F473332

General Info

Members Datasets Scaffolds Average Seq Length
660 262 1320 114

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10203067|Ga0105238_102030671
Length 115
Sequence MGETLFNKIIRREIPADIVFEDAEVLAFRDINPQAPVHVLFIPKKKAFATLNDVGAADAELIGRLFLAATAWAKDKGLADDGYRLVMNCNAHGGQTVFHIHLHLLAGRQMHWPPG

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
108 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
109 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
110 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
160 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
161 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
162 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
169 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
170 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
171 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
173 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
178 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
179 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
184 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
187 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
188 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
189 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
190 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
191 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
192 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
193 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
194 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
195 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
198 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
199 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
211 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 2.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 1.21
Rhizosphere 95.61
Stem 0
Stem Tuber 0
Unclassified 8.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10203067 3300009551 Bacteria 1958
2 JGI24740J21852_10150144 3300001979 Bacteria 579
3 JGI24744J21845_10004789 3300002077 Bacteria 2798
4 JGI25156J39149_1008652 3300002705 Bacteria 2542
5 JGI25157J39369_1001451 3300002741 Bacteria 8856
6 Ga0065707_10109909 3300005295 Bacteria 2451
7 Ga0065707_10707990 3300005295 Bacteria 636
8 Ga0070658_10316775 3300005327 Bacteria 1332
9 Ga0070683_100048065 3300005329 Bacteria 3944
10 Ga0070690_100350765 3300005330 Bacteria 1071
11 Ga0070670_100010150 3300005331 Bacteria 8036
12 Ga0068869_100039908 3300005334 Bacteria 3354
13 Ga0068869_100328397 3300005334 Bacteria 1242
14 Ga0070666_10000119 3300005335 Bacteria 54440
15 Ga0070666_10000349 3300005335 Bacteria 28972
16 Ga0070666_10016973 3300005335 Bacteria 4662
17 Ga0070680_100502969 3300005336 Bacteria 1037
18 Ga0070682_100076363 3300005337 Bacteria 2156
19 Ga0068868_100152487 3300005338 Bacteria 1904
20 Ga0068868_101661488 3300005338 Bacteria 601
21 Ga0070660_100558337 3300005339 Bacteria 955
22 Ga0070689_100244246 3300005340 Bacteria 1480
23 Ga0070687_100192943 3300005343 Bacteria 1229
24 Ga0070687_100534878 3300005343 Unclassified 795
25 Ga0070661_100053715 3300005344 Bacteria 2949
26 Ga0070669_100103540 3300005353 Bacteria 2151
27 Ga0070669_100759021 3300005353 Bacteria 822
28 Ga0070671_100860609 3300005355 Bacteria 791
29 Ga0070673_100308062 3300005364 Bacteria 1396
30 Ga0070688_100315711 3300005365 Unclassified 1134
31 Ga0070659_100163918 3300005366 Bacteria 1818
32 Ga0070659_101295033 3300005366 Bacteria 646
33 Ga0070667_100072472 3300005367 Bacteria 2936
34 Ga0070667_100080250 3300005367 Bacteria 2790
35 Ga0070667_100249356 3300005367 Bacteria 1587
36 Ga0070667_101621286 3300005367 Bacteria 608
37 Ga0070703_10542493 3300005406 Unclassified 529
38 Ga0070701_10177306 3300005438 Unclassified 1245
39 Ga0070705_100004571 3300005440 Bacteria 6738
40 Ga0070694_100951969 3300005444 Unclassified 711
41 Ga0070694_101711559 3300005444 Unclassified 535
42 Ga0070708_100142813 3300005445 Bacteria 2221
43 Ga0070708_100146827 3300005445 Bacteria 2191
44 Ga0070708_100220539 3300005445 Bacteria 1778
45 Ga0070708_100451427 3300005445 Bacteria 1213
46 Ga0070708_100846621 3300005445 Unclassified 859
47 Ga0070708_101152751 3300005445 Bacteria 725
48 Ga0070663_100006777 3300005455 Bacteria 6921
49 Ga0070663_100036592 3300005455 Bacteria 3410
50 Ga0070663_101341590 3300005455 Bacteria 632
51 Ga0070662_100074819 3300005457 Bacteria 2507
52 Ga0070662_100106073 3300005457 Bacteria 2134
53 Ga0070681_10223611 3300005458 Bacteria 1797
54 Ga0070681_11624525 3300005458 Bacteria 572
55 Ga0068867_100026742 3300005459 Bacteria 4145
56 Ga0070706_100086577 3300005467 Bacteria 2903
57 Ga0070706_101600280 3300005467 Unclassified 594
58 Ga0070707_100056191 3300005468 Bacteria 3775
59 Ga0070707_100193242 3300005468 Bacteria 1985
60 Ga0070707_100377849 3300005468 Bacteria 1376
61 Ga0070698_100292662 3300005471 Bacteria 1559
62 Ga0070699_100035546 3300005518 Unclassified 4307
63 Ga0070699_100070229 3300005518 Bacteria 3044
64 Ga0070699_100080905 3300005518 Bacteria 2831
65 Ga0070699_100091778 3300005518 Unclassified 2656
66 Ga0070697_100009769 3300005536 Bacteria 7486
67 Ga0070697_100087342 3300005536 Unclassified 2574
68 Ga0070697_100236679 3300005536 Bacteria 1559
69 Ga0070697_101630321 3300005536 Bacteria 577
70 Ga0068853_100235999 3300005539 Bacteria 1674
71 Ga0068853_100726140 3300005539 Bacteria 948
72 Ga0070686_100193917 3300005544 Unclassified 1452
73 Ga0070686_101895077 3300005544 Bacteria 509
74 Ga0070695_100645501 3300005545 Unclassified 835
75 Ga0070696_100283289 3300005546 Bacteria 1264
76 Ga0070696_100304780 3300005546 Bacteria 1221
77 Ga0070696_100847134 3300005546 Bacteria 755
78 Ga0070693_100012438 3300005547 Bacteria 4306
79 Ga0070693_100518728 3300005547 Bacteria 848
80 Ga0070665_100000227 3300005548 Bacteria 93439
81 Ga0070704_100338600 3300005549 Bacteria 1266
82 Ga0068855_100011861 3300005563 Bacteria 10537
83 Ga0068855_100644711 3300005563 Bacteria 1138
84 Ga0070664_100313637 3300005564 Bacteria 1420
85 Ga0070664_100788772 3300005564 Bacteria 888
86 Ga0068854_100016559 3300005578 Bacteria 4917
87 Ga0068854_100062414 3300005578 Bacteria 2701
88 Ga0068854_101635790 3300005578 Bacteria 587
89 Ga0068856_100396113 3300005614 Bacteria 1400
90 Ga0070702_101259236 3300005615 Bacteria 599
91 Ga0068852_100005316 3300005616 Bacteria 9193
92 Ga0068852_100016040 3300005616 Bacteria 5832
93 Ga0068852_100212374 3300005616 Bacteria 1836
94 Ga0068852_100387026 3300005616 Bacteria 1373
95 Ga0068859_100227775 3300005617 Bacteria 1952
96 Ga0068859_100774535 3300005617 Bacteria 1048
97 Ga0068859_102495910 3300005617 Bacteria 569
98 Ga0068864_100020561 3300005618 Bacteria 5523
99 Ga0068864_100716891 3300005618 Bacteria 978
100 Ga0068866_10506220 3300005718 Bacteria 800
101 Ga0068861_100458337 3300005719 Bacteria 1144
102 Ga0068851_10004560 3300005834 Bacteria 6250
103 Ga0068851_10017031 3300005834 Bacteria 3486
104 Ga0068863_100032498 3300005841 Bacteria 4975
105 Ga0068863_100179716 3300005841 Bacteria 2031
106 Ga0068863_100362126 3300005841 Bacteria 1414
107 Ga0068863_100596191 3300005841 Bacteria 1093
108 Ga0068858_100001997 3300005842 Bacteria 20860
109 Ga0068860_100008623 3300005843 Bacteria 10162
110 Ga0068860_100067303 3300005843 Bacteria 3404
111 Ga0068862_100058372 3300005844 Bacteria 3310
112 Ga0068862_100381848 3300005844 Bacteria 1314
113 Ga0068862_100644855 3300005844 Bacteria 1021
114 Ga0068862_100951319 3300005844 Unclassified 847
115 Ga0081455_10203449 3300005937 Bacteria 1481
116 Ga0081538_10068122 3300005981 Bacteria 1981
117 Ga0097621_100101820 3300006237 Bacteria 2417
118 Ga0097621_100391538 3300006237 Bacteria 1243
119 Ga0097621_100474939 3300006237 Bacteria 1129
120 Ga0068871_100039261 3300006358 Bacteria 3787
121 Ga0068871_100087602 3300006358 Bacteria 2589
122 Ga0068871_100273471 3300006358 Bacteria 1476
123 Ga0068871_100947583 3300006358 Bacteria 800
124 Ga0068871_101797812 3300006358 Bacteria 582
125 Ga0075428_100027803 3300006844 Bacteria 6257
126 Ga0075428_100063388 3300006844 Bacteria 4047
127 Ga0075428_100457140 3300006844 Bacteria 1367
128 Ga0075428_101071510 3300006844 Bacteria 852
129 Ga0075430_100005820 3300006846 Bacteria 10402
130 Ga0075430_100666383 3300006846 Bacteria 858
131 Ga0075431_100095596 3300006847 Bacteria 3067
132 Ga0075431_100129557 3300006847 Bacteria 2603
133 Ga0075431_100208994 3300006847 Unclassified 1994
134 Ga0075433_10000019 3300006852 Bacteria 63182
135 Ga0075433_10040798 3300006852 Bacteria 4019
136 Ga0075433_10046972 3300006852 Bacteria 3755
137 Ga0075433_10062154 3300006852 Bacteria 3271
138 Ga0075433_10074191 3300006852 Bacteria 2993
139 Ga0075433_10388587 3300006852 Bacteria 1231
140 Ga0075433_10737211 3300006852 Unclassified 862
141 Ga0075433_10839155 3300006852 Bacteria 802
142 Ga0075433_10883737 3300006852 Bacteria 780
143 Ga0075433_10911399 3300006852 Bacteria 767
144 Ga0075434_100000806 3300006871 Bacteria 24834
145 Ga0075434_100008901 3300006871 Bacteria 9344
146 Ga0075434_100067279 3300006871 Bacteria 3569
147 Ga0075434_100120227 3300006871 Bacteria 2642
148 Ga0075434_100437689 3300006871 Bacteria 1329
149 Ga0075434_100614956 3300006871 Bacteria 1105
150 Ga0075434_100782992 3300006871 Unclassified 970
151 Ga0075434_101498732 3300006871 Bacteria 684
152 Ga0075434_102180025 3300006871 Bacteria 558
153 Ga0075429_100014375 3300006880 Bacteria 6860
154 Ga0075429_100056126 3300006880 Bacteria 3427
155 Ga0075429_100278643 3300006880 Unclassified 1464
156 Ga0068865_100035799 3300006881 Bacteria 3342
157 Ga0075436_100181473 3300006914 Bacteria 1488
158 Ga0075436_101108536 3300006914 Bacteria 596
159 Ga0097620_100227773 3300006931 Bacteria 1952
160 Ga0097620_100774535 3300006931 Bacteria 1048
161 Ga0097620_102496007 3300006931 Bacteria 569
162 Ga0075435_100017497 3300007076 Bacteria 5428
163 Ga0075435_100025454 3300007076 Bacteria 4607
164 Ga0075435_100218552 3300007076 Bacteria 1618
165 Ga0075435_100278194 3300007076 Unclassified 1428
166 Ga0099794_10057052 3300007265 Bacteria 1891
167 Ga0099794_10564557 3300007265 Unclassified 601
168 Ga0099794_10773602 3300007265 Bacteria 513
169 Ga0105240_10013778 3300009093 Bacteria 11079
170 Ga0105240_10014864 3300009093 Bacteria 10610
171 Ga0105240_10224946 3300009093 Bacteria 2184
172 Ga0105240_11026124 3300009093 Bacteria 881
173 Ga0111539_10004379 3300009094 Bacteria 18476
174 Ga0111539_10005631 3300009094 Bacteria 16199
175 Ga0111539_10024208 3300009094 Bacteria 7455
176 Ga0111539_10203174 3300009094 Bacteria 2310
177 Ga0105245_10168348 3300009098 Bacteria 2085
178 Ga0114129_10000934 3300009147 Bacteria 38171
179 Ga0114129_10029177 3300009147 Bacteria 7815
180 Ga0114129_10065832 3300009147 Bacteria 5056
181 Ga0114129_10120112 3300009147 Unclassified 3619
182 Ga0114129_10177329 3300009147 Bacteria 2902
183 Ga0114129_10292562 3300009147 Bacteria 2173
184 Ga0114129_10313650 3300009147 Bacteria 2087
185 Ga0114129_10486877 3300009147 Bacteria 1613
186 Ga0114129_10991194 3300009147 Unclassified 1059
187 Ga0114129_11142176 3300009147 Bacteria 973
188 Ga0105243_10760048 3300009148 Bacteria 951
189 Ga0105241_10045134 3300009174 Bacteria 3342
190 Ga0105241_10060576 3300009174 Bacteria 2912
191 Ga0105242_10271272 3300009176 Bacteria 1537
192 Ga0105248_10394162 3300009177 Bacteria 1559
193 Ga0105248_11117487 3300009177 Bacteria 891
194 Ga0105237_10001820 3300009545 Bacteria 27503
195 Ga0105237_10137271 3300009545 Bacteria 2440
196 Ga0105237_10259920 3300009545 Bacteria 1739
197 Ga0105237_10338175 3300009545 Bacteria 1510
198 Ga0105238_10018113 3300009551 Bacteria 7161
199 Ga0105238_10170882 3300009551 Bacteria 2150
200 Ga0105238_11522103 3300009551 Bacteria 698
201 Ga0105238_12262372 3300009551 Bacteria 579
202 Ga0105249_10830502 3300009553 Bacteria 989
203 Ga0105249_11288911 3300009553 Bacteria 802
204 Ga0105249_11891573 3300009553 Bacteria 669
205 Ga0105239_10259065 3300010375 Bacteria 1954
206 Ga0105239_10311401 3300010375 Bacteria 1774
207 Ga0105239_10455089 3300010375 Bacteria 1452
208 Ga0105239_12285662 3300010375 Bacteria 629
209 Ga0105246_10052175 3300011119 Bacteria 2810
210 Ga0105246_11889019 3300011119 Bacteria 573
211 Ga0157373_10068465 3300013100 Bacteria 2509
212 Ga0157370_10046942 3300013104 Bacteria 4140
213 Ga0157370_10714975 3300013104 Bacteria 914
214 Ga0157369_10006923 3300013105 Bacteria 13083
215 Ga0157369_10088736 3300013105 Bacteria 3301
216 Ga0157369_10468719 3300013105 Bacteria 1304
217 Ga0157374_11812568 3300013296 Bacteria 636
218 Ga0157378_10001939 3300013297 Bacteria 18555
219 Ga0157378_10145479 3300013297 Bacteria 2204
220 Ga0157378_11130993 3300013297 Bacteria 821
221 Ga0163162_10135398 3300013306 Bacteria 2574
222 Ga0157372_10001701 3300013307 Bacteria 23836
223 Ga0157372_10194718 3300013307 Bacteria 2348
224 Ga0157372_11599163 3300013307 Bacteria 750
225 Ga0157375_10958600 3300013308 Unclassified 997
226 Ga0157375_12746523 3300013308 Bacteria 589
227 Ga0163163_10000233 3300014325 Bacteria 57369
228 Ga0163163_10934259 3300014325 Bacteria 931
229 Ga0182008_10036638 3300014497 Bacteria 2454
230 Ga0157379_10114135 3300014968 Bacteria 2428
231 Ga0157379_10253593 3300014968 Bacteria 1598
232 Ga0157379_10541678 3300014968 Bacteria 1082
233 Ga0157376_10002010 3300014969 Bacteria 13636
234 Ga0157376_10313729 3300014969 Bacteria 1488
235 Ga0157376_10751074 3300014969 Bacteria 985
236 Ga0183369_1006 3300015685 Bacteria 449058
237 Ga0163161_10519404 3300017792 Bacteria 972
238 Ga0197907_10912049 3300020069 Bacteria 1944
239 Ga0206356_10352472 3300020070 Bacteria 3648
240 Ga0206354_11499460 3300020081 Bacteria 1784
241 Ga0206353_11950011 3300020082 Bacteria 6034
242 Ga0209435_122239 3300025206 Bacteria 611
243 Ga0209646_1005932 3300025246 Bacteria 2088
244 Ga0209026_1000713 3300025250 Bacteria 19613
245 Ga0209026_1003884 3300025250 Bacteria 4705
246 Ga0209759_1008135 3300025256 Bacteria 3301
247 Ga0207656_10001638 3300025321 Bacteria 7458
248 Ga0207656_10136113 3300025321 Bacteria 1154
249 Ga0207688_10586294 3300025901 Bacteria 702
250 Ga0207680_10000709 3300025903 Bacteria 15637
251 Ga0207680_10011774 3300025903 Bacteria 4432
252 Ga0207647_10000213 3300025904 Bacteria 47297
253 Ga0207647_10004386 3300025904 Bacteria 10466
254 Ga0207647_10142169 3300025904 Bacteria 1406
255 Ga0207684_10040217 3300025910 Bacteria 3964
256 Ga0207684_10113913 3300025910 Bacteria 2315
257 Ga0207654_10040991 3300025911 Bacteria 2612
258 Ga0207707_10632652 3300025912 Bacteria 903
259 Ga0207695_10001592 3300025913 Bacteria 36863
260 Ga0207695_10014854 3300025913 Bacteria 9194
261 Ga0207695_10069450 3300025913 Bacteria 3605
262 Ga0207695_10297618 3300025913 Bacteria 1505
263 Ga0207695_10468238 3300025913 Bacteria 1143
264 Ga0207695_10880146 3300025913 Bacteria 775
265 Ga0207671_10001137 3300025914 Bacteria 31975
266 Ga0207671_10237021 3300025914 Bacteria 1432
267 Ga0207671_10239000 3300025914 Bacteria 1426
268 Ga0207660_10182109 3300025917 Bacteria 1632
269 Ga0207662_10076680 3300025918 Bacteria 2032
270 Ga0207662_10567162 3300025918 Unclassified 787
271 Ga0207657_10018269 3300025919 Bacteria 6704
272 Ga0207649_10158148 3300025920 Bacteria 1568
273 Ga0207649_10452275 3300025920 Bacteria 969
274 Ga0207646_10016037 3300025922 Bacteria 7043
275 Ga0207646_10049031 3300025922 Bacteria 3783
276 Ga0207646_10074647 3300025922 Bacteria 3029
277 Ga0207681_10354082 3300025923 Bacteria 1176
278 Ga0207681_10513763 3300025923 Bacteria 982
279 Ga0207681_10951992 3300025923 Bacteria 720
280 Ga0207694_10007420 3300025924 Bacteria 8314
281 Ga0207694_10116027 3300025924 Bacteria 2134
282 Ga0207650_10027243 3300025925 Bacteria 4089
283 Ga0207687_10330183 3300025927 Bacteria 1237
284 Ga0207687_10759772 3300025927 Bacteria 825
285 Ga0207687_11011027 3300025927 Bacteria 713
286 Ga0207644_10089227 3300025931 Bacteria 2295
287 Ga0207644_10189142 3300025931 Bacteria 1618
288 Ga0207644_10270724 3300025931 Bacteria 1361
289 Ga0207690_10138322 3300025932 Bacteria 1791
290 Ga0207706_10001116 3300025933 Bacteria 27311
291 Ga0207706_10550815 3300025933 Bacteria 993
292 Ga0207706_10952496 3300025933 Bacteria 723
293 Ga0207686_11108276 3300025934 Bacteria 646
294 Ga0207704_10145120 3300025938 Bacteria 1666
295 Ga0207704_10819898 3300025938 Unclassified 778
296 Ga0207711_10546485 3300025941 Bacteria 1080
297 Ga0207689_10060550 3300025942 Bacteria 3113
298 Ga0207689_10300564 3300025942 Bacteria 1330
299 Ga0207689_11437114 3300025942 Bacteria 577
300 Ga0207661_10055918 3300025944 Bacteria 3166
301 Ga0207679_10428086 3300025945 Bacteria 1169
302 Ga0207667_10052006 3300025949 Bacteria 4316
303 Ga0207667_10391524 3300025949 Bacteria 1415
304 Ga0207667_10906379 3300025949 Bacteria 873
305 Ga0207651_10631597 3300025960 Bacteria 939
306 Ga0207712_10000302 3300025961 Bacteria 46123
307 Ga0207712_10743029 3300025961 Bacteria 859
308 Ga0207712_11092105 3300025961 Bacteria 710
309 Ga0207640_10004856 3300025981 Bacteria 7301
310 Ga0207640_10009948 3300025981 Bacteria 5341
311 Ga0207640_11502469 3300025981 Bacteria 605
312 Ga0207658_10068400 3300025986 Bacteria 2679
313 Ga0207658_10112907 3300025986 Bacteria 2152
314 Ga0207658_10406476 3300025986 Bacteria 1198
315 Ga0207658_10456250 3300025986 Bacteria 1132
316 Ga0207658_10749683 3300025986 Bacteria 884
317 Ga0207677_10432059 3300026023 Bacteria 1124
318 Ga0207703_10000456 3300026035 Bacteria 43004
319 Ga0207703_10083175 3300026035 Bacteria 2674
320 Ga0207703_10313532 3300026035 Bacteria 1434
321 Ga0207639_10004122 3300026041 Bacteria 9797
322 Ga0207639_10120845 3300026041 Bacteria 2152
323 Ga0207678_10004648 3300026067 Bacteria 12330
324 Ga0207678_10030815 3300026067 Bacteria 4684
325 Ga0207702_10226619 3300026078 Bacteria 1744
326 Ga0207641_10383615 3300026088 Bacteria 1346
327 Ga0207641_10710128 3300026088 Bacteria 990
328 Ga0207641_10732832 3300026088 Bacteria 975
329 Ga0207676_10008750 3300026095 Bacteria 7201
330 Ga0207676_10329489 3300026095 Bacteria 1405
331 Ga0207674_10003529 3300026116 Bacteria 19091
332 Ga0207674_10944031 3300026116 Bacteria 831
333 Ga0207675_100218394 3300026118 Bacteria 1836
334 Ga0207698_10170845 3300026142 Bacteria 1914
335 Ga0207698_10173059 3300026142 Bacteria 1904
336 Ga0207698_10239455 3300026142 Bacteria 1653
337 Ga0207698_10263945 3300026142 Bacteria 1583
338 Ga0207698_10531500 3300026142 Bacteria 1149
339 Ga0209974_10123221 3300027876 Bacteria 920
340 Ga0207428_10000132 3300027907 Bacteria 101581
341 Ga0207428_10000191 3300027907 Bacteria 85144
342 Ga0207428_10042583 3300027907 Bacteria 3671
343 Ga0207428_10132402 3300027907 Bacteria 1907
344 Ga0268266_10000006 3300028379 Bacteria 1410021
345 Ga0268265_10133648 3300028380 Bacteria 2066
346 Ga0268265_10568417 3300028380 Bacteria 1079
347 Ga0268265_10584412 3300028380 Bacteria 1065
348 Ga0268265_10677824 3300028380 Unclassified 994
349 Ga0268264_10036045 3300028381 Bacteria 4072
350 Ga0268264_10126869 3300028381 Bacteria 2256
351 Ga0268264_10318461 3300028381 Bacteria 1470
352 Ga0307509_10301765 3300031507 Bacteria 1349
353 Ga0316575_10001211 3300031665 Bacteria 8170
354 Ga0316575_10004002 3300031665 Bacteria 5161
355 Ga0316575_10065069 3300031665 Bacteria 1460
356 Ga0316579_10000213 3300031691 Bacteria 17409
357 Ga0316579_10001278 3300031691 Bacteria 9066
358 Ga0316579_10003171 3300031691 Bacteria 6362
359 Ga0316579_10020751 3300031691 Bacteria 2920
360 Ga0316579_10022481 3300031691 Bacteria 2819
361 Ga0316579_10418364 3300031691 Bacteria 648
362 Ga0316576_10065821 3300031727 Bacteria 2664
363 Ga0316576_10131743 3300031727 Bacteria 1881
364 Ga0316576_10703150 3300031727 Bacteria 732
365 Ga0316576_11134632 3300031727 Bacteria 553
366 Ga0316578_10030023 3300031728 Bacteria 3087
367 Ga0316578_10035994 3300031728 Bacteria 2848
368 Ga0316578_10069667 3300031728 Bacteria 2081
369 Ga0307516_10072071 3300031730 Bacteria 3315
370 Ga0307516_10147169 3300031730 Bacteria 2120
371 Ga0316577_10004883 3300031733 Bacteria 6979
372 Ga0316577_10009707 3300031733 Bacteria 5180
373 Ga0316577_10069332 3300031733 Bacteria 1970
374 Ga0307416_101570362 3300032002 Bacteria 763
375 Ga0307414_10193743 3300032004 Bacteria 1647
376 Ga0307411_10988732 3300032005 Bacteria 753
377 Ga0316583_10019824 3300032133 Bacteria 2411
378 Ga0316585_10000622 3300032137 Bacteria 8722
379 Ga0316585_10001194 3300032137 Bacteria 6782
380 Ga0316585_10106558 3300032137 Bacteria 921
381 Ga0316585_10114088 3300032137 Bacteria 888
382 Ga0316580_10000104 3300032139 Bacteria 15373
383 Ga0316580_10027022 3300032139 Bacteria 1774
384 Ga0316593_10000128 3300032168 Bacteria 10385
385 Ga0316593_10004553 3300032168 Bacteria 3570
386 Ga0316593_10005766 3300032168 Bacteria 3297
387 Ga0316593_10007801 3300032168 Bacteria 2955
388 Ga0316593_10017045 3300032168 Bacteria 2211
389 Ga0307507_10095975 3300033179 Bacteria 2511
390 Ga0316592_1024976 3300033524 Bacteria 1287
391 Ga0316588_1000304 3300033528 Bacteria 6154
392 Ga0316588_1085095 3300033528 Bacteria 785
393 Ga0316587_1014711 3300033529 Unclassified 1293
394 Ga0316587_1028899 3300033529 Bacteria 973
395 Ga0316596_1002274 3300033541 Bacteria 4075
396 Ga0316596_1038486 3300033541 Bacteria 1253
397 Ga0316596_1167182 3300033541 Bacteria 606
398 Ga0373938_0114020 3300034957 Bacteria 691
399 Ga0373929_0242321 3300035085 Bacteria 520
400 Ga0373940_0015461 3300035088 Bacteria 1877
401 Ga0373940_0078352 3300035088 Unclassified 973
402 Ga0373932_0041892 3300035112 Bacteria 1325
403 Ga0373932_0220832 3300035112 Bacteria 681
404 Ga0373939_0038790 3300035114 Bacteria 1423
405 Ga0373961_0252751 3300035241 Bacteria 638
406 Ga0373962_0031210 3300035242 Bacteria 1461
407 Ga0316574_0067282 3300035398 Bacteria 2258
408 Ga0316574_0124266 3300035398 Bacteria 1658
409 Ga0373931_0046435 3300035691 Bacteria 2296
410 Ga0316582_0032379 3300036647 Unclassified 3203
411 Ga0316582_0123930 3300036647 Bacteria 1732
412 Ga0316584_0010624 3300036712 Bacteria 6442
413 Ga0316584_0282272 3300036712 Bacteria 1206
414 Ga0316584_0386782 3300036712 Bacteria 999
415 Ga0316584_0719174 3300036712 Bacteria 683
416 Ga0316581_0008877 3300037588 Bacteria 2749
417 Ga0400484_22850 3300038725 Bacteria 14598
418 Ga0400490_57583 3300038726 Bacteria 17256
419 Ga0400488_07419 3300038741 Bacteria 21837
420 Ga0242420_042487 3300038996 Bacteria 871
421 Ga0400487_32542 3300039110 Bacteria 31777
422 Ga0451793_0110387 3300041452 Bacteria 3492
423 Ga0451802_0805771 3300041460 Bacteria 1092
424 Ga0451807_0321033 3300041486 Bacteria 1199
425 Ga0451807_1040393 3300041486 Bacteria 1407
426 Ga0451833_0920604 3300041491 Bacteria 602
427 Ga0451837_0036307 3300041494 Bacteria 3285
428 Ga0451843_1602175 3300041509 Bacteria 1379
429 Ga0451853_0732924 3300041512 Bacteria 1177
430 Ga0439444_0044608 3300042437 Bacteria 882
431 Ga0451577_0001990 3300042876 Bacteria 25566
432 Ga0451577_0637218 3300042876 Unclassified 967
433 Ga0453683_0017557 3300044673 Bacteria 4606
434 Ga0453684_0048429 3300044712 Bacteria 5621
435 Ga0451576_0011192 3300045051 Bacteria 10221
436 Ga0451576_0501914 3300045051 Bacteria 1274
437 Ga0451576_0517806 3300045051 Bacteria 1253
438 Ga0451576_0569146 3300045051 Unclassified 1190
439 Ga0495650_0002190 3300046471 Bacteria 16518
440 Ga0495580_0046106 3300046472 Bacteria 3094
441 Ga0495584_0562578 3300046491 Unclassified 581
442 Ga0495594_0301142 3300046499 Unclassified 913
443 Ga0495642_0108261 3300046528 Bacteria 1187
444 Ga0495659_0229809 3300046664 Bacteria 768
445 Ga0495636_0043964 3300047318 Bacteria 1859
446 Ga0496102_0584207 3300048905 Unclassified 1040
447 Ga0496106_0895865 3300048909 Bacteria 701
448 Ga0496109_1124794 3300048912 Bacteria 722
449 Ga0496112_0975533 3300048915 Bacteria 768
450 Ga0501031_0019624 3300049568 Bacteria 4403
451 Ga0501031_0257506 3300049568 Bacteria 1134
452 Ga0501032_0015994 3300049569 Bacteria 5282
453 Ga0501033_0027581 3300049570 Bacteria 4270
454 Ga0501033_0981852 3300049570 Unclassified 565
455 Ga0501034_0005990 3300049571 Bacteria 13153
456 Ga0501034_0326158 3300049571 Bacteria 1467
457 Ga0501034_0331919 3300049571 Bacteria 1452
458 Ga0501034_0350531 3300049571 Bacteria 1404
459 Ga0501036_0003128 3300049572 Bacteria 13203
460 Ga0501036_0022039 3300049572 Bacteria 5357
461 Ga0501036_0086471 3300049572 Bacteria 2650
462 Ga0501036_0091100 3300049572 Bacteria 2576
463 Ga0501036_0335312 3300049572 Bacteria 1263
464 Ga0501037_0039674 3300049573 Bacteria 3466
465 Ga0501037_0140033 3300049573 Bacteria 1732
466 Ga0501037_0331323 3300049573 Bacteria 1053
467 Ga0501038_0009568 3300049574 Bacteria 8892
468 Ga0501038_0015444 3300049574 Bacteria 6941
469 Ga0501038_0081243 3300049574 Bacteria 2731
470 Ga0501038_0436681 3300049574 Unclassified 1008
471 Ga0501038_0788299 3300049574 Bacteria 707
472 Ga0501039_0001204 3300049575 Bacteria 19002
473 Ga0501039_0105332 3300049575 Bacteria 2202
474 Ga0501039_0326390 3300049575 Bacteria 1206
475 Ga0501040_0002060 3300049576 Bacteria 12963
476 Ga0501040_0117878 3300049576 Bacteria 1861
477 Ga0501040_0121451 3300049576 Bacteria 1833
478 Ga0501041_0001770 3300049577 Bacteria 12110
479 Ga0501041_0017076 3300049577 Bacteria 4318
480 Ga0501041_0094034 3300049577 Unclassified 1851
481 Ga0501041_0988955 3300049577 Unclassified 541
482 Ga0501042_0000386 3300049578 Bacteria 22386
483 Ga0501042_0029398 3300049578 Bacteria 3875
484 Ga0501042_0066551 3300049578 Bacteria 2576
485 Ga0501042_0281572 3300049578 Bacteria 1201
486 Ga0501043_0012562 3300049579 Bacteria 6623
487 Ga0501043_0636821 3300049579 Bacteria 784
488 Ga0501046_0001020 3300049580 Bacteria 27338
489 Ga0501046_0018162 3300049580 Bacteria 5857
490 Ga0501046_0190679 3300049580 Bacteria 1529
491 Ga0501046_0223052 3300049580 Bacteria 1395
492 Ga0501046_0230347 3300049580 Bacteria 1369
493 Ga0501046_0350011 3300049580 Bacteria 1073
494 Ga0501047_0005171 3300049581 Bacteria 12245
495 Ga0501047_0005370 3300049581 Bacteria 12041
496 Ga0501047_0026545 3300049581 Bacteria 5573
497 Ga0501047_0166101 3300049581 Bacteria 2077
498 Ga0501048_0003447 3300049582 Bacteria 12020
499 Ga0501048_0221638 3300049582 Bacteria 1342
500 Ga0501048_0621925 3300049582 Unclassified 775
501 Ga0501067_0001808 3300049583 Bacteria 11761
502 Ga0501067_0218154 3300049583 Bacteria 1062
503 Ga0501068_0011271 3300049584 Bacteria 5043
504 Ga0501068_0029702 3300049584 Bacteria 3239
505 Ga0501068_0031760 3300049584 Bacteria 3137
506 Ga0501068_0172899 3300049584 Unclassified 1364
507 Ga0501068_0695056 3300049584 Bacteria 665
508 Ga0501069_0015898 3300049585 Bacteria 4034
509 Ga0501069_0077714 3300049585 Bacteria 1866
510 Ga0501070_0005922 3300049586 Bacteria 10427
511 Ga0501070_0062098 3300049586 Bacteria 3095
512 Ga0501070_0068413 3300049586 Bacteria 2939
513 Ga0501070_0090441 3300049586 Bacteria 2533
514 Ga0501070_0102894 3300049586 Bacteria 2362
515 Ga0501070_0173178 3300049586 Bacteria 1777
516 Ga0501071_0000527 3300049587 Bacteria 19563
517 Ga0501071_0070111 3300049587 Bacteria 2553
518 Ga0501071_0413491 3300049587 Unclassified 1030
519 Ga0501072_0000490 3300049588 Bacteria 28398
520 Ga0501072_0002408 3300049588 Bacteria 14031
521 Ga0501072_0002667 3300049588 Bacteria 13380
522 Ga0501072_0243285 3300049588 Bacteria 1433
523 Ga0501072_0393684 3300049588 Unclassified 1099
524 Ga0501073_0001173 3300049589 Bacteria 19136
525 Ga0501073_0031856 3300049589 Bacteria 3761
526 Ga0501073_0075507 3300049589 Bacteria 2346
527 Ga0501073_0085716 3300049589 Bacteria 2191
528 Ga0501074_0002957 3300049590 Bacteria 11941
529 Ga0501074_0037472 3300049590 Bacteria 3514
530 Ga0501074_0040635 3300049590 Bacteria 3368
531 Ga0501074_0061900 3300049590 Bacteria 2696
532 Ga0501074_0065846 3300049590 Bacteria 2607
533 Ga0501074_0103720 3300049590 Bacteria 2036
534 Ga0501075_0000963 3300049591 Bacteria 18333
535 Ga0501075_0005521 3300049591 Bacteria 8650
536 Ga0501075_0048022 3300049591 Bacteria 3208
537 Ga0501075_0264187 3300049591 Bacteria 1312
538 Ga0501075_1491952 3300049591 Bacteria 512
539 Ga0501076_0000025 3300049592 Bacteria 78281
540 Ga0501076_0003248 3300049592 Bacteria 11375
541 Ga0501076_0090249 3300049592 Bacteria 2464
542 Ga0501076_0152162 3300049592 Bacteria 1882
543 Ga0501076_0441124 3300049592 Bacteria 1072
544 Ga0501076_1287404 3300049592 Bacteria 601
545 Ga0501077_0000479 3300049593 Bacteria 24334
546 Ga0501077_0072957 3300049593 Unclassified 2175
547 Ga0501077_0111221 3300049593 Bacteria 1736
548 Ga0501079_0003206 3300049741 Bacteria 11980
549 Ga0501079_0014426 3300049741 Bacteria 6024
550 Ga0501079_0170289 3300049741 Unclassified 1698
551 Ga0501079_0179708 3300049741 Bacteria 1651
552 Ga0501079_0231576 3300049741 Bacteria 1443
553 Ga0501079_0544713 3300049741 Bacteria 912
554 Ga0501079_1031161 3300049741 Bacteria 648
555 Ga0501080_0000259 3300049742 Bacteria 40024
556 Ga0501080_0001523 3300049742 Bacteria 19572
557 Ga0501080_0003049 3300049742 Bacteria 14788
558 Ga0501080_0007456 3300049742 Bacteria 9875
559 Ga0501080_0038158 3300049742 Bacteria 4486
560 Ga0501080_0116182 3300049742 Bacteria 2480
561 Ga0501080_0399802 3300049742 Bacteria 1236
562 Ga0501080_0654415 3300049742 Bacteria 929
563 Ga0501080_1084004 3300049742 Bacteria 692
564 Ga0501080_1493775 3300049742 Bacteria 574
565 Ga0501081_0002117 3300049743 Bacteria 12419
566 Ga0501081_0010131 3300049743 Bacteria 6150
567 Ga0501081_0059771 3300049743 Bacteria 2639
568 Ga0501081_0917660 3300049743 Bacteria 661
569 Ga0501081_1386817 3300049743 Bacteria 533
570 Ga0501083_0000670 3300049744 Bacteria 22251
571 Ga0501083_0097077 3300049744 Bacteria 1944
572 Ga0501083_0543778 3300049744 Bacteria 756
573 Ga0501083_0631760 3300049744 Bacteria 696
574 Ga0501083_0686501 3300049744 Bacteria 666
575 Ga0501035_0012988 3300049822 Bacteria 7684
576 Ga0501035_0156756 3300049822 Bacteria 1973
577 Ga0501035_0210886 3300049822 Bacteria 1662
578 Ga0501035_0272465 3300049822 Bacteria 1432
579 Ga0501035_0593833 3300049822 Unclassified 903
580 Ga0501044_0005560 3300049823 Bacteria 13993
581 Ga0501044_0473568 3300049823 Bacteria 1156
582 Ga0501044_0715353 3300049823 Bacteria 886
583 Ga0501044_1395516 3300049823 Unclassified 566
584 Ga0501045_0004878 3300049824 Bacteria 9288
585 Ga0501045_0021372 3300049824 Bacteria 4628
586 Ga0501045_0079594 3300049824 Bacteria 2416
587 nmdc:mga05p37_11922_c1 3300050507 Bacteria 10366
588 nmdc:mga05p37_1230541_c1 3300050507 Bacteria 770
589 nmdc:mga05p37_1253912_c1 3300050507 Bacteria 760
590 nmdc:mga05p37_149283_c1 3300050507 Bacteria 2860
591 nmdc:mga05p37_19514_c1 3300050507 Bacteria 8201
592 nmdc:mga05p37_296946_c1 3300050507 Bacteria 1921
593 nmdc:mga05p37_36755_c1 3300050507 Bacteria 6007
594 nmdc:mga05p37_580703_c1 3300050507 Bacteria 1269
595 nmdc:mga05p37_6342_c1 3300050507 Bacteria 13931
596 nmdc:mga09592_26898_c1 3300050508 Bacteria 4770
597 nmdc:mga09592_292633_c1 3300050508 Bacteria 1412
598 nmdc:mga09592_40441_c1 3300050508 Bacteria 3917
599 nmdc:mga09592_802109_c1 3300050508 Bacteria 796
600 nmdc:mga09592_877569_c1 3300050508 Bacteria 755
601 nmdc:mga0qj67_10839_c1 3300050509 Bacteria 6819
602 nmdc:mga0qj67_581328_c1 3300050509 Bacteria 897
603 nmdc:mga06r32_1110662_c1 3300050510 Bacteria 739
604 nmdc:mga06r32_169302_c1 3300050510 Bacteria 2168
605 nmdc:mga06r32_182642_c1 3300050510 Unclassified 2084
606 nmdc:mga06r32_30808_c1 3300050510 Bacteria 5034
607 nmdc:mga08y16_1084_c1 3300050511 Bacteria 26806
608 nmdc:mga08y16_12068_c1 3300050511 Bacteria 9078
609 nmdc:mga08y16_1756401_c1 3300050511 Unclassified 574
610 nmdc:mga08y16_627_c1 3300050511 Bacteria 33082
611 nmdc:mga0n895_1061924_c1 3300050512 Bacteria 789
612 nmdc:mga0n895_113467_c1 3300050512 Bacteria 2728
613 nmdc:mga0n895_12448_c1 3300050512 Bacteria 7633
614 nmdc:mga0n895_1630145_c1 3300050512 Unclassified 609
615 nmdc:mga0n895_197693_c1 3300050512 Bacteria 2042
616 nmdc:mga0n895_2198592_c1 3300050512 Bacteria 507
617 nmdc:mga0n895_357627_c1 3300050512 Bacteria 1479
618 nmdc:mga0n895_41896_c1 3300050512 Bacteria 4453
619 nmdc:mga0n895_7770_c1 3300050512 Bacteria 9239
620 nmdc:mga0n895_7870_c1 3300050512 Bacteria 9190
621 nmdc:mga0rr50_136265_c1 3300050513 Unclassified 1971
622 nmdc:mga0rr50_27778_c1 3300050513 Bacteria 3968
623 nmdc:mga0rr50_87179_c1 3300050513 Bacteria 2423
624 nmdc:mga0rr50_9660_c1 3300050513 Bacteria 6080
625 nmdc:mga08x19_299558_c1 3300050514 Bacteria 1117
626 nmdc:mga08x19_809877_c1 3300050514 Bacteria 665
627 nmdc:mga0a205_12953_c1 3300050515 Bacteria 7740
628 nmdc:mga0a205_164034_c1 3300050515 Unclassified 2118
629 nmdc:mga0a205_22188_c1 3300050515 Bacteria 6010
630 nmdc:mga0a205_23462_c1 3300050515 Bacteria 3256
631 nmdc:mga0a205_373165_c1 3300050515 Bacteria 1292
632 nmdc:mga0a205_382471_c1 3300050515 Bacteria 1273
633 nmdc:mga0a205_42716_c1 3300050515 Bacteria 4368
634 nmdc:mga0a205_52330_c1 3300050515 Bacteria 3941
635 nmdc:mga0a205_54783_c1 3300050515 Bacteria 2566
636 nmdc:mga0a205_662_c1 3300050515 Bacteria 27442
637 nmdc:mga0a205_74817_c1 3300050515 Bacteria 3272
638 nmdc:mga0a205_780778_c1 3300050515 Bacteria 803
639 nmdc:mga0a205_998020_c1 3300050515 Bacteria 684
640 Ga0500651_0000033 3300053093 Bacteria 108567
641 Ga0501084_0001491 3300054114 Bacteria 18602
642 Ga0501084_0071042 3300054114 Bacteria 2914
643 Ga0501084_0120351 3300054114 Bacteria 2207
644 Ga0501084_0131948 3300054114 Unclassified 2103
645 Ga0501084_0211768 3300054114 Bacteria 1635
646 Ga0501084_1449675 3300054114 Bacteria 575
647 Ga0501082_0002170 3300060353 Bacteria 17200
648 Ga0501082_0004672 3300060353 Bacteria 11944
649 Ga0501082_0030804 3300060353 Bacteria 4624
650 Ga0501082_0076339 3300060353 Bacteria 2888
651 Ga0501082_0278231 3300060353 Bacteria 1457
652 Ga0501082_0312083 3300060353 Unclassified 1369
653 Ga0501082_0398612 3300060353 Bacteria 1201
654 Ga0501082_0732892 3300060353 Bacteria 865
655 Ga0530510_0000006 3300061734 Bacteria 180585
656 Ga0530510_0000939 3300061734 Bacteria 19234
657 Ga0530510_0001824 3300061734 Bacteria 14537
658 Ga0530510_0035898 3300061734 Bacteria 3573
659 Ga0530510_0090053 3300061734 Bacteria 2237
660 Ga0530510_0265192 3300061734 Bacteria 1281
661 Ga0105238_10203067
662 JGI24740J21852_10150144
663 JGI24744J21845_10004789
664 JGI25156J39149_1008652
665 JGI25157J39369_1001451
666 Ga0065707_10109909
667 Ga0065707_10707990
668 Ga0070658_10316775
669 Ga0070683_100048065
670 Ga0070690_100350765
671 Ga0070670_100010150
672 Ga0068869_100039908
673 Ga0068869_100328397
674 Ga0070666_10000119
675 Ga0070666_10000349
676 Ga0070666_10016973
677 Ga0070680_100502969
678 Ga0070682_100076363
679 Ga0068868_100152487
680 Ga0068868_101661488
681 Ga0070660_100558337
682 Ga0070689_100244246
683 Ga0070687_100192943
684 Ga0070687_100534878
685 Ga0070661_100053715
686 Ga0070669_100103540
687 Ga0070669_100759021
688 Ga0070671_100860609
689 Ga0070673_100308062
690 Ga0070688_100315711
691 Ga0070659_100163918
692 Ga0070659_101295033
693 Ga0070667_100072472
694 Ga0070667_100080250
695 Ga0070667_100249356
696 Ga0070667_101621286
697 Ga0070703_10542493
698 Ga0070701_10177306
699 Ga0070705_100004571
700 Ga0070694_100951969
701 Ga0070694_101711559
702 Ga0070708_100142813
703 Ga0070708_100146827
704 Ga0070708_100220539
705 Ga0070708_100451427
706 Ga0070708_100846621
707 Ga0070708_101152751
708 Ga0070663_100006777
709 Ga0070663_100036592
710 Ga0070663_101341590
711 Ga0070662_100074819
712 Ga0070662_100106073
713 Ga0070681_10223611
714 Ga0070681_11624525
715 Ga0068867_100026742
716 Ga0070706_100086577
717 Ga0070706_101600280
718 Ga0070707_100056191
719 Ga0070707_100193242
720 Ga0070707_100377849
721 Ga0070698_100292662
722 Ga0070699_100035546
723 Ga0070699_100070229
724 Ga0070699_100080905
725 Ga0070699_100091778
726 Ga0070697_100009769
727 Ga0070697_100087342
728 Ga0070697_100236679
729 Ga0070697_101630321
730 Ga0068853_100235999
731 Ga0068853_100726140
732 Ga0070686_100193917
733 Ga0070686_101895077
734 Ga0070695_100645501
735 Ga0070696_100283289
736 Ga0070696_100304780
737 Ga0070696_100847134
738 Ga0070693_100012438
739 Ga0070693_100518728
740 Ga0070665_100000227
741 Ga0070704_100338600
742 Ga0068855_100011861
743 Ga0068855_100644711
744 Ga0070664_100313637
745 Ga0070664_100788772
746 Ga0068854_100016559
747 Ga0068854_100062414
748 Ga0068854_101635790
749 Ga0068856_100396113
750 Ga0070702_101259236
751 Ga0068852_100005316
752 Ga0068852_100016040
753 Ga0068852_100212374
754 Ga0068852_100387026
755 Ga0068859_100227775
756 Ga0068859_100774535
757 Ga0068859_102495910
758 Ga0068864_100020561
759 Ga0068864_100716891
760 Ga0068866_10506220
761 Ga0068861_100458337
762 Ga0068851_10004560
763 Ga0068851_10017031
764 Ga0068863_100032498
765 Ga0068863_100179716
766 Ga0068863_100362126
767 Ga0068863_100596191
768 Ga0068858_100001997
769 Ga0068860_100008623
770 Ga0068860_100067303
771 Ga0068862_100058372
772 Ga0068862_100381848
773 Ga0068862_100644855
774 Ga0068862_100951319
775 Ga0081455_10203449
776 Ga0081538_10068122
777 Ga0097621_100101820
778 Ga0097621_100391538
779 Ga0097621_100474939
780 Ga0068871_100039261
781 Ga0068871_100087602
782 Ga0068871_100273471
783 Ga0068871_100947583
784 Ga0068871_101797812
785 Ga0075428_100027803
786 Ga0075428_100063388
787 Ga0075428_100457140
788 Ga0075428_101071510
789 Ga0075430_100005820
790 Ga0075430_100666383
791 Ga0075431_100095596
792 Ga0075431_100129557
793 Ga0075431_100208994
794 Ga0075433_10000019
795 Ga0075433_10040798
796 Ga0075433_10046972
797 Ga0075433_10062154
798 Ga0075433_10074191
799 Ga0075433_10388587
800 Ga0075433_10737211
801 Ga0075433_10839155
802 Ga0075433_10883737
803 Ga0075433_10911399
804 Ga0075434_100000806
805 Ga0075434_100008901
806 Ga0075434_100067279
807 Ga0075434_100120227
808 Ga0075434_100437689
809 Ga0075434_100614956
810 Ga0075434_100782992
811 Ga0075434_101498732
812 Ga0075434_102180025
813 Ga0075429_100014375
814 Ga0075429_100056126
815 Ga0075429_100278643
816 Ga0068865_100035799
817 Ga0075436_100181473
818 Ga0075436_101108536
819 Ga0097620_100227773
820 Ga0097620_100774535
821 Ga0097620_102496007
822 Ga0075435_100017497
823 Ga0075435_100025454
824 Ga0075435_100218552
825 Ga0075435_100278194
826 Ga0099794_10057052
827 Ga0099794_10564557
828 Ga0099794_10773602
829 Ga0105240_10013778
830 Ga0105240_10014864
831 Ga0105240_10224946
832 Ga0105240_11026124
833 Ga0111539_10004379
834 Ga0111539_10005631
835 Ga0111539_10024208
836 Ga0111539_10203174
837 Ga0105245_10168348
838 Ga0114129_10000934
839 Ga0114129_10029177
840 Ga0114129_10065832
841 Ga0114129_10120112
842 Ga0114129_10177329
843 Ga0114129_10292562
844 Ga0114129_10313650
845 Ga0114129_10486877
846 Ga0114129_10991194
847 Ga0114129_11142176
848 Ga0105243_10760048
849 Ga0105241_10045134
850 Ga0105241_10060576
851 Ga0105242_10271272
852 Ga0105248_10394162
853 Ga0105248_11117487
854 Ga0105237_10001820
855 Ga0105237_10137271
856 Ga0105237_10259920
857 Ga0105237_10338175
858 Ga0105238_10018113
859 Ga0105238_10170882
860 Ga0105238_11522103
861 Ga0105238_12262372
862 Ga0105249_10830502
863 Ga0105249_11288911
864 Ga0105249_11891573
865 Ga0105239_10259065
866 Ga0105239_10311401
867 Ga0105239_10455089
868 Ga0105239_12285662
869 Ga0105246_10052175
870 Ga0105246_11889019
871 Ga0157373_10068465
872 Ga0157370_10046942
873 Ga0157370_10714975
874 Ga0157369_10006923
875 Ga0157369_10088736
876 Ga0157369_10468719
877 Ga0157374_11812568
878 Ga0157378_10001939
879 Ga0157378_10145479
880 Ga0157378_11130993
881 Ga0163162_10135398
882 Ga0157372_10001701
883 Ga0157372_10194718
884 Ga0157372_11599163
885 Ga0157375_10958600
886 Ga0157375_12746523
887 Ga0163163_10000233
888 Ga0163163_10934259
889 Ga0182008_10036638
890 Ga0157379_10114135
891 Ga0157379_10253593
892 Ga0157379_10541678
893 Ga0157376_10002010
894 Ga0157376_10313729
895 Ga0157376_10751074
896 Ga0183369_1006
897 Ga0163161_10519404
898 Ga0197907_10912049
899 Ga0206356_10352472
900 Ga0206354_11499460
901 Ga0206353_11950011
902 Ga0209435_122239
903 Ga0209646_1005932
904 Ga0209026_1000713
905 Ga0209026_1003884
906 Ga0209759_1008135
907 Ga0207656_10001638
908 Ga0207656_10136113
909 Ga0207688_10586294
910 Ga0207680_10000709
911 Ga0207680_10011774
912 Ga0207647_10000213
913 Ga0207647_10004386
914 Ga0207647_10142169
915 Ga0207684_10040217
916 Ga0207684_10113913
917 Ga0207654_10040991
918 Ga0207707_10632652
919 Ga0207695_10001592
920 Ga0207695_10014854
921 Ga0207695_10069450
922 Ga0207695_10297618
923 Ga0207695_10468238
924 Ga0207695_10880146
925 Ga0207671_10001137
926 Ga0207671_10237021
927 Ga0207671_10239000
928 Ga0207660_10182109
929 Ga0207662_10076680
930 Ga0207662_10567162
931 Ga0207657_10018269
932 Ga0207649_10158148
933 Ga0207649_10452275
934 Ga0207646_10016037
935 Ga0207646_10049031
936 Ga0207646_10074647
937 Ga0207681_10354082
938 Ga0207681_10513763
939 Ga0207681_10951992
940 Ga0207694_10007420
941 Ga0207694_10116027
942 Ga0207650_10027243
943 Ga0207687_10330183
944 Ga0207687_10759772
945 Ga0207687_11011027
946 Ga0207644_10089227
947 Ga0207644_10189142
948 Ga0207644_10270724
949 Ga0207690_10138322
950 Ga0207706_10001116
951 Ga0207706_10550815
952 Ga0207706_10952496
953 Ga0207686_11108276
954 Ga0207704_10145120
955 Ga0207704_10819898
956 Ga0207711_10546485
957 Ga0207689_10060550
958 Ga0207689_10300564
959 Ga0207689_11437114
960 Ga0207661_10055918
961 Ga0207679_10428086
962 Ga0207667_10052006
963 Ga0207667_10391524
964 Ga0207667_10906379
965 Ga0207651_10631597
966 Ga0207712_10000302
967 Ga0207712_10743029
968 Ga0207712_11092105
969 Ga0207640_10004856
970 Ga0207640_10009948
971 Ga0207640_11502469
972 Ga0207658_10068400
973 Ga0207658_10112907
974 Ga0207658_10406476
975 Ga0207658_10456250
976 Ga0207658_10749683
977 Ga0207677_10432059
978 Ga0207703_10000456
979 Ga0207703_10083175
980 Ga0207703_10313532
981 Ga0207639_10004122
982 Ga0207639_10120845
983 Ga0207678_10004648
984 Ga0207678_10030815
985 Ga0207702_10226619
986 Ga0207641_10383615
987 Ga0207641_10710128
988 Ga0207641_10732832
989 Ga0207676_10008750
990 Ga0207676_10329489
991 Ga0207674_10003529
992 Ga0207674_10944031
993 Ga0207675_100218394
994 Ga0207698_10170845
995 Ga0207698_10173059
996 Ga0207698_10239455
997 Ga0207698_10263945
998 Ga0207698_10531500
999 Ga0209974_10123221
1000 Ga0207428_10000132
1001 Ga0207428_10000191
1002 Ga0207428_10042583
1003 Ga0207428_10132402
1004 Ga0268266_10000006
1005 Ga0268265_10133648
1006 Ga0268265_10568417
1007 Ga0268265_10584412
1008 Ga0268265_10677824
1009 Ga0268264_10036045
1010 Ga0268264_10126869
1011 Ga0268264_10318461
1012 Ga0307509_10301765
1013 Ga0316575_10001211
1014 Ga0316575_10004002
1015 Ga0316575_10065069
1016 Ga0316579_10000213
1017 Ga0316579_10001278
1018 Ga0316579_10003171
1019 Ga0316579_10020751
1020 Ga0316579_10022481
1021 Ga0316579_10418364
1022 Ga0316576_10065821
1023 Ga0316576_10131743
1024 Ga0316576_10703150
1025 Ga0316576_11134632
1026 Ga0316578_10030023
1027 Ga0316578_10035994
1028 Ga0316578_10069667
1029 Ga0307516_10072071
1030 Ga0307516_10147169
1031 Ga0316577_10004883
1032 Ga0316577_10009707
1033 Ga0316577_10069332
1034 Ga0307416_101570362
1035 Ga0307414_10193743
1036 Ga0307411_10988732
1037 Ga0316583_10019824
1038 Ga0316585_10000622
1039 Ga0316585_10001194
1040 Ga0316585_10106558
1041 Ga0316585_10114088
1042 Ga0316580_10000104
1043 Ga0316580_10027022
1044 Ga0316593_10000128
1045 Ga0316593_10004553
1046 Ga0316593_10005766
1047 Ga0316593_10007801
1048 Ga0316593_10017045
1049 Ga0307507_10095975
1050 Ga0316592_1024976
1051 Ga0316588_1000304
1052 Ga0316588_1085095
1053 Ga0316587_1014711
1054 Ga0316587_1028899
1055 Ga0316596_1002274
1056 Ga0316596_1038486
1057 Ga0316596_1167182
1058 Ga0373938_0114020
1059 Ga0373929_0242321
1060 Ga0373940_0015461
1061 Ga0373940_0078352
1062 Ga0373932_0041892
1063 Ga0373932_0220832
1064 Ga0373939_0038790
1065 Ga0373961_0252751
1066 Ga0373962_0031210
1067 Ga0316574_0067282
1068 Ga0316574_0124266
1069 Ga0373931_0046435
1070 Ga0316582_0032379
1071 Ga0316582_0123930
1072 Ga0316584_0010624
1073 Ga0316584_0282272
1074 Ga0316584_0386782
1075 Ga0316584_0719174
1076 Ga0316581_0008877
1077 Ga0400484_22850
1078 Ga0400490_57583
1079 Ga0400488_07419
1080 Ga0242420_042487
1081 Ga0400487_32542
1082 Ga0451793_0110387
1083 Ga0451802_0805771
1084 Ga0451807_0321033
1085 Ga0451807_1040393
1086 Ga0451833_0920604
1087 Ga0451837_0036307
1088 Ga0451843_1602175
1089 Ga0451853_0732924
1090 Ga0439444_0044608
1091 Ga0451577_0001990
1092 Ga0451577_0637218
1093 Ga0453683_0017557
1094 Ga0453684_0048429
1095 Ga0451576_0011192
1096 Ga0451576_0501914
1097 Ga0451576_0517806
1098 Ga0451576_0569146
1099 Ga0495650_0002190
1100 Ga0495580_0046106
1101 Ga0495584_0562578
1102 Ga0495594_0301142
1103 Ga0495642_0108261
1104 Ga0495659_0229809
1105 Ga0495636_0043964
1106 Ga0496102_0584207
1107 Ga0496106_0895865
1108 Ga0496109_1124794
1109 Ga0496112_0975533
1110 Ga0501031_0019624
1111 Ga0501031_0257506
1112 Ga0501032_0015994
1113 Ga0501033_0027581
1114 Ga0501033_0981852
1115 Ga0501034_0005990
1116 Ga0501034_0326158
1117 Ga0501034_0331919
1118 Ga0501034_0350531
1119 Ga0501036_0003128
1120 Ga0501036_0022039
1121 Ga0501036_0086471
1122 Ga0501036_0091100
1123 Ga0501036_0335312
1124 Ga0501037_0039674
1125 Ga0501037_0140033
1126 Ga0501037_0331323
1127 Ga0501038_0009568
1128 Ga0501038_0015444
1129 Ga0501038_0081243
1130 Ga0501038_0436681
1131 Ga0501038_0788299
1132 Ga0501039_0001204
1133 Ga0501039_0105332
1134 Ga0501039_0326390
1135 Ga0501040_0002060
1136 Ga0501040_0117878
1137 Ga0501040_0121451
1138 Ga0501041_0001770
1139 Ga0501041_0017076
1140 Ga0501041_0094034
1141 Ga0501041_0988955
1142 Ga0501042_0000386
1143 Ga0501042_0029398
1144 Ga0501042_0066551
1145 Ga0501042_0281572
1146 Ga0501043_0012562
1147 Ga0501043_0636821
1148 Ga0501046_0001020
1149 Ga0501046_0018162
1150 Ga0501046_0190679
1151 Ga0501046_0223052
1152 Ga0501046_0230347
1153 Ga0501046_0350011
1154 Ga0501047_0005171
1155 Ga0501047_0005370
1156 Ga0501047_0026545
1157 Ga0501047_0166101
1158 Ga0501048_0003447
1159 Ga0501048_0221638
1160 Ga0501048_0621925
1161 Ga0501067_0001808
1162 Ga0501067_0218154
1163 Ga0501068_0011271
1164 Ga0501068_0029702
1165 Ga0501068_0031760
1166 Ga0501068_0172899
1167 Ga0501068_0695056
1168 Ga0501069_0015898
1169 Ga0501069_0077714
1170 Ga0501070_0005922
1171 Ga0501070_0062098
1172 Ga0501070_0068413
1173 Ga0501070_0090441
1174 Ga0501070_0102894
1175 Ga0501070_0173178
1176 Ga0501071_0000527
1177 Ga0501071_0070111
1178 Ga0501071_0413491
1179 Ga0501072_0000490
1180 Ga0501072_0002408
1181 Ga0501072_0002667
1182 Ga0501072_0243285
1183 Ga0501072_0393684
1184 Ga0501073_0001173
1185 Ga0501073_0031856
1186 Ga0501073_0075507
1187 Ga0501073_0085716
1188 Ga0501074_0002957
1189 Ga0501074_0037472
1190 Ga0501074_0040635
1191 Ga0501074_0061900
1192 Ga0501074_0065846
1193 Ga0501074_0103720
1194 Ga0501075_0000963
1195 Ga0501075_0005521
1196 Ga0501075_0048022
1197 Ga0501075_0264187
1198 Ga0501075_1491952
1199 Ga0501076_0000025
1200 Ga0501076_0003248
1201 Ga0501076_0090249
1202 Ga0501076_0152162
1203 Ga0501076_0441124
1204 Ga0501076_1287404
1205 Ga0501077_0000479
1206 Ga0501077_0072957
1207 Ga0501077_0111221
1208 Ga0501079_0003206
1209 Ga0501079_0014426
1210 Ga0501079_0170289
1211 Ga0501079_0179708
1212 Ga0501079_0231576
1213 Ga0501079_0544713
1214 Ga0501079_1031161
1215 Ga0501080_0000259
1216 Ga0501080_0001523
1217 Ga0501080_0003049
1218 Ga0501080_0007456
1219 Ga0501080_0038158
1220 Ga0501080_0116182
1221 Ga0501080_0399802
1222 Ga0501080_0654415
1223 Ga0501080_1084004
1224 Ga0501080_1493775
1225 Ga0501081_0002117
1226 Ga0501081_0010131
1227 Ga0501081_0059771
1228 Ga0501081_0917660
1229 Ga0501081_1386817
1230 Ga0501083_0000670
1231 Ga0501083_0097077
1232 Ga0501083_0543778
1233 Ga0501083_0631760
1234 Ga0501083_0686501
1235 Ga0501035_0012988
1236 Ga0501035_0156756
1237 Ga0501035_0210886
1238 Ga0501035_0272465
1239 Ga0501035_0593833
1240 Ga0501044_0005560
1241 Ga0501044_0473568
1242 Ga0501044_0715353
1243 Ga0501044_1395516
1244 Ga0501045_0004878
1245 Ga0501045_0021372
1246 Ga0501045_0079594
1247 nmdc:mga05p37_11922_c1
1248 nmdc:mga05p37_1230541_c1
1249 nmdc:mga05p37_1253912_c1
1250 nmdc:mga05p37_149283_c1
1251 nmdc:mga05p37_19514_c1
1252 nmdc:mga05p37_296946_c1
1253 nmdc:mga05p37_36755_c1
1254 nmdc:mga05p37_580703_c1
1255 nmdc:mga05p37_6342_c1
1256 nmdc:mga09592_26898_c1
1257 nmdc:mga09592_292633_c1
1258 nmdc:mga09592_40441_c1
1259 nmdc:mga09592_802109_c1
1260 nmdc:mga09592_877569_c1
1261 nmdc:mga0qj67_10839_c1
1262 nmdc:mga0qj67_581328_c1
1263 nmdc:mga06r32_1110662_c1
1264 nmdc:mga06r32_169302_c1
1265 nmdc:mga06r32_182642_c1
1266 nmdc:mga06r32_30808_c1
1267 nmdc:mga08y16_1084_c1
1268 nmdc:mga08y16_12068_c1
1269 nmdc:mga08y16_1756401_c1
1270 nmdc:mga08y16_627_c1
1271 nmdc:mga0n895_1061924_c1
1272 nmdc:mga0n895_113467_c1
1273 nmdc:mga0n895_12448_c1
1274 nmdc:mga0n895_1630145_c1
1275 nmdc:mga0n895_197693_c1
1276 nmdc:mga0n895_2198592_c1
1277 nmdc:mga0n895_357627_c1
1278 nmdc:mga0n895_41896_c1
1279 nmdc:mga0n895_7770_c1
1280 nmdc:mga0n895_7870_c1
1281 nmdc:mga0rr50_136265_c1
1282 nmdc:mga0rr50_27778_c1
1283 nmdc:mga0rr50_87179_c1
1284 nmdc:mga0rr50_9660_c1
1285 nmdc:mga08x19_299558_c1
1286 nmdc:mga08x19_809877_c1
1287 nmdc:mga0a205_12953_c1
1288 nmdc:mga0a205_164034_c1
1289 nmdc:mga0a205_22188_c1
1290 nmdc:mga0a205_23462_c1
1291 nmdc:mga0a205_373165_c1
1292 nmdc:mga0a205_382471_c1
1293 nmdc:mga0a205_42716_c1
1294 nmdc:mga0a205_52330_c1
1295 nmdc:mga0a205_54783_c1
1296 nmdc:mga0a205_662_c1
1297 nmdc:mga0a205_74817_c1
1298 nmdc:mga0a205_780778_c1
1299 nmdc:mga0a205_998020_c1
1300 Ga0500651_0000033
1301 Ga0501084_0001491
1302 Ga0501084_0071042
1303 Ga0501084_0120351
1304 Ga0501084_0131948
1305 Ga0501084_0211768
1306 Ga0501084_1449675
1307 Ga0501082_0002170
1308 Ga0501082_0004672
1309 Ga0501082_0030804
1310 Ga0501082_0076339
1311 Ga0501082_0278231
1312 Ga0501082_0312083
1313 Ga0501082_0398612
1314 Ga0501082_0732892
1315 Ga0530510_0000006
1316 Ga0530510_0000939
1317 Ga0530510_0001824
1318 Ga0530510_0035898
1319 Ga0530510_0090053
1320 Ga0530510_0265192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

3

112

0.96

PF01230

HIT

HIT domain

11

110

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d6j-assembly1.cif.gz_A crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 0.9851 4 114
5waa-assembly1.cif.gz_B human histidine triad nucleotide binding protein 1 (hhint1) c84r mutant 0.9771 2 114
6j65-assembly1.cif.gz_B crystal structure of human hint1 mutant complexing with ap4a ii 0.9752 2 114
6ypx-assembly1.cif.gz_AAA human histidine triad nucleotide-binding protein 2 (hhint2) refined to 2.11 a in c2221 space group 0.9744 1 114
1kpc-assembly1.cif.gz_B pkci-1-apo+zinc 0.9734 3 114
ID Description Score Start End Superfamily
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9734 3 114 3.30.428.10
af_Q8STA5_22_150_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9654 1 114 3.30.428.10
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9649 3 114 3.30.428.10
af_I1MGX8_45_178_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9642 4 114 3.30.428.10
4eguB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.964 1 108 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A064A739-F1-model_v4 HIT family hydrolase 0.9914 4 110 GO:0016787
AF-A0A2E6AX68-F1-model_v4 Histidine triad nucleotide-binding protein 0.9906 3 114 GO:0003824
AF-A0A838Q3Z8-F1-model_v4 Histidine triad nucleotide-binding protein 0.9904 4 105 GO:0003824
AF-A0A6M4MCM2-F1-model_v4 Histidine triad nucleotide-binding protein 0.9901 1 113 GO:0003824
AF-A0A5D9D864-F1-model_v4 Histidine triad nucleotide-binding protein 0.9896 3 114 GO:0003824

Map