F472908

General Info

Members Datasets Scaffolds Average Seq Length
655 356 1310 172

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100023154|Ga0070697_1000231543
Length 207
Sequence MDVFDSIATKLDVRQFSSQDVPSEIKRSVLEAARLTGTGLNTQHWRFIMVEGKDRLKKLAEDSTSGMWVASANFAIIVLTNPKYNFHMIDAGRVLQNMQLAAWNMGVASGLFTGVRDEKLRNDFAIPKELNITLTIGFGYPVRKLTGKKKDRMSIGELFYHEKYGNPMTTQVLNVKPHMALEGKTPANAAGLNVKGWRELLQESLRR

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
11 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300003379 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM Metagenome Rhizosphere
13 3300003380 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM Metagenome Rhizosphere
14 3300003382 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM Metagenome Rhizosphere
15 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
16 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
17 3300003396 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM Metagenome Rhizosphere
18 3300003398 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM Metagenome Rhizosphere
19 3300003399 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM Metagenome Rhizosphere
20 3300003400 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM Metagenome Rhizosphere
21 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
22 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
23 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
24 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
25 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
117 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
118 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
119 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
120 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
121 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
122 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
123 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
124 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
125 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
126 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
127 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
128 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
129 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
130 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
131 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
132 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
133 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
134 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
143 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
147 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
148 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
215 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
220 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
223 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
224 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
225 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
226 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
227 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
243 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
244 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
245 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
246 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
247 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
248 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
249 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
250 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
251 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
252 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
253 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
254 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
255 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
256 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
257 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
258 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
259 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
260 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
261 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
262 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
263 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
264 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
265 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
266 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
267 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
268 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
269 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
270 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
276 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
284 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
285 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
286 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
287 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
288 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
293 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
304 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
305 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
306 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
307 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
321 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
322 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
323 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
324 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
325 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
326 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
327 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
328 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
329 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
330 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
331 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
332 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
333 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
334 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
335 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
336 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
337 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
340 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
341 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
351 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
352 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
353 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.83
Rhizosphere 97.86
Stem 0
Stem Tuber 0
Unclassified 16.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100023154 3300005536 Archaea 4939
2 ARcpr5oldR_c001655 3300000041 Archaea 2189
3 ARSoilYngRDRAFT_c00609 3300000042 Archaea 3720
4 ARcpr5yngRDRAFT_c000421 3300000043 Archaea 5573
5 ARcpr5yngRDRAFT_c003297 3300000043 Archaea 1603
6 ARSoilOldRDRAFT_c000358 3300000044 Archaea 5790
7 ARCol0oldRDRAFT_c00188 3300000045 Archaea 5646
8 ARCol0oldRDRAFT_c00634 3300000045 Archaea 3089
9 ARCol0yngRDRAFT_1000358 3300000652 Archaea 6392
10 JGI24739J22299_10047856 3300001989 Archaea 1393
11 JGI24737J22298_10035398 3300001990 Archaea 1545
12 JGI26145J50221_1000314 3300003371 Bacteria 4202
13 JGI25407J50210_10004852 3300003373 Unclassified 3283
14 JGI25407J50210_10089383 3300003373 Archaea 763
15 JGI26142J50222_100718 3300003379 Archaea 1059
16 JGI26144J50225_100830 3300003380 Archaea 973
17 JGI26139J50223_100206 3300003382 Bacteria 2886
18 JGI26140J50224_100204 3300003383 Bacteria 3402
19 JGI26134J50242_100842 3300003392 Archaea 1038
20 JGI26137J50245_101001 3300003396 Archaea 883
21 JGI26130J50248_100389 3300003398 Archaea 1786
22 JGI26136J50244_100446 3300003399 Archaea 1418
23 JGI26131J50246_100473 3300003400 Archaea 1458
24 JGI26143J51219_1000398 3300003502 Archaea 1721
25 JGI26141J51220_1001470 3300003503 Archaea 1426
26 JGI26138J51218_100584 3300003504 Archaea 1409
27 Ga0065717_1000985 3300005276 Archaea 708
28 Ga0065716_1000111 3300005277 Archaea 2354
29 Ga0065704_10011217 3300005289 Archaea 2884
30 Ga0065704_10043043 3300005289 Unclassified 1439
31 Ga0065704_10073731 3300005289 Archaea 6828
32 Ga0065712_10075209 3300005290 Unclassified 3850
33 Ga0065715_10000871 3300005293 Archaea 7999
34 Ga0065715_10007379 3300005293 Archaea 5097
35 Ga0065715_10030161 3300005293 Unclassified 1320
36 Ga0065707_10006612 3300005295 Archaea 4748
37 Ga0065707_10222673 3300005295 Archaea 1215
38 Ga0070676_10150255 3300005328 Archaea 1490
39 Ga0070676_10321894 3300005328 Archaea 1055
40 Ga0070683_100140756 3300005329 Archaea 2286
41 Ga0070683_100158345 3300005329 Archaea 2148
42 Ga0070690_100176637 3300005330 Archaea 1473
43 Ga0070670_100043029 3300005331 Bacteria 3883
44 Ga0070670_100724310 3300005331 Archaea 895
45 Ga0070677_10088020 3300005333 Archaea 1344
46 Ga0068869_100036062 3300005334 Archaea 3509
47 Ga0070680_100088314 3300005336 Archaea 2564
48 Ga0070682_100006155 3300005337 Archaea 6721
49 Ga0070689_100843677 3300005340 Archaea 808
50 Ga0070691_10212748 3300005341 Archaea 1021
51 Ga0070687_100003239 3300005343 Archaea 6291
52 Ga0070661_100155379 3300005344 Unclassified 1731
53 Ga0070692_10037157 3300005345 Archaea 2474
54 Ga0070692_10185865 3300005345 Archaea 1207
55 Ga0070668_100232693 3300005347 Archaea 1524
56 Ga0070669_100034704 3300005353 Archaea 3652
57 Ga0070669_100046463 3300005353 Unclassified 3166
58 Ga0070669_100052744 3300005353 Archaea 2976
59 Ga0070675_100191677 3300005354 Archaea 1771
60 Ga0070674_100253596 3300005356 Archaea 1383
61 Ga0070674_100458433 3300005356 Archaea 1054
62 Ga0070688_100655939 3300005365 Archaea 809
63 Ga0070659_100035444 3300005366 Archaea 3885
64 Ga0070659_100116986 3300005366 Archaea 2156
65 Ga0070667_100010398 3300005367 Archaea 7679
66 Ga0070709_10193991 3300005434 Bacteria 1434
67 Ga0070714_100048846 3300005435 Archaea 3600
68 Ga0070710_10049454 3300005437 Archaea 2352
69 Ga0070710_10298002 3300005437 Bacteria 1051
70 Ga0070701_10018334 3300005438 Archaea 3287
71 Ga0070701_10077667 3300005438 Archaea 1790
72 Ga0070711_100004650 3300005439 Archaea 8125
73 Ga0070711_100007945 3300005439 Archaea 6470
74 Ga0070705_100009064 3300005440 Archaea 4940
75 Ga0070705_100335747 3300005440 Unclassified 1096
76 Ga0070700_100001885 3300005441 Archaea 10595
77 Ga0070700_100089507 3300005441 Archaea 2005
78 Ga0070700_100322796 3300005441 Archaea 1135
79 Ga0070700_100603121 3300005441 Archaea 860
80 Ga0070694_100035658 3300005444 Bacteria 3290
81 Ga0070694_100039806 3300005444 Archaea 3131
82 Ga0070708_100005797 3300005445 Archaea 9805
83 Ga0070708_100675285 3300005445 Unclassified 973
84 Ga0070663_100872621 3300005455 Archaea 776
85 Ga0070663_101505036 3300005455 Unclassified 598
86 Ga0070678_100069366 3300005456 Unclassified 2632
87 Ga0070662_100011063 3300005457 Archaea 5941
88 Ga0070662_100042322 3300005457 Archaea 3253
89 Ga0068867_100099503 3300005459 Archaea 2219
90 Ga0068867_100101583 3300005459 Archaea 2197
91 Ga0068867_100198593 3300005459 Archaea 1604
92 Ga0070685_10656218 3300005466 Archaea 761
93 Ga0070706_100307169 3300005467 Archaea 1480
94 Ga0070707_100009112 3300005468 Archaea 9202
95 Ga0070707_100182327 3300005468 Archaea 2047
96 Ga0070698_100094982 3300005471 Archaea 2960
97 Ga0070698_100256870 3300005471 Unclassified 1680
98 Ga0070699_101307329 3300005518 Archaea 665
99 Ga0070684_100188662 3300005535 Unclassified 1875
100 Ga0070684_100485338 3300005535 Archaea 1144
101 Ga0070684_100859275 3300005535 Archaea 849
102 Ga0070697_100116687 3300005536 Archaea 2230
103 Ga0070697_100528050 3300005536 Unclassified 1034
104 Ga0070697_101154990 3300005536 Archaea 690
105 Ga0068853_100436026 3300005539 Archaea 1231
106 Ga0070672_100085673 3300005543 Bacteria 2533
107 Ga0070672_100267469 3300005543 Archaea 1443
108 Ga0070686_100096424 3300005544 Archaea 1989
109 Ga0070695_100007553 3300005545 Archaea 6439
110 Ga0070695_100212413 3300005545 Unclassified 1390
111 Ga0070695_100222115 3300005545 Archaea 1361
112 Ga0070695_100272817 3300005545 Archaea 1240
113 Ga0070693_100019652 3300005547 Unclassified 3547
114 Ga0070704_100178232 3300005549 Archaea 1697
115 Ga0070704_100594680 3300005549 Archaea 972
116 Ga0070664_100401864 3300005564 Archaea 1253
117 Ga0070664_100662296 3300005564 Archaea 971
118 Ga0068857_100243059 3300005577 Archaea 1648
119 Ga0068857_100470785 3300005577 Archaea 1176
120 Ga0068857_100687398 3300005577 Archaea 971
121 Ga0068854_100451296 3300005578 Archaea 1074
122 Ga0068856_100004013 3300005614 Archaea 14739
123 Ga0068856_100886355 3300005614 Archaea 911
124 Ga0070702_100017116 3300005615 Archaea 3732
125 Ga0070702_100306506 3300005615 Archaea 1101
126 Ga0068852_100054017 3300005616 Unclassified 3461
127 Ga0068852_100240864 3300005616 Archaea 1728
128 Ga0068859_101503288 3300005617 Archaea 743
129 Ga0068864_100016770 3300005618 Bacteria 6104
130 Ga0068864_100492437 3300005618 Archaea 1178
131 Ga0068864_100992426 3300005618 Unclassified 832
132 Ga0068866_10055377 3300005718 Archaea 2036
133 Ga0068866_10065601 3300005718 Archaea 1899
134 Ga0068866_10070111 3300005718 Archaea 1849
135 Ga0068870_10014619 3300005840 Bacteria 3710
136 Ga0068870_10133119 3300005840 Archaea 1446
137 Ga0068858_100673588 3300005842 Archaea 1006
138 Ga0068860_100017784 3300005843 Archaea 6925
139 Ga0068860_100744218 3300005843 Archaea 992
140 Ga0068860_101251294 3300005843 Unclassified 763
141 Ga0068860_102408222 3300005843 Unclassified 546
142 Ga0068862_100011251 3300005844 Archaea 7388
143 Ga0068862_100095974 3300005844 Archaea 2587
144 Ga0068862_100541487 3300005844 Archaea 1110
145 Ga0081455_10003028 3300005937 Archaea 19585
146 Ga0081455_10146424 3300005937 Archaea 1826
147 Ga0081538_10069502 3300005981 Archaea 1950
148 Ga0081538_10074069 3300005981 Unclassified 1856
149 Ga0081538_10117463 3300005981 Archaea 1288
150 Ga0070717_10021329 3300006028 Archaea 5103
151 Ga0075432_10003742 3300006058 Archaea 5179
152 Ga0075432_10023940 3300006058 Archaea 2092
153 Ga0075432_10128455 3300006058 Archaea 958
154 Ga0070715_10028978 3300006163 Archaea 2227
155 Ga0070715_10211908 3300006163 Archaea 991
156 Ga0070716_100210681 3300006173 Archaea 1298
157 Ga0070712_100041728 3300006175 Archaea 3152
158 Ga0075427_10002105 3300006194 Archaea 2638
159 Ga0075427_10031693 3300006194 Archaea 869
160 Ga0097621_100020366 3300006237 Archaea 5110
161 Ga0097621_100036319 3300006237 Archaea 3942
162 Ga0068871_100027074 3300006358 Archaea 4481
163 Ga0068871_100097784 3300006358 Archaea 2454
164 Ga0068871_100760712 3300006358 Unclassified 891
165 Ga0075428_100005236 3300006844 Archaea 14421
166 Ga0075428_100013906 3300006844 Archaea 8963
167 Ga0075428_100071097 3300006844 Archaea 3803
168 Ga0075428_100129375 3300006844 Bacteria 2747
169 Ga0075430_100000292 3300006846 Archaea 35366
170 Ga0075430_100008256 3300006846 Archaea 8792
171 Ga0075430_100038492 3300006846 Archaea 4049
172 Ga0075430_100055429 3300006846 Unclassified 3333
173 Ga0075430_100272990 3300006846 Archaea 1399
174 Ga0075430_100354007 3300006846 Archaea 1212
175 Ga0075431_100005785 3300006847 Archaea 12231
176 Ga0075431_100036629 3300006847 Archaea 5053
177 Ga0075431_100410871 3300006847 Archaea 1354
178 Ga0075431_100841581 3300006847 Archaea 889
179 Ga0075431_101020681 3300006847 Archaea 794
180 Ga0075433_10005205 3300006852 Archaea 10193
181 Ga0075433_10111098 3300006852 Archaea 2432
182 Ga0075433_10411236 3300006852 Archaea 1193
183 Ga0075434_100041735 3300006871 Archaea 4545
184 Ga0075434_100114114 3300006871 Archaea 2714
185 Ga0075434_100291630 3300006871 Archaea 1651
186 Ga0075429_100005524 3300006880 Archaea 10889
187 Ga0075429_100007664 3300006880 Archaea 9372
188 Ga0075429_100008755 3300006880 Archaea 8803
189 Ga0075429_100106258 3300006880 Unclassified 2452
190 Ga0075429_100281124 3300006880 Archaea 1457
191 Ga0068865_100010199 3300006881 Archaea 5840
192 Ga0068865_100085480 3300006881 Archaea 2276
193 Ga0068865_101158070 3300006881 Unclassified 683
194 Ga0075436_100305591 3300006914 Unclassified 1141
195 Ga0075436_100520516 3300006914 Archaea 871
196 Ga0097620_101504032 3300006931 Archaea 743
197 Ga0075435_100012842 3300007076 Archaea 6209
198 Ga0075435_100041171 3300007076 Archaea 3692
199 Ga0075435_100357222 3300007076 Unclassified 1253
200 Ga0075435_100641051 3300007076 Archaea 922
201 Ga0111539_10005679 3300009094 Archaea 16142
202 Ga0111539_10046400 3300009094 Archaea 5196
203 Ga0111539_10079194 3300009094 Archaea 3865
204 Ga0111539_10111425 3300009094 Archaea 3211
205 Ga0111539_10139834 3300009094 Archaea 2835
206 Ga0111539_10300698 3300009094 Archaea 1868
207 Ga0111539_10316869 3300009094 Archaea 1815
208 Ga0111539_10318748 3300009094 Archaea 1809
209 Ga0111539_11146926 3300009094 Archaea 903
210 Ga0111539_12114036 3300009094 Archaea 653
211 Ga0114129_10000370 3300009147 Archaea 52236
212 Ga0114129_10024434 3300009147 Archaea 8561
213 Ga0114129_10203115 3300009147 Archaea 2683
214 Ga0114129_10423210 3300009147 Archaea 1751
215 Ga0114129_10583242 3300009147 Archaea 1451
216 Ga0114129_10681978 3300009147 Unclassified 1323
217 Ga0114129_11377085 3300009147 Archaea 871
218 Ga0114129_11519798 3300009147 Unclassified 822
219 Ga0105241_11308193 3300009174 Unclassified 691
220 Ga0105242_10049901 3300009176 Archaea 3407
221 Ga0105237_10243634 3300009545 Archaea 1799
222 Ga0105249_10105637 3300009553 Archaea 2655
223 Ga0105249_10108963 3300009553 Archaea 2615
224 Ga0105249_10130334 3300009553 Archaea 2400
225 Ga0105239_10026410 3300010375 Archaea 6390
226 Ga0105239_10145297 3300010375 Archaea 2645
227 Ga0105239_10465769 3300010375 Bacteria 1435
228 Ga0105246_10016753 3300011119 Bacteria 4647
229 Ga0105246_10050766 3300011119 Archaea 2846
230 Ga0105246_10212834 3300011119 Archaea 1510
231 Ga0105246_10474862 3300011119 Unclassified 1056
232 Ga0157317_1006525 3300012475 Archaea 816
233 Ga0157344_1008460 3300012476 Archaea 706
234 Ga0157336_1001012 3300012477 Archaea 1387
235 Ga0157336_1004825 3300012477 Archaea 867
236 Ga0157328_1002244 3300012478 Archaea 912
237 Ga0157346_1000119 3300012480 Archaea 3108
238 Ga0157320_1007272 3300012481 Archaea 788
239 Ga0157337_1000090 3300012483 Archaea 3932
240 Ga0157337_1001700 3300012483 Archaea 1169
241 Ga0157325_1002004 3300012485 Archaea 997
242 Ga0157321_1002083 3300012487 Archaea 1088
243 Ga0157343_1000213 3300012488 Archaea 2114
244 Ga0157329_1016662 3300012491 Archaea 648
245 Ga0157335_1002702 3300012492 Archaea 1088
246 Ga0157341_1000357 3300012494 Archaea 2222
247 Ga0157323_1002586 3300012495 Archaea 1021
248 Ga0157347_1000927 3300012502 Archaea 2132
249 Ga0157315_1000951 3300012508 Archaea 1486
250 Ga0157316_1000032 3300012510 Archaea 5581
251 Ga0157326_1030507 3300012513 Archaea 711
252 Ga0157338_1000072 3300012515 Archaea 4396
253 Ga0157373_10845077 3300013100 Archaea 677
254 Ga0157371_10032906 3300013102 Archaea 3729
255 Ga0157374_10003176 3300013296 Archaea 13804
256 Ga0157374_10009235 3300013296 Archaea 8455
257 Ga0157378_10721258 3300013297 Unclassified 1018
258 Ga0157372_10002266 3300013307 Archaea 20841
259 Ga0157372_10013347 3300013307 Archaea 8772
260 Ga0157375_10021196 3300013308 Archaea 5954
261 Ga0157380_10086748 3300014326 Archaea 2572
262 Ga0157380_10148463 3300014326 Archaea 2023
263 Ga0182008_10026621 3300014497 Archaea 2932
264 Ga0182008_10118437 3300014497 Unclassified 1315
265 Ga0182008_10154912 3300014497 Unclassified 1150
266 Ga0157377_10033885 3300014745 Unclassified 2791
267 Ga0157377_10348309 3300014745 Unclassified 993
268 Ga0157379_10177334 3300014968 Archaea 1924
269 Ga0157376_10314151 3300014969 Archaea 1487
270 Ga0182006_1019740 3300015261 Archaea 2833
271 Ga0182007_10003657 3300015262 Archaea 7206
272 Ga0182005_1028343 3300015265 Unclassified 1527
273 Ga0207697_10002215 3300025315 Archaea 10159
274 Ga0207692_10121304 3300025898 Bacteria 1464
275 Ga0207692_10134410 3300025898 Archaea 1400
276 Ga0207642_10077854 3300025899 Archaea 1601
277 Ga0207642_10206415 3300025899 Archaea 1089
278 Ga0207642_10250180 3300025899 Archaea 1005
279 Ga0207688_10000539 3300025901 Archaea 18400
280 Ga0207688_10211809 3300025901 Archaea 1164
281 Ga0207647_10013313 3300025904 Archaea 5707
282 Ga0207647_10460837 3300025904 Archaea 712
283 Ga0207699_10069379 3300025906 Archaea 2149
284 Ga0207699_10162608 3300025906 Archaea 1487
285 Ga0207699_10984671 3300025906 Unclassified 623
286 Ga0207645_10004737 3300025907 Archaea 10013
287 Ga0207645_10005472 3300025907 Archaea 9192
288 Ga0207643_10010586 3300025908 Bacteria 4966
289 Ga0207643_10101136 3300025908 Archaea 1690
290 Ga0207693_10069290 3300025915 Archaea 2760
291 Ga0207663_10005148 3300025916 Archaea 6577
292 Ga0207663_10205339 3300025916 Archaea 1424
293 Ga0207660_10060119 3300025917 Archaea 2730
294 Ga0207660_10361747 3300025917 Archaea 1164
295 Ga0207662_10006896 3300025918 Archaea 6158
296 Ga0207662_10450570 3300025918 Archaea 880
297 Ga0207646_10195301 3300025922 Archaea 1827
298 Ga0207681_10035197 3300025923 Unclassified 3298
299 Ga0207681_10044800 3300025923 Archaea 2966
300 Ga0207681_10224266 3300025923 Archaea 1455
301 Ga0207650_10569344 3300025925 Archaea 951
302 Ga0207659_10017471 3300025926 Archaea 4687
303 Ga0207664_10172006 3300025929 Archaea 1854
304 Ga0207664_11605065 3300025929 Unclassified 573
305 Ga0207644_10373494 3300025931 Unclassified 1162
306 Ga0207690_10286921 3300025932 Archaea 1283
307 Ga0207690_10836228 3300025932 Archaea 762
308 Ga0207706_10003562 3300025933 Archaea 14872
309 Ga0207706_10083858 3300025933 Archaea 2802
310 Ga0207686_10212830 3300025934 Unclassified 1391
311 Ga0207686_10295546 3300025934 Archaea 1201
312 Ga0207670_10641228 3300025936 Unclassified 875
313 Ga0207704_10023850 3300025938 Archaea 3305
314 Ga0207665_10010388 3300025939 Archaea 6116
315 Ga0207691_10004240 3300025940 Archaea 13930
316 Ga0207691_10049240 3300025940 Bacteria 3860
317 Ga0207689_10018360 3300025942 Archaea 5901
318 Ga0207661_10653744 3300025944 Unclassified 966
319 Ga0207661_10804913 3300025944 Archaea 865
320 Ga0207679_10551391 3300025945 Archaea 1034
321 Ga0207679_10626884 3300025945 Archaea 971
322 Ga0207679_10787428 3300025945 Archaea 866
323 Ga0207667_10914726 3300025949 Archaea 868
324 Ga0207651_10851323 3300025960 Archaea 810
325 Ga0207712_10004131 3300025961 Archaea 9167
326 Ga0207712_10030761 3300025961 Unclassified 3611
327 Ga0207712_10034035 3300025961 Bacteria 3449
328 Ga0207712_10357345 3300025961 Archaea 1216
329 Ga0207668_10299096 3300025972 Archaea 1327
330 Ga0207640_10582376 3300025981 Unclassified 945
331 Ga0207658_10017580 3300025986 Archaea 4930
332 Ga0207677_10171068 3300026023 Unclassified 1698
333 Ga0207639_10746072 3300026041 Archaea 910
334 Ga0207678_10357655 3300026067 Archaea 1260
335 Ga0207708_10003220 3300026075 Archaea 12024
336 Ga0207708_10411067 3300026075 Archaea 1121
337 Ga0207708_10536939 3300026075 Archaea 985
338 Ga0207702_10375238 3300026078 Unclassified 1366
339 Ga0207648_10007138 3300026089 Archaea 11017
340 Ga0207648_10009593 3300026089 Archaea 9261
341 Ga0207648_10044314 3300026089 Archaea 3903
342 Ga0207674_10771871 3300026116 Archaea 928
343 Ga0207674_11318504 3300026116 Archaea 691
344 Ga0207674_11363632 3300026116 Unclassified 678
345 Ga0207683_10531438 3300026121 Unclassified 1087
346 Ga0207698_10052076 3300026142 Archaea 3134
347 Ga0207698_10195579 3300026142 Archaea 1806
348 Ga0209973_1000438 3300027252 Archaea 3135
349 Ga0209973_1002711 3300027252 Archaea 1686
350 Ga0209969_1012006 3300027360 Archaea 1246
351 Ga0209969_1029513 3300027360 Archaea 836
352 Ga0209967_1036375 3300027364 Unclassified 744
353 Ga0209981_1003578 3300027378 Bacteria 2018
354 Ga0209984_1005327 3300027424 Archaea 1544
355 Ga0209995_1003778 3300027471 Unclassified 2416
356 Ga0209968_1002263 3300027526 Bacteria 2909
357 Ga0209999_1018312 3300027543 Archaea 1282
358 Ga0209982_1009318 3300027552 Archaea 1449
359 Ga0209970_1002364 3300027614 Archaea 3215
360 Ga0209983_1019251 3300027665 Archaea 1419
361 Ga0209983_1040466 3300027665 Archaea 1007
362 Ga0209983_1052764 3300027665 Archaea 891
363 Ga0209971_1004851 3300027682 Archaea 3195
364 Ga0209971_1020987 3300027682 Archaea 1554
365 Ga0209966_1002410 3300027695 Bacteria 3119
366 Ga0209998_10000437 3300027717 Archaea 11640
367 Ga0209998_10003304 3300027717 Bacteria 3542
368 Ga0209974_10000224 3300027876 Archaea 18182
369 Ga0207428_10000403 3300027907 Archaea 53683
370 Ga0207428_10001141 3300027907 Archaea 28781
371 Ga0207428_10003363 3300027907 Archaea 15544
372 Ga0207428_10007682 3300027907 Archaea 9815
373 Ga0207428_10312160 3300027907 Archaea 1162
374 Ga0207428_10315701 3300027907 Archaea 1155
375 Ga0268265_10004702 3300028380 Archaea 9422
376 Ga0268265_10667940 3300028380 Archaea 1000
377 Ga0268264_10016159 3300028381 Archaea 6114
378 Ga0268264_10341364 3300028381 Archaea 1423
379 Ga0307408_100016689 3300031548 Unclassified 4908
380 Ga0307405_10108699 3300031731 Archaea 1874
381 Ga0307413_10018926 3300031824 Unclassified 3625
382 Ga0307410_10008027 3300031852 Archaea 5824
383 Ga0307406_10013623 3300031901 Unclassified 4661
384 Ga0307407_10206238 3300031903 Archaea 1320
385 Ga0307412_10235576 3300031911 Archaea 1412
386 Ga0307409_100009636 3300031995 Archaea 5948
387 Ga0307416_100007842 3300032002 Archaea 6824
388 Ga0307416_100475617 3300032002 Archaea 1308
389 Ga0307414_10020623 3300032004 Unclassified 4112
390 Ga0307414_10547460 3300032004 Archaea 1031
391 Ga0307411_10219324 3300032005 Archaea 1475
392 Ga0307411_10363378 3300032005 Archaea 1184
393 Ga0307415_100323711 3300032126 Archaea 1286
394 Ga0373958_0057022 3300034819 Archaea 838
395 Ga0373959_0014742 3300034820 Archaea 1427
396 Ga0373951_0114742 3300035091 Unclassified 728
397 Ga0373952_0007122 3300035092 Archaea 2087
398 Ga0373932_0010663 3300035112 Archaea 2229
399 Ga0373941_0083308 3300035115 Archaea 1084
400 Ga0373954_0006139 3300035118 Archaea 5234
401 Ga0373956_0025958 3300035119 Unclassified 2535
402 Ga0373955_0006642 3300035172 Archaea 5275
403 Ga0373942_0004498 3300035207 Archaea 3233
404 Ga0373961_0190466 3300035241 Archaea 719
405 Ga0373924_0060527 3300035410 Unclassified 1583
406 Ga0373931_0074453 3300035691 Archaea 1860
407 Ga0373933_0008808 3300035724 Archaea 5501
408 Ga0373947_0240007 3300035725 Unclassified 1196
409 Ga0373937_0019599 3300036401 Unclassified 6054
410 Ga0373925_0418974 3300037068 Unclassified 1094
411 Ga0242420_014783 3300038996 Archaea 1343
412 Ga0242420_080916 3300038996 Archaea 671
413 Ga0436365_0490197 3300039437 Archaea 7939
414 Ga0436361_0278384 3300039447 Bacteria 821
415 Ga0436363_1406325 3300039450 Unclassified 687
416 Ga0439447_095072 3300041407 Archaea 684
417 Ga0439453_0078234 3300041408 Unclassified 710
418 Ga0439461_0064196 3300041410 Archaea 839
419 Ga0439441_005631 3300042001 Archaea 1956
420 Ga0439443_070447 3300042003 Archaea 638
421 Ga0439448_0245816 3300042005 Unclassified 631
422 Ga0439432_023698 3300042006 Archaea 2020
423 Ga0439450_169340 3300042008 Archaea 577
424 Ga0439451_014757 3300042009 Archaea 1576
425 Ga0439451_020652 3300042009 Archaea 1327
426 Ga0439452_012326 3300042010 Archaea 2436
427 Ga0439452_014714 3300042010 Archaea 2165
428 Ga0439455_0074172 3300042012 Archaea 918
429 Ga0439456_048746 3300042013 Archaea 924
430 Ga0439462_0009125 3300042015 Archaea 2508
431 Ga0439463_012275 3300042016 Archaea 2104
432 Ga0439463_064514 3300042016 Archaea 936
433 Ga0439446_0007318 3300042156 Archaea 2901
434 Ga0450908_040801 3300042184 Archaea 805
435 Ga0439434_0013846 3300042435 Archaea 2397
436 Ga0439434_0024158 3300042435 Archaea 1833
437 Ga0439434_0063346 3300042435 Archaea 1158
438 Ga0439435_0001301 3300042436 Archaea 4545
439 Ga0439444_0036542 3300042437 Archaea 947
440 Ga0439444_0081302 3300042437 Archaea 709
441 Ga0439464_0005275 3300042439 Archaea 3336
442 Ga0439464_0036229 3300042439 Archaea 1395
443 Ga0439464_0036357 3300042439 Archaea 1393
444 Ga0439460_0004535 3300042461 Archaea 3389
445 Ga0439460_0021601 3300042461 Unclassified 1760
446 Ga0450893_0016969 3300042532 Archaea 1235
447 Ga0439440_0002077 3300042993 Archaea 3738
448 Ga0439440_0005520 3300042993 Archaea 2515
449 Ga0439440_0017450 3300042993 Archaea 1581
450 Ga0453683_0034169 3300044673 Archaea 3206
451 Ga0453683_0054692 3300044673 Archaea 2498
452 Ga0466964_0375407 3300044706 Archaea 737
453 Ga0453684_0095133 3300044712 Archaea 3662
454 Ga0451576_0008043 3300045051 Archaea 12443
455 Ga0495592_0056882 3300046454 Unclassified 2888
456 Ga0495651_0005524 3300046462 Archaea 9641
457 Ga0495653_0260616 3300046463 Unclassified 1146
458 Ga0495584_0040592 3300046491 Archaea 2350
459 Ga0495608_0141351 3300046511 Unclassified 1536
460 Ga0495628_0907845 3300046516 Unclassified 611
461 Ga0495663_0178406 3300046525 Archaea 735
462 Ga0495652_0023844 3300046529 Archaea 5420
463 Ga0495640_0315853 3300046533 Unclassified 968
464 Ga0495587_0037439 3300046536 Unclassified 2913
465 Ga0495645_0064549 3300046543 Archaea 2649
466 Ga0495656_0348795 3300046615 Archaea 767
467 Ga0495635_0310425 3300046663 Unclassified 1057
468 Ga0495659_0258691 3300046664 Unclassified 727
469 Ga0495659_0363184 3300046664 Unclassified 620
470 Ga0495657_0117609 3300046675 Unclassified 1677
471 Ga0495599_0009895 3300046678 Unclassified 5836
472 Ga0495623_0011360 3300046679 Unclassified 5761
473 Ga0495646_0183242 3300046680 Archaea 1148
474 Ga0495671_0500313 3300046692 Archaea 580
475 Ga0495600_0431937 3300046809 Unclassified 816
476 Ga0495636_0181254 3300047318 Archaea 956
477 Ga0495674_0263329 3300047319 Unclassified 1416
478 Ga0495675_0051464 3300047444 Unclassified 2615
479 Ga0495602_0023448 3300048088 Unclassified 6012
480 Ga0496100_0541237 3300048903 Archaea 900
481 Ga0496102_0027410 3300048905 Archaea 5087
482 Ga0496102_0679258 3300048905 Archaea 953
483 Ga0496102_1367595 3300048905 Unclassified 627
484 Ga0496104_0309324 3300048907 Unclassified 1493
485 Ga0496106_0050577 3300048909 Archaea 3132
486 Ga0496107_0132608 3300048910 Unclassified 1840
487 Ga0496108_0913125 3300048911 Unclassified 753
488 Ga0496110_0419187 3300048913 Archaea 1221
489 Ga0496112_0340404 3300048915 Archaea 1443
490 Ga0496113_0376426 3300048916 Unclassified 1140
491 Ga0496113_0766102 3300048916 Bacteria 768
492 Ga0501291_008288 3300049514 Archaea 1432
493 Ga0501295_015793 3300049518 Archaea 1298
494 Ga0501298_011064 3300049521 Archaea 1561
495 Ga0501299_004966 3300049522 Archaea 2019
496 Ga0501299_068940 3300049522 Archaea 764
497 Ga0501031_0125738 3300049568 Archaea 1675
498 Ga0501031_0159927 3300049568 Archaea 1472
499 Ga0501031_0753798 3300049568 Archaea 624
500 Ga0501033_0118692 3300049570 Archaea 1921
501 Ga0501034_0065370 3300049571 Archaea 3649
502 Ga0501036_0067618 3300049572 Archaea 3023
503 Ga0501036_0153335 3300049572 Archaea 1943
504 Ga0501036_0159803 3300049572 Archaea 1900
505 Ga0501036_1452251 3300049572 Archaea 555
506 Ga0501038_0011532 3300049574 Archaea 8064
507 Ga0501039_0041224 3300049575 Archaea 3565
508 Ga0501039_0098079 3300049575 Archaea 2286
509 Ga0501039_0397567 3300049575 Archaea 1082
510 Ga0501040_0033585 3300049576 Archaea 3476
511 Ga0501040_0035590 3300049576 Archaea 3377
512 Ga0501040_0209074 3300049576 Archaea 1387
513 Ga0501040_0241808 3300049576 Unclassified 1287
514 Ga0501040_0763505 3300049576 Archaea 699
515 Ga0501041_0005074 3300049577 Archaea 7673
516 Ga0501041_0072772 3300049577 Archaea 2112
517 Ga0501041_0073924 3300049577 Archaea 2094
518 Ga0501041_0258646 3300049577 Unclassified 1094
519 Ga0501041_0284199 3300049577 Archaea 1041
520 Ga0501042_0001059 3300049578 Archaea 15733
521 Ga0501042_0043121 3300049578 Archaea 3211
522 Ga0501042_0129868 3300049578 Unclassified 1816
523 Ga0501042_0132838 3300049578 Archaea 1794
524 Ga0501042_0208554 3300049578 Archaea 1409
525 Ga0501042_0501344 3300049578 Archaea 881
526 Ga0501043_0023792 3300049579 Archaea 4806
527 Ga0501043_0316864 3300049579 Archaea 1190
528 Ga0501046_0010922 3300049580 Archaea 7784
529 Ga0501046_0058876 3300049580 Archaea 3011
530 Ga0501046_0137198 3300049580 Archaea 1852
531 Ga0501046_0143367 3300049580 Archaea 1806
532 Ga0501046_0545386 3300049580 Archaea 827
533 Ga0501047_0111986 3300049581 Archaea 2612
534 Ga0501048_0055855 3300049582 Archaea 2802
535 Ga0501048_0083772 3300049582 Archaea 2248
536 Ga0501048_0130076 3300049582 Archaea 1780
537 Ga0501067_0316786 3300049583 Unclassified 869
538 Ga0501070_0071804 3300049586 Archaea 2866
539 Ga0501071_0010739 3300049587 Archaea 6142
540 Ga0501071_0130919 3300049587 Archaea 1863
541 Ga0501071_0386280 3300049587 Archaea 1068
542 Ga0501071_1028194 3300049587 Archaea 636
543 Ga0501072_0000391 3300049588 Archaea 31437
544 Ga0501072_0313132 3300049588 Archaea 1248
545 Ga0501074_0317144 3300049590 Archaea 1107
546 Ga0501075_0018669 3300049591 Archaea 5021
547 Ga0501075_0110150 3300049591 Archaea 2093
548 Ga0501075_0166291 3300049591 Archaea 1683
549 Ga0501075_0219193 3300049591 Archaea 1451
550 Ga0501075_0234222 3300049591 Archaea 1400
551 Ga0501076_0000366 3300049592 Archaea 28077
552 Ga0501076_0074030 3300049592 Archaea 2728
553 Ga0501076_0199697 3300049592 Unclassified 1633
554 Ga0501076_0510163 3300049592 Archaea 991
555 Ga0501076_0778371 3300049592 Archaea 789
556 Ga0501077_0020372 3300049593 Archaea 4198
557 Ga0501077_0073357 3300049593 Archaea 2168
558 Ga0501077_0113029 3300049593 Archaea 1722
559 Ga0501077_0236670 3300049593 Archaea 1161
560 Ga0501077_0641684 3300049593 Archaea 682
561 Ga0501198_031046 3300049649 Unclassified 892
562 Ga0501209_064002 3300049656 Archaea 1032
563 Ga0501217_017098 3300049661 Archaea 1669
564 Ga0501242_012868 3300049674 Archaea 1023
565 Ga0501243_007837 3300049675 Archaea 1638
566 Ga0501253_021917 3300049683 Archaea 1132
567 Ga0501221_015808 3300049704 Archaea 1420
568 Ga0501225_0026438 3300049705 Archaea 1595
569 Ga0501245_005189 3300049708 Archaea 1802
570 Ga0501245_007619 3300049708 Unclassified 1532
571 Ga0501079_0012796 3300049741 Archaea 6407
572 Ga0501079_0045951 3300049741 Archaea 3369
573 Ga0501079_0830642 3300049741 Archaea 727
574 Ga0501080_0219734 3300049742 Archaea 1739
575 Ga0501080_0353578 3300049742 Archaea 1326
576 Ga0501080_0830004 3300049742 Archaea 809
577 Ga0501080_1043219 3300049742 Archaea 708
578 Ga0501081_0005598 3300049743 Archaea 8112
579 Ga0501081_0039703 3300049743 Archaea 3222
580 Ga0501081_0261099 3300049743 Archaea 1266
581 Ga0501081_0431266 3300049743 Unclassified 978
582 Ga0501081_0797841 3300049743 Archaea 710
583 Ga0501081_1078879 3300049743 Archaea 607
584 Ga0501266_017957 3300049763 Unclassified 949
585 Ga0501268_000433 3300049765 Unclassified 4507
586 Ga0501044_0045104 3300049823 Archaea 4571
587 Ga0501045_0017418 3300049824 Archaea 5100
588 Ga0501045_0035556 3300049824 Archaea 3617
589 Ga0501045_1137383 3300049824 Archaea 570
590 nmdc:mga05p37_1412_c1 3300050507 Archaea 27926
591 nmdc:mga05p37_169662_c1 3300050507 Unclassified 2662
592 nmdc:mga05p37_19288_c1 3300050507 Archaea 8248
593 nmdc:mga05p37_4055_c1 3300050507 Archaea 13041
594 nmdc:mga05p37_607233_c1 3300050507 Archaea 1234
595 nmdc:mga05p37_95332_c1 3300050507 Archaea 3666
596 nmdc:mga09592_194963_c1 3300050508 Archaea 1754
597 nmdc:mga09592_2592_c1 3300050508 Archaea 14642
598 nmdc:mga09592_279414_c1 3300050508 Archaea 1448
599 nmdc:mga09592_285633_c1 3300050508 Archaea 1431
600 nmdc:mga09592_4996_c1 3300050508 Archaea 10751
601 nmdc:mga09592_538316_c1 3300050508 Archaea 1004
602 nmdc:mga09592_57099_c1 3300050508 Archaea 3298
603 nmdc:mga09592_59355_c1 3300050508 Archaea 3234
604 nmdc:mga09592_73930_c1 3300050508 Archaea 2897
605 nmdc:mga0qj67_2010_c1 3300050509 Archaea 14504
606 nmdc:mga0qj67_2834_c1 3300050509 Archaea 12428
607 nmdc:mga0qj67_313740_c1 3300050509 Archaea 1270
608 nmdc:mga0qj67_420430_c1 3300050509 Archaea 1078
609 nmdc:mga0qj67_444490_c1 3300050509 Archaea 1045
610 nmdc:mga0qj67_521281_c1 3300050509 Bacteria 955
611 nmdc:mga0qj67_7544_c1 3300050509 Archaea 8037
612 nmdc:mga06r32_162891_c1 3300050510 Archaea 2213
613 nmdc:mga06r32_211820_c1 3300050510 Archaea 1925
614 nmdc:mga06r32_238502_c1 3300050510 Archaea 1806
615 nmdc:mga06r32_738960_c1 3300050510 Unclassified 948
616 nmdc:mga06r32_773835_c1 3300050510 Archaea 922
617 nmdc:mga06r32_837_c1 3300050510 Archaea 27291
618 nmdc:mga08y16_1064304_c1 3300050511 Archaea 786
619 nmdc:mga08y16_120720_c1 3300050511 Archaea 2728
620 nmdc:mga08y16_12692_c1 3300050511 Archaea 8864
621 nmdc:mga08y16_1754932_c1 3300050511 Unclassified 575
622 nmdc:mga08y16_18422_c1 3300050511 Archaea 7359
623 nmdc:mga08y16_492240_c1 3300050511 Archaea 1247
624 nmdc:mga08y16_603966_c1 3300050511 Archaea 1106
625 nmdc:mga0n895_1120_c1 3300050512 Archaea 19568
626 nmdc:mga0n895_128785_c1 3300050512 Archaea 2555
627 nmdc:mga0n895_31387_c1 3300050512 Unclassified 5087
628 nmdc:mga0n895_526294_c1 3300050512 Archaea 1190
629 nmdc:mga0n895_58879_c1 3300050512 Archaea 3789
630 nmdc:mga0rr50_28236_c1 3300050513 Archaea 3942
631 nmdc:mga0rr50_438058_c1 3300050513 Archaea 1107
632 nmdc:mga0rr50_4731_c1 3300050513 Archaea 8026
633 nmdc:mga0rr50_654_c1 3300050513 Archaea 18630
634 nmdc:mga08x19_564348_c1 3300050514 Unclassified 806
635 nmdc:mga08x19_8881_c1 3300050514 Archaea 5995
636 nmdc:mga0a205_10719_c1 3300050515 Archaea 8428
637 nmdc:mga0a205_3276_c1 3300050515 Archaea 14404
638 nmdc:mga0a205_604346_c1 3300050515 Unclassified 950
639 Ga0495619_0009750 3300053085 Unclassified 6053
640 Ga0501084_0040605 3300054114 Archaea 3893
641 Ga0501084_0052645 3300054114 Archaea 3405
642 Ga0501084_0172950 3300054114 Archaea 1823
643 Ga0501084_0189498 3300054114 Unclassified 1735
644 Ga0501084_0212459 3300054114 Archaea 1632
645 Ga0501084_1019952 3300054114 Archaea 695
646 Ga0501082_0000490 3300060353 Archaea 34919
647 Ga0501082_0019730 3300060353 Archaea 5813
648 Ga0501082_0029085 3300060353 Archaea 4760
649 Ga0501082_0224166 3300060353 Unclassified 1636
650 Ga0501082_0538431 3300060353 Archaea 1021
651 Ga0530510_0039714 3300061734 Archaea 3397
652 Ga0530510_0122022 3300061734 Archaea 1913
653 Ga0530510_0188428 3300061734 Archaea 1531
654 Ga0530510_0324002 3300061734 Archaea 1155
655 Ga0530510_1022487 3300061734 Archaea 632
656 Ga0070697_100023154
657 ARcpr5oldR_c001655
658 ARSoilYngRDRAFT_c00609
659 ARcpr5yngRDRAFT_c000421
660 ARcpr5yngRDRAFT_c003297
661 ARSoilOldRDRAFT_c000358
662 ARCol0oldRDRAFT_c00188
663 ARCol0oldRDRAFT_c00634
664 ARCol0yngRDRAFT_1000358
665 JGI24739J22299_10047856
666 JGI24737J22298_10035398
667 JGI26145J50221_1000314
668 JGI25407J50210_10004852
669 JGI25407J50210_10089383
670 JGI26142J50222_100718
671 JGI26144J50225_100830
672 JGI26139J50223_100206
673 JGI26140J50224_100204
674 JGI26134J50242_100842
675 JGI26137J50245_101001
676 JGI26130J50248_100389
677 JGI26136J50244_100446
678 JGI26131J50246_100473
679 JGI26143J51219_1000398
680 JGI26141J51220_1001470
681 JGI26138J51218_100584
682 Ga0065717_1000985
683 Ga0065716_1000111
684 Ga0065704_10011217
685 Ga0065704_10043043
686 Ga0065704_10073731
687 Ga0065712_10075209
688 Ga0065715_10000871
689 Ga0065715_10007379
690 Ga0065715_10030161
691 Ga0065707_10006612
692 Ga0065707_10222673
693 Ga0070676_10150255
694 Ga0070676_10321894
695 Ga0070683_100140756
696 Ga0070683_100158345
697 Ga0070690_100176637
698 Ga0070670_100043029
699 Ga0070670_100724310
700 Ga0070677_10088020
701 Ga0068869_100036062
702 Ga0070680_100088314
703 Ga0070682_100006155
704 Ga0070689_100843677
705 Ga0070691_10212748
706 Ga0070687_100003239
707 Ga0070661_100155379
708 Ga0070692_10037157
709 Ga0070692_10185865
710 Ga0070668_100232693
711 Ga0070669_100034704
712 Ga0070669_100046463
713 Ga0070669_100052744
714 Ga0070675_100191677
715 Ga0070674_100253596
716 Ga0070674_100458433
717 Ga0070688_100655939
718 Ga0070659_100035444
719 Ga0070659_100116986
720 Ga0070667_100010398
721 Ga0070709_10193991
722 Ga0070714_100048846
723 Ga0070710_10049454
724 Ga0070710_10298002
725 Ga0070701_10018334
726 Ga0070701_10077667
727 Ga0070711_100004650
728 Ga0070711_100007945
729 Ga0070705_100009064
730 Ga0070705_100335747
731 Ga0070700_100001885
732 Ga0070700_100089507
733 Ga0070700_100322796
734 Ga0070700_100603121
735 Ga0070694_100035658
736 Ga0070694_100039806
737 Ga0070708_100005797
738 Ga0070708_100675285
739 Ga0070663_100872621
740 Ga0070663_101505036
741 Ga0070678_100069366
742 Ga0070662_100011063
743 Ga0070662_100042322
744 Ga0068867_100099503
745 Ga0068867_100101583
746 Ga0068867_100198593
747 Ga0070685_10656218
748 Ga0070706_100307169
749 Ga0070707_100009112
750 Ga0070707_100182327
751 Ga0070698_100094982
752 Ga0070698_100256870
753 Ga0070699_101307329
754 Ga0070684_100188662
755 Ga0070684_100485338
756 Ga0070684_100859275
757 Ga0070697_100116687
758 Ga0070697_100528050
759 Ga0070697_101154990
760 Ga0068853_100436026
761 Ga0070672_100085673
762 Ga0070672_100267469
763 Ga0070686_100096424
764 Ga0070695_100007553
765 Ga0070695_100212413
766 Ga0070695_100222115
767 Ga0070695_100272817
768 Ga0070693_100019652
769 Ga0070704_100178232
770 Ga0070704_100594680
771 Ga0070664_100401864
772 Ga0070664_100662296
773 Ga0068857_100243059
774 Ga0068857_100470785
775 Ga0068857_100687398
776 Ga0068854_100451296
777 Ga0068856_100004013
778 Ga0068856_100886355
779 Ga0070702_100017116
780 Ga0070702_100306506
781 Ga0068852_100054017
782 Ga0068852_100240864
783 Ga0068859_101503288
784 Ga0068864_100016770
785 Ga0068864_100492437
786 Ga0068864_100992426
787 Ga0068866_10055377
788 Ga0068866_10065601
789 Ga0068866_10070111
790 Ga0068870_10014619
791 Ga0068870_10133119
792 Ga0068858_100673588
793 Ga0068860_100017784
794 Ga0068860_100744218
795 Ga0068860_101251294
796 Ga0068860_102408222
797 Ga0068862_100011251
798 Ga0068862_100095974
799 Ga0068862_100541487
800 Ga0081455_10003028
801 Ga0081455_10146424
802 Ga0081538_10069502
803 Ga0081538_10074069
804 Ga0081538_10117463
805 Ga0070717_10021329
806 Ga0075432_10003742
807 Ga0075432_10023940
808 Ga0075432_10128455
809 Ga0070715_10028978
810 Ga0070715_10211908
811 Ga0070716_100210681
812 Ga0070712_100041728
813 Ga0075427_10002105
814 Ga0075427_10031693
815 Ga0097621_100020366
816 Ga0097621_100036319
817 Ga0068871_100027074
818 Ga0068871_100097784
819 Ga0068871_100760712
820 Ga0075428_100005236
821 Ga0075428_100013906
822 Ga0075428_100071097
823 Ga0075428_100129375
824 Ga0075430_100000292
825 Ga0075430_100008256
826 Ga0075430_100038492
827 Ga0075430_100055429
828 Ga0075430_100272990
829 Ga0075430_100354007
830 Ga0075431_100005785
831 Ga0075431_100036629
832 Ga0075431_100410871
833 Ga0075431_100841581
834 Ga0075431_101020681
835 Ga0075433_10005205
836 Ga0075433_10111098
837 Ga0075433_10411236
838 Ga0075434_100041735
839 Ga0075434_100114114
840 Ga0075434_100291630
841 Ga0075429_100005524
842 Ga0075429_100007664
843 Ga0075429_100008755
844 Ga0075429_100106258
845 Ga0075429_100281124
846 Ga0068865_100010199
847 Ga0068865_100085480
848 Ga0068865_101158070
849 Ga0075436_100305591
850 Ga0075436_100520516
851 Ga0097620_101504032
852 Ga0075435_100012842
853 Ga0075435_100041171
854 Ga0075435_100357222
855 Ga0075435_100641051
856 Ga0111539_10005679
857 Ga0111539_10046400
858 Ga0111539_10079194
859 Ga0111539_10111425
860 Ga0111539_10139834
861 Ga0111539_10300698
862 Ga0111539_10316869
863 Ga0111539_10318748
864 Ga0111539_11146926
865 Ga0111539_12114036
866 Ga0114129_10000370
867 Ga0114129_10024434
868 Ga0114129_10203115
869 Ga0114129_10423210
870 Ga0114129_10583242
871 Ga0114129_10681978
872 Ga0114129_11377085
873 Ga0114129_11519798
874 Ga0105241_11308193
875 Ga0105242_10049901
876 Ga0105237_10243634
877 Ga0105249_10105637
878 Ga0105249_10108963
879 Ga0105249_10130334
880 Ga0105239_10026410
881 Ga0105239_10145297
882 Ga0105239_10465769
883 Ga0105246_10016753
884 Ga0105246_10050766
885 Ga0105246_10212834
886 Ga0105246_10474862
887 Ga0157317_1006525
888 Ga0157344_1008460
889 Ga0157336_1001012
890 Ga0157336_1004825
891 Ga0157328_1002244
892 Ga0157346_1000119
893 Ga0157320_1007272
894 Ga0157337_1000090
895 Ga0157337_1001700
896 Ga0157325_1002004
897 Ga0157321_1002083
898 Ga0157343_1000213
899 Ga0157329_1016662
900 Ga0157335_1002702
901 Ga0157341_1000357
902 Ga0157323_1002586
903 Ga0157347_1000927
904 Ga0157315_1000951
905 Ga0157316_1000032
906 Ga0157326_1030507
907 Ga0157338_1000072
908 Ga0157373_10845077
909 Ga0157371_10032906
910 Ga0157374_10003176
911 Ga0157374_10009235
912 Ga0157378_10721258
913 Ga0157372_10002266
914 Ga0157372_10013347
915 Ga0157375_10021196
916 Ga0157380_10086748
917 Ga0157380_10148463
918 Ga0182008_10026621
919 Ga0182008_10118437
920 Ga0182008_10154912
921 Ga0157377_10033885
922 Ga0157377_10348309
923 Ga0157379_10177334
924 Ga0157376_10314151
925 Ga0182006_1019740
926 Ga0182007_10003657
927 Ga0182005_1028343
928 Ga0207697_10002215
929 Ga0207692_10121304
930 Ga0207692_10134410
931 Ga0207642_10077854
932 Ga0207642_10206415
933 Ga0207642_10250180
934 Ga0207688_10000539
935 Ga0207688_10211809
936 Ga0207647_10013313
937 Ga0207647_10460837
938 Ga0207699_10069379
939 Ga0207699_10162608
940 Ga0207699_10984671
941 Ga0207645_10004737
942 Ga0207645_10005472
943 Ga0207643_10010586
944 Ga0207643_10101136
945 Ga0207693_10069290
946 Ga0207663_10005148
947 Ga0207663_10205339
948 Ga0207660_10060119
949 Ga0207660_10361747
950 Ga0207662_10006896
951 Ga0207662_10450570
952 Ga0207646_10195301
953 Ga0207681_10035197
954 Ga0207681_10044800
955 Ga0207681_10224266
956 Ga0207650_10569344
957 Ga0207659_10017471
958 Ga0207664_10172006
959 Ga0207664_11605065
960 Ga0207644_10373494
961 Ga0207690_10286921
962 Ga0207690_10836228
963 Ga0207706_10003562
964 Ga0207706_10083858
965 Ga0207686_10212830
966 Ga0207686_10295546
967 Ga0207670_10641228
968 Ga0207704_10023850
969 Ga0207665_10010388
970 Ga0207691_10004240
971 Ga0207691_10049240
972 Ga0207689_10018360
973 Ga0207661_10653744
974 Ga0207661_10804913
975 Ga0207679_10551391
976 Ga0207679_10626884
977 Ga0207679_10787428
978 Ga0207667_10914726
979 Ga0207651_10851323
980 Ga0207712_10004131
981 Ga0207712_10030761
982 Ga0207712_10034035
983 Ga0207712_10357345
984 Ga0207668_10299096
985 Ga0207640_10582376
986 Ga0207658_10017580
987 Ga0207677_10171068
988 Ga0207639_10746072
989 Ga0207678_10357655
990 Ga0207708_10003220
991 Ga0207708_10411067
992 Ga0207708_10536939
993 Ga0207702_10375238
994 Ga0207648_10007138
995 Ga0207648_10009593
996 Ga0207648_10044314
997 Ga0207674_10771871
998 Ga0207674_11318504
999 Ga0207674_11363632
1000 Ga0207683_10531438
1001 Ga0207698_10052076
1002 Ga0207698_10195579
1003 Ga0209973_1000438
1004 Ga0209973_1002711
1005 Ga0209969_1012006
1006 Ga0209969_1029513
1007 Ga0209967_1036375
1008 Ga0209981_1003578
1009 Ga0209984_1005327
1010 Ga0209995_1003778
1011 Ga0209968_1002263
1012 Ga0209999_1018312
1013 Ga0209982_1009318
1014 Ga0209970_1002364
1015 Ga0209983_1019251
1016 Ga0209983_1040466
1017 Ga0209983_1052764
1018 Ga0209971_1004851
1019 Ga0209971_1020987
1020 Ga0209966_1002410
1021 Ga0209998_10000437
1022 Ga0209998_10003304
1023 Ga0209974_10000224
1024 Ga0207428_10000403
1025 Ga0207428_10001141
1026 Ga0207428_10003363
1027 Ga0207428_10007682
1028 Ga0207428_10312160
1029 Ga0207428_10315701
1030 Ga0268265_10004702
1031 Ga0268265_10667940
1032 Ga0268264_10016159
1033 Ga0268264_10341364
1034 Ga0307408_100016689
1035 Ga0307405_10108699
1036 Ga0307413_10018926
1037 Ga0307410_10008027
1038 Ga0307406_10013623
1039 Ga0307407_10206238
1040 Ga0307412_10235576
1041 Ga0307409_100009636
1042 Ga0307416_100007842
1043 Ga0307416_100475617
1044 Ga0307414_10020623
1045 Ga0307414_10547460
1046 Ga0307411_10219324
1047 Ga0307411_10363378
1048 Ga0307415_100323711
1049 Ga0373958_0057022
1050 Ga0373959_0014742
1051 Ga0373951_0114742
1052 Ga0373952_0007122
1053 Ga0373932_0010663
1054 Ga0373941_0083308
1055 Ga0373954_0006139
1056 Ga0373956_0025958
1057 Ga0373955_0006642
1058 Ga0373942_0004498
1059 Ga0373961_0190466
1060 Ga0373924_0060527
1061 Ga0373931_0074453
1062 Ga0373933_0008808
1063 Ga0373947_0240007
1064 Ga0373937_0019599
1065 Ga0373925_0418974
1066 Ga0242420_014783
1067 Ga0242420_080916
1068 Ga0436365_0490197
1069 Ga0436361_0278384
1070 Ga0436363_1406325
1071 Ga0439447_095072
1072 Ga0439453_0078234
1073 Ga0439461_0064196
1074 Ga0439441_005631
1075 Ga0439443_070447
1076 Ga0439448_0245816
1077 Ga0439432_023698
1078 Ga0439450_169340
1079 Ga0439451_014757
1080 Ga0439451_020652
1081 Ga0439452_012326
1082 Ga0439452_014714
1083 Ga0439455_0074172
1084 Ga0439456_048746
1085 Ga0439462_0009125
1086 Ga0439463_012275
1087 Ga0439463_064514
1088 Ga0439446_0007318
1089 Ga0450908_040801
1090 Ga0439434_0013846
1091 Ga0439434_0024158
1092 Ga0439434_0063346
1093 Ga0439435_0001301
1094 Ga0439444_0036542
1095 Ga0439444_0081302
1096 Ga0439464_0005275
1097 Ga0439464_0036229
1098 Ga0439464_0036357
1099 Ga0439460_0004535
1100 Ga0439460_0021601
1101 Ga0450893_0016969
1102 Ga0439440_0002077
1103 Ga0439440_0005520
1104 Ga0439440_0017450
1105 Ga0453683_0034169
1106 Ga0453683_0054692
1107 Ga0466964_0375407
1108 Ga0453684_0095133
1109 Ga0451576_0008043
1110 Ga0495592_0056882
1111 Ga0495651_0005524
1112 Ga0495653_0260616
1113 Ga0495584_0040592
1114 Ga0495608_0141351
1115 Ga0495628_0907845
1116 Ga0495663_0178406
1117 Ga0495652_0023844
1118 Ga0495640_0315853
1119 Ga0495587_0037439
1120 Ga0495645_0064549
1121 Ga0495656_0348795
1122 Ga0495635_0310425
1123 Ga0495659_0258691
1124 Ga0495659_0363184
1125 Ga0495657_0117609
1126 Ga0495599_0009895
1127 Ga0495623_0011360
1128 Ga0495646_0183242
1129 Ga0495671_0500313
1130 Ga0495600_0431937
1131 Ga0495636_0181254
1132 Ga0495674_0263329
1133 Ga0495675_0051464
1134 Ga0495602_0023448
1135 Ga0496100_0541237
1136 Ga0496102_0027410
1137 Ga0496102_0679258
1138 Ga0496102_1367595
1139 Ga0496104_0309324
1140 Ga0496106_0050577
1141 Ga0496107_0132608
1142 Ga0496108_0913125
1143 Ga0496110_0419187
1144 Ga0496112_0340404
1145 Ga0496113_0376426
1146 Ga0496113_0766102
1147 Ga0501291_008288
1148 Ga0501295_015793
1149 Ga0501298_011064
1150 Ga0501299_004966
1151 Ga0501299_068940
1152 Ga0501031_0125738
1153 Ga0501031_0159927
1154 Ga0501031_0753798
1155 Ga0501033_0118692
1156 Ga0501034_0065370
1157 Ga0501036_0067618
1158 Ga0501036_0153335
1159 Ga0501036_0159803
1160 Ga0501036_1452251
1161 Ga0501038_0011532
1162 Ga0501039_0041224
1163 Ga0501039_0098079
1164 Ga0501039_0397567
1165 Ga0501040_0033585
1166 Ga0501040_0035590
1167 Ga0501040_0209074
1168 Ga0501040_0241808
1169 Ga0501040_0763505
1170 Ga0501041_0005074
1171 Ga0501041_0072772
1172 Ga0501041_0073924
1173 Ga0501041_0258646
1174 Ga0501041_0284199
1175 Ga0501042_0001059
1176 Ga0501042_0043121
1177 Ga0501042_0129868
1178 Ga0501042_0132838
1179 Ga0501042_0208554
1180 Ga0501042_0501344
1181 Ga0501043_0023792
1182 Ga0501043_0316864
1183 Ga0501046_0010922
1184 Ga0501046_0058876
1185 Ga0501046_0137198
1186 Ga0501046_0143367
1187 Ga0501046_0545386
1188 Ga0501047_0111986
1189 Ga0501048_0055855
1190 Ga0501048_0083772
1191 Ga0501048_0130076
1192 Ga0501067_0316786
1193 Ga0501070_0071804
1194 Ga0501071_0010739
1195 Ga0501071_0130919
1196 Ga0501071_0386280
1197 Ga0501071_1028194
1198 Ga0501072_0000391
1199 Ga0501072_0313132
1200 Ga0501074_0317144
1201 Ga0501075_0018669
1202 Ga0501075_0110150
1203 Ga0501075_0166291
1204 Ga0501075_0219193
1205 Ga0501075_0234222
1206 Ga0501076_0000366
1207 Ga0501076_0074030
1208 Ga0501076_0199697
1209 Ga0501076_0510163
1210 Ga0501076_0778371
1211 Ga0501077_0020372
1212 Ga0501077_0073357
1213 Ga0501077_0113029
1214 Ga0501077_0236670
1215 Ga0501077_0641684
1216 Ga0501198_031046
1217 Ga0501209_064002
1218 Ga0501217_017098
1219 Ga0501242_012868
1220 Ga0501243_007837
1221 Ga0501253_021917
1222 Ga0501221_015808
1223 Ga0501225_0026438
1224 Ga0501245_005189
1225 Ga0501245_007619
1226 Ga0501079_0012796
1227 Ga0501079_0045951
1228 Ga0501079_0830642
1229 Ga0501080_0219734
1230 Ga0501080_0353578
1231 Ga0501080_0830004
1232 Ga0501080_1043219
1233 Ga0501081_0005598
1234 Ga0501081_0039703
1235 Ga0501081_0261099
1236 Ga0501081_0431266
1237 Ga0501081_0797841
1238 Ga0501081_1078879
1239 Ga0501266_017957
1240 Ga0501268_000433
1241 Ga0501044_0045104
1242 Ga0501045_0017418
1243 Ga0501045_0035556
1244 Ga0501045_1137383
1245 nmdc:mga05p37_1412_c1
1246 nmdc:mga05p37_169662_c1
1247 nmdc:mga05p37_19288_c1
1248 nmdc:mga05p37_4055_c1
1249 nmdc:mga05p37_607233_c1
1250 nmdc:mga05p37_95332_c1
1251 nmdc:mga09592_194963_c1
1252 nmdc:mga09592_2592_c1
1253 nmdc:mga09592_279414_c1
1254 nmdc:mga09592_285633_c1
1255 nmdc:mga09592_4996_c1
1256 nmdc:mga09592_538316_c1
1257 nmdc:mga09592_57099_c1
1258 nmdc:mga09592_59355_c1
1259 nmdc:mga09592_73930_c1
1260 nmdc:mga0qj67_2010_c1
1261 nmdc:mga0qj67_2834_c1
1262 nmdc:mga0qj67_313740_c1
1263 nmdc:mga0qj67_420430_c1
1264 nmdc:mga0qj67_444490_c1
1265 nmdc:mga0qj67_521281_c1
1266 nmdc:mga0qj67_7544_c1
1267 nmdc:mga06r32_162891_c1
1268 nmdc:mga06r32_211820_c1
1269 nmdc:mga06r32_238502_c1
1270 nmdc:mga06r32_738960_c1
1271 nmdc:mga06r32_773835_c1
1272 nmdc:mga06r32_837_c1
1273 nmdc:mga08y16_1064304_c1
1274 nmdc:mga08y16_120720_c1
1275 nmdc:mga08y16_12692_c1
1276 nmdc:mga08y16_1754932_c1
1277 nmdc:mga08y16_18422_c1
1278 nmdc:mga08y16_492240_c1
1279 nmdc:mga08y16_603966_c1
1280 nmdc:mga0n895_1120_c1
1281 nmdc:mga0n895_128785_c1
1282 nmdc:mga0n895_31387_c1
1283 nmdc:mga0n895_526294_c1
1284 nmdc:mga0n895_58879_c1
1285 nmdc:mga0rr50_28236_c1
1286 nmdc:mga0rr50_438058_c1
1287 nmdc:mga0rr50_4731_c1
1288 nmdc:mga0rr50_654_c1
1289 nmdc:mga08x19_564348_c1
1290 nmdc:mga08x19_8881_c1
1291 nmdc:mga0a205_10719_c1
1292 nmdc:mga0a205_3276_c1
1293 nmdc:mga0a205_604346_c1
1294 Ga0495619_0009750
1295 Ga0501084_0040605
1296 Ga0501084_0052645
1297 Ga0501084_0172950
1298 Ga0501084_0189498
1299 Ga0501084_0212459
1300 Ga0501084_1019952
1301 Ga0501082_0000490
1302 Ga0501082_0019730
1303 Ga0501082_0029085
1304 Ga0501082_0224166
1305 Ga0501082_0538431
1306 Ga0530510_0039714
1307 Ga0530510_0122022
1308 Ga0530510_0188428
1309 Ga0530510_0324002
1310 Ga0530510_1022487

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

7

81

0.89

PF00881

Nitroreductase

Nitroreductase family

67

140

0.89

PF14512

TM1586_NiRdase

Putative TM nitroreductase

2

176

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j6c-assembly1.cif.gz_B fmn-dependent nitroreductase (cdr20291_0767) from clostridium difficile r20291 0.9206 12 144
3g14-assembly1.cif.gz_A crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.8898 1 141
4g8s-assembly1.cif.gz_B crystal structure of a putative nitroreductase from geobacter sulfurreducens pca (target psi-013445) 0.887 1 141
3g14-assembly1.cif.gz_B crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.8658 1 148
3h4o-assembly1.cif.gz_A crystal structure of a nitroreductase family protein (cd3355) from clostridium difficile 630 at 1.50 a resolution 0.8612 1 163
ID Description Score Start End Superfamily
5j6cB00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9206 12 144 3.40.109.10
3g14A00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8622 4 141 3.40.109.10
4g8sB00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8436 1 141 3.40.109.10
3h4oA00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8358 5 163 3.40.109.10
3gfdA01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8334 4 141 3.40.109.10
ID Description Score Start End GO Terms
AF-K0IDH5-F1-model_v4 Putative nitroreductase 0.9283 1 146 GO:0016491
AF-A0A3M1Y1F1-F1-model_v4 NAD(P)H nitroreductase 0.9111 4 145 GO:0016491
AF-A0A1G3PDN7-F1-model_v4 Nitroreductase domain-containing protein 0.9035 4 147 GO:0016491
AF-A0A7X8EIT0-F1-model_v4 NAD(P)H-dependent dehydrogenase/reductase 0.9004 1 146 GO:0016491
AF-A0A7I9M8H0-F1-model_v4 deleted 0.8997 1 143

Map