Ga0268265_10142597 Ga0268265_101425971 194
79 3300029957 Ga0265324_10054166 Ga0265324_100541662 194
80 3300031251 Ga0265327_10041296 Ga0265327_100412964 194
81 3300031344 Ga0265316_10134566 Ga0265316_101345662 194
82 3300044712 Ga0453684_0843899 Ga0453684_0843899_146_730 194
83 3300045051 Ga0451576_0134107 Ga0451576_0134107_958_1542 194
84 3300046537 Ga0495598_0054314 Ga0495598_0054314_131_715 194
85 3300049572 Ga0501036_0054905 Ga0501036_0054905_1186_1770 194
86 3300049575 Ga0501039_0003352 Ga0501039_0003352_7292_7876 194
87 3300049576 Ga0501040_0042221 Ga0501040_0042221_1565_2149 194
88 3300049577 Ga0501041_0003981 Ga0501041_0003981_6196_6780 194
89 3300049578 Ga0501042_0045093 Ga0501042_0045093_1134_1718 194
90 3300049579 Ga0501043_0018409 Ga0501043_0018409_1837_2421 194
91 3300049580 Ga0501046_0432739 Ga0501046_0432739_232_816 194
92 3300049585 Ga0501069_0154663 Ga0501069_0154663_470_1054 194
93 3300049587 Ga0501071_0016352 Ga0501071_0016352_3054_3638 194
94 3300049588 Ga0501072_0054968 Ga0501072_0054968_1255_1839 194
95 3300049591 Ga0501075_0041398 Ga0501075_0041398_2195_2779 194
96 3300049592 Ga0501076_0002058 Ga0501076_0002058_4612_5196 194
97 3300049593 Ga0501077_0015273 Ga0501077_0015273_1008_1592 194
98 3300049741 Ga0501079_0000800 Ga0501079_0000800_11935_12519 194
99 3300049742 Ga0501080_0003066 Ga0501080_0003066_7173_7757 194
100 3300049743 Ga0501081_0001026 Ga0501081_0001026_764_1348 194
101 3300050508 nmdc:mga09592_2590_c1 nmdc:mga09592_2590_c1_7176_7760 194
102 3300050509 nmdc:mga0qj67_312902_c1 nmdc:mga0qj67_312902_c1_10_594 194
103 3300050511 nmdc:mga08y16_663_c1 nmdc:mga08y16_663_c1_27701_28285 194
104 3300050513 nmdc:mga0rr50_700904_c1 nmdc:mga0rr50_700904_c1_71_655 194
105 3300053121 Ga0500607_014149 Ga0500607_014149_2984_3568 194
106 3300053136 Ga0500559_0040709 Ga0500559_0040709_510_1094 194
107 3300053177 Ga0500636_0020843 Ga0500636_0020843_3066_3650 194
108 3300053178 Ga0500637_0009892 Ga0500637_0009892_2251_2835 194
109 3300054114 Ga0501084_0054540 Ga0501084_0054540_1528_2112 194
110 3300060353 Ga0501082_0001997 Ga0501082_0001997_13496_14080 194
111 3300060353 Ga0501082_0152523 Ga0501082_0152523_479_1063 194
112 3300061734 Ga0530510_0066669 Ga0530510_0066669_1369_1953 194
113 iso_pu_bacteria 2521172590 2521560065 194
114 iso_pu_bacteria 2818991449 2819616428 194
115 iso_pu_bacteria 2904439833 2904440901 194
116 iso_pu_bacteria 2904530477 2904535503 194
117 iso_pu_bacteria 2904584206 2904588356 194
118 iso_pu_bacteria 2904589729 2904594756 194
119 iso_pu_bacteria 2904601388 2904606019 194
120 iso_pu_bacteria 2919079590 2919084677 194
121 iso_pu_bacteria 2928130867 2928134364 194
122 3300005331 Ga0070670_100460511 Ga0070670_1004605111 195
123 3300005336 Ga0070680_100063149 Ga0070680_1000631492 195
124 3300005339 Ga0070660_100351838 Ga0070660_1003518382 195
125 3300005340 Ga0070689_100352155 Ga0070689_1003521552 195
126 3300005341 Ga0070691_10338831 Ga0070691_103388311 195
127 3300005435 Ga0070714_100016095 Ga0070714_1000160952 195
128 3300005444 Ga0070694_100194439 Ga0070694_1001944392 195
129 3300005456 Ga0070678_100450889 Ga0070678_1004508892 195
130 3300005467 Ga0070706_100414112 Ga0070706_1004141122 195
131 3300005530 Ga0070679_100121699 Ga0070679_1001216993 195
132 3300005530 Ga0070679_100201319 Ga0070679_1002013192 195
133 3300005535 Ga0070684_100229658 Ga0070684_1002296582 195
134 3300005539 Ga0068853_100044550 Ga0068853_1000445504 195
135 3300005544 Ga0070686_100829095 Ga0070686_1008290951 195
136 3300005546 Ga0070696_100127459 Ga0070696_1001274592 195
137 3300005547 Ga0070693_100011883 Ga0070693_1000118833 195
138 3300005563 Ga0068855_100393806 Ga0068855_1003938062 195
139 3300005564 Ga0070664_100142688 Ga0070664_1001426883 195
140 3300005577 Ga0068857_100144104 Ga0068857_1001441043 195
141 3300005718 Ga0068866_10573592 Ga0068866_105735921 195
142 3300005834 Ga0068851_10143536 Ga0068851_101435362 195
143 3300005841 Ga0068863_100071732 Ga0068863_1000717322 195
144 3300006358 Ga0068871_100073876 Ga0068871_1000738763 195
145 3300006846 Ga0075430_100036111 Ga0075430_1000361113 195
146 3300006847 Ga0075431_100000766 Ga0075431_10000076615 195
147 3300006847 Ga0075431_100355902 Ga0075431_1003559022 195
148 3300006881 Ga0068865_100162558 Ga0068865_1001625582 195
149 3300009094 Ga0111539_10049803 Ga0111539_100498035 195
150 3300009098 Ga0105245_10457993 Ga0105245_104579932 195
151 3300009101 Ga0105247_10022891 Ga0105247_100228913 195
152 3300009147 Ga0114129_10776949 Ga0114129_107769492 195
153 3300009174 Ga0105241_10008396 Ga0105241_100083969 195
154 3300009177 Ga0105248_10043136 Ga0105248_100431362 195
155 3300009545 Ga0105237_10019528 Ga0105237_100195285 195
156 3300009553 Ga0105249_10636697 Ga0105249_106366972 195
157 3300010375 Ga0105239_10309750 Ga0105239_103097503 195
158 3300013104 Ga0157370_10006761 Ga0157370_100067616 195
159 3300013296 Ga0157374_10002909 Ga0157374_1000290922 195
160 3300013297 Ga0157378_10025647 Ga0157378_100256479 195
161 3300013297 Ga0157378_10302282 Ga0157378_103022822 195
162 3300013307 Ga0157372_10207503 Ga0157372_102075032 195
163 3300013308 Ga0157375_10057467 Ga0157375_100574672 195
164 3300013308 Ga0157375_11219164 Ga0157375_112191642 195
165 3300014968 Ga0157379_10954228 Ga0157379_109542281 195
166 3300014969 Ga0157376_10041971 Ga0157376_100419712 195
167 3300021361 Ga0213872_10001257 Ga0213872_1000125719 195
168 3300021361 Ga0213872_10004111 Ga0213872_100041113 195
169 3300025914 Ga0207671_10041878 Ga0207671_100418781 195
170 3300025917 Ga0207660_10046173 Ga0207660_100461734 195
171 3300025917 Ga0207660_10330678 Ga0207660_103306782 195
172 3300025918 Ga0207662_10042449 Ga0207662_100424493 195
173 3300025919 Ga0207657_10268658 Ga0207657_102686582 195
174 3300025919 Ga0207657_10368070 Ga0207657_103680702 195
175 3300025921 Ga0207652_10197973 Ga0207652_101979732 195
176 3300025925 Ga0207650_10548575 Ga0207650_105485751 195
177 3300025929 Ga0207664_10018372 Ga0207664_100183725 195
178 3300025932 Ga0207690_10035471 Ga0207690_100354712 195
179 3300025936 Ga0207670_10477256 Ga0207670_104772562 195
180 3300025938 Ga0207704_10113690 Ga0207704_101136902 195
181 3300025938 Ga0207704_10346583 Ga0207704_103465832 195
182 3300025941 Ga0207711_10218069 Ga0207711_102180692 195
183 3300025949 Ga0207667_10254072 Ga0207667_102540722 195
184 3300025986 Ga0207658_10149890 Ga0207658_101498902 195
185 3300026041 Ga0207639_10040678 Ga0207639_100406782 195
186 3300026089 Ga0207648_10059099 Ga0207648_100590992 195
187 3300026116 Ga0207674_10032531 Ga0207674_100325317 195
188 3300026118 Ga0207675_100110730 Ga0207675_1001107302 195
189 3300026121 Ga0207683_11015420 Ga0207683_110154202 195
190 3300027360 Ga0209969_1012582 Ga0209969_10125822 195
191 3300027907 Ga0207428_10073354 Ga0207428_100733543 195
192 3300027907 Ga0207428_10195804 Ga0207428_101958041 195
193 3300028380 Ga0268265_10139293 Ga0268265_101392932 195
194 3300028381 Ga0268264_10659479 Ga0268264_106594791 195
195 3300028666 Ga0265336_10000938 Ga0265336_100009382 195
196 3300028800 Ga0265338_10071896 Ga0265338_100718963 195
197 3300029957 Ga0265324_10000023 Ga0265324_1000002392 195
198 3300029957 Ga0265324_10000147 Ga0265324_1000014756 195
199 3300029957 Ga0265324_10030156 Ga0265324_100301562 195
200 3300031238 Ga0265332_10000058 Ga0265332_1000005876 195
201 3300031239 Ga0265328_10000252 Ga0265328_1000025217 195
202 3300031241 Ga0265325_10001509 Ga0265325_100015096 195
203 3300031241 Ga0265325_10111259 Ga0265325_101112591 195
204 3300031250 Ga0265331_10000050 Ga0265331_10000050176 195
205 3300031250 Ga0265331_10006402 Ga0265331_100064024 195
206 3300031251 Ga0265327_10000109 Ga0265327_1000010949 195
207 3300031344 Ga0265316_10041696 Ga0265316_100416962 195
208 3300031507 Ga0307509_10000054 Ga0307509_1000005441 195
209 3300031711 Ga0265314_10000451 Ga0265314_1000045156 195
210 3300031711 Ga0265314_10026077 Ga0265314_100260774 195
211 3300031711 Ga0265314_10040315 Ga0265314_100403154 195
212 3300031728 Ga0316578_10104105 Ga0316578_101041053 195
213 3300031824 Ga0307413_10087397 Ga0307413_100873973 195
214 3300031852 Ga0307410_10052900 Ga0307410_100529003 195
215 3300031901 Ga0307406_10007624 Ga0307406_100076246 195
216 3300031903 Ga0307407_10233252 Ga0307407_102332522 195
217 3300031911 Ga0307412_10244122 Ga0307412_102441222 195
218 3300031995 Ga0307409_100136874 Ga0307409_1001368742 195
219 3300031995 Ga0307409_100139543 Ga0307409_1001395432 195
220 3300032002 Ga0307416_100028019 Ga0307416_1000280194 195
221 3300032005 Ga0307411_10372593 Ga0307411_103725931 195
222 3300032126 Ga0307415_100533906 Ga0307415_1005339061 195
223 3300032133 Ga0316583_10002919 Ga0316583_100029196 195
224 3300033541 Ga0316596_1000679 Ga0316596_10006795 195
225 3300035092 Ga0373952_0000149 Ga0373952_0000149_1157_1744 195
226 3300035119 Ga0373956_0141093 Ga0373956_0141093_282_869 195
227 3300035121 Ga0373960_0006955 Ga0373960_0006955_1705_2292 195
228 3300035207 Ga0373942_0006992 Ga0373942_0006992_820_1407 195
229 3300035241 Ga0373961_0046875 Ga0373961_0046875_354_941 195
230 3300035398 Ga0316574_0396730 Ga0316574_0396730_243_833 195
231 3300035724 Ga0373933_0084809 Ga0373933_0084809_933_1520 195
232 3300038726 Ga0400490_26241 Ga0400490_26241_9601_10191 195
233 3300038726 Ga0400490_56340 Ga0400490_56340_17909_18499 195
234 3300038735 Ga0400485_06298 Ga0400485_06298_350_940 195
235 3300038735 Ga0400485_19789 Ga0400485_19789_1320_1910 195
236 3300038742 Ga0400486_02326 Ga0400486_02326_1816_2406 195
237 3300039062 Ga0400483_066832 Ga0400483_066832_1726_2316 195
238 3300039062 Ga0400483_095062 Ga0400483_095062_622_1212 195
239 3300039062 Ga0400483_184140 Ga0400483_184140_902_1492 195
240 3300039062 Ga0400483_256413 Ga0400483_256413_2862_3452 195
241 3300039093 Ga0400489_43087 Ga0400489_43087_64_654 195
242 3300039093 Ga0400489_55584 Ga0400489_55584_1704_2294 195
243 3300039110 Ga0400487_42385 Ga0400487_42385_1143_1733 195
244 3300039447 Ga0436361_0293841 Ga0436361_0293841_61146_61739 195
245 3300039447 Ga0436361_0921278 Ga0436361_0921278_7258_7851 195
246 3300042001 Ga0439441_002768 Ga0439441_002768_880_1467 195
247 3300042133 Ga0450896_024162 Ga0450896_024162_103_705 195
248 3300042876 Ga0451577_0062653 Ga0451577_0062653_2685_3272 195
249 3300042876 Ga0451577_0191895 Ga0451577_0191895_946_1560 195
250 3300044656 Ga0466969_0006652 Ga0466969_0006652_3840_4433 195
251 3300044683 Ga0466965_0005697 Ga0466965_0005697_2618_3211 195
252 3300044684 Ga0466966_0011833 Ga0466966_0011833_938_1531 195
253 3300044693 Ga0466961_0001619 Ga0466961_0001619_10612_11205 195
254 3300044706 Ga0466964_0175705 Ga0466964_0175705_147_740 195
255 3300044712 Ga0453684_0006657 Ga0453684_0006657_11678_12265 195
256 3300045049 Ga0466959_0019116 Ga0466959_0019116_3966_4559 195
257 3300045049 Ga0466959_0036551 Ga0466959_0036551_478_1071 195
258 3300045051 Ga0451576_0000060 Ga0451576_0000060_157823_158410 195
259 3300045051 Ga0451576_0000239 Ga0451576_0000239_78437_79024 195
260 3300045051 Ga0451576_0891281 Ga0451576_0891281_217_804 195
261 3300045976 Ga0466967_0008116 Ga0466967_0008116_1438_2031 195
262 3300047318 Ga0495636_0178283 Ga0495636_0178283_229_816 195
263 3300049526 Ga0501303_014689 Ga0501303_014689_62_649 195
264 3300049568 Ga0501031_0002629 Ga0501031_0002629_7333_7920 195
265 3300049568 Ga0501031_0006864 Ga0501031_0006864_5790_6377 195
266 3300049569 Ga0501032_0000851 Ga0501032_0000851_11067_11654 195
267 3300049569 Ga0501032_0005458 Ga0501032_0005458_7843_8430 195
268 3300049569 Ga0501032_0008735 Ga0501032_0008735_1262_1849 195
269 3300049569 Ga0501032_0296896 Ga0501032_0296896_212_799 195
270 3300049570 Ga0501033_0004717 Ga0501033_0004717_2478_3065 195
271 3300049570 Ga0501033_0014684 Ga0501033_0014684_1009_1596 195
272 3300049570 Ga0501033_0043036 Ga0501033_0043036_1140_1727 195
273 3300049570 Ga0501033_0417930 Ga0501033_0417930_296_883 195
274 3300049571 Ga0501034_0012065 Ga0501034_0012065_3371_3958 195
275 3300049572 Ga0501036_0004087 Ga0501036_0004087_3315_3902 195
276 3300049572 Ga0501036_0007132 Ga0501036_0007132_420_1007 195
277 3300049572 Ga0501036_0019041 Ga0501036_0019041_1860_2447 195
278 3300049573 Ga0501037_0005227 Ga0501037_0005227_7843_8430 195
279 3300049574 Ga0501038_0002842 Ga0501038_0002842_7734_8321 195
280 3300049574 Ga0501038_0003593 Ga0501038_0003593_6678_7265 195
281 3300049574 Ga0501038_0008551 Ga0501038_0008551_2471_3058 195
282 3300049574 Ga0501038_0022931 Ga0501038_0022931_1854_2441 195
283 3300049574 Ga0501038_0063354 Ga0501038_0063354_862_1449 195
284 3300049574 Ga0501038_0065687 Ga0501038_0065687_685_1272 195
285 3300049574 Ga0501038_0442498 Ga0501038_0442498_133_720 195
286 3300049575 Ga0501039_0007003 Ga0501039_0007003_7754_8341 195
287 3300049575 Ga0501039_0007282 Ga0501039_0007282_4092_4679 195
288 3300049575 Ga0501039_0129412 Ga0501039_0129412_355_942 195
289 3300049575 Ga0501039_0395063 Ga0501039_0395063_292_879 195
290 3300049576 Ga0501040_0225602 Ga0501040_0225602_367_954 195
291 3300049578 Ga0501042_0002271 Ga0501042_0002271_3314_3901 195
292 3300049579 Ga0501043_0000590 Ga0501043_0000590_7843_8430 195
293 3300049579 Ga0501043_0011488 Ga0501043_0011488_1482_2069 195
294 3300049579 Ga0501043_0011693 Ga0501043_0011693_390_977 195
295 3300049579 Ga0501043_0272298 Ga0501043_0272298_31_618 195
296 3300049579 Ga0501043_0510725 Ga0501043_0510725_109_696 195
297 3300049580 Ga0501046_0003768 Ga0501046_0003768_7835_8422 195
298 3300049580 Ga0501046_0016345 Ga0501046_0016345_3448_4035 195
299 3300049581 Ga0501047_0004747 Ga0501047_0004747_4350_4937 195
300 3300049581 Ga0501047_0063680 Ga0501047_0063680_1542_2129 195
301 3300049582 Ga0501048_0010447 Ga0501048_0010447_3423_4010 195
302 3300049583 Ga0501067_0304943 Ga0501067_0304943_236_823 195
303 3300049584 Ga0501068_0001005 Ga0501068_0001005_7793_8380 195
304 3300049591 Ga0501075_0150057 Ga0501075_0150057_1134_1721 195
305 3300049593 Ga0501077_0277538 Ga0501077_0277538_337_924 195
306 3300049742 Ga0501080_0519210 Ga0501080_0519210_457_1044 195
307 3300049822 Ga0501035_0007605 Ga0501035_0007605_1431_2018 195
308 3300049822 Ga0501035_0007618 Ga0501035_0007618_3187_3774 195
309 3300049822 Ga0501035_0012793 Ga0501035_0012793_1632_2219 195
310 3300049823 Ga0501044_0000326 Ga0501044_0000326_8107_8694 195
311 3300049823 Ga0501044_0001129 Ga0501044_0001129_7843_8430 195
312 3300049823 Ga0501044_0035724 Ga0501044_0035724_1525_2112 195
313 3300049823 Ga0501044_0231089 Ga0501044_0231089_430_1017 195
314 3300049823 Ga0501044_0558689 Ga0501044_0558689_311_898 195
315 3300049824 Ga0501045_0001357 Ga0501045_0001357_7843_8430 195
316 3300049824 Ga0501045_0049710 Ga0501045_0049710_100_687 195
317 3300050509 nmdc:mga0qj67_22237_c1 nmdc:mga0qj67_22237_c1_3864_4451 195
318 3300050510 nmdc:mga06r32_10171_c1 nmdc:mga06r32_10171_c1_1714_2301 195
319 3300053085 Ga0495619_0454059 Ga0495619_0454059_128_715 195
320 3300053156 Ga0500622_0000029 Ga0500622_0000029_28004_28591 195
321 3300060353 Ga0501082_0152463 Ga0501082_0152463_577_1164 195
322 3300005334 Ga0068869_101059741 Ga0068869_1010597411 196
323 3300005344 Ga0070661_100029556 Ga0070661_1000295563 196
324 3300005458 Ga0070681_10056629 Ga0070681_100566292 196
325 3300005530 Ga0070679_100005476 Ga0070679_10000547614 196
326 3300005539 Ga0068853_100035271 Ga0068853_1000352713 196
327 3300006195 Ga0075366_10008305 Ga0075366_100083052 196
328 3300013100 Ga0157373_10002101 Ga0157373_1000210116 196
329 3300013104 Ga0157370_10062128 Ga0157370_100621285 196
330 3300013307 Ga0157372_10186251 Ga0157372_101862512 196
331 3300025912 Ga0207707_10023156 Ga0207707_100231563 196
332 3300025921 Ga0207652_10026700 Ga0207652_100267002 196
333 3300026041 Ga0207639_10023614 Ga0207639_100236144 196
334 3300026142 Ga0207698_10722742 Ga0207698_107227422 196
335 3300028794 Ga0307515_10017584 Ga0307515_1001758415 196
336 3300031731 Ga0307405_11174055 Ga0307405_111740551 196
337 3300037853 Ga0436364_1012154 Ga0436364_1012154_263_853 196
338 3300046519 Ga0495632_0009066 Ga0495632_0009066_1202_1795 196
339 3300048090 Ga0495615_0061311 Ga0495615_0061311_146_736 196
340 3300048904 Ga0496101_0403119 Ga0496101_0403119_433_1023 196
341 3300048910 Ga0496107_0025418 Ga0496107_0025418_1557_2147 196
342 3300048911 Ga0496108_0419652 Ga0496108_0419652_43_633 196
343 3300048912 Ga0496109_0176591 Ga0496109_0176591_739_1329 196
344 3300048914 Ga0496111_0044269 Ga0496111_0044269_679_1269 196
345 3300049571 Ga0501034_0070908 Ga0501034_0070908_150_764 196
346 3300049575 Ga0501039_0215223 Ga0501039_0215223_710_1315 196
347 3300049581 Ga0501047_0073274 Ga0501047_0073274_1030_1644 196
348 3300049583 Ga0501067_0011417 Ga0501067_0011417_2749_3363 196
349 3300049586 Ga0501070_0009606 Ga0501070_0009606_2043_2657 196
350 3300049586 Ga0501070_0116295 Ga0501070_0116295_279_893 196
351 3300049588 Ga0501072_0051532 Ga0501072_0051532_2117_2731 196
352 3300049589 Ga0501073_0041281 Ga0501073_0041281_653_1267 196
353 3300049590 Ga0501074_0035869 Ga0501074_0035869_2082_2696 196
354 3300049592 Ga0501076_0118778 Ga0501076_0118778_344_949 196
355 3300049742 Ga0501080_0018069 Ga0501080_0018069_5358_5972 196
356 3300049744 Ga0501083_0017528 Ga0501083_0017528_1748_2362 196
357 3300049822 Ga0501035_0130208 Ga0501035_0130208_329_943 196
358 3300050493 nmdc:mga0k408_1893_c1 nmdc:mga0k408_1893_c1_504_1097 196
359 3300053739 Ga0500587_003796 Ga0500587_003796_1107_1700 196
360 3300059423 Ga0590074_013965 Ga0590074_013965_625_1215 196
361 3300059424 Ga0590075_061970 Ga0590075_061970_54_644 196
362 3300005331 Ga0070670_100016600 Ga0070670_1000166007 197
363 3300005331 Ga0070670_100265135 Ga0070670_1002651352 197
364 3300005331 Ga0070670_100330054 Ga0070670_1003300542 197
365 3300005334 Ga0068869_100407832 Ga0068869_1004078322 197
366 3300005338 Ga0068868_100043354 Ga0068868_1000433543 197
367 3300005338 Ga0068868_100090657 Ga0068868_1000906573 197
368 3300005353 Ga0070669_100022069 Ga0070669_1000220694 197
369 3300005354 Ga0070675_100000345 Ga0070675_1000003459 197
370 3300005355 Ga0070671_100004354 Ga0070671_1000043545 197
371 3300005355 Ga0070671_100230216 Ga0070671_1002302162 197
372 3300005355 Ga0070671_100418935 Ga0070671_1004189352 197
373 3300005356 Ga0070674_100007024 Ga0070674_1000070243 197
374 3300005356 Ga0070674_100017660 Ga0070674_1000176603 197
375 3300005356 Ga0070674_100824499 Ga0070674_1008244991 197
376 3300005364 Ga0070673_101190370 Ga0070673_1011903701 197
377 3300005367 Ga0070667_100002153 Ga0070667_1000021534 197
378 3300005367 Ga0070667_100063550 Ga0070667_1000635503 197
379 3300005440 Ga0070705_100098308 Ga0070705_1000983081 197
380 3300005456 Ga0070678_100002860 Ga0070678_1000028609 197
381 3300005456 Ga0070678_100655736 Ga0070678_1006557362 197
382 3300005459 Ga0068867_100004068 Ga0068867_1000040684 197
383 3300005459 Ga0068867_100042758 Ga0068867_1000427583 197
384 3300005459 Ga0068867_100754424 Ga0068867_1007544241 197
385 3300005467 Ga0070706_100256514 Ga0070706_1002565142 197
386 3300005468 Ga0070707_100456444 Ga0070707_1004564441 197
387 3300005468 Ga0070707_100828959 Ga0070707_1008289591 197
388 3300005471 Ga0070698_100126714 Ga0070698_1001267143 197
389 3300005518 Ga0070699_100582674 Ga0070699_1005826741 197
390 3300005536 Ga0070697_100143990 Ga0070697_1001439902 197
391 3300005543 Ga0070672_100000229 Ga0070672_10000022922 197
392 3300005548 Ga0070665_100291717 Ga0070665_1002917172 197
393 3300005564 Ga0070664_100157118 Ga0070664_1001571182 197
394 3300005615 Ga0070702_100365321 Ga0070702_1003653212 197
395 3300005616 Ga0068852_100717265 Ga0068852_1007172652 197
396 3300005616 Ga0068852_100781724 Ga0068852_1007817242 197
397 3300005617 Ga0068859_100306702 Ga0068859_1003067021 197
398 3300005618 Ga0068864_100002948 Ga0068864_1000029489 197
399 3300005841 Ga0068863_100143263 Ga0068863_1001432633 197
400 3300005842 Ga0068858_100160232 Ga0068858_1001602322 197
401 3300006173 Ga0070716_100008565 Ga0070716_1000085655 197
402 3300006353 Ga0075370_10271332 Ga0075370_102713321 197
403 3300006358 Ga0068871_100120239 Ga0068871_1001202392 197
404 3300006852 Ga0075433_10048009 Ga0075433_100480093 197
405 3300006871 Ga0075434_100012989 Ga0075434_1000129898 197
406 3300006931 Ga0097620_100306695 Ga0097620_1003066951 197
407 3300007076 Ga0075435_100021557 Ga0075435_1000215574 197
408 3300007076 Ga0075435_100152759 Ga0075435_1001527592 197
409 3300009094 Ga0111539_10083256 Ga0111539_100832565 197
410 3300009177 Ga0105248_11099611 Ga0105248_110996112 197
411 3300013306 Ga0163162_10046879 Ga0163162_100468792 197
412 3300013307 Ga0157372_10943907 Ga0157372_109439071 197
413 3300013308 Ga0157375_11055736 Ga0157375_110557362 197
414 3300014325 Ga0163163_10200793 Ga0163163_102007932 197
415 3300014326 Ga0157380_10397101 Ga0157380_103971012 197
416 3300017792 Ga0163161_10001851 Ga0163161_100018514 197
417 3300025315 Ga0207697_10005049 Ga0207697_100050497 197
418 3300025899 Ga0207642_10383436 Ga0207642_103834362 197
419 3300025910 Ga0207684_10045540 Ga0207684_100455403 197
420 3300025910 Ga0207684_10064876 Ga0207684_100648763 197
421 3300025923 Ga0207681_10019329 Ga0207681_100193292 197
422 3300025923 Ga0207681_10537378 Ga0207681_105373781 197
423 3300025925 Ga0207650_10000230 Ga0207650_1000023036 197
424 3300025925 Ga0207650_10198753 Ga0207650_101987532 197
425 3300025926 Ga0207659_10002004 Ga0207659_100020049 197
426 3300025927 Ga0207687_10058566 Ga0207687_100585664 197
427 3300025931 Ga0207644_10142054 Ga0207644_101420542 197
428 3300025931 Ga0207644_10142605 Ga0207644_101426052 197
429 3300025937 Ga0207669_10004262 Ga0207669_100042622 197
430 3300025938 Ga0207704_10099209 Ga0207704_100992092 197
431 3300025940 Ga0207691_10000681 Ga0207691_1000068126 197
432 3300025942 Ga0207689_10395647 Ga0207689_103956471 197
433 3300025945 Ga0207679_10133213 Ga0207679_101332132 197
434 3300025945 Ga0207679_10195988 Ga0207679_101959882 197
435 3300025945 Ga0207679_10839760 Ga0207679_108397601 197
436 3300025960 Ga0207651_10057679 Ga0207651_100576792 197
437 3300025981 Ga0207640_10258913 Ga0207640_102589131 197
438 3300025986 Ga0207658_10001079 Ga0207658_1000107919 197
439 3300025986 Ga0207658_10044220 Ga0207658_100442203 197
440 3300026023 Ga0207677_10009684 Ga0207677_100096845 197
441 3300026023 Ga0207677_10145963 Ga0207677_101459632 197
442 3300026035 Ga0207703_10291833 Ga0207703_102918333 197
443 3300026089 Ga0207648_10074201 Ga0207648_100742013 197
444 3300026095 Ga0207676_10336881 Ga0207676_103368812 197
445 3300026118 Ga0207675_100712269 Ga0207675_1007122692 197
446 3300026142 Ga0207698_10463773 Ga0207698_104637732 197
447 3300028379 Ga0268266_10040066 Ga0268266_100400664 197
448 3300028381 Ga0268264_10039780 Ga0268264_100397803 197
449 3300031235 Ga0265330_10027481 Ga0265330_100274812 197
450 3300031238 Ga0265332_10000453 Ga0265332_1000045313 197
451 3300031239 Ga0265328_10071701 Ga0265328_100717012 197
452 3300031241 Ga0265325_10015088 Ga0265325_100150884 197
453 3300031242 Ga0265329_10002052 Ga0265329_100020524 197
454 3300031250 Ga0265331_10001285 Ga0265331_1000128516 197
455 3300031251 Ga0265327_10001001 Ga0265327_1000100127 197
456 3300031344 Ga0265316_10024222 Ga0265316_100242224 197
457 3300031456 Ga0307513_10047590 Ga0307513_100475903 197
458 3300031507 Ga0307509_10377373 Ga0307509_103773732 197
459 3300031548 Ga0307408_100067213 Ga0307408_1000672132 197
460 3300031595 Ga0265313_10031376 Ga0265313_100313762 197
461 3300031711 Ga0265314_10058091 Ga0265314_100580913 197
462 3300031712 Ga0265342_10064500 Ga0265342_100645002 197
463 3300031727 Ga0316576_10034871 Ga0316576_100348712 197
464 3300031728 Ga0316578_10002871 Ga0316578_100028717 197
465 3300031728 Ga0316578_10004419 Ga0316578_100044194 197
466 3300031731 Ga0307405_10327612 Ga0307405_103276122 197
467 3300031733 Ga0316577_10035139 Ga0316577_100351393 197
468 3300031824 Ga0307413_10005043 Ga0307413_100050433 197
469 3300031852 Ga0307410_10023014 Ga0307410_100230142 197
470 3300031901 Ga0307406_10003493 Ga0307406_100034934 197
471 3300031911 Ga0307412_10008031 Ga0307412_100080317 197
472 3300031995 Ga0307409_100076998 Ga0307409_1000769983 197
473 3300032002 Ga0307416_100124624 Ga0307416_1001246243 197
474 3300032004 Ga0307414_10013961 Ga0307414_100139618 197
475 3300032005 Ga0307411_10000874 Ga0307411_1000087412 197
476 3300032126 Ga0307415_100050306 Ga0307415_1000503063 197
477 3300032139 Ga0316580_10001537 Ga0316580_100015375 197
478 3300032139 Ga0316580_10044229 Ga0316580_100442292 197
479 3300032168 Ga0316593_10106258 Ga0316593_101062581 197
480 3300032168 Ga0316593_10166873 Ga0316593_101668732 197
481 3300033528 Ga0316588_1083180 Ga0316588_10831801 197
482 3300035119 Ga0373956_0063309 Ga0373956_0063309_398_994 197
483 3300035410 Ga0373924_0383177 Ga0373924_0383177_19_615 197
484 3300035695 Ga0373927_0091782 Ga0373927_0091782_1024_1650 197
485 3300035725 Ga0373947_0145684 Ga0373947_0145684_574_1194 197
486 3300036647 Ga0316582_0004958 Ga0316582_0004958_5332_5937 197
487 3300036647 Ga0316582_0010780 Ga0316582_0010780_1677_2270 197
488 3300036712 Ga0316584_0008439 Ga0316584_0008439_3040_3645 197
489 3300036712 Ga0316584_0095107 Ga0316584_0095107_858_1451 197
490 3300036712 Ga0316584_0219362 Ga0316584_0219362_25_630 197
491 3300037068 Ga0373925_0158374 Ga0373925_0158374_64_660 197
492 3300042876 Ga0451577_1071569 Ga0451577_1071569_94_687 197
493 3300044673 Ga0453683_0113604 Ga0453683_0113604_626_1231 197
494 3300044683 Ga0466965_0268405 Ga0466965_0268405_83_676 197
495 3300046472 Ga0495580_0031053 Ga0495580_0031053_3143_3763 197
496 3300046472 Ga0495580_0117159 Ga0495580_0117159_757_1353 197
497 3300046524 Ga0495648_0169559 Ga0495648_0169559_367_969 197
498 3300046537 Ga0495598_0150252 Ga0495598_0150252_148_744 197
499 3300048904 Ga0496101_0915618 Ga0496101_0915618_15_614 197
500 3300048909 Ga0496106_0094040 Ga0496106_0094040_706_1305 197
501 3300048911 Ga0496108_0236469 Ga0496108_0236469_551_1150 197
502 3300048917 Ga0496114_0037516 Ga0496114_0037516_181_780 197
503 3300049592 Ga0501076_0763679 Ga0501076_0763679_141_734 197
504 3300050511 nmdc:mga08y16_68226_c1 nmdc:mga08y16_68226_c1_409_1008 197
505 3300050512 nmdc:mga0n895_191951_c1 nmdc:mga0n895_191951_c1_236_856 197
506 3300050513 nmdc:mga0rr50_384634_c1 nmdc:mga0rr50_384634_c1_346_966 197
507 3300003751 Ga0055538_1000038 Ga0055538_1000038119 198
508 3300003752 Ga0055539_1000049 Ga0055539_1000049119 198
509 3300003756 Ga0055533_1000060 Ga0055533_1000060119 198
510 3300003759 Ga0055525_1000068 Ga0055525_100006876 198
511 3300003841 Ga0055541_1000036 Ga0055541_100003676 198
512 3300005328 Ga0070676_10007085 Ga0070676_100070852 198
513 3300005331 Ga0070670_100140615 Ga0070670_1001406152 198
514 3300005331 Ga0070670_100545016 Ga0070670_1005450162 198
515 3300005334 Ga0068869_100007578 Ga0068869_1000075788 198
516 3300005334 Ga0068869_100008290 Ga0068869_1000082905 198
517 3300005334 Ga0068869_100547133 Ga0068869_1005471331 198
518 3300005335 Ga0070666_10049642 Ga0070666_100496422 198
519 3300005338 Ga0068868_100047324 Ga0068868_1000473242 198
520 3300005340 Ga0070689_100013740 Ga0070689_1000137406 198
521 3300005353 Ga0070669_100011337 Ga0070669_10001133711 198
522 3300005353 Ga0070669_100197570 Ga0070669_1001975702 198
523 3300005354 Ga0070675_100026716 Ga0070675_1000267163 198
524 3300005355 Ga0070671_100298584 Ga0070671_1002985842 198
525 3300005356 Ga0070674_100271873 Ga0070674_1002718731 198
526 3300005356 Ga0070674_100430987 Ga0070674_1004309871 198
527 3300005364 Ga0070673_100272128 Ga0070673_1002721282 198
528 3300005364 Ga0070673_100344370 Ga0070673_1003443702 198
529 3300005365 Ga0070688_100327212 Ga0070688_1003272121 198
530 3300005367 Ga0070667_100055691 Ga0070667_1000556912 198
531 3300005367 Ga0070667_100137227 Ga0070667_1001372272 198
532 3300005367 Ga0070667_100214749 Ga0070667_1002147492 198
533 3300005439 Ga0070711_100076373 Ga0070711_1000763734 198
534 3300005445 Ga0070708_100249928 Ga0070708_1002499282 198
535 3300005456 Ga0070678_100013673 Ga0070678_1000136737 198
536 3300005456 Ga0070678_101225191 Ga0070678_1012251911 198
537 3300005458 Ga0070681_10507030 Ga0070681_105070302 198
538 3300005459 Ga0068867_100005656 Ga0068867_1000056564 198
539 3300005459 Ga0068867_100387254 Ga0068867_1003872542 198
540 3300005539 Ga0068853_100041016 Ga0068853_1000410163 198
541 3300005548 Ga0070665_100010396 Ga0070665_1000103962 198
542 3300005548 Ga0070665_100025954 Ga0070665_1000259544 198
543 3300005548 Ga0070665_100962925 Ga0070665_1009629252 198
544 3300005563 Ga0068855_100001111 Ga0068855_10000111133 198
545 3300005578 Ga0068854_100007750 Ga0068854_1000077502 198
546 3300005617 Ga0068859_100011041 Ga0068859_1000110413 198
547 3300005617 Ga0068859_100594582 Ga0068859_1005945821 198
548 3300005618 Ga0068864_100008010 Ga0068864_1000080104 198
549 3300005719 Ga0068861_100082970 Ga0068861_1000829703 198
550 3300005841 Ga0068863_100104886 Ga0068863_1001048863 198
551 3300005842 Ga0068858_100102803 Ga0068858_1001028033 198
552 3300005842 Ga0068858_100145995 Ga0068858_1001459951 198
553 3300005843 Ga0068860_100010046 Ga0068860_1000100463 198
554 3300005844 Ga0068862_100065861 Ga0068862_1000658614 198
555 3300005844 Ga0068862_100559616 Ga0068862_1005596162 198
556 3300006237 Ga0097621_100015272 Ga0097621_1000152723 198
557 3300006237 Ga0097621_100026255 Ga0097621_1000262552 198
558 3300006237 Ga0097621_100070108 Ga0097621_1000701084 198
559 3300006358 Ga0068871_100018023 Ga0068871_1000180237 198
560 3300006358 Ga0068871_100067154 Ga0068871_1000671542 198
561 3300006931 Ga0097620_100011041 Ga0097620_1000110413 198
562 3300006931 Ga0097620_100594609 Ga0097620_1005946092 198
563 3300009093 Ga0105240_10080514 Ga0105240_100805144 198
564 3300009093 Ga0105240_10282157 Ga0105240_102821571 198
565 3300009176 Ga0105242_10193740 Ga0105242_101937402 198
566 3300009545 Ga0105237_10177610 Ga0105237_101776102 198
567 3300009551 Ga0105238_10000037 Ga0105238_1000003722 198
568 3300009553 Ga0105249_10695340 Ga0105249_106953402 198
569 3300010159 Ga0099796_10032235 Ga0099796_100322352 198
570 3300010375 Ga0105239_10003694 Ga0105239_1000369421 198
571 3300010375 Ga0105239_10126821 Ga0105239_101268212 198
572 3300011119 Ga0105246_10058629 Ga0105246_100586292 198
573 3300013102 Ga0157371_10420569 Ga0157371_104205691 198
574 3300013296 Ga0157374_10063782 Ga0157374_100637822 198
575 3300013297 Ga0157378_10154075 Ga0157378_101540753 198
576 3300013308 Ga0157375_11420214 Ga0157375_114202142 198
577 3300014325 Ga0163163_10415524 Ga0163163_104155241 198
578 3300014326 Ga0157380_10039424 Ga0157380_100394242 198
579 3300014326 Ga0157380_10122177 Ga0157380_101221772 198
580 3300014968 Ga0157379_10050073 Ga0157379_100500733 198
581 3300017792 Ga0163161_10034675 Ga0163161_100346754 198
582 3300021361 Ga0213872_10000532 Ga0213872_100005324 198
583 3300021361 Ga0213872_10028863 Ga0213872_100288633 198
584 3300021361 Ga0213872_10075631 Ga0213872_100756313 198
585 3300025224 Ga0209784_100021 Ga0209784_100021219 198
586 3300025225 Ga0209566_100039 Ga0209566_100039220 198
587 3300025226 Ga0209674_100036 Ga0209674_100036219 198
588 3300025230 Ga0209563_100040 Ga0209563_100040219 198
589 3300025253 Ga0209677_100023 Ga0209677_100023219 198
590 3300025893 Ga0207682_10098547 Ga0207682_100985472 198
591 3300025893 Ga0207682_10258890 Ga0207682_102588902 198
592 3300025901 Ga0207688_10219330 Ga0207688_102193302 198
593 3300025907 Ga0207645_10000283 Ga0207645_1000028310 198
594 3300025908 Ga0207643_10149304 Ga0207643_101493041 198
595 3300025913 Ga0207695_10004822 Ga0207695_1000482210 198
596 3300025913 Ga0207695_10123126 Ga0207695_101231263 198
597 3300025914 Ga0207671_10029655 Ga0207671_100296556 198
598 3300025916 Ga0207663_10182289 Ga0207663_101822891 198
599 3300025923 Ga0207681_10030135 Ga0207681_100301351 198
600 3300025924 Ga0207694_10000054 Ga0207694_1000005423 198
601 3300025925 Ga0207650_10392283 Ga0207650_103922832 198
602 3300025925 Ga0207650_10603642 Ga0207650_106036421 198
603 3300025925 Ga0207650_10656347 Ga0207650_106563472 198
604 3300025926 Ga0207659_10039071 Ga0207659_100390713 198
605 3300025927 Ga0207687_10140591 Ga0207687_101405911 198
606 3300025931 Ga0207644_10640179 Ga0207644_106401792 198
607 3300025934 Ga0207686_10014249 Ga0207686_100142493 198
608 3300025934 Ga0207686_10120182 Ga0207686_101201822 198
609 3300025936 Ga0207670_10040216 Ga0207670_100402162 198
610 3300025937 Ga0207669_10864731 Ga0207669_108647311 198
611 3300025938 Ga0207704_10021622 Ga0207704_100216222 198
612 3300025940 Ga0207691_10027496 Ga0207691_100274964 198
613 3300025940 Ga0207691_10073729 Ga0207691_100737293 198
614 3300025941 Ga0207711_10066450 Ga0207711_100664501 198
615 3300025942 Ga0207689_10004785 Ga0207689_1000478511 198
616 3300025942 Ga0207689_10016386 Ga0207689_100163864 198
617 3300025942 Ga0207689_10837095 Ga0207689_108370951 198
618 3300025949 Ga0207667_10000043 Ga0207667_1000004322 198
619 3300025960 Ga0207651_10086881 Ga0207651_100868813 198
620 3300025960 Ga0207651_10120789 Ga0207651_101207893 198
621 3300025972 Ga0207668_10007674 Ga0207668_100076742 198
622 3300025986 Ga0207658_10009685 Ga0207658_100096853 198
623 3300026035 Ga0207703_10011411 Ga0207703_1001141111 198
624 3300026035 Ga0207703_10065587 Ga0207703_100655873 198
625 3300026035 Ga0207703_10088049 Ga0207703_100880492 198
626 3300026041 Ga0207639_10286592 Ga0207639_102865922 198
627 3300026078 Ga0207702_10638676 Ga0207702_106386762 198
628 3300026088 Ga0207641_10082878 Ga0207641_100828784 198
629 3300026089 Ga0207648_10000564 Ga0207648_1000056447 198
630 3300026089 Ga0207648_10010337 Ga0207648_100103375 198
631 3300026089 Ga0207648_10855858 Ga0207648_108558581 198
632 3300026095 Ga0207676_10093767 Ga0207676_100937672 198
633 3300026116 Ga0207674_10067908 Ga0207674_100679082 198
634 3300026118 Ga0207675_100398854 Ga0207675_1003988542 198
635 3300026121 Ga0207683_10000424 Ga0207683_100004249 198
636 3300026121 Ga0207683_10050559 Ga0207683_100505592 198
637 3300027682 Ga0209971_1008768 Ga0209971_10087682 198
638 3300028379 Ga0268266_10051870 Ga0268266_100518704 198
639 3300028380 Ga0268265_11064964 Ga0268265_110649641 198
640 3300028381 Ga0268264_10170987 Ga0268264_101709873 198
641 3300031235 Ga0265330_10000044 Ga0265330_1000004476 198
642 3300031238 Ga0265332_10000046 Ga0265332_1000004620 198
643 3300031241 Ga0265325_10005336 Ga0265325_100053367 198
644 3300031711 Ga0265314_10000130 Ga0265314_1000013076 198
645 3300031712 Ga0265342_10224754 Ga0265342_102247542 198
646 3300031728 Ga0316578_10210115 Ga0316578_102101151 198
647 3300031911 Ga0307412_10613775 Ga0307412_106137752 198
648 3300032168 Ga0316593_10046355 Ga0316593_100463553 198
649 3300036647 Ga0316582_0578169 Ga0316582_0578169_25_648 198
650 3300039062 Ga0400483_201100 Ga0400483_201100_304_909 198
651 3300039447 Ga0436361_0197834 Ga0436361_0197834_1706_2314 198
652 3300039447 Ga0436361_0632156 Ga0436361_0632156_7403_8026 198
653 3300039447 Ga0436361_0704696 Ga0436361_0704696_12926_13522 198
654 3300039447 Ga0436361_1128421 Ga0436361_1128421_2749_3360 198
655 3300042156 Ga0439446_0009364 Ga0439446_0009364_1609_2244 198
656 3300042876 Ga0451577_0121300 Ga0451577_0121300_1685_2281 198
657 3300044673 Ga0453683_0089392 Ga0453683_0089392_179_802 198
658 3300045051 Ga0451576_0090389 Ga0451576_0090389_509_1132 198
659 3300046475 Ga0495639_0112986 Ga0495639_0112986_310_906 198
660 3300046507 Ga0495606_0025241 Ga0495606_0025241_1250_1846 198
661 3300046528 Ga0495642_0057037 Ga0495642_0057037_198_794 198
662 3300046539 Ga0495621_0036484 Ga0495621_0036484_550_1146 198
663 3300048905 Ga0496102_0283160 Ga0496102_0283160_874_1470 198
664 3300048906 Ga0496103_0148425 Ga0496103_0148425_571_1167 198
665 3300048909 Ga0496106_0219403 Ga0496106_0219403_139_828 198
666 3300048913 Ga0496110_1159396 Ga0496110_1159396_41_643 198
667 3300048917 Ga0496114_0532137 Ga0496114_0532137_229_888 198
668 3300048927 Ga0496124_0004049 Ga0496124_0004049_4267_4869 198
669 3300048929 Ga0496126_0076463 Ga0496126_0076463_520_1161 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

65

208

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.991 5 186
7oj5-assembly1.cif.gz_A cryo-em structure of medicago truncatula hisn5 protein 0.9861 5 186
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9803 5 186
7oj5-assembly1.cif.gz_A cryo-em structure of medicago truncatula hisn5 protein 0.9703 5 186
6fwh-assembly1.cif.gz_A acanthamoeba igpd in complex with r-c348 to 1.7a resolution 0.9662 4 196
ID Description Score Start End Superfamily
2ae8A02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.986 93 182 3.30.230.40
4qnkD01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9837 3 91 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9825 93 186 3.30.230.40
af_C6T988_68_169_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9815 2 91 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9723 93 186 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A3D0LTM6-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 1.009 6 73 GO:0000105
GO:0004424
AF-A0A1Z9GWE8-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 1.005 5 86 GO:0000105
GO:0004424
AF-A0A3S4I3K5-F1-model_v4 Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19) 1.004 5 78 GO:0000105
GO:0004424
AF-A0A522GSK4-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 1.004 6 80 GO:0000105
GO:0004424
AF-A0A2E4EWP6-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 1.004 6 68 GO:0000105
GO:0004424

Feature Viewer

pLDDT pTM Quality
94.2 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map