F473457
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 662 | 427 | 597 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100211394|Ga0070671_1002113942 |
| Length | 345 |
| Sequence | MRRCLRPIWPSAPQSSENDVAQITLVEAVNLALHRAMADDGDVVVLGQDVGRDGGVFRATLGLLDKFGPERVIDTPLAENLIAGASIGMAAEGLRPVAEIQFSGFSYTVLDQILNHAGRLRHRTRGRLSCPMVLRTPCGAGIHPPEHHSESPDAMFAHIPGIRVVYPSSPKRAYGLLLAAIRDPDPVIFLEPTRLYRLFKEEVADDGQSLALDACYTLREGTDVTLVSWGAMIYETLQVADELSEQGIAAEVIDVATLKPIDFDTILASVAKTGRCVIVTEAPRHCSIASEISAHLAEHGLLTLLAPVLRVTAPDVVVPLSRLEHHYLPGKAQITAAVRKVLEFA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 2 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 3 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 4 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 5 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 6 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 7 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 8 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 9 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 10 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 11 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 12 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 13 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 14 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 15 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 16 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 17 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 18 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 19 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 20 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 21 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 22 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 23 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 24 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 25 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 26 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 27 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 28 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 29 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 30 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 31 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 32 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 33 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 34 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 35 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 36 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 37 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 38 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 39 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 40 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 41 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 42 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 43 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 44 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 45 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 46 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 47 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 48 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 49 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 50 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 51 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 52 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 53 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 54 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 55 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 56 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 59 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 61 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 62 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 64 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 70 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 74 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 75 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 92 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 97 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 105 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 106 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 107 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 108 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 109 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 110 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 111 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 112 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 114 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 115 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 116 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 118 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 119 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 120 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 122 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 123 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 124 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 125 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 126 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 127 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 130 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 131 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 132 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 133 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 134 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 214 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 215 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 225 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 226 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 230 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 236 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 237 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 238 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 239 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 240 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 250 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 251 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 253 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 254 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 255 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 258 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 259 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 260 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 261 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 262 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 263 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 264 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 265 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 266 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 267 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 268 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 269 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 270 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 271 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 272 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 273 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 274 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 275 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 346 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 347 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 348 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 349 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 352 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 353 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 354 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 355 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 356 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 357 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 358 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 359 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 360 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 361 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 362 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 390 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 391 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 392 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 393 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 408 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 409 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 410 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 411 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 412 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 413 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 414 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 415 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 416 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 419 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 420 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 421 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 422 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 423 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 424 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 425 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 426 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 427 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.27 |
| Metatranscriptomes | 0.91 |
| Isolates | 9.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.5 |
| Nodule | 7.4 |
| Rhizoplane | 5.29 |
| Rhizosphere | 76.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000065 | 3300003187 | Bacteria | 145136 |
| 2 | JGI25151J46595_10003107 | 3300003187 | Bacteria | 9353 |
| 3 | JGI25151J46595_10047976 | 3300003187 | Bacteria | 1480 |
| 4 | JGI25406J46586_10008960 | 3300003203 | Bacteria | 4502 |
| 5 | Ga0055526_1008036 | 3300003771 | Bacteria | 5333 |
| 6 | Ga0055526_1013999 | 3300003771 | Bacteria | 3341 |
| 7 | Ga0055537_1000409 | 3300003773 | Bacteria | 28111 |
| 8 | Ga0055524_1032463 | 3300003775 | Bacteria | 1479 |
| 9 | Ga0055536_1000026 | 3300003781 | Bacteria | 166220 |
| 10 | Ga0055534_1000189 | 3300003784 | Bacteria | 45268 |
| 11 | Ga0055534_1001063 | 3300003784 | Bacteria | 11875 |
| 12 | Ga0065715_10189389 | 3300005293 | Bacteria | 1424 |
| 13 | Ga0065707_10081743 | 3300005295 | Bacteria | 52414 |
| 14 | Ga0065707_10088932 | 3300005295 | Bacteria | 4511 |
| 15 | Ga0070658_10336468 | 3300005327 | Bacteria | 1291 |
| 16 | Ga0070676_10095021 | 3300005328 | Bacteria | 1832 |
| 17 | Ga0070676_10113826 | 3300005328 | Bacteria | 1688 |
| 18 | Ga0070683_100214156 | 3300005329 | Bacteria | 1830 |
| 19 | Ga0070670_100036342 | 3300005331 | Bacteria | 4239 |
| 20 | Ga0070670_100176392 | 3300005331 | Bacteria | 1855 |
| 21 | Ga0070677_10008159 | 3300005333 | Bacteria | 3518 |
| 22 | Ga0070677_10149203 | 3300005333 | Bacteria | 1086 |
| 23 | Ga0068869_100068986 | 3300005334 | Bacteria | 2613 |
| 24 | Ga0070666_10327171 | 3300005335 | Bacteria | 1094 |
| 25 | Ga0070680_100058077 | 3300005336 | Bacteria | 3164 |
| 26 | Ga0070682_100051074 | 3300005337 | Bacteria | 2583 |
| 27 | Ga0068868_100063251 | 3300005338 | Bacteria | 2935 |
| 28 | Ga0068868_100067312 | 3300005338 | Bacteria | 2850 |
| 29 | Ga0070689_100031371 | 3300005340 | Bacteria | 4037 |
| 30 | Ga0070661_100239470 | 3300005344 | Bacteria | 1397 |
| 31 | Ga0070668_100114662 | 3300005347 | Bacteria | 2147 |
| 32 | Ga0070675_100035799 | 3300005354 | Bacteria | 4037 |
| 33 | Ga0070675_100169265 | 3300005354 | Archaea | 1883 |
| 34 | Ga0070671_100082708 | 3300005355 | Bacteria | 2685 |
| 35 | Ga0070671_100211394 | 3300005355 | Bacteria | 1645 |
| 36 | Ga0070673_100004595 | 3300005364 | Bacteria | 8751 |
| 37 | Ga0070667_100085213 | 3300005367 | Bacteria | 2710 |
| 38 | Ga0070667_100324048 | 3300005367 | Bacteria | 1391 |
| 39 | Ga0070709_10102714 | 3300005434 | Archaea | 1907 |
| 40 | Ga0070710_10119844 | 3300005437 | Archaea | 1591 |
| 41 | Ga0070701_10070545 | 3300005438 | Bacteria | 1867 |
| 42 | Ga0070701_10172778 | 3300005438 | Bacteria | 1259 |
| 43 | Ga0070705_100120875 | 3300005440 | Bacteria | 1691 |
| 44 | Ga0070700_100046888 | 3300005441 | Bacteria | 2672 |
| 45 | Ga0070694_100119992 | 3300005444 | Bacteria | 1885 |
| 46 | Ga0070694_100207814 | 3300005444 | Bacteria | 1462 |
| 47 | Ga0070708_100102739 | 3300005445 | Bacteria | 2619 |
| 48 | Ga0070678_100007935 | 3300005456 | Bacteria | 6323 |
| 49 | Ga0070678_100051903 | 3300005456 | Bacteria | 2975 |
| 50 | Ga0070662_100060371 | 3300005457 | Bacteria | 2765 |
| 51 | Ga0070662_100091608 | 3300005457 | Bacteria | 2283 |
| 52 | Ga0070681_10001662 | 3300005458 | Bacteria | 19868 |
| 53 | Ga0070681_10002738 | 3300005458 | Bacteria | 16241 |
| 54 | Ga0070681_10031983 | 3300005458 | Bacteria | 5281 |
| 55 | Ga0068867_100031201 | 3300005459 | Bacteria | 3846 |
| 56 | Ga0068867_100034316 | 3300005459 | Bacteria | 3677 |
| 57 | Ga0068867_100128454 | 3300005459 | Bacteria | 1967 |
| 58 | Ga0070706_100193797 | 3300005467 | Bacteria | 1899 |
| 59 | Ga0070706_100497445 | 3300005467 | Bacteria | 1134 |
| 60 | Ga0070707_100190417 | 3300005468 | Bacteria | 2000 |
| 61 | Ga0070698_100173595 | 3300005471 | Bacteria | 2096 |
| 62 | Ga0070699_100006567 | 3300005518 | Bacteria | 10121 |
| 63 | Ga0070679_100002816 | 3300005530 | Bacteria | 15812 |
| 64 | Ga0070679_100010362 | 3300005530 | Bacteria | 8841 |
| 65 | Ga0070679_100067542 | 3300005530 | Bacteria | 3565 |
| 66 | Ga0070684_100011305 | 3300005535 | Bacteria | 7106 |
| 67 | Ga0070684_100229029 | 3300005535 | Bacteria | 1697 |
| 68 | Ga0070697_100040317 | 3300005536 | Bacteria | 3777 |
| 69 | Ga0070672_100009641 | 3300005543 | Bacteria | 6665 |
| 70 | Ga0070672_100041626 | 3300005543 | Bacteria | 3533 |
| 71 | Ga0070665_100262877 | 3300005548 | Bacteria | 1727 |
| 72 | Ga0070665_100425695 | 3300005548 | Bacteria | 1336 |
| 73 | Ga0070704_100077188 | 3300005549 | Bacteria | 2439 |
| 74 | Ga0070704_100226032 | 3300005549 | Unclassified | 1524 |
| 75 | Ga0068854_100010855 | 3300005578 | Bacteria | 5911 |
| 76 | Ga0068854_100144893 | 3300005578 | Bacteria | 1826 |
| 77 | Ga0068852_100006347 | 3300005616 | Bacteria | 8534 |
| 78 | Ga0068864_100075436 | 3300005618 | Bacteria | 2944 |
| 79 | Ga0068864_100078493 | 3300005618 | Bacteria | 2889 |
| 80 | Ga0068861_100050841 | 3300005719 | Bacteria | 3144 |
| 81 | Ga0068851_10037164 | 3300005834 | Bacteria | 2441 |
| 82 | Ga0068863_100079248 | 3300005841 | Bacteria | 3111 |
| 83 | Ga0068858_100004871 | 3300005842 | Bacteria | 13165 |
| 84 | Ga0081455_10005009 | 3300005937 | Bacteria | 14652 |
| 85 | Ga0081455_10036010 | 3300005937 | Bacteria | 4413 |
| 86 | Ga0081538_10004387 | 3300005981 | Bacteria | 13028 |
| 87 | Ga0081538_10014551 | 3300005981 | Bacteria | 6151 |
| 88 | Ga0081539_10002801 | 3300005985 | Bacteria | 23305 |
| 89 | Ga0081539_10003064 | 3300005985 | Bacteria | 21557 |
| 90 | Ga0081539_10101393 | 3300005985 | Bacteria | 1466 |
| 91 | Ga0070717_10082141 | 3300006028 | Bacteria | 2707 |
| 92 | Ga0075365_10019003 | 3300006038 | Bacteria | 4233 |
| 93 | Ga0075363_100050571 | 3300006048 | Bacteria | 2215 |
| 94 | Ga0075364_10016546 | 3300006051 | Bacteria | 4589 |
| 95 | Ga0070716_100015432 | 3300006173 | Bacteria | 3924 |
| 96 | Ga0070716_100097950 | 3300006173 | Bacteria | 1791 |
| 97 | Ga0075362_10029092 | 3300006177 | Bacteria | 2378 |
| 98 | Ga0075369_10003788 | 3300006186 | Bacteria | 5536 |
| 99 | Ga0075427_10001119 | 3300006194 | Bacteria | 3376 |
| 100 | Ga0097621_100339638 | 3300006237 | Bacteria | 1333 |
| 101 | Ga0075428_100020350 | 3300006844 | Bacteria | 7349 |
| 102 | Ga0075428_100052854 | 3300006844 | Bacteria | 4451 |
| 103 | Ga0075428_100072604 | 3300006844 | Bacteria | 3759 |
| 104 | Ga0075428_100215838 | 3300006844 | Bacteria | 2073 |
| 105 | Ga0075430_100028740 | 3300006846 | Bacteria | 4722 |
| 106 | Ga0075430_100032363 | 3300006846 | Bacteria | 4439 |
| 107 | Ga0075430_100181989 | 3300006846 | Bacteria | 1748 |
| 108 | Ga0075431_100021479 | 3300006847 | Bacteria | 6601 |
| 109 | Ga0075431_100033281 | 3300006847 | Bacteria | 5312 |
| 110 | Ga0075431_100116384 | 3300006847 | Archaea | 2759 |
| 111 | Ga0075433_10012098 | 3300006852 | Bacteria | 6960 |
| 112 | Ga0075433_10020700 | 3300006852 | Bacteria | 5506 |
| 113 | Ga0075433_10031177 | 3300006852 | Bacteria | 4555 |
| 114 | Ga0075433_10174944 | 3300006852 | Bacteria | 1910 |
| 115 | Ga0075434_100018418 | 3300006871 | Bacteria | 6746 |
| 116 | Ga0075434_100055127 | 3300006871 | Bacteria | 3950 |
| 117 | Ga0075434_100411858 | 3300006871 | Bacteria | 1373 |
| 118 | Ga0075429_100042525 | 3300006880 | Bacteria | 3954 |
| 119 | Ga0075436_100002502 | 3300006914 | Bacteria | 12638 |
| 120 | Ga0075436_100019613 | 3300006914 | Bacteria | 4635 |
| 121 | Ga0075436_100022926 | 3300006914 | Bacteria | 4289 |
| 122 | Ga0075436_100027978 | 3300006914 | Bacteria | 3880 |
| 123 | Ga0075436_100099586 | 3300006914 | Archaea | 2023 |
| 124 | Ga0075436_100278844 | 3300006914 | Bacteria | 1195 |
| 125 | Ga0097620_100037630 | 3300006931 | Bacteria | 4856 |
| 126 | Ga0099824_1017890 | 3300006942 | Bacteria | 5989 |
| 127 | Ga0099822_1006921 | 3300006943 | Bacteria | 14719 |
| 128 | Ga0099826_10107849 | 3300006948 | Bacteria | 1665 |
| 129 | Ga0075435_100030773 | 3300007076 | Bacteria | 4224 |
| 130 | Ga0075435_100047136 | 3300007076 | Bacteria | 3460 |
| 131 | Ga0075435_100047201 | 3300007076 | Bacteria | 3457 |
| 132 | Ga0075435_100128197 | 3300007076 | Bacteria | 2122 |
| 133 | Ga0099795_10002286 | 3300007788 | Bacteria | 4465 |
| 134 | Ga0105240_10013803 | 3300009093 | Bacteria | 11066 |
| 135 | Ga0105240_10058445 | 3300009093 | Bacteria | 4814 |
| 136 | Ga0105240_10324452 | 3300009093 | Bacteria | 1754 |
| 137 | Ga0111539_10035004 | 3300009094 | Bacteria | 6082 |
| 138 | Ga0111539_10050663 | 3300009094 | Bacteria | 4947 |
| 139 | Ga0111539_10113991 | 3300009094 | Bacteria | 3170 |
| 140 | Ga0111539_10458715 | 3300009094 | Bacteria | 1484 |
| 141 | Ga0105245_10072584 | 3300009098 | Bacteria | 3127 |
| 142 | Ga0105245_10306358 | 3300009098 | Bacteria | 1560 |
| 143 | Ga0114129_10148278 | 3300009147 | Bacteria | 3212 |
| 144 | Ga0114129_10547344 | 3300009147 | Bacteria | 1505 |
| 145 | Ga0114129_10739995 | 3300009147 | Bacteria | 1260 |
| 146 | Ga0105242_10047961 | 3300009176 | Bacteria | 3470 |
| 147 | Ga0105248_10020155 | 3300009177 | Bacteria | 7388 |
| 148 | Ga0105249_10050501 | 3300009553 | Bacteria | 3791 |
| 149 | Ga0105249_10238865 | 3300009553 | Bacteria | 1795 |
| 150 | Ga0157373_10117512 | 3300013100 | Bacteria | 1869 |
| 151 | Ga0157371_10116951 | 3300013102 | Bacteria | 1895 |
| 152 | Ga0157369_10001094 | 3300013105 | Bacteria | 33888 |
| 153 | Ga0157369_10007378 | 3300013105 | Bacteria | 12658 |
| 154 | Ga0157374_10047438 | 3300013296 | Bacteria | 3983 |
| 155 | Ga0157378_10022897 | 3300013297 | Bacteria | 5499 |
| 156 | Ga0157378_10028936 | 3300013297 | Bacteria | 4891 |
| 157 | Ga0157378_10293647 | 3300013297 | Bacteria | 1571 |
| 158 | Ga0163162_10087235 | 3300013306 | Bacteria | 3199 |
| 159 | Ga0163162_10147926 | 3300013306 | Bacteria | 2466 |
| 160 | Ga0157372_10075500 | 3300013307 | Bacteria | 3803 |
| 161 | Ga0157375_10001310 | 3300013308 | Bacteria | 21450 |
| 162 | Ga0157375_10033230 | 3300013308 | Bacteria | 4899 |
| 163 | Ga0157380_10200110 | 3300014326 | Bacteria | 1771 |
| 164 | Ga0157380_10296540 | 3300014326 | Bacteria | 1487 |
| 165 | Ga0157377_10069610 | 3300014745 | Bacteria | 2031 |
| 166 | Ga0157377_10185971 | 3300014745 | Bacteria | 1310 |
| 167 | Ga0157379_10071413 | 3300014968 | Bacteria | 3105 |
| 168 | Ga0157379_10103235 | 3300014968 | Bacteria | 2558 |
| 169 | Ga0157376_10137422 | 3300014969 | Bacteria | 2189 |
| 170 | Ga0163161_10129105 | 3300017792 | Bacteria | 1905 |
| 171 | Ga0163161_10256479 | 3300017792 | Bacteria | 1364 |
| 172 | Ga0197907_10631922 | 3300020069 | Bacteria | 3988 |
| 173 | Ga0206356_10210458 | 3300020070 | Bacteria | 4213 |
| 174 | Ga0206354_10271013 | 3300020081 | Bacteria | 4354 |
| 175 | Ga0206354_10719210 | 3300020081 | Bacteria | 4972 |
| 176 | Ga0206353_10311756 | 3300020082 | Bacteria | 4778 |
| 177 | Ga0224712_10004229 | 3300022467 | Bacteria | 3847 |
| 178 | Ga0209565_1000109 | 3300025263 | Bacteria | 120345 |
| 179 | Ga0209455_1021482 | 3300025272 | Bacteria | 1251 |
| 180 | Ga0209675_1000026 | 3300025291 | Bacteria | 284716 |
| 181 | Ga0209675_1000118 | 3300025291 | Bacteria | 110507 |
| 182 | Ga0209676_1000059 | 3300025292 | Bacteria | 344882 |
| 183 | Ga0209025_1000066 | 3300025294 | Bacteria | 298742 |
| 184 | Ga0209025_1000151 | 3300025294 | Bacteria | 172081 |
| 185 | Ga0209025_1000159 | 3300025294 | Bacteria | 167081 |
| 186 | Ga0209564_1000084 | 3300025295 | Bacteria | 252729 |
| 187 | Ga0209564_1000161 | 3300025295 | Bacteria | 162489 |
| 188 | Ga0209564_1001556 | 3300025295 | Bacteria | 22580 |
| 189 | Ga0209256_1001890 | 3300025299 | Bacteria | 19210 |
| 190 | Ga0207697_10018003 | 3300025315 | Bacteria | 2900 |
| 191 | Ga0207682_10008773 | 3300025893 | Bacteria | 3998 |
| 192 | Ga0207692_10094952 | 3300025898 | Archaea | 1625 |
| 193 | Ga0207688_10004632 | 3300025901 | Bacteria | 7494 |
| 194 | Ga0207647_10126999 | 3300025904 | Bacteria | 1500 |
| 195 | Ga0207685_10006267 | 3300025905 | Bacteria | 3225 |
| 196 | Ga0207699_10181816 | 3300025906 | Archaea | 1414 |
| 197 | Ga0207645_10002333 | 3300025907 | Bacteria | 14995 |
| 198 | Ga0207645_10134821 | 3300025907 | Bacteria | 1608 |
| 199 | Ga0207684_10039044 | 3300025910 | Bacteria | 4028 |
| 200 | Ga0207684_10270650 | 3300025910 | Bacteria | 1465 |
| 201 | Ga0207654_10040560 | 3300025911 | Bacteria | 2624 |
| 202 | Ga0207707_10000134 | 3300025912 | Bacteria | 77031 |
| 203 | Ga0207707_10055475 | 3300025912 | Bacteria | 3447 |
| 204 | Ga0207707_10101528 | 3300025912 | Bacteria | 2514 |
| 205 | Ga0207695_10265803 | 3300025913 | Bacteria | 1612 |
| 206 | Ga0207671_10025879 | 3300025914 | Bacteria | 4403 |
| 207 | Ga0207693_10022996 | 3300025915 | Bacteria | 4950 |
| 208 | Ga0207693_10057630 | 3300025915 | Bacteria | 3044 |
| 209 | Ga0207660_10019686 | 3300025917 | Bacteria | 4516 |
| 210 | Ga0207649_10143883 | 3300025920 | Bacteria | 1635 |
| 211 | Ga0207652_10004279 | 3300025921 | Bacteria | 11648 |
| 212 | Ga0207652_10006706 | 3300025921 | Bacteria | 9276 |
| 213 | Ga0207646_10000871 | 3300025922 | Bacteria | 38971 |
| 214 | Ga0207646_10120736 | 3300025922 | Bacteria | 2354 |
| 215 | Ga0207694_10223439 | 3300025924 | Bacteria | 1537 |
| 216 | Ga0207650_10008552 | 3300025925 | Bacteria | 6987 |
| 217 | Ga0207650_10028693 | 3300025925 | Bacteria | 3993 |
| 218 | Ga0207650_10102605 | 3300025925 | Bacteria | 2204 |
| 219 | Ga0207659_10020113 | 3300025926 | Bacteria | 4405 |
| 220 | Ga0207659_10096357 | 3300025926 | Archaea | 2221 |
| 221 | Ga0207659_10115344 | 3300025926 | Bacteria | 2049 |
| 222 | Ga0207687_10148559 | 3300025927 | Bacteria | 1786 |
| 223 | Ga0207700_10049199 | 3300025928 | Bacteria | 3135 |
| 224 | Ga0207664_10256998 | 3300025929 | Bacteria | 1526 |
| 225 | Ga0207644_10043577 | 3300025931 | Bacteria | 3185 |
| 226 | Ga0207644_10224566 | 3300025931 | Bacteria | 1490 |
| 227 | Ga0207706_10199561 | 3300025933 | Bacteria | 1755 |
| 228 | Ga0207665_10023706 | 3300025939 | Bacteria | 4042 |
| 229 | Ga0207665_10129795 | 3300025939 | Bacteria | 1788 |
| 230 | Ga0207691_10006472 | 3300025940 | Bacteria | 11315 |
| 231 | Ga0207691_10007344 | 3300025940 | Bacteria | 10628 |
| 232 | Ga0207691_10021556 | 3300025940 | Bacteria | 6083 |
| 233 | Ga0207711_10025736 | 3300025941 | Bacteria | 4934 |
| 234 | Ga0207689_10084180 | 3300025942 | Bacteria | 2614 |
| 235 | Ga0207661_10012138 | 3300025944 | Bacteria | 6255 |
| 236 | Ga0207661_10198554 | 3300025944 | Bacteria | 1762 |
| 237 | Ga0207651_10005561 | 3300025960 | Bacteria | 6488 |
| 238 | Ga0207668_10334374 | 3300025972 | Bacteria | 1261 |
| 239 | Ga0207640_10055551 | 3300025981 | Bacteria | 2594 |
| 240 | Ga0207658_10083313 | 3300025986 | Bacteria | 2458 |
| 241 | Ga0207677_10026177 | 3300026023 | Bacteria | 3654 |
| 242 | Ga0207703_10122975 | 3300026035 | Bacteria | 2230 |
| 243 | Ga0207708_10019988 | 3300026075 | Bacteria | 5049 |
| 244 | Ga0207641_10065182 | 3300026088 | Bacteria | 3115 |
| 245 | Ga0207641_10097736 | 3300026088 | Bacteria | 2581 |
| 246 | Ga0207648_10015932 | 3300026089 | Bacteria | 6888 |
| 247 | Ga0207648_10028060 | 3300026089 | Bacteria | 4993 |
| 248 | Ga0207648_10046401 | 3300026089 | Bacteria | 3809 |
| 249 | Ga0207676_10001527 | 3300026095 | Bacteria | 17082 |
| 250 | Ga0207674_10007077 | 3300026116 | Bacteria | 13107 |
| 251 | Ga0207674_10100243 | 3300026116 | Bacteria | 2878 |
| 252 | Ga0207675_100040834 | 3300026118 | Bacteria | 4333 |
| 253 | Ga0207683_10000592 | 3300026121 | Bacteria | 33374 |
| 254 | Ga0207683_10069583 | 3300026121 | Bacteria | 3108 |
| 255 | Ga0207698_10369552 | 3300026142 | Bacteria | 1361 |
| 256 | Ga0209589_1000009 | 3300027357 | Bacteria | 252104 |
| 257 | Ga0209969_1000252 | 3300027360 | Bacteria | 7109 |
| 258 | Ga0209489_100010 | 3300027361 | Bacteria | 252139 |
| 259 | Ga0209700_100017 | 3300027363 | Bacteria | 252104 |
| 260 | Ga0209967_1002052 | 3300027364 | Bacteria | 2598 |
| 261 | Ga0209995_1000556 | 3300027471 | Bacteria | 5681 |
| 262 | Ga0209999_1006791 | 3300027543 | Bacteria | 2060 |
| 263 | Ga0209588_1005801 | 3300027671 | Bacteria | 3556 |
| 264 | Ga0207428_10005458 | 3300027907 | Bacteria | 11857 |
| 265 | Ga0268265_10151082 | 3300028380 | Bacteria | 1959 |
| 266 | Ga0265338_10008231 | 3300028800 | Bacteria | 12701 |
| 267 | Ga0265330_10050406 | 3300031235 | Bacteria | 1826 |
| 268 | Ga0265332_10005303 | 3300031238 | Bacteria | 5961 |
| 269 | Ga0265328_10001996 | 3300031239 | Bacteria | 9235 |
| 270 | Ga0265328_10015116 | 3300031239 | Bacteria | 3030 |
| 271 | Ga0265325_10001737 | 3300031241 | Bacteria | 15129 |
| 272 | Ga0265339_10000101 | 3300031249 | Bacteria | 69843 |
| 273 | Ga0265316_10020282 | 3300031344 | Bacteria | 5663 |
| 274 | Ga0307513_10076919 | 3300031456 | Bacteria | 3459 |
| 275 | Ga0307509_10005263 | 3300031507 | Bacteria | 18116 |
| 276 | Ga0307509_10162734 | 3300031507 | Bacteria | 2126 |
| 277 | Ga0265313_10003333 | 3300031595 | Bacteria | 13128 |
| 278 | Ga0265314_10000895 | 3300031711 | Bacteria | 35520 |
| 279 | Ga0265342_10022105 | 3300031712 | Bacteria | 4051 |
| 280 | Ga0307413_10106951 | 3300031824 | Bacteria | 1863 |
| 281 | Ga0307406_10067925 | 3300031901 | Bacteria | 2326 |
| 282 | Ga0307407_10234213 | 3300031903 | Bacteria | 1249 |
| 283 | Ga0307416_100121656 | 3300032002 | Bacteria | 2328 |
| 284 | Ga0307416_100185609 | 3300032002 | Bacteria | 1954 |
| 285 | Ga0307411_10211149 | 3300032005 | Bacteria | 1499 |
| 286 | Ga0307507_10018630 | 3300033179 | Bacteria | 7877 |
| 287 | Ga0315911_1000065 | 3300033442 | Bacteria | 18719 |
| 288 | Ga0373940_0016492 | 3300035088 | Bacteria | 1830 |
| 289 | Ga0373923_0008342 | 3300035111 | Bacteria | 3690 |
| 290 | Ga0373936_0008260 | 3300035113 | Bacteria | 3915 |
| 291 | Ga0373945_0002588 | 3300035116 | Bacteria | 5667 |
| 292 | Ga0373956_0043911 | 3300035119 | Bacteria | 1991 |
| 293 | Ga0373956_0083294 | 3300035119 | Bacteria | 1470 |
| 294 | Ga0373943_0007981 | 3300035170 | Bacteria | 4751 |
| 295 | Ga0373943_0050554 | 3300035170 | Bacteria | 2043 |
| 296 | Ga0373946_0005758 | 3300035171 | Bacteria | 4484 |
| 297 | Ga0373955_0007337 | 3300035172 | Bacteria | 5065 |
| 298 | Ga0373955_0020598 | 3300035172 | Bacteria | 3318 |
| 299 | Ga0373942_0003008 | 3300035207 | Bacteria | 3993 |
| 300 | Ga0316574_0031643 | 3300035398 | Bacteria | 3210 |
| 301 | Ga0316574_0062525 | 3300035398 | Bacteria | 2340 |
| 302 | Ga0373924_0038127 | 3300035410 | Bacteria | 1959 |
| 303 | Ga0373935_0015289 | 3300035692 | Bacteria | 4636 |
| 304 | Ga0373935_0023351 | 3300035692 | Bacteria | 3800 |
| 305 | Ga0373935_0069562 | 3300035692 | Bacteria | 2267 |
| 306 | Ga0373927_0009120 | 3300035695 | Bacteria | 6658 |
| 307 | Ga0373927_0068031 | 3300035695 | Bacteria | 2304 |
| 308 | Ga0373933_0012659 | 3300035724 | Bacteria | 4662 |
| 309 | Ga0373947_0008626 | 3300035725 | Bacteria | 5868 |
| 310 | Ga0373947_0093842 | 3300035725 | Bacteria | 1876 |
| 311 | Ga0373947_0167412 | 3300035725 | Bacteria | 1424 |
| 312 | Ga0373947_0255518 | 3300035725 | Bacteria | 1160 |
| 313 | Ga0373937_0042988 | 3300036401 | Bacteria | 4124 |
| 314 | Ga0373925_0014818 | 3300037068 | Bacteria | 5635 |
| 315 | Ga0373925_0073058 | 3300037068 | Bacteria | 2595 |
| 316 | Ga0395899_0077178 | 3300037312 | Bacteria | 2430 |
| 317 | Ga0395900_0000211 | 3300037418 | Bacteria | 91303 |
| 318 | Ga0395900_0151827 | 3300037418 | Bacteria | 2366 |
| 319 | Ga0395900_0263243 | 3300037418 | Bacteria | 1721 |
| 320 | Ga0395898_0000519 | 3300037466 | Bacteria | 73573 |
| 321 | Ga0395898_0005969 | 3300037466 | Bacteria | 13079 |
| 322 | Ga0395901_0000081 | 3300038443 | Bacteria | 130244 |
| 323 | Ga0395901_0000134 | 3300038443 | Bacteria | 95892 |
| 324 | Ga0395901_0024571 | 3300038443 | Bacteria | 6186 |
| 325 | Ga0395901_0038669 | 3300038443 | Bacteria | 4935 |
| 326 | Ga0395901_0315055 | 3300038443 | Bacteria | 1619 |
| 327 | Ga0400483_011534 | 3300039062 | Bacteria | 5166 |
| 328 | Ga0436361_0424425 | 3300039447 | Bacteria | 14085 |
| 329 | Ga0436363_0402666 | 3300039450 | Bacteria | 3397 |
| 330 | Ga0436362_0777509 | 3300039453 | Bacteria | 1147 |
| 331 | Ga0439453_0001059 | 3300041408 | Bacteria | 3388 |
| 332 | Ga0439441_004226 | 3300042001 | Bacteria | 2164 |
| 333 | Ga0450894_014072 | 3300042131 | Bacteria | 1054 |
| 334 | Ga0439440_0008194 | 3300042993 | Bacteria | 2140 |
| 335 | Ga0466966_0001018 | 3300044684 | Bacteria | 17889 |
| 336 | Ga0466966_0051894 | 3300044684 | Bacteria | 2606 |
| 337 | Ga0466961_0041804 | 3300044693 | Bacteria | 2939 |
| 338 | Ga0466971_0001312 | 3300044719 | Bacteria | 10392 |
| 339 | Ga0466957_0018592 | 3300044842 | Bacteria | 4082 |
| 340 | Ga0466959_0015328 | 3300045049 | Bacteria | 5581 |
| 341 | Ga0451576_0052660 | 3300045051 | Bacteria | 4265 |
| 342 | Ga0451576_0132460 | 3300045051 | Bacteria | 2599 |
| 343 | Ga0466958_0031663 | 3300045836 | Bacteria | 3144 |
| 344 | Ga0495592_0017159 | 3300046454 | Bacteria | 5497 |
| 345 | Ga0495603_0000241 | 3300046455 | Bacteria | 28490 |
| 346 | Ga0495603_0000494 | 3300046455 | Bacteria | 21813 |
| 347 | Ga0495603_0043961 | 3300046455 | Bacteria | 2666 |
| 348 | Ga0495603_0211165 | 3300046455 | Bacteria | 1121 |
| 349 | Ga0495590_0010344 | 3300046457 | Bacteria | 3511 |
| 350 | Ga0495629_0001268 | 3300046459 | Bacteria | 19845 |
| 351 | Ga0495638_0002250 | 3300046460 | Bacteria | 15996 |
| 352 | Ga0495641_0002706 | 3300046461 | Bacteria | 13782 |
| 353 | Ga0495651_0002860 | 3300046462 | Bacteria | 13372 |
| 354 | Ga0495653_0010786 | 3300046463 | Bacteria | 7483 |
| 355 | Ga0495650_0011168 | 3300046471 | Bacteria | 4948 |
| 356 | Ga0495580_0014199 | 3300046472 | Bacteria | 6047 |
| 357 | Ga0495580_0018631 | 3300046472 | Bacteria | 5166 |
| 358 | Ga0495580_0106075 | 3300046472 | Bacteria | 1952 |
| 359 | Ga0495582_0000438 | 3300046473 | Bacteria | 22737 |
| 360 | Ga0495582_0016750 | 3300046473 | Bacteria | 4014 |
| 361 | Ga0495605_0003442 | 3300046474 | Bacteria | 9409 |
| 362 | Ga0495605_0058312 | 3300046474 | Bacteria | 1856 |
| 363 | Ga0495639_0001888 | 3300046475 | Bacteria | 9290 |
| 364 | Ga0495662_0007519 | 3300046476 | Bacteria | 5381 |
| 365 | Ga0495664_0028688 | 3300046477 | Bacteria | 3250 |
| 366 | Ga0495584_0132656 | 3300046491 | Bacteria | 1264 |
| 367 | Ga0495594_0001717 | 3300046499 | Bacteria | 11357 |
| 368 | Ga0495608_0006731 | 3300046511 | Bacteria | 8150 |
| 369 | Ga0495610_0005881 | 3300046512 | Bacteria | 8604 |
| 370 | Ga0495616_0005920 | 3300046513 | Bacteria | 7457 |
| 371 | Ga0495628_0012853 | 3300046516 | Bacteria | 7049 |
| 372 | Ga0495630_0007657 | 3300046517 | Bacteria | 7723 |
| 373 | Ga0495630_0214894 | 3300046517 | Bacteria | 1468 |
| 374 | Ga0495631_0119490 | 3300046518 | Bacteria | 1133 |
| 375 | Ga0495637_0022117 | 3300046520 | Bacteria | 2905 |
| 376 | Ga0495663_0022382 | 3300046525 | Bacteria | 1825 |
| 377 | Ga0495666_0066236 | 3300046526 | Bacteria | 1722 |
| 378 | Ga0495642_0024857 | 3300046528 | Bacteria | 2371 |
| 379 | Ga0495665_0001088 | 3300046531 | Bacteria | 14362 |
| 380 | Ga0495665_0071658 | 3300046531 | Bacteria | 1825 |
| 381 | Ga0495640_0014993 | 3300046533 | Bacteria | 5843 |
| 382 | Ga0495640_0016417 | 3300046533 | Bacteria | 5538 |
| 383 | Ga0495586_0042884 | 3300046535 | Bacteria | 2436 |
| 384 | Ga0495645_0010708 | 3300046543 | Bacteria | 6440 |
| 385 | Ga0495645_0086881 | 3300046543 | Bacteria | 2237 |
| 386 | Ga0495622_0003834 | 3300046557 | Bacteria | 7021 |
| 387 | Ga0495622_0004695 | 3300046557 | Bacteria | 6334 |
| 388 | Ga0495622_0007279 | 3300046557 | Bacteria | 5138 |
| 389 | Ga0495667_0027618 | 3300046559 | Bacteria | 3822 |
| 390 | Ga0495656_0017464 | 3300046615 | Bacteria | 2738 |
| 391 | Ga0495668_0048279 | 3300046616 | Bacteria | 2362 |
| 392 | Ga0495634_0004708 | 3300046642 | Bacteria | 10611 |
| 393 | Ga0495634_0031837 | 3300046642 | Bacteria | 3630 |
| 394 | Ga0495611_0033529 | 3300046648 | Bacteria | 2266 |
| 395 | Ga0495635_0003631 | 3300046663 | Bacteria | 10698 |
| 396 | Ga0495659_0020303 | 3300046664 | Bacteria | 2230 |
| 397 | Ga0495588_0034068 | 3300046674 | Bacteria | 2576 |
| 398 | Ga0495657_0030815 | 3300046675 | Bacteria | 3753 |
| 399 | Ga0495599_0137636 | 3300046678 | Bacteria | 1515 |
| 400 | Ga0495623_0005091 | 3300046679 | Bacteria | 8624 |
| 401 | Ga0495647_0038476 | 3300046681 | Bacteria | 1808 |
| 402 | Ga0495658_0001846 | 3300046683 | Bacteria | 10823 |
| 403 | Ga0495658_0003373 | 3300046683 | Bacteria | 7916 |
| 404 | Ga0495658_0045632 | 3300046683 | Bacteria | 2460 |
| 405 | Ga0495658_0275500 | 3300046683 | Bacteria | 1061 |
| 406 | Ga0495669_0043864 | 3300046684 | Bacteria | 1991 |
| 407 | Ga0495613_0003392 | 3300046689 | Bacteria | 11906 |
| 408 | Ga0495624_0007222 | 3300046690 | Bacteria | 7809 |
| 409 | Ga0495649_0050873 | 3300046694 | Bacteria | 2247 |
| 410 | Ga0495581_0000360 | 3300047315 | Bacteria | 22826 |
| 411 | Ga0495604_0000337 | 3300047317 | Bacteria | 41859 |
| 412 | Ga0495636_0001794 | 3300047318 | Bacteria | 8190 |
| 413 | Ga0495674_0013302 | 3300047319 | Bacteria | 7738 |
| 414 | Ga0495674_0054532 | 3300047319 | Bacteria | 3510 |
| 415 | Ga0495672_0009667 | 3300047320 | Bacteria | 6957 |
| 416 | Ga0495672_0019647 | 3300047320 | Bacteria | 4453 |
| 417 | Ga0495672_0127572 | 3300047320 | Bacteria | 1343 |
| 418 | Ga0495676_0010445 | 3300047321 | Bacteria | 8419 |
| 419 | Ga0495680_0022933 | 3300047322 | Bacteria | 5197 |
| 420 | Ga0495683_0041969 | 3300047323 | Bacteria | 2307 |
| 421 | Ga0495677_0043449 | 3300047445 | Bacteria | 1647 |
| 422 | Ga0495673_0018620 | 3300047469 | Bacteria | 3496 |
| 423 | Ga0495673_0074042 | 3300047469 | Bacteria | 1426 |
| 424 | Ga0495681_0035271 | 3300047470 | Bacteria | 2485 |
| 425 | Ga0495684_0033409 | 3300047471 | Bacteria | 3945 |
| 426 | Ga0495686_0021325 | 3300047472 | Bacteria | 4305 |
| 427 | Ga0495593_0000528 | 3300047673 | Bacteria | 21651 |
| 428 | Ga0495593_0036929 | 3300047673 | Bacteria | 2646 |
| 429 | Ga0495602_0007377 | 3300048088 | Bacteria | 11510 |
| 430 | Ga0495614_0050477 | 3300048089 | Bacteria | 1782 |
| 431 | Ga0495626_0017930 | 3300048091 | Bacteria | 3568 |
| 432 | Ga0496100_0002123 | 3300048903 | Bacteria | 9986 |
| 433 | Ga0496101_0005702 | 3300048904 | Bacteria | 7949 |
| 434 | Ga0496101_0059996 | 3300048904 | Bacteria | 2759 |
| 435 | Ga0496102_0061372 | 3300048905 | Bacteria | 3441 |
| 436 | Ga0496104_0060715 | 3300048907 | Bacteria | 3581 |
| 437 | Ga0496104_0284485 | 3300048907 | Bacteria | 1566 |
| 438 | Ga0496104_0293418 | 3300048907 | Bacteria | 1539 |
| 439 | Ga0496105_0012761 | 3300048908 | Bacteria | 6655 |
| 440 | Ga0496105_0182314 | 3300048908 | Bacteria | 1719 |
| 441 | Ga0496106_0006589 | 3300048909 | Bacteria | 8599 |
| 442 | Ga0496107_0010201 | 3300048910 | Bacteria | 6517 |
| 443 | Ga0496107_0055041 | 3300048910 | Bacteria | 2873 |
| 444 | Ga0496108_0010882 | 3300048911 | Bacteria | 7387 |
| 445 | Ga0496108_0011998 | 3300048911 | Bacteria | 7050 |
| 446 | Ga0496108_0017785 | 3300048911 | Bacteria | 5813 |
| 447 | Ga0496108_0031856 | 3300048911 | Bacteria | 4376 |
| 448 | Ga0496108_0115205 | 3300048911 | Bacteria | 2302 |
| 449 | Ga0496109_0007508 | 3300048912 | Bacteria | 9236 |
| 450 | Ga0496109_0286927 | 3300048912 | Bacteria | 1551 |
| 451 | Ga0496109_0357398 | 3300048912 | Bacteria | 1380 |
| 452 | Ga0496110_0001095 | 3300048913 | Bacteria | 19091 |
| 453 | Ga0496110_0037220 | 3300048913 | Bacteria | 4229 |
| 454 | Ga0496110_0039890 | 3300048913 | Bacteria | 4091 |
| 455 | Ga0496110_0049007 | 3300048913 | Bacteria | 3704 |
| 456 | Ga0496110_0251208 | 3300048913 | Bacteria | 1609 |
| 457 | Ga0496111_0001472 | 3300048914 | Bacteria | 13471 |
| 458 | Ga0496111_0079122 | 3300048914 | Bacteria | 2398 |
| 459 | Ga0496111_0080545 | 3300048914 | Bacteria | 2376 |
| 460 | Ga0496112_0046812 | 3300048915 | Bacteria | 4243 |
| 461 | Ga0496112_0051047 | 3300048915 | Bacteria | 4056 |
| 462 | Ga0496112_0146865 | 3300048915 | Bacteria | 2326 |
| 463 | Ga0496113_0001276 | 3300048916 | Bacteria | 13885 |
| 464 | Ga0496114_0011061 | 3300048917 | Bacteria | 7200 |
| 465 | Ga0496115_0021422 | 3300048918 | Bacteria | 4994 |
| 466 | Ga0496116_0001237 | 3300048919 | Bacteria | 29731 |
| 467 | Ga0496117_0074138 | 3300048920 | Bacteria | 2267 |
| 468 | Ga0496118_0012577 | 3300048921 | Bacteria | 8105 |
| 469 | Ga0496119_0066612 | 3300048922 | Bacteria | 2127 |
| 470 | Ga0496121_0006301 | 3300048924 | Bacteria | 14827 |
| 471 | Ga0495682_0012406 | 3300049460 | Bacteria | 3266 |
| 472 | Ga0501032_0028543 | 3300049569 | Bacteria | 3834 |
| 473 | Ga0501033_0001708 | 3300049570 | Bacteria | 19234 |
| 474 | Ga0501033_0042763 | 3300049570 | Bacteria | 3377 |
| 475 | Ga0501036_0009386 | 3300049572 | Bacteria | 8049 |
| 476 | Ga0501036_0314050 | 3300049572 | Bacteria | 1310 |
| 477 | Ga0501037_0001314 | 3300049573 | Bacteria | 18266 |
| 478 | Ga0501037_0079120 | 3300049573 | Bacteria | 2386 |
| 479 | Ga0501038_0046432 | 3300049574 | Bacteria | 3766 |
| 480 | Ga0501039_0006086 | 3300049575 | Bacteria | 9159 |
| 481 | Ga0501039_0118198 | 3300049575 | Bacteria | 2076 |
| 482 | Ga0501039_0125229 | 3300049575 | Bacteria | 2015 |
| 483 | Ga0501039_0163193 | 3300049575 | Bacteria | 1752 |
| 484 | Ga0501040_0003605 | 3300049576 | Bacteria | 10012 |
| 485 | Ga0501040_0009154 | 3300049576 | Bacteria | 6448 |
| 486 | Ga0501040_0011458 | 3300049576 | Bacteria | 5807 |
| 487 | Ga0501040_0079452 | 3300049576 | Bacteria | 2271 |
| 488 | Ga0501041_0001288 | 3300049577 | Bacteria | 13799 |
| 489 | Ga0501041_0012729 | 3300049577 | Bacteria | 4984 |
| 490 | Ga0501041_0016454 | 3300049577 | Bacteria | 4397 |
| 491 | Ga0501041_0058350 | 3300049577 | Bacteria | 2361 |
| 492 | Ga0501041_0098675 | 3300049577 | Bacteria | 1807 |
| 493 | Ga0501042_0000799 | 3300049578 | Bacteria | 17298 |
| 494 | Ga0501046_0022852 | 3300049580 | Bacteria | 5151 |
| 495 | Ga0501046_0026776 | 3300049580 | Bacteria | 4709 |
| 496 | Ga0501046_0060113 | 3300049580 | Unclassified | 2975 |
| 497 | Ga0501048_0020290 | 3300049582 | Bacteria | 4871 |
| 498 | Ga0501048_0050623 | 3300049582 | Bacteria | 2958 |
| 499 | Ga0501048_0154829 | 3300049582 | Bacteria | 1621 |
| 500 | Ga0501068_0065901 | 3300049584 | Bacteria | 2205 |
| 501 | Ga0501069_0114602 | 3300049585 | Bacteria | 1537 |
| 502 | Ga0501070_0058814 | 3300049586 | Bacteria | 3186 |
| 503 | Ga0501071_0002341 | 3300049587 | Bacteria | 11452 |
| 504 | Ga0501071_0229415 | 3300049587 | Archaea | 1398 |
| 505 | Ga0501072_0001227 | 3300049588 | Bacteria | 19141 |
| 506 | Ga0501072_0021401 | 3300049588 | Bacteria | 5015 |
| 507 | Ga0501072_0095755 | 3300049588 | Bacteria | 2359 |
| 508 | Ga0501073_0033068 | 3300049589 | Bacteria | 3685 |
| 509 | Ga0501074_0037785 | 3300049590 | Bacteria | 3499 |
| 510 | Ga0501074_0061054 | 3300049590 | Bacteria | 2716 |
| 511 | Ga0501075_0000698 | 3300049591 | Bacteria | 20803 |
| 512 | Ga0501075_0022199 | 3300049591 | Bacteria | 4633 |
| 513 | Ga0501075_0029363 | 3300049591 | Bacteria | 4066 |
| 514 | Ga0501075_0059515 | 3300049591 | Bacteria | 2877 |
| 515 | Ga0501075_0134965 | 3300049591 | Bacteria | 1880 |
| 516 | Ga0501076_0000465 | 3300049592 | Bacteria | 25590 |
| 517 | Ga0501076_0108653 | 3300049592 | Archaea | 2240 |
| 518 | Ga0501076_0137790 | 3300049592 | Bacteria | 1982 |
| 519 | Ga0501077_0002091 | 3300049593 | Bacteria | 12037 |
| 520 | Ga0501077_0024598 | 3300049593 | Bacteria | 3825 |
| 521 | Ga0501077_0310846 | 3300049593 | Archaea | 1004 |
| 522 | Ga0501079_0001622 | 3300049741 | Bacteria | 16031 |
| 523 | Ga0501079_0154495 | 3300049741 | Bacteria | 1789 |
| 524 | Ga0501079_0238372 | 3300049741 | Bacteria | 1421 |
| 525 | Ga0501080_0083944 | 3300049742 | Bacteria | 2959 |
| 526 | Ga0501080_0166842 | 3300049742 | Archaea | 2031 |
| 527 | Ga0501081_0000363 | 3300049743 | Bacteria | 24680 |
| 528 | Ga0501081_0014018 | 3300049743 | Bacteria | 5279 |
| 529 | Ga0501081_0064892 | 3300049743 | Bacteria | 2537 |
| 530 | Ga0501081_0083913 | 3300049743 | Bacteria | 2234 |
| 531 | Ga0501081_0127867 | 3300049743 | Bacteria | 1813 |
| 532 | Ga0501035_0042891 | 3300049822 | Bacteria | 4078 |
| 533 | Ga0501045_0002485 | 3300049824 | Bacteria | 12545 |
| 534 | Ga0501045_0012143 | 3300049824 | Bacteria | 6063 |
| 535 | Ga0501045_0040523 | 3300049824 | Bacteria | 3388 |
| 536 | Ga0501045_0354643 | 3300049824 | Bacteria | 1092 |
| 537 | nmdc:mga03683_21704_c1 | 3300050489 | Bacteria | 2480 |
| 538 | nmdc:mga03n38_23306_c1 | 3300050490 | Bacteria | 2516 |
| 539 | nmdc:mga00v17_3088_c1 | 3300050491 | Bacteria | 8562 |
| 540 | nmdc:mga0yw44_40669_c1 | 3300050492 | Bacteria | 2764 |
| 541 | nmdc:mga05p37_17006_c1 | 3300050507 | Bacteria | 8772 |
| 542 | nmdc:mga05p37_73659_c1 | 3300050507 | Bacteria | 4203 |
| 543 | nmdc:mga09592_3890_c1 | 3300050508 | Bacteria | 12030 |
| 544 | nmdc:mga0qj67_163641_c1 | 3300050509 | Bacteria | 1806 |
| 545 | nmdc:mga0qj67_167236_c1 | 3300050509 | Bacteria | 1785 |
| 546 | nmdc:mga0qj67_22527_c1 | 3300050509 | Bacteria | 4839 |
| 547 | nmdc:mga0qj67_47960_c1 | 3300050509 | Bacteria | 3375 |
| 548 | nmdc:mga0qj67_70381_c1 | 3300050509 | Bacteria | 2790 |
| 549 | nmdc:mga06r32_44627_c1 | 3300050510 | Bacteria | 4221 |
| 550 | nmdc:mga06r32_62142_c1 | 3300050510 | Bacteria | 3597 |
| 551 | nmdc:mga06r32_8319_c1 | 3300050510 | Bacteria | 9338 |
| 552 | nmdc:mga08y16_25744_c1 | 3300050511 | Bacteria | 6208 |
| 553 | nmdc:mga08y16_4703_c1 | 3300050511 | Bacteria | 14229 |
| 554 | nmdc:mga08y16_93352_c1 | 3300050511 | Bacteria | 3135 |
| 555 | nmdc:mga0n895_299917_c1 | 3300050512 | Bacteria | 1629 |
| 556 | nmdc:mga0n895_3827_c1 | 3300050512 | Bacteria | 12204 |
| 557 | nmdc:mga0n895_580382_c1 | 3300050512 | Bacteria | 1125 |
| 558 | nmdc:mga0rr50_107951_c1 | 3300050513 | Bacteria | 2198 |
| 559 | nmdc:mga0rr50_161528_c1 | 3300050513 | Bacteria | 1819 |
| 560 | nmdc:mga0rr50_78599_c1 | 3300050513 | Bacteria | 2539 |
| 561 | nmdc:mga08x19_100064_c1 | 3300050514 | Bacteria | 1923 |
| 562 | nmdc:mga08x19_171247_c1 | 3300050514 | Bacteria | 1479 |
| 563 | nmdc:mga08x19_23272_c1 | 3300050514 | Bacteria | 3843 |
| 564 | nmdc:mga08x19_321_c1 | 3300050514 | Bacteria | 34664 |
| 565 | nmdc:mga08x19_61459_c1 | 3300050514 | Archaea | 2434 |
| 566 | nmdc:mga0a205_13403_c1 | 3300050515 | Bacteria | 7633 |
| 567 | nmdc:mga0a205_41263_c1 | 3300050515 | Bacteria | 4443 |
| 568 | nmdc:mga0a205_9450_c1 | 3300050515 | Bacteria | 8916 |
| 569 | nmdc:mga0sz30_27391_c1 | 3300050516 | Bacteria | 2341 |
| 570 | Ga0495601_0017195 | 3300053077 | Bacteria | 4389 |
| 571 | Ga0495601_0051092 | 3300053077 | Bacteria | 2609 |
| 572 | Ga0495612_0030840 | 3300053078 | Bacteria | 2160 |
| 573 | Ga0495595_0006392 | 3300053084 | Bacteria | 4803 |
| 574 | Ga0495619_0032747 | 3300053085 | Bacteria | 3373 |
| 575 | Ga0495619_0059078 | 3300053085 | Bacteria | 2547 |
| 576 | Ga0500578_0003225 | 3300053086 | Bacteria | 12433 |
| 577 | Ga0500651_0003755 | 3300053093 | Bacteria | 8372 |
| 578 | Ga0500595_013600 | 3300053119 | Bacteria | 3114 |
| 579 | Ga0500573_0001628 | 3300053140 | Bacteria | 10869 |
| 580 | Ga0500622_0000707 | 3300053156 | Bacteria | 29296 |
| 581 | Ga0500637_0003093 | 3300053178 | Bacteria | 7590 |
| 582 | Ga0500637_0008132 | 3300053178 | Bacteria | 5278 |
| 583 | Ga0500637_0045982 | 3300053178 | Bacteria | 2477 |
| 584 | Ga0500611_003477 | 3300053727 | Bacteria | 2022 |
| 585 | Ga0500645_006631 | 3300053730 | Bacteria | 4106 |
| 586 | Ga0500596_001246 | 3300053735 | Bacteria | 5155 |
| 587 | Ga0501084_0003976 | 3300054114 | Bacteria | 12041 |
| 588 | Ga0501084_0042090 | 3300054114 | Bacteria | 3820 |
| 589 | Ga0501084_0057390 | 3300054114 | Bacteria | 3258 |
| 590 | Ga0501082_0005061 | 3300060353 | Bacteria | 11490 |
| 591 | Ga0501082_0013216 | 3300060353 | Bacteria | 7100 |
| 592 | Ga0501082_0067865 | 3300060353 | Bacteria | 3071 |
| 593 | Ga0501082_0186388 | 3300060353 | Bacteria | 1806 |
| 594 | Ga0530510_0000311 | 3300061734 | Bacteria | 31154 |
| 595 | Ga0530510_0022605 | 3300061734 | Bacteria | 4480 |
| 596 | Ga0530510_0032902 | 3300061734 | Bacteria | 3731 |
| 597 | Ga0530510_0092520 | 3300061734 | Bacteria | 2207 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046512 | Ga0495610_0005881 | Ga0495610_0005881_7262_8137 | 275 |
| 2 | 3300017792 | Ga0163161_10129105 | Ga0163161_101291051 | 278 |
| 3 | 3300046683 | Ga0495658_0275500 | Ga0495658_0275500_44_883 | 279 |
| 4 | 3300035725 | Ga0373947_0167412 | Ga0373947_0167412_530_1390 | 283 |
| 5 | 3300044684 | Ga0466966_0051894 | Ga0466966_0051894_1670_2581 | 283 |
| 6 | 3300046517 | Ga0495630_0214894 | Ga0495630_0214894_15_875 | 283 |
| 7 | 3300049743 | Ga0501081_0064892 | Ga0501081_0064892_15_866 | 283 |
| 8 | 3300049741 | Ga0501079_0154495 | Ga0501079_0154495_868_1779 | 288 |
| 9 | 3300006847 | Ga0075431_100033281 | Ga0075431_1000332814 | 293 |
| 10 | 3300006846 | Ga0075430_100028740 | Ga0075430_1000287402 | 296 |
| 11 | 3300050509 | nmdc:mga0qj67_163641_c1 | nmdc:mga0qj67_163641_c1_804_1781 | 296 |
| 12 | 3300014745 | Ga0157377_10069610 | Ga0157377_100696102 | 304 |
| 13 | iso_pu_bacteria | 2935694250 | 2935702570 | 305 |
| 14 | 3300046455 | Ga0495603_0000241 | Ga0495603_0000241_16766_17746 | 308 |
| 15 | 3300046457 | Ga0495590_0010344 | Ga0495590_0010344_1434_2414 | 308 |
| 16 | 3300046472 | Ga0495580_0014199 | Ga0495580_0014199_1418_2398 | 308 |
| 17 | 3300046474 | Ga0495605_0003442 | Ga0495605_0003442_5905_6885 | 308 |
| 18 | 3300046513 | Ga0495616_0005920 | Ga0495616_0005920_2437_3417 | 308 |
| 19 | 3300046528 | Ga0495642_0024857 | Ga0495642_0024857_311_1291 | 308 |
| 20 | 3300046557 | Ga0495622_0003834 | Ga0495622_0003834_2679_3659 | 308 |
| 21 | 3300047319 | Ga0495674_0054532 | Ga0495674_0054532_32_1012 | 308 |
| 22 | 3300047320 | Ga0495672_0019647 | Ga0495672_0019647_1485_2465 | 308 |
| 23 | 3300047469 | Ga0495673_0018620 | Ga0495673_0018620_79_1059 | 308 |
| 24 | 3300048091 | Ga0495626_0017930 | Ga0495626_0017930_684_1664 | 308 |
| 25 | 3300048903 | Ga0496100_0002123 | Ga0496100_0002123_5927_6907 | 308 |
| 26 | 3300048904 | Ga0496101_0005702 | Ga0496101_0005702_5361_6341 | 308 |
| 27 | 3300048907 | Ga0496104_0060715 | Ga0496104_0060715_1442_2422 | 308 |
| 28 | 3300048908 | Ga0496105_0012761 | Ga0496105_0012761_3215_4195 | 308 |
| 29 | 3300048915 | Ga0496112_0051047 | Ga0496112_0051047_666_1646 | 308 |
| 30 | 3300048916 | Ga0496113_0001276 | Ga0496113_0001276_10771_11751 | 308 |
| 31 | 3300048918 | Ga0496115_0021422 | Ga0496115_0021422_3175_4155 | 308 |
| 32 | 3300048922 | Ga0496119_0066612 | Ga0496119_0066612_445_1425 | 308 |
| 33 | 3300048924 | Ga0496121_0006301 | Ga0496121_0006301_8476_9456 | 308 |
| 34 | 3300049460 | Ga0495682_0012406 | Ga0495682_0012406_969_1949 | 308 |
| 35 | 3300009553 | Ga0105249_10238865 | Ga0105249_102388653 | 309 |
| 36 | 3300013297 | Ga0157378_10022897 | Ga0157378_100228972 | 309 |
| 37 | 3300005440 | Ga0070705_100120875 | Ga0070705_1001208752 | 310 |
| 38 | 3300048920 | Ga0496117_0074138 | Ga0496117_0074138_734_1714 | 311 |
| 39 | 3300048921 | Ga0496118_0012577 | Ga0496118_0012577_6944_7924 | 311 |
| 40 | 3300049824 | Ga0501045_0354643 | Ga0501045_0354643_56_1036 | 314 |
| 41 | 3300005438 | Ga0070701_10070545 | Ga0070701_100705452 | 315 |
| 42 | 3300032002 | Ga0307416_100121656 | Ga0307416_1001216562 | 315 |
| 43 | 3300039447 | Ga0436361_0424425 | Ga0436361_0424425_6968_7948 | 315 |
| 44 | 3300049591 | Ga0501075_0059515 | Ga0501075_0059515_1023_2003 | 315 |
| 45 | 3300049741 | Ga0501079_0238372 | Ga0501079_0238372_14_961 | 315 |
| 46 | 3300053727 | Ga0500611_003477 | Ga0500611_003477_605_1621 | 315 |
| 47 | 3300053730 | Ga0500645_006631 | Ga0500645_006631_1428_2444 | 315 |
| 48 | 3300037418 | Ga0395900_0151827 | Ga0395900_0151827_230_1213 | 316 |
| 49 | 3300047317 | Ga0495604_0000337 | Ga0495604_0000337_4458_5438 | 317 |
| 50 | 3300047322 | Ga0495680_0022933 | Ga0495680_0022933_625_1605 | 317 |
| 51 | 3300048088 | Ga0495602_0007377 | Ga0495602_0007377_6439_7419 | 317 |
| 52 | 3300006038 | Ga0075365_10019003 | Ga0075365_100190034 | 319 |
| 53 | 3300006048 | Ga0075363_100050571 | Ga0075363_1000505712 | 319 |
| 54 | 3300006051 | Ga0075364_10016546 | Ga0075364_100165466 | 319 |
| 55 | 3300006177 | Ga0075362_10029092 | Ga0075362_100290922 | 319 |
| 56 | 3300006186 | Ga0075369_10003788 | Ga0075369_100037886 | 319 |
| 57 | 3300006844 | Ga0075428_100020350 | Ga0075428_1000203504 | 319 |
| 58 | 3300050489 | nmdc:mga03683_21704_c1 | nmdc:mga03683_21704_c1_427_1407 | 319 |
| 59 | 3300050490 | nmdc:mga03n38_23306_c1 | nmdc:mga03n38_23306_c1_1214_2194 | 319 |
| 60 | 3300050491 | nmdc:mga00v17_3088_c1 | nmdc:mga00v17_3088_c1_4504_5484 | 319 |
| 61 | 3300050492 | nmdc:mga0yw44_40669_c1 | nmdc:mga0yw44_40669_c1_1406_2386 | 319 |
| 62 | 3300050516 | nmdc:mga0sz30_27391_c1 | nmdc:mga0sz30_27391_c1_11_991 | 319 |
| 63 | 3300047320 | Ga0495672_0127572 | Ga0495672_0127572_122_1084 | 320 |
| 64 | 3300047472 | Ga0495686_0021325 | Ga0495686_0021325_2164_3126 | 320 |
| 65 | 3300053156 | Ga0500622_0000707 | Ga0500622_0000707_5180_6142 | 320 |
| 66 | 3300005458 | Ga0070681_10001662 | Ga0070681_1000166215 | 321 |
| 67 | 3300005530 | Ga0070679_100002816 | Ga0070679_1000028168 | 321 |
| 68 | 3300025921 | Ga0207652_10006706 | Ga0207652_100067062 | 321 |
| 69 | 3300031507 | Ga0307509_10005263 | Ga0307509_100052638 | 321 |
| 70 | 3300046460 | Ga0495638_0002250 | Ga0495638_0002250_10511_11476 | 321 |
| 71 | 3300048913 | Ga0496110_0039890 | Ga0496110_0039890_2088_3053 | 321 |
| 72 | 3300049589 | Ga0501073_0033068 | Ga0501073_0033068_14_979 | 321 |
| 73 | 3300050512 | nmdc:mga0n895_580382_c1 | nmdc:mga0n895_580382_c1_13_978 | 321 |
| 74 | iso_pu_bacteria | 2512047030 | 2512352556 | 321 |
| 75 | iso_pu_bacteria | 2513237165 | 2514042860 | 321 |
| 76 | iso_pu_bacteria | 2858688981 | 2858693598 | 321 |
| 77 | iso_pu_bacteria | 644736347 | 644752020 | 321 |
| 78 | iso_pu_bacteria | 2513237082 | 2513557211 | 322 |
| 79 | iso_pu_bacteria | 2513237083 | 2513562813 | 322 |
| 80 | iso_pu_bacteria | 2513237094 | 2513644208 | 322 |
| 81 | iso_pu_bacteria | 2513237101 | 2513691630 | 322 |
| 82 | iso_pu_bacteria | 2513237137 | 2513862026 | 322 |
| 83 | iso_pu_bacteria | 2513237166 | 2514051323 | 322 |
| 84 | iso_pu_bacteria | 2515154122 | 2515681425 | 322 |
| 85 | iso_pu_bacteria | 2515154123 | 2515689728 | 322 |
| 86 | iso_pu_bacteria | 2515154189 | 2516025244 | 322 |
| 87 | iso_pu_bacteria | 2517572143 | 2517893798 | 322 |
| 88 | iso_pu_bacteria | 2562617112 | 2563060709 | 322 |
| 89 | iso_pu_bacteria | 2667528175 | 2671124114 | 322 |
| 90 | iso_pu_bacteria | 2711768613 | 2713475890 | 322 |
| 91 | iso_pu_bacteria | 2721755755 | 2723845948 | 322 |
| 92 | iso_pu_bacteria | 2728368998 | 2728752940 | 322 |
| 93 | iso_pu_bacteria | 2744054900 | 2746087557 | 322 |
| 94 | iso_pu_bacteria | 2744054901 | 2746095919 | 322 |
| 95 | iso_pu_bacteria | 2791355137 | 2792837097 | 322 |
| 96 | iso_pu_bacteria | 2818991450 | 2819621158 | 322 |
| 97 | iso_pu_bacteria | 2876761206 | 2876770785 | 322 |
| 98 | iso_pu_bacteria | 2876808645 | 2876813228 | 322 |
| 99 | iso_pu_bacteria | 2879110137 | 2879110387 | 322 |
| 100 | iso_pu_bacteria | 2885270888 | 2885275843 | 322 |
| 101 | iso_pu_bacteria | 2885374607 | 2885376258 | 322 |
| 102 | iso_pu_bacteria | 2889033259 | 2889040810 | 322 |
| 103 | iso_pu_bacteria | 2902682994 | 2902686126 | 322 |
| 104 | iso_pu_bacteria | 2904615490 | 2904620155 | 322 |
| 105 | iso_pu_bacteria | 2906626472 | 2906628720 | 322 |
| 106 | iso_pu_bacteria | 2906635258 | 2906641245 | 322 |
| 107 | iso_pu_bacteria | 2906660503 | 2906665175 | 322 |
| 108 | iso_pu_bacteria | 2928108538 | 2928114657 | 322 |
| 109 | iso_pu_bacteria | 2928135762 | 2928142159 | 322 |
| 110 | iso_pu_bacteria | 2928503688 | 2928510043 | 322 |
| 111 | iso_pu_bacteria | 2935630451 | 2935634611 | 322 |
| 112 | iso_pu_bacteria | 2935675223 | 2935680223 | 322 |
| 113 | iso_pu_bacteria | 2935684952 | 2935693715 | 322 |
| 114 | iso_pu_bacteria | 2935694250 | 2935700775 | 322 |
| 115 | iso_pu_bacteria | 2935713505 | 2935722412 | 322 |
| 116 | iso_pu_bacteria | 2935722832 | 2935731721 | 322 |
| 117 | iso_pu_bacteria | 2935732158 | 2935740930 | 322 |
| 118 | iso_pu_bacteria | 2935741537 | 2935750367 | 322 |
| 119 | iso_pu_bacteria | 2935750917 | 2935759900 | 322 |
| 120 | iso_pu_bacteria | 2935760218 | 2935768734 | 322 |
| 121 | iso_pu_bacteria | 2935785616 | 2935788637 | 322 |
| 122 | iso_pu_bacteria | 2935793552 | 2935795737 | 322 |
| 123 | iso_pu_bacteria | 2940556831 | 2940565805 | 322 |
| 124 | iso_pu_bacteria | 2941507105 | 2941509097 | 322 |
| 125 | iso_pu_bacteria | 2941515067 | 2941516926 | 322 |
| 126 | iso_pu_bacteria | 2941523033 | 2941524979 | 322 |
| 127 | iso_pu_bacteria | 3005474847 | 3005478770 | 322 |
| 128 | iso_pu_bacteria | 3005483717 | 3005489898 | 322 |
| 129 | iso_pu_bacteria | 642555112 | 642597779 | 322 |
| 130 | iso_pu_bacteria | 8002060224 | 8002061594 | 322 |
| 131 | iso_pu_bacteria | 8003955200 | 8003955984 | 322 |
| 132 | iso_pu_bacteria | 8006964411 | 8006968734 | 322 |
| 133 | iso_pu_bacteria | 8006994254 | 8006996278 | 322 |
| 134 | iso_pu_bacteria | 8016583857 | 8016592819 | 322 |
| 135 | iso_pu_bacteria | 8019565922 | 8019566956 | 322 |
| 136 | iso_pu_bacteria | 8019648815 | 8019654670 | 322 |
| 137 | iso_pu_bacteria | 8019648815 | 8019657248 | 322 |
| 138 | 3300009094 | Ga0111539_10035004 | Ga0111539_100350046 | 323 |
| 139 | 3300009093 | Ga0105240_10324452 | Ga0105240_103244522 | 324 |
| 140 | 3300003187 | JGI25151J46595_10047976 | JGI25151J46595_100479762 | 325 |
| 141 | 3300005549 | Ga0070704_100226032 | Ga0070704_1002260322 | 325 |
| 142 | 3300006844 | Ga0075428_100215838 | Ga0075428_1002158382 | 325 |
| 143 | 3300006948 | Ga0099826_10107849 | Ga0099826_101078492 | 325 |
| 144 | 3300025294 | Ga0209025_1000151 | Ga0209025_100015112 | 325 |
| 145 | 3300028380 | Ga0268265_10151082 | Ga0268265_101510822 | 325 |
| 146 | 3300035398 | Ga0316574_0031643 | Ga0316574_0031643_2058_3035 | 325 |
| 147 | 3300035398 | Ga0316574_0062525 | Ga0316574_0062525_149_1126 | 325 |
| 148 | 3300042131 | Ga0450894_014072 | Ga0450894_014072_53_1030 | 325 |
| 149 | 3300047318 | Ga0495636_0001794 | Ga0495636_0001794_544_1521 | 325 |
| 150 | 3300048919 | Ga0496116_0001237 | Ga0496116_0001237_16803_17780 | 325 |
| 151 | 3300050509 | nmdc:mga0qj67_70381_c1 | nmdc:mga0qj67_70381_c1_976_1953 | 325 |
| 152 | 3300053178 | Ga0500637_0008132 | Ga0500637_0008132_10_987 | 325 |
| 153 | 3300003187 | JGI25151J46595_10000065 | JGI25151J46595_1000006539 | 326 |
| 154 | 3300003187 | JGI25151J46595_10003107 | JGI25151J46595_100031075 | 326 |
| 155 | 3300003203 | JGI25406J46586_10008960 | JGI25406J46586_100089603 | 326 |
| 156 | 3300003771 | Ga0055526_1008036 | Ga0055526_10080362 | 326 |
| 157 | 3300003771 | Ga0055526_1013999 | Ga0055526_10139992 | 326 |
| 158 | 3300003773 | Ga0055537_1000409 | Ga0055537_10004093 | 326 |
| 159 | 3300003775 | Ga0055524_1032463 | Ga0055524_10324632 | 326 |
| 160 | 3300003781 | Ga0055536_1000026 | Ga0055536_100002657 | 326 |
| 161 | 3300003784 | Ga0055534_1000189 | Ga0055534_100018940 | 326 |
| 162 | 3300003784 | Ga0055534_1001063 | Ga0055534_10010639 | 326 |
| 163 | 3300005293 | Ga0065715_10189389 | Ga0065715_101893892 | 326 |
| 164 | 3300005295 | Ga0065707_10081743 | Ga0065707_1008174328 | 326 |
| 165 | 3300005295 | Ga0065707_10088932 | Ga0065707_100889322 | 326 |
| 166 | 3300005327 | Ga0070658_10336468 | Ga0070658_103364682 | 326 |
| 167 | 3300005328 | Ga0070676_10095021 | Ga0070676_100950212 | 326 |
| 168 | 3300005328 | Ga0070676_10113826 | Ga0070676_101138262 | 326 |
| 169 | 3300005329 | Ga0070683_100214156 | Ga0070683_1002141562 | 326 |
| 170 | 3300005331 | Ga0070670_100036342 | Ga0070670_1000363423 | 326 |
| 171 | 3300005331 | Ga0070670_100176392 | Ga0070670_1001763922 | 326 |
| 172 | 3300005333 | Ga0070677_10008159 | Ga0070677_100081592 | 326 |
| 173 | 3300005333 | Ga0070677_10149203 | Ga0070677_101492031 | 326 |
| 174 | 3300005334 | Ga0068869_100068986 | Ga0068869_1000689862 | 326 |
| 175 | 3300005335 | Ga0070666_10327171 | Ga0070666_103271711 | 326 |
| 176 | 3300005336 | Ga0070680_100058077 | Ga0070680_1000580772 | 326 |
| 177 | 3300005337 | Ga0070682_100051074 | Ga0070682_1000510742 | 326 |
| 178 | 3300005338 | Ga0068868_100063251 | Ga0068868_1000632512 | 326 |
| 179 | 3300005338 | Ga0068868_100067312 | Ga0068868_1000673122 | 326 |
| 180 | 3300005340 | Ga0070689_100031371 | Ga0070689_1000313711 | 326 |
| 181 | 3300005344 | Ga0070661_100239470 | Ga0070661_1002394702 | 326 |
| 182 | 3300005347 | Ga0070668_100114662 | Ga0070668_1001146622 | 326 |
| 183 | 3300005354 | Ga0070675_100035799 | Ga0070675_1000357994 | 326 |
| 184 | 3300005354 | Ga0070675_100169265 | Ga0070675_1001692652 | 326 |
| 185 | 3300005355 | Ga0070671_100082708 | Ga0070671_1000827082 | 326 |
| 186 | 3300005355 | Ga0070671_100211394 | Ga0070671_1002113942 | 326 |
| 187 | 3300005364 | Ga0070673_100004595 | Ga0070673_1000045958 | 326 |
| 188 | 3300005367 | Ga0070667_100085213 | Ga0070667_1000852133 | 326 |
| 189 | 3300005367 | Ga0070667_100324048 | Ga0070667_1003240482 | 326 |
| 190 | 3300005434 | Ga0070709_10102714 | Ga0070709_101027142 | 326 |
| 191 | 3300005437 | Ga0070710_10119844 | Ga0070710_101198442 | 326 |
| 192 | 3300005438 | Ga0070701_10172778 | Ga0070701_101727781 | 326 |
| 193 | 3300005441 | Ga0070700_100046888 | Ga0070700_1000468883 | 326 |
| 194 | 3300005444 | Ga0070694_100119992 | Ga0070694_1001199922 | 326 |
| 195 | 3300005444 | Ga0070694_100207814 | Ga0070694_1002078141 | 326 |
| 196 | 3300005445 | Ga0070708_100102739 | Ga0070708_1001027392 | 326 |
| 197 | 3300005456 | Ga0070678_100007935 | Ga0070678_1000079354 | 326 |
| 198 | 3300005456 | Ga0070678_100051903 | Ga0070678_1000519032 | 326 |
| 199 | 3300005457 | Ga0070662_100060371 | Ga0070662_1000603713 | 326 |
| 200 | 3300005457 | Ga0070662_100091608 | Ga0070662_1000916082 | 326 |
| 201 | 3300005458 | Ga0070681_10002738 | Ga0070681_100027388 | 326 |
| 202 | 3300005458 | Ga0070681_10031983 | Ga0070681_100319831 | 326 |
| 203 | 3300005459 | Ga0068867_100031201 | Ga0068867_1000312013 | 326 |
| 204 | 3300005459 | Ga0068867_100034316 | Ga0068867_1000343162 | 326 |
| 205 | 3300005459 | Ga0068867_100128454 | Ga0068867_1001284542 | 326 |
| 206 | 3300005467 | Ga0070706_100193797 | Ga0070706_1001937971 | 326 |
| 207 | 3300005467 | Ga0070706_100497445 | Ga0070706_1004974451 | 326 |
| 208 | 3300005468 | Ga0070707_100190417 | Ga0070707_1001904172 | 326 |
| 209 | 3300005471 | Ga0070698_100173595 | Ga0070698_1001735952 | 326 |
| 210 | 3300005518 | Ga0070699_100006567 | Ga0070699_1000065675 | 326 |
| 211 | 3300005530 | Ga0070679_100010362 | Ga0070679_1000103622 | 326 |
| 212 | 3300005530 | Ga0070679_100067542 | Ga0070679_1000675422 | 326 |
| 213 | 3300005535 | Ga0070684_100011305 | Ga0070684_1000113054 | 326 |
| 214 | 3300005535 | Ga0070684_100229029 | Ga0070684_1002290292 | 326 |
| 215 | 3300005536 | Ga0070697_100040317 | Ga0070697_1000403176 | 326 |
| 216 | 3300005543 | Ga0070672_100009641 | Ga0070672_1000096414 | 326 |
| 217 | 3300005543 | Ga0070672_100041626 | Ga0070672_1000416264 | 326 |
| 218 | 3300005548 | Ga0070665_100262877 | Ga0070665_1002628772 | 326 |
| 219 | 3300005548 | Ga0070665_100425695 | Ga0070665_1004256951 | 326 |
| 220 | 3300005549 | Ga0070704_100077188 | Ga0070704_1000771882 | 326 |
| 221 | 3300005578 | Ga0068854_100010855 | Ga0068854_1000108556 | 326 |
| 222 | 3300005578 | Ga0068854_100144893 | Ga0068854_1001448932 | 326 |
| 223 | 3300005616 | Ga0068852_100006347 | Ga0068852_1000063476 | 326 |
| 224 | 3300005618 | Ga0068864_100075436 | Ga0068864_1000754363 | 326 |
| 225 | 3300005618 | Ga0068864_100078493 | Ga0068864_1000784933 | 326 |
| 226 | 3300005719 | Ga0068861_100050841 | Ga0068861_1000508413 | 326 |
| 227 | 3300005834 | Ga0068851_10037164 | Ga0068851_100371642 | 326 |
| 228 | 3300005841 | Ga0068863_100079248 | Ga0068863_1000792482 | 326 |
| 229 | 3300005842 | Ga0068858_100004871 | Ga0068858_1000048716 | 326 |
| 230 | 3300005937 | Ga0081455_10005009 | Ga0081455_100050094 | 326 |
| 231 | 3300005937 | Ga0081455_10036010 | Ga0081455_100360103 | 326 |
| 232 | 3300005981 | Ga0081538_10004387 | Ga0081538_100043876 | 326 |
| 233 | 3300005981 | Ga0081538_10014551 | Ga0081538_100145514 | 326 |
| 234 | 3300005985 | Ga0081539_10002801 | Ga0081539_1000280117 | 326 |
| 235 | 3300005985 | Ga0081539_10003064 | Ga0081539_100030644 | 326 |
| 236 | 3300005985 | Ga0081539_10101393 | Ga0081539_101013932 | 326 |
| 237 | 3300006028 | Ga0070717_10082141 | Ga0070717_100821413 | 326 |
| 238 | 3300006173 | Ga0070716_100015432 | Ga0070716_1000154325 | 326 |
| 239 | 3300006173 | Ga0070716_100097950 | Ga0070716_1000979502 | 326 |
| 240 | 3300006194 | Ga0075427_10001119 | Ga0075427_100011194 | 326 |
| 241 | 3300006237 | Ga0097621_100339638 | Ga0097621_1003396382 | 326 |
| 242 | 3300006844 | Ga0075428_100052854 | Ga0075428_1000528543 | 326 |
| 243 | 3300006844 | Ga0075428_100072604 | Ga0075428_1000726044 | 326 |
| 244 | 3300006846 | Ga0075430_100032363 | Ga0075430_1000323634 | 326 |
| 245 | 3300006846 | Ga0075430_100181989 | Ga0075430_1001819892 | 326 |
| 246 | 3300006847 | Ga0075431_100021479 | Ga0075431_1000214793 | 326 |
| 247 | 3300006847 | Ga0075431_100116384 | Ga0075431_1001163843 | 326 |
| 248 | 3300006852 | Ga0075433_10012098 | Ga0075433_100120985 | 326 |
| 249 | 3300006852 | Ga0075433_10020700 | Ga0075433_100207005 | 326 |
| 250 | 3300006852 | Ga0075433_10031177 | Ga0075433_100311773 | 326 |
| 251 | 3300006852 | Ga0075433_10174944 | Ga0075433_101749442 | 326 |
| 252 | 3300006871 | Ga0075434_100018418 | Ga0075434_1000184181 | 326 |
| 253 | 3300006871 | Ga0075434_100055127 | Ga0075434_1000551272 | 326 |
| 254 | 3300006871 | Ga0075434_100411858 | Ga0075434_1004118582 | 326 |
| 255 | 3300006880 | Ga0075429_100042525 | Ga0075429_1000425252 | 326 |
| 256 | 3300006914 | Ga0075436_100002502 | Ga0075436_1000025025 | 326 |
| 257 | 3300006914 | Ga0075436_100019613 | Ga0075436_1000196132 | 326 |
| 258 | 3300006914 | Ga0075436_100022926 | Ga0075436_1000229264 | 326 |
| 259 | 3300006914 | Ga0075436_100027978 | Ga0075436_1000279783 | 326 |
| 260 | 3300006914 | Ga0075436_100099586 | Ga0075436_1000995862 | 326 |
| 261 | 3300006914 | Ga0075436_100278844 | Ga0075436_1002788442 | 326 |
| 262 | 3300006931 | Ga0097620_100037630 | Ga0097620_1000376307 | 326 |
| 263 | 3300006942 | Ga0099824_1017890 | Ga0099824_10178904 | 326 |
| 264 | 3300006943 | Ga0099822_1006921 | Ga0099822_10069214 | 326 |
| 265 | 3300007076 | Ga0075435_100030773 | Ga0075435_1000307733 | 326 |
| 266 | 3300007076 | Ga0075435_100047136 | Ga0075435_1000471363 | 326 |
| 267 | 3300007076 | Ga0075435_100047201 | Ga0075435_1000472012 | 326 |
| 268 | 3300007076 | Ga0075435_100128197 | Ga0075435_1001281972 | 326 |
| 269 | 3300007788 | Ga0099795_10002286 | Ga0099795_100022862 | 326 |
| 270 | 3300009093 | Ga0105240_10013803 | Ga0105240_100138035 | 326 |
| 271 | 3300009093 | Ga0105240_10058445 | Ga0105240_100584452 | 326 |
| 272 | 3300009094 | Ga0111539_10050663 | Ga0111539_100506633 | 326 |
| 273 | 3300009094 | Ga0111539_10113991 | Ga0111539_101139913 | 326 |
| 274 | 3300009094 | Ga0111539_10458715 | Ga0111539_104587152 | 326 |
| 275 | 3300009098 | Ga0105245_10072584 | Ga0105245_100725842 | 326 |
| 276 | 3300009098 | Ga0105245_10306358 | Ga0105245_103063582 | 326 |
| 277 | 3300009147 | Ga0114129_10148278 | Ga0114129_101482783 | 326 |
| 278 | 3300009147 | Ga0114129_10547344 | Ga0114129_105473441 | 326 |
| 279 | 3300009147 | Ga0114129_10739995 | Ga0114129_107399952 | 326 |
| 280 | 3300009176 | Ga0105242_10047961 | Ga0105242_100479614 | 326 |
| 281 | 3300009177 | Ga0105248_10020155 | Ga0105248_100201554 | 326 |
| 282 | 3300009553 | Ga0105249_10050501 | Ga0105249_100505013 | 326 |
| 283 | 3300013100 | Ga0157373_10117512 | Ga0157373_101175122 | 326 |
| 284 | 3300013102 | Ga0157371_10116951 | Ga0157371_101169512 | 326 |
| 285 | 3300013105 | Ga0157369_10001094 | Ga0157369_1000109411 | 326 |
| 286 | 3300013105 | Ga0157369_10007378 | Ga0157369_1000737811 | 326 |
| 287 | 3300013296 | Ga0157374_10047438 | Ga0157374_100474382 | 326 |
| 288 | 3300013297 | Ga0157378_10028936 | Ga0157378_100289362 | 326 |
| 289 | 3300013297 | Ga0157378_10293647 | Ga0157378_102936472 | 326 |
| 290 | 3300013306 | Ga0163162_10087235 | Ga0163162_100872352 | 326 |
| 291 | 3300013306 | Ga0163162_10147926 | Ga0163162_101479262 | 326 |
| 292 | 3300013307 | Ga0157372_10075500 | Ga0157372_100755002 | 326 |
| 293 | 3300013308 | Ga0157375_10001310 | Ga0157375_1000131017 | 326 |
| 294 | 3300013308 | Ga0157375_10033230 | Ga0157375_100332303 | 326 |
| 295 | 3300014326 | Ga0157380_10200110 | Ga0157380_102001102 | 326 |
| 296 | 3300014326 | Ga0157380_10296540 | Ga0157380_102965401 | 326 |
| 297 | 3300014745 | Ga0157377_10185971 | Ga0157377_101859712 | 326 |
| 298 | 3300014968 | Ga0157379_10071413 | Ga0157379_100714132 | 326 |
| 299 | 3300014968 | Ga0157379_10103235 | Ga0157379_101032351 | 326 |
| 300 | 3300014969 | Ga0157376_10137422 | Ga0157376_101374222 | 326 |
| 301 | 3300017792 | Ga0163161_10256479 | Ga0163161_102564792 | 326 |
| 302 | 3300020069 | Ga0197907_10631922 | Ga0197907_106319222 | 326 |
| 303 | 3300020070 | Ga0206356_10210458 | Ga0206356_102104582 | 326 |
| 304 | 3300020081 | Ga0206354_10271013 | Ga0206354_102710133 | 326 |
| 305 | 3300020081 | Ga0206354_10719210 | Ga0206354_107192102 | 326 |
| 306 | 3300020082 | Ga0206353_10311756 | Ga0206353_103117563 | 326 |
| 307 | 3300022467 | Ga0224712_10004229 | Ga0224712_100042292 | 326 |
| 308 | 3300025263 | Ga0209565_1000109 | Ga0209565_1000109110 | 326 |
| 309 | 3300025272 | Ga0209455_1021482 | Ga0209455_10214822 | 326 |
| 310 | 3300025291 | Ga0209675_1000026 | Ga0209675_1000026144 | 326 |
| 311 | 3300025291 | Ga0209675_1000118 | Ga0209675_10001183 | 326 |
| 312 | 3300025292 | Ga0209676_1000059 | Ga0209676_1000059161 | 326 |
| 313 | 3300025294 | Ga0209025_1000066 | Ga0209025_1000066168 | 326 |
| 314 | 3300025294 | Ga0209025_1000159 | Ga0209025_100015948 | 326 |
| 315 | 3300025295 | Ga0209564_1000084 | Ga0209564_100008415 | 326 |
| 316 | 3300025295 | Ga0209564_1000161 | Ga0209564_1000161137 | 326 |
| 317 | 3300025295 | Ga0209564_1001556 | Ga0209564_100155618 | 326 |
| 318 | 3300025299 | Ga0209256_1001890 | Ga0209256_100189016 | 326 |
| 319 | 3300025315 | Ga0207697_10018003 | Ga0207697_100180033 | 326 |
| 320 | 3300025893 | Ga0207682_10008773 | Ga0207682_100087733 | 326 |
| 321 | 3300025898 | Ga0207692_10094952 | Ga0207692_100949522 | 326 |
| 322 | 3300025901 | Ga0207688_10004632 | Ga0207688_100046322 | 326 |
| 323 | 3300025904 | Ga0207647_10126999 | Ga0207647_101269992 | 326 |
| 324 | 3300025905 | Ga0207685_10006267 | Ga0207685_100062672 | 326 |
| 325 | 3300025906 | Ga0207699_10181816 | Ga0207699_101818162 | 326 |
| 326 | 3300025907 | Ga0207645_10002333 | Ga0207645_100023336 | 326 |
| 327 | 3300025907 | Ga0207645_10134821 | Ga0207645_101348211 | 326 |
| 328 | 3300025910 | Ga0207684_10039044 | Ga0207684_100390442 | 326 |
| 329 | 3300025910 | Ga0207684_10270650 | Ga0207684_102706502 | 326 |
| 330 | 3300025911 | Ga0207654_10040560 | Ga0207654_100405602 | 326 |
| 331 | 3300025912 | Ga0207707_10000134 | Ga0207707_1000013461 | 326 |
| 332 | 3300025912 | Ga0207707_10055475 | Ga0207707_100554752 | 326 |
| 333 | 3300025912 | Ga0207707_10101528 | Ga0207707_101015282 | 326 |
| 334 | 3300025913 | Ga0207695_10265803 | Ga0207695_102658032 | 326 |
| 335 | 3300025914 | Ga0207671_10025879 | Ga0207671_100258792 | 326 |
| 336 | 3300025915 | Ga0207693_10022996 | Ga0207693_100229961 | 326 |
| 337 | 3300025915 | Ga0207693_10057630 | Ga0207693_100576302 | 326 |
| 338 | 3300025917 | Ga0207660_10019686 | Ga0207660_100196864 | 326 |
| 339 | 3300025920 | Ga0207649_10143883 | Ga0207649_101438831 | 326 |
| 340 | 3300025921 | Ga0207652_10004279 | Ga0207652_100042798 | 326 |
| 341 | 3300025922 | Ga0207646_10000871 | Ga0207646_1000087132 | 326 |
| 342 | 3300025922 | Ga0207646_10120736 | Ga0207646_101207362 | 326 |
| 343 | 3300025924 | Ga0207694_10223439 | Ga0207694_102234392 | 326 |
| 344 | 3300025925 | Ga0207650_10008552 | Ga0207650_100085525 | 326 |
| 345 | 3300025925 | Ga0207650_10028693 | Ga0207650_100286933 | 326 |
| 346 | 3300025925 | Ga0207650_10102605 | Ga0207650_101026052 | 326 |
| 347 | 3300025926 | Ga0207659_10020113 | Ga0207659_100201133 | 326 |
| 348 | 3300025926 | Ga0207659_10096357 | Ga0207659_100963572 | 326 |
| 349 | 3300025926 | Ga0207659_10115344 | Ga0207659_101153442 | 326 |
| 350 | 3300025927 | Ga0207687_10148559 | Ga0207687_101485592 | 326 |
| 351 | 3300025928 | Ga0207700_10049199 | Ga0207700_100491992 | 326 |
| 352 | 3300025929 | Ga0207664_10256998 | Ga0207664_102569981 | 326 |
| 353 | 3300025931 | Ga0207644_10043577 | Ga0207644_100435774 | 326 |
| 354 | 3300025931 | Ga0207644_10224566 | Ga0207644_102245661 | 326 |
| 355 | 3300025933 | Ga0207706_10199561 | Ga0207706_101995612 | 326 |
| 356 | 3300025939 | Ga0207665_10023706 | Ga0207665_100237064 | 326 |
| 357 | 3300025939 | Ga0207665_10129795 | Ga0207665_101297952 | 326 |
| 358 | 3300025940 | Ga0207691_10006472 | Ga0207691_100064728 | 326 |
| 359 | 3300025940 | Ga0207691_10007344 | Ga0207691_100073443 | 326 |
| 360 | 3300025940 | Ga0207691_10021556 | Ga0207691_100215564 | 326 |
| 361 | 3300025941 | Ga0207711_10025736 | Ga0207711_100257364 | 326 |
| 362 | 3300025942 | Ga0207689_10084180 | Ga0207689_100841802 | 326 |
| 363 | 3300025944 | Ga0207661_10012138 | Ga0207661_100121385 | 326 |
| 364 | 3300025944 | Ga0207661_10198554 | Ga0207661_101985541 | 326 |
| 365 | 3300025960 | Ga0207651_10005561 | Ga0207651_100055616 | 326 |
| 366 | 3300025972 | Ga0207668_10334374 | Ga0207668_103343741 | 326 |
| 367 | 3300025981 | Ga0207640_10055551 | Ga0207640_100555513 | 326 |
| 368 | 3300025986 | Ga0207658_10083313 | Ga0207658_100833132 | 326 |
| 369 | 3300026023 | Ga0207677_10026177 | Ga0207677_100261773 | 326 |
| 370 | 3300026035 | Ga0207703_10122975 | Ga0207703_101229752 | 326 |
| 371 | 3300026075 | Ga0207708_10019988 | Ga0207708_100199884 | 326 |
| 372 | 3300026088 | Ga0207641_10065182 | Ga0207641_100651822 | 326 |
| 373 | 3300026088 | Ga0207641_10097736 | Ga0207641_100977362 | 326 |
| 374 | 3300026089 | Ga0207648_10015932 | Ga0207648_100159324 | 326 |
| 375 | 3300026089 | Ga0207648_10028060 | Ga0207648_100280604 | 326 |
| 376 | 3300026089 | Ga0207648_10046401 | Ga0207648_100464012 | 326 |
| 377 | 3300026095 | Ga0207676_10001527 | Ga0207676_1000152713 | 326 |
| 378 | 3300026116 | Ga0207674_10007077 | Ga0207674_100070774 | 326 |
| 379 | 3300026116 | Ga0207674_10100243 | Ga0207674_101002433 | 326 |
| 380 | 3300026118 | Ga0207675_100040834 | Ga0207675_1000408343 | 326 |
| 381 | 3300026121 | Ga0207683_10000592 | Ga0207683_100005924 | 326 |
| 382 | 3300026121 | Ga0207683_10069583 | Ga0207683_100695833 | 326 |
| 383 | 3300026142 | Ga0207698_10369552 | Ga0207698_103695522 | 326 |
| 384 | 3300027357 | Ga0209589_1000009 | Ga0209589_1000009258 | 326 |
| 385 | 3300027360 | Ga0209969_1000252 | Ga0209969_10002522 | 326 |
| 386 | 3300027361 | Ga0209489_100010 | Ga0209489_10001012 | 326 |
| 387 | 3300027363 | Ga0209700_100017 | Ga0209700_10001712 | 326 |
| 388 | 3300027364 | Ga0209967_1002052 | Ga0209967_10020522 | 326 |
| 389 | 3300027471 | Ga0209995_1000556 | Ga0209995_10005565 | 326 |
| 390 | 3300027543 | Ga0209999_1006791 | Ga0209999_10067912 | 326 |
| 391 | 3300027671 | Ga0209588_1005801 | Ga0209588_10058014 | 326 |
| 392 | 3300027907 | Ga0207428_10005458 | Ga0207428_100054588 | 326 |
| 393 | 3300028800 | Ga0265338_10008231 | Ga0265338_1000823110 | 326 |
| 394 | 3300031235 | Ga0265330_10050406 | Ga0265330_100504062 | 326 |
| 395 | 3300031238 | Ga0265332_10005303 | Ga0265332_100053035 | 326 |
| 396 | 3300031239 | Ga0265328_10001996 | Ga0265328_100019968 | 326 |
| 397 | 3300031239 | Ga0265328_10015116 | Ga0265328_100151163 | 326 |
| 398 | 3300031241 | Ga0265325_10001737 | Ga0265325_1000173712 | 326 |
| 399 | 3300031249 | Ga0265339_10000101 | Ga0265339_100001012 | 326 |
| 400 | 3300031344 | Ga0265316_10020282 | Ga0265316_100202825 | 326 |
| 401 | 3300031456 | Ga0307513_10076919 | Ga0307513_100769192 | 326 |
| 402 | 3300031507 | Ga0307509_10162734 | Ga0307509_101627342 | 326 |
| 403 | 3300031595 | Ga0265313_10003333 | Ga0265313_100033333 | 326 |
| 404 | 3300031711 | Ga0265314_10000895 | Ga0265314_1000089528 | 326 |
| 405 | 3300031712 | Ga0265342_10022105 | Ga0265342_100221054 | 326 |
| 406 | 3300031824 | Ga0307413_10106951 | Ga0307413_101069512 | 326 |
| 407 | 3300031901 | Ga0307406_10067925 | Ga0307406_100679252 | 326 |
| 408 | 3300031903 | Ga0307407_10234213 | Ga0307407_102342132 | 326 |
| 409 | 3300032002 | Ga0307416_100185609 | Ga0307416_1001856092 | 326 |
| 410 | 3300032005 | Ga0307411_10211149 | Ga0307411_102111492 | 326 |
| 411 | 3300033179 | Ga0307507_10018630 | Ga0307507_100186302 | 326 |
| 412 | 3300033442 | Ga0315911_1000065 | Ga0315911_100006516 | 326 |
| 413 | 3300035088 | Ga0373940_0016492 | Ga0373940_0016492_399_1379 | 326 |
| 414 | 3300035111 | Ga0373923_0008342 | Ga0373923_0008342_32_1012 | 326 |
| 415 | 3300035113 | Ga0373936_0008260 | Ga0373936_0008260_965_1945 | 326 |
| 416 | 3300035116 | Ga0373945_0002588 | Ga0373945_0002588_1450_2430 | 326 |
| 417 | 3300035119 | Ga0373956_0043911 | Ga0373956_0043911_731_1714 | 326 |
| 418 | 3300035119 | Ga0373956_0083294 | Ga0373956_0083294_27_1007 | 326 |
| 419 | 3300035170 | Ga0373943_0007981 | Ga0373943_0007981_2567_3547 | 326 |
| 420 | 3300035170 | Ga0373943_0050554 | Ga0373943_0050554_168_1151 | 326 |
| 421 | 3300035171 | Ga0373946_0005758 | Ga0373946_0005758_985_1965 | 326 |
| 422 | 3300035172 | Ga0373955_0007337 | Ga0373955_0007337_1588_2571 | 326 |
| 423 | 3300035172 | Ga0373955_0020598 | Ga0373955_0020598_1079_2059 | 326 |
| 424 | 3300035207 | Ga0373942_0003008 | Ga0373942_0003008_1035_2015 | 326 |
| 425 | 3300035410 | Ga0373924_0038127 | Ga0373924_0038127_84_1064 | 326 |
| 426 | 3300035692 | Ga0373935_0015289 | Ga0373935_0015289_2317_3297 | 326 |
| 427 | 3300035692 | Ga0373935_0023351 | Ga0373935_0023351_445_1428 | 326 |
| 428 | 3300035692 | Ga0373935_0069562 | Ga0373935_0069562_1065_2045 | 326 |
| 429 | 3300035695 | Ga0373927_0009120 | Ga0373927_0009120_2552_3532 | 326 |
| 430 | 3300035695 | Ga0373927_0068031 | Ga0373927_0068031_238_1218 | 326 |
| 431 | 3300035724 | Ga0373933_0012659 | Ga0373933_0012659_904_1887 | 326 |
| 432 | 3300035725 | Ga0373947_0008626 | Ga0373947_0008626_2665_3645 | 326 |
| 433 | 3300035725 | Ga0373947_0093842 | Ga0373947_0093842_466_1446 | 326 |
| 434 | 3300035725 | Ga0373947_0255518 | Ga0373947_0255518_110_1090 | 326 |
| 435 | 3300036401 | Ga0373937_0042988 | Ga0373937_0042988_982_1962 | 326 |
| 436 | 3300037068 | Ga0373925_0014818 | Ga0373925_0014818_1686_2666 | 326 |
| 437 | 3300037068 | Ga0373925_0073058 | Ga0373925_0073058_1007_1987 | 326 |
| 438 | 3300037312 | Ga0395899_0077178 | Ga0395899_0077178_134_1117 | 326 |
| 439 | 3300037418 | Ga0395900_0000211 | Ga0395900_0000211_69903_70886 | 326 |
| 440 | 3300037418 | Ga0395900_0263243 | Ga0395900_0263243_301_1284 | 326 |
| 441 | 3300037466 | Ga0395898_0000519 | Ga0395898_0000519_43151_44134 | 326 |
| 442 | 3300037466 | Ga0395898_0005969 | Ga0395898_0005969_1188_2171 | 326 |
| 443 | 3300038443 | Ga0395901_0000081 | Ga0395901_0000081_11206_12189 | 326 |
| 444 | 3300038443 | Ga0395901_0000134 | Ga0395901_0000134_1307_2290 | 326 |
| 445 | 3300038443 | Ga0395901_0024571 | Ga0395901_0024571_4893_5876 | 326 |
| 446 | 3300038443 | Ga0395901_0038669 | Ga0395901_0038669_2407_3387 | 326 |
| 447 | 3300038443 | Ga0395901_0315055 | Ga0395901_0315055_311_1294 | 326 |
| 448 | 3300039062 | Ga0400483_011534 | Ga0400483_011534_563_1543 | 326 |
| 449 | 3300039450 | Ga0436363_0402666 | Ga0436363_0402666_1891_2880 | 326 |
| 450 | 3300039453 | Ga0436362_0777509 | Ga0436362_0777509_116_1099 | 326 |
| 451 | 3300041408 | Ga0439453_0001059 | Ga0439453_0001059_920_1900 | 326 |
| 452 | 3300042001 | Ga0439441_004226 | Ga0439441_004226_667_1647 | 326 |
| 453 | 3300042993 | Ga0439440_0008194 | Ga0439440_0008194_777_1757 | 326 |
| 454 | 3300044684 | Ga0466966_0001018 | Ga0466966_0001018_7058_8041 | 326 |
| 455 | 3300044693 | Ga0466961_0041804 | Ga0466961_0041804_1334_2317 | 326 |
| 456 | 3300044719 | Ga0466971_0001312 | Ga0466971_0001312_860_1843 | 326 |
| 457 | 3300044842 | Ga0466957_0018592 | Ga0466957_0018592_1784_2767 | 326 |
| 458 | 3300045049 | Ga0466959_0015328 | Ga0466959_0015328_1800_2783 | 326 |
| 459 | 3300045051 | Ga0451576_0052660 | Ga0451576_0052660_693_1673 | 326 |
| 460 | 3300045051 | Ga0451576_0132460 | Ga0451576_0132460_257_1237 | 326 |
| 461 | 3300045836 | Ga0466958_0031663 | Ga0466958_0031663_187_1170 | 326 |
| 462 | 3300046454 | Ga0495592_0017159 | Ga0495592_0017159_2784_3764 | 326 |
| 463 | 3300046455 | Ga0495603_0000494 | Ga0495603_0000494_3288_4268 | 326 |
| 464 | 3300046455 | Ga0495603_0043961 | Ga0495603_0043961_1455_2435 | 326 |
| 465 | 3300046455 | Ga0495603_0211165 | Ga0495603_0211165_111_1100 | 326 |
| 466 | 3300046459 | Ga0495629_0001268 | Ga0495629_0001268_1319_2299 | 326 |
| 467 | 3300046461 | Ga0495641_0002706 | Ga0495641_0002706_10853_11833 | 326 |
| 468 | 3300046462 | Ga0495651_0002860 | Ga0495651_0002860_7677_8660 | 326 |
| 469 | 3300046463 | Ga0495653_0010786 | Ga0495653_0010786_2344_3327 | 326 |
| 470 | 3300046471 | Ga0495650_0011168 | Ga0495650_0011168_585_1571 | 326 |
| 471 | 3300046472 | Ga0495580_0018631 | Ga0495580_0018631_2606_3586 | 326 |
| 472 | 3300046472 | Ga0495580_0106075 | Ga0495580_0106075_101_1081 | 326 |
| 473 | 3300046473 | Ga0495582_0000438 | Ga0495582_0000438_17559_18539 | 326 |
| 474 | 3300046473 | Ga0495582_0016750 | Ga0495582_0016750_1889_2872 | 326 |
| 475 | 3300046474 | Ga0495605_0058312 | Ga0495605_0058312_448_1428 | 326 |
| 476 | 3300046475 | Ga0495639_0001888 | Ga0495639_0001888_4645_5625 | 326 |
| 477 | 3300046476 | Ga0495662_0007519 | Ga0495662_0007519_2233_3213 | 326 |
| 478 | 3300046477 | Ga0495664_0028688 | Ga0495664_0028688_1077_2057 | 326 |
| 479 | 3300046491 | Ga0495584_0132656 | Ga0495584_0132656_83_1063 | 326 |
| 480 | 3300046499 | Ga0495594_0001717 | Ga0495594_0001717_6682_7662 | 326 |
| 481 | 3300046511 | Ga0495608_0006731 | Ga0495608_0006731_829_1812 | 326 |
| 482 | 3300046516 | Ga0495628_0012853 | Ga0495628_0012853_1984_2967 | 326 |
| 483 | 3300046517 | Ga0495630_0007657 | Ga0495630_0007657_4275_5255 | 326 |
| 484 | 3300046518 | Ga0495631_0119490 | Ga0495631_0119490_126_1106 | 326 |
| 485 | 3300046520 | Ga0495637_0022117 | Ga0495637_0022117_1319_2299 | 326 |
| 486 | 3300046525 | Ga0495663_0022382 | Ga0495663_0022382_451_1431 | 326 |
| 487 | 3300046526 | Ga0495666_0066236 | Ga0495666_0066236_680_1660 | 326 |
| 488 | 3300046531 | Ga0495665_0001088 | Ga0495665_0001088_9272_10252 | 326 |
| 489 | 3300046531 | Ga0495665_0071658 | Ga0495665_0071658_341_1324 | 326 |
| 490 | 3300046533 | Ga0495640_0014993 | Ga0495640_0014993_4416_5399 | 326 |
| 491 | 3300046533 | Ga0495640_0016417 | Ga0495640_0016417_3266_4246 | 326 |
| 492 | 3300046535 | Ga0495586_0042884 | Ga0495586_0042884_865_1845 | 326 |
| 493 | 3300046543 | Ga0495645_0010708 | Ga0495645_0010708_2176_3159 | 326 |
| 494 | 3300046543 | Ga0495645_0086881 | Ga0495645_0086881_544_1560 | 326 |
| 495 | 3300046557 | Ga0495622_0004695 | Ga0495622_0004695_954_1934 | 326 |
| 496 | 3300046557 | Ga0495622_0007279 | Ga0495622_0007279_1851_2831 | 326 |
| 497 | 3300046559 | Ga0495667_0027618 | Ga0495667_0027618_2089_3069 | 326 |
| 498 | 3300046615 | Ga0495656_0017464 | Ga0495656_0017464_1064_2044 | 326 |
| 499 | 3300046616 | Ga0495668_0048279 | Ga0495668_0048279_1208_2188 | 326 |
| 500 | 3300046642 | Ga0495634_0004708 | Ga0495634_0004708_2744_3724 | 326 |
| 501 | 3300046642 | Ga0495634_0031837 | Ga0495634_0031837_2464_3447 | 326 |
| 502 | 3300046648 | Ga0495611_0033529 | Ga0495611_0033529_570_1550 | 326 |
| 503 | 3300046663 | Ga0495635_0003631 | Ga0495635_0003631_6905_7885 | 326 |
| 504 | 3300046664 | Ga0495659_0020303 | Ga0495659_0020303_889_1869 | 326 |
| 505 | 3300046674 | Ga0495588_0034068 | Ga0495588_0034068_1454_2434 | 326 |
| 506 | 3300046675 | Ga0495657_0030815 | Ga0495657_0030815_2127_3134 | 326 |
| 507 | 3300046678 | Ga0495599_0137636 | Ga0495599_0137636_354_1334 | 326 |
| 508 | 3300046679 | Ga0495623_0005091 | Ga0495623_0005091_6418_7401 | 326 |
| 509 | 3300046681 | Ga0495647_0038476 | Ga0495647_0038476_680_1660 | 326 |
| 510 | 3300046683 | Ga0495658_0001846 | Ga0495658_0001846_9317_10297 | 326 |
| 511 | 3300046683 | Ga0495658_0003373 | Ga0495658_0003373_6785_7765 | 326 |
| 512 | 3300046683 | Ga0495658_0045632 | Ga0495658_0045632_715_1695 | 326 |
| 513 | 3300046684 | Ga0495669_0043864 | Ga0495669_0043864_535_1515 | 326 |
| 514 | 3300046689 | Ga0495613_0003392 | Ga0495613_0003392_4089_5069 | 326 |
| 515 | 3300046690 | Ga0495624_0007222 | Ga0495624_0007222_3107_4087 | 326 |
| 516 | 3300046694 | Ga0495649_0050873 | Ga0495649_0050873_1202_2182 | 326 |
| 517 | 3300047315 | Ga0495581_0000360 | Ga0495581_0000360_4303_5283 | 326 |
| 518 | 3300047319 | Ga0495674_0013302 | Ga0495674_0013302_4186_5166 | 326 |
| 519 | 3300047320 | Ga0495672_0009667 | Ga0495672_0009667_4618_5598 | 326 |
| 520 | 3300047321 | Ga0495676_0010445 | Ga0495676_0010445_5269_6249 | 326 |
| 521 | 3300047323 | Ga0495683_0041969 | Ga0495683_0041969_84_1064 | 326 |
| 522 | 3300047445 | Ga0495677_0043449 | Ga0495677_0043449_551_1531 | 326 |
| 523 | 3300047469 | Ga0495673_0074042 | Ga0495673_0074042_77_1057 | 326 |
| 524 | 3300047470 | Ga0495681_0035271 | Ga0495681_0035271_1088_2068 | 326 |
| 525 | 3300047471 | Ga0495684_0033409 | Ga0495684_0033409_460_1467 | 326 |
| 526 | 3300047673 | Ga0495593_0000528 | Ga0495593_0000528_17567_18547 | 326 |
| 527 | 3300047673 | Ga0495593_0036929 | Ga0495593_0036929_697_1680 | 326 |
| 528 | 3300048089 | Ga0495614_0050477 | Ga0495614_0050477_660_1640 | 326 |
| 529 | 3300048904 | Ga0496101_0059996 | Ga0496101_0059996_485_1465 | 326 |
| 530 | 3300048905 | Ga0496102_0061372 | Ga0496102_0061372_1331_2311 | 326 |
| 531 | 3300048907 | Ga0496104_0284485 | Ga0496104_0284485_351_1331 | 326 |
| 532 | 3300048907 | Ga0496104_0293418 | Ga0496104_0293418_475_1455 | 326 |
| 533 | 3300048908 | Ga0496105_0182314 | Ga0496105_0182314_444_1424 | 326 |
| 534 | 3300048909 | Ga0496106_0006589 | Ga0496106_0006589_4857_5837 | 326 |
| 535 | 3300048910 | Ga0496107_0010201 | Ga0496107_0010201_5398_6378 | 326 |
| 536 | 3300048910 | Ga0496107_0055041 | Ga0496107_0055041_1142_2122 | 326 |
| 537 | 3300048911 | Ga0496108_0010882 | Ga0496108_0010882_4309_5289 | 326 |
| 538 | 3300048911 | Ga0496108_0011998 | Ga0496108_0011998_5964_6944 | 326 |
| 539 | 3300048911 | Ga0496108_0017785 | Ga0496108_0017785_1827_2807 | 326 |
| 540 | 3300048911 | Ga0496108_0031856 | Ga0496108_0031856_1836_2816 | 326 |
| 541 | 3300048911 | Ga0496108_0115205 | Ga0496108_0115205_1105_2085 | 326 |
| 542 | 3300048912 | Ga0496109_0007508 | Ga0496109_0007508_2103_3119 | 326 |
| 543 | 3300048912 | Ga0496109_0286927 | Ga0496109_0286927_450_1430 | 326 |
| 544 | 3300048912 | Ga0496109_0357398 | Ga0496109_0357398_44_1024 | 326 |
| 545 | 3300048913 | Ga0496110_0001095 | Ga0496110_0001095_4062_5042 | 326 |
| 546 | 3300048913 | Ga0496110_0037220 | Ga0496110_0037220_1411_2391 | 326 |
| 547 | 3300048913 | Ga0496110_0049007 | Ga0496110_0049007_2238_3218 | 326 |
| 548 | 3300048913 | Ga0496110_0251208 | Ga0496110_0251208_74_1054 | 326 |
| 549 | 3300048914 | Ga0496111_0001472 | Ga0496111_0001472_2423_3403 | 326 |
| 550 | 3300048914 | Ga0496111_0079122 | Ga0496111_0079122_1133_2113 | 326 |
| 551 | 3300048914 | Ga0496111_0080545 | Ga0496111_0080545_838_1818 | 326 |
| 552 | 3300048915 | Ga0496112_0046812 | Ga0496112_0046812_1433_2413 | 326 |
| 553 | 3300048915 | Ga0496112_0146865 | Ga0496112_0146865_919_1899 | 326 |
| 554 | 3300048917 | Ga0496114_0011061 | Ga0496114_0011061_1659_2639 | 326 |
| 555 | 3300049569 | Ga0501032_0028543 | Ga0501032_0028543_1175_2155 | 326 |
| 556 | 3300049570 | Ga0501033_0001708 | Ga0501033_0001708_4361_5377 | 326 |
| 557 | 3300049570 | Ga0501033_0042763 | Ga0501033_0042763_1683_2663 | 326 |
| 558 | 3300049572 | Ga0501036_0009386 | Ga0501036_0009386_2370_3350 | 326 |
| 559 | 3300049572 | Ga0501036_0314050 | Ga0501036_0314050_130_1110 | 326 |
| 560 | 3300049573 | Ga0501037_0001314 | Ga0501037_0001314_9480_10496 | 326 |
| 561 | 3300049573 | Ga0501037_0079120 | Ga0501037_0079120_1122_2102 | 326 |
| 562 | 3300049574 | Ga0501038_0046432 | Ga0501038_0046432_495_1475 | 326 |
| 563 | 3300049575 | Ga0501039_0006086 | Ga0501039_0006086_6282_7262 | 326 |
| 564 | 3300049575 | Ga0501039_0118198 | Ga0501039_0118198_1038_2018 | 326 |
| 565 | 3300049575 | Ga0501039_0125229 | Ga0501039_0125229_185_1165 | 326 |
| 566 | 3300049575 | Ga0501039_0163193 | Ga0501039_0163193_740_1720 | 326 |
| 567 | 3300049576 | Ga0501040_0003605 | Ga0501040_0003605_3901_4881 | 326 |
| 568 | 3300049576 | Ga0501040_0009154 | Ga0501040_0009154_4352_5332 | 326 |
| 569 | 3300049576 | Ga0501040_0011458 | Ga0501040_0011458_2323_3303 | 326 |
| 570 | 3300049576 | Ga0501040_0079452 | Ga0501040_0079452_474_1454 | 326 |
| 571 | 3300049577 | Ga0501041_0001288 | Ga0501041_0001288_11213_12193 | 326 |
| 572 | 3300049577 | Ga0501041_0012729 | Ga0501041_0012729_453_1433 | 326 |
| 573 | 3300049577 | Ga0501041_0016454 | Ga0501041_0016454_980_1996 | 326 |
| 574 | 3300049577 | Ga0501041_0058350 | Ga0501041_0058350_298_1278 | 326 |
| 575 | 3300049577 | Ga0501041_0098675 | Ga0501041_0098675_496_1476 | 326 |
| 576 | 3300049578 | Ga0501042_0000799 | Ga0501042_0000799_3902_4882 | 326 |
| 577 | 3300049580 | Ga0501046_0022852 | Ga0501046_0022852_1290_2270 | 326 |
| 578 | 3300049580 | Ga0501046_0026776 | Ga0501046_0026776_1511_2491 | 326 |
| 579 | 3300049580 | Ga0501046_0060113 | Ga0501046_0060113_1579_2559 | 326 |
| 580 | 3300049582 | Ga0501048_0020290 | Ga0501048_0020290_133_1113 | 326 |
| 581 | 3300049582 | Ga0501048_0050623 | Ga0501048_0050623_468_1448 | 326 |
| 582 | 3300049582 | Ga0501048_0154829 | Ga0501048_0154829_367_1347 | 326 |
| 583 | 3300049584 | Ga0501068_0065901 | Ga0501068_0065901_881_1861 | 326 |
| 584 | 3300049585 | Ga0501069_0114602 | Ga0501069_0114602_13_993 | 326 |
| 585 | 3300049586 | Ga0501070_0058814 | Ga0501070_0058814_880_1860 | 326 |
| 586 | 3300049587 | Ga0501071_0002341 | Ga0501071_0002341_1758_2738 | 326 |
| 587 | 3300049587 | Ga0501071_0229415 | Ga0501071_0229415_144_1124 | 326 |
| 588 | 3300049588 | Ga0501072_0001227 | Ga0501072_0001227_9259_10239 | 326 |
| 589 | 3300049588 | Ga0501072_0021401 | Ga0501072_0021401_1321_2301 | 326 |
| 590 | 3300049588 | Ga0501072_0095755 | Ga0501072_0095755_144_1124 | 326 |
| 591 | 3300049590 | Ga0501074_0037785 | Ga0501074_0037785_988_1968 | 326 |
| 592 | 3300049590 | Ga0501074_0061054 | Ga0501074_0061054_1100_2080 | 326 |
| 593 | 3300049591 | Ga0501075_0000698 | Ga0501075_0000698_10284_11264 | 326 |
| 594 | 3300049591 | Ga0501075_0022199 | Ga0501075_0022199_2330_3310 | 326 |
| 595 | 3300049591 | Ga0501075_0029363 | Ga0501075_0029363_2320_3300 | 326 |
| 596 | 3300049591 | Ga0501075_0134965 | Ga0501075_0134965_842_1822 | 326 |
| 597 | 3300049592 | Ga0501076_0000465 | Ga0501076_0000465_12587_13567 | 326 |
| 598 | 3300049592 | Ga0501076_0108653 | Ga0501076_0108653_34_1014 | 326 |
| 599 | 3300049592 | Ga0501076_0137790 | Ga0501076_0137790_594_1574 | 326 |
| 600 | 3300049593 | Ga0501077_0002091 | Ga0501077_0002091_4796_5776 | 326 |
| 601 | 3300049593 | Ga0501077_0024598 | Ga0501077_0024598_187_1167 | 326 |
| 602 | 3300049593 | Ga0501077_0310846 | Ga0501077_0310846_14_994 | 326 |
| 603 | 3300049741 | Ga0501079_0001622 | Ga0501079_0001622_11278_12258 | 326 |
| 604 | 3300049742 | Ga0501080_0083944 | Ga0501080_0083944_259_1239 | 326 |
| 605 | 3300049742 | Ga0501080_0166842 | Ga0501080_0166842_294_1274 | 326 |
| 606 | 3300049743 | Ga0501081_0000363 | Ga0501081_0000363_12637_13617 | 326 |
| 607 | 3300049743 | Ga0501081_0014018 | Ga0501081_0014018_4250_5230 | 326 |
| 608 | 3300049743 | Ga0501081_0083913 | Ga0501081_0083913_268_1248 | 326 |
| 609 | 3300049743 | Ga0501081_0127867 | Ga0501081_0127867_791_1771 | 326 |
| 610 | 3300049822 | Ga0501035_0042891 | Ga0501035_0042891_689_1669 | 326 |
| 611 | 3300049824 | Ga0501045_0002485 | Ga0501045_0002485_9212_10192 | 326 |
| 612 | 3300049824 | Ga0501045_0012143 | Ga0501045_0012143_3861_4841 | 326 |
| 613 | 3300049824 | Ga0501045_0040523 | Ga0501045_0040523_847_1827 | 326 |
| 614 | 3300050507 | nmdc:mga05p37_17006_c1 | nmdc:mga05p37_17006_c1_2328_3308 | 326 |
| 615 | 3300050507 | nmdc:mga05p37_73659_c1 | nmdc:mga05p37_73659_c1_1816_2796 | 326 |
| 616 | 3300050508 | nmdc:mga09592_3890_c1 | nmdc:mga09592_3890_c1_5064_6044 | 326 |
| 617 | 3300050509 | nmdc:mga0qj67_167236_c1 | nmdc:mga0qj67_167236_c1_338_1318 | 326 |
| 618 | 3300050509 | nmdc:mga0qj67_22527_c1 | nmdc:mga0qj67_22527_c1_1855_2835 | 326 |
| 619 | 3300050509 | nmdc:mga0qj67_47960_c1 | nmdc:mga0qj67_47960_c1_1374_2354 | 326 |
| 620 | 3300050510 | nmdc:mga06r32_44627_c1 | nmdc:mga06r32_44627_c1_1763_2743 | 326 |
| 621 | 3300050510 | nmdc:mga06r32_62142_c1 | nmdc:mga06r32_62142_c1_1699_2679 | 326 |
| 622 | 3300050510 | nmdc:mga06r32_8319_c1 | nmdc:mga06r32_8319_c1_1532_2512 | 326 |
| 623 | 3300050511 | nmdc:mga08y16_25744_c1 | nmdc:mga08y16_25744_c1_3814_4797 | 326 |
| 624 | 3300050511 | nmdc:mga08y16_4703_c1 | nmdc:mga08y16_4703_c1_1532_2512 | 326 |
| 625 | 3300050511 | nmdc:mga08y16_93352_c1 | nmdc:mga08y16_93352_c1_1455_2435 | 326 |
| 626 | 3300050512 | nmdc:mga0n895_299917_c1 | nmdc:mga0n895_299917_c1_461_1441 | 326 |
| 627 | 3300050512 | nmdc:mga0n895_3827_c1 | nmdc:mga0n895_3827_c1_5644_6624 | 326 |
| 628 | 3300050513 | nmdc:mga0rr50_107951_c1 | nmdc:mga0rr50_107951_c1_912_1892 | 326 |
| 629 | 3300050513 | nmdc:mga0rr50_161528_c1 | nmdc:mga0rr50_161528_c1_291_1271 | 326 |
| 630 | 3300050513 | nmdc:mga0rr50_78599_c1 | nmdc:mga0rr50_78599_c1_619_1599 | 326 |
| 631 | 3300050514 | nmdc:mga08x19_100064_c1 | nmdc:mga08x19_100064_c1_462_1481 | 326 |
| 632 | 3300050514 | nmdc:mga08x19_171247_c1 | nmdc:mga08x19_171247_c1_33_1013 | 326 |
| 633 | 3300050514 | nmdc:mga08x19_23272_c1 | nmdc:mga08x19_23272_c1_2769_3749 | 326 |
| 634 | 3300050514 | nmdc:mga08x19_321_c1 | nmdc:mga08x19_321_c1_11610_12590 | 326 |
| 635 | 3300050514 | nmdc:mga08x19_61459_c1 | nmdc:mga08x19_61459_c1_864_1844 | 326 |
| 636 | 3300050515 | nmdc:mga0a205_13403_c1 | nmdc:mga0a205_13403_c1_2506_3525 | 326 |
| 637 | 3300050515 | nmdc:mga0a205_41263_c1 | nmdc:mga0a205_41263_c1_3079_4059 | 326 |
| 638 | 3300050515 | nmdc:mga0a205_9450_c1 | nmdc:mga0a205_9450_c1_2468_3448 | 326 |
| 639 | 3300053077 | Ga0495601_0017195 | Ga0495601_0017195_3149_4132 | 326 |
| 640 | 3300053077 | Ga0495601_0051092 | Ga0495601_0051092_1537_2526 | 326 |
| 641 | 3300053078 | Ga0495612_0030840 | Ga0495612_0030840_774_1790 | 326 |
| 642 | 3300053084 | Ga0495595_0006392 | Ga0495595_0006392_1105_2088 | 326 |
| 643 | 3300053085 | Ga0495619_0032747 | Ga0495619_0032747_2201_3184 | 326 |
| 644 | 3300053085 | Ga0495619_0059078 | Ga0495619_0059078_123_1112 | 326 |
| 645 | 3300053086 | Ga0500578_0003225 | Ga0500578_0003225_7455_8435 | 326 |
| 646 | 3300053093 | Ga0500651_0003755 | Ga0500651_0003755_5074_6054 | 326 |
| 647 | 3300053119 | Ga0500595_013600 | Ga0500595_013600_1441_2421 | 326 |
| 648 | 3300053140 | Ga0500573_0001628 | Ga0500573_0001628_471_1487 | 326 |
| 649 | 3300053178 | Ga0500637_0003093 | Ga0500637_0003093_2562_3542 | 326 |
| 650 | 3300053178 | Ga0500637_0045982 | Ga0500637_0045982_1298_2278 | 326 |
| 651 | 3300053735 | Ga0500596_001246 | Ga0500596_001246_1161_2141 | 326 |
| 652 | 3300054114 | Ga0501084_0003976 | Ga0501084_0003976_4793_5773 | 326 |
| 653 | 3300054114 | Ga0501084_0042090 | Ga0501084_0042090_1817_2797 | 326 |
| 654 | 3300054114 | Ga0501084_0057390 | Ga0501084_0057390_429_1409 | 326 |
| 655 | 3300060353 | Ga0501082_0005061 | Ga0501082_0005061_4920_5900 | 326 |
| 656 | 3300060353 | Ga0501082_0013216 | Ga0501082_0013216_2330_3310 | 326 |
| 657 | 3300060353 | Ga0501082_0067865 | Ga0501082_0067865_1550_2530 | 326 |
| 658 | 3300060353 | Ga0501082_0186388 | Ga0501082_0186388_80_1060 | 326 |
| 659 | 3300061734 | Ga0530510_0000311 | Ga0530510_0000311_20482_21462 | 326 |
| 660 | 3300061734 | Ga0530510_0022605 | Ga0530510_0022605_1624_2604 | 326 |
| 661 | 3300061734 | Ga0530510_0032902 | Ga0530510_0032902_419_1399 | 326 |
| 662 | 3300061734 | Ga0530510_0092520 | Ga0530510_0092520_524_1504 | 326 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1umd-assembly1.cif.gz_D | branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate | 0.9593 | 2 | 324 |
| 3duf-assembly2.cif.gz_H | snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex | 0.9581 | 2 | 324 |
| 1ik6-assembly1.cif.gz_A | 3d structure of the e1beta subunit of pyruvate dehydrogenase from the archeon pyrobaculum aerophilum | 0.9576 | 1 | 324 |
| 2beu-assembly1.cif.gz_B | reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch | 0.9549 | 2 | 324 |
| 2bew-assembly1.cif.gz_B | reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch | 0.9546 | 2 | 324 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ik6A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9798 | 190 | 315 | 3.40.50.920 |
| af_B4FUC1_232_362_3.40.50.920 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9669 | 193 | 324 | 3.40.50.920 |
| 1um9D02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9663 | 197 | 324 | 3.40.50.920 |
| af_B4FUC1_232_362_3.40.50.920 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9598 | 193 | 324 | 3.40.50.920 |
| 1w85B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9597 | 193 | 324 | 3.40.50.920 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-D3JWS9-F1-model_v4 | Pyruvate dehydrogenase (EC 1.2.4.1) | 0.9925 | 191 | 260 |
GO:0004739
|
| AF-A0A453MUU2-F1-model_v4 | Transketolase C-terminal domain-containing protein | 0.9919 | 191 | 279 |
GO:0003824
GO:0007584 GO:0009083 |
| AF-A0A7X6EMC4-F1-model_v4 | deleted | 0.9876 | 190 | 279 |
|
| AF-A0A227J0R1-F1-model_v4 | Alpha-ketoacid dehydrogenase subunit beta | 0.9787 | 202 | 296 |
GO:0003824
|
| AF-A0A6B0Q4D3-F1-model_v4 | deleted | 0.9757 | 1 | 113 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar