F472734

General Info

Members Datasets Scaffolds Average Seq Length
653 336 594 385

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10017668|Ga0055531_100176681
Length 423
Sequence MPRLKSRTSSPRPKWSRAESNAVNEVVQPNAIPIVLAQGAPVAKQNLLDLDREGLERFFAETLGEARYRAHQVMKWIHHHYVTDFDQMTDLGKALRSKLQQHAEVRVPNIVFDKPSADGTHKWLLAMGTDGKNAIEAVYIPDKNRGTLCVSSQVGCALNCTFCSTATQGFNRNLSTAEIIGQVWVAARHLGNIPHKQRRLTNVVMMGMGEPLMNXDNVVRAMSVMRDDLGYGLANKRVTLSTSGLVPQIDRLSAESDVSLAVSLHAPNDALRETLVPLNKKYPIVELMASCARYLRANKRRESVTFEYTLMKGINDQPEHARQLARLMRQFDNAVQAAHSGKVNLIPFNPFPGTRYERSGDAEIRAFQKILLDSQVLTMVRRTRGDDIDAACGQLKGQVMDRTRRQAEFNKTLQDGKNRDAAA

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
6 2643221559 Lysobacter sp. Root559 Isolate Unclassified
7 2643221573 Lysobacter sp. Root604 Isolate Unclassified
8 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
9 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
10 2643221593 Lysobacter sp. Root690 Isolate Unclassified
11 2643221612 Lysobacter sp. Root76 Isolate Unclassified
12 2643221695 Lysobacter sp. Root494 Isolate Unclassified
13 2643221720 Lysobacter sp. Root916 Isolate Unclassified
14 2643221727 Lysobacter sp. Root96 Isolate Unclassified
15 2643221728 Lysobacter sp. Root983 Isolate Unclassified
16 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
17 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
18 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
19 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
20 2818991457 Xanthomonas translucens 569 Isolate Unclassified
21 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
22 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
23 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
24 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
25 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
26 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
27 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
28 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
29 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
30 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
31 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
32 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
33 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
34 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
35 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
36 2919513703 Luteimonas sp. 3794 Isolate Unclassified
37 2919675420 Luteimonas terrae 4099 Isolate Unclassified
38 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
39 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
40 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
41 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
42 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
43 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
44 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
45 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
46 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
47 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
48 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
49 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
50 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
51 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
52 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
53 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
54 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
55 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
56 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
57 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
58 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
59 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
60 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
61 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
62 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
63 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
64 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
65 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
66 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
67 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
68 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
69 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
70 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
71 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
72 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
73 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
81 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
82 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
83 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
84 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
85 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
86 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
87 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
88 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
89 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
90 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
91 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
92 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
93 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
94 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
95 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
96 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
97 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
98 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
108 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
129 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
146 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
150 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
151 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
152 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
219 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
220 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
221 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
222 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
223 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
224 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
225 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
226 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
227 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
228 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
231 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
232 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
233 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
234 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
237 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
238 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
242 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
243 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
244 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
245 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
246 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
247 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
248 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
249 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
250 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
251 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
252 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
253 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
254 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
255 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
256 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
257 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
258 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
259 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
267 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
268 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
273 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
274 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
288 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
289 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
290 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
291 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
296 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
310 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
313 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
314 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
315 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
316 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
317 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
318 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
322 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
323 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
324 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
326 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
327 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
328 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
329 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
330 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
334 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
335 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
336 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.81
Metatranscriptomes 0.31
Isolates 8.88

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 11.49
Nodule 0.15
Rhizoplane 3.06
Rhizosphere 73.51
Stem 0
Stem Tuber 0
Unclassified 11.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10003192 3300002077 Bacteria 3365
2 JGI25152J39213_1000529 3300002773 Bacteria 21134
3 JGI25150J39212_1000383 3300002774 Bacteria 21138
4 JGI25151J46595_10000041 3300003187 Bacteria 174472
5 JGI25151J46595_10000176 3300003187 Bacteria 82143
6 JGI25153J46596_10000129 3300003215 Bacteria 82143
7 Ga0055526_1000527 3300003771 Bacteria 30369
8 Ga0055526_1001879 3300003771 Bacteria 14549
9 Ga0055526_1004038 3300003771 Bacteria 9017
10 Ga0055537_1000226 3300003773 Bacteria 41255
11 Ga0055537_1001085 3300003773 Bacteria 11959
12 Ga0055524_1000041 3300003775 Bacteria 156728
13 Ga0055524_1020562 3300003775 Bacteria 2219
14 Ga0055536_1008190 3300003781 Bacteria 4539
15 Ga0055536_1011555 3300003781 Bacteria 3370
16 Ga0055536_1011574 3300003781 Bacteria 3364
17 Ga0055536_1014965 3300003781 Bacteria 2684
18 Ga0055534_1000258 3300003784 Bacteria 36880
19 Ga0055534_1000462 3300003784 Bacteria 23363
20 Ga0055534_1011667 3300003784 Bacteria 1775
21 Ga0055528_1000017 3300003790 Bacteria 156728
22 Ga0055528_1000065 3300003790 Bacteria 85294
23 Ga0055530_10019232 3300003791 Bacteria 2074
24 Ga0055530_10019234 3300003791 Bacteria 2074
25 Ga0055531_10011324 3300003794 Bacteria 4319
26 Ga0055531_10017668 3300003794 Bacteria 2995
27 Ga0058692_1000023 3300003856 Bacteria 237263
28 Ga0058692_1000285 3300003856 Bacteria 26681
29 Ga0065704_10000509 3300005289 Bacteria 25144
30 Ga0065704_10070536 3300005289 Bacteria 21377
31 Ga0065704_10111287 3300005289 Bacteria 1960
32 Ga0065704_10112342 3300005289 Bacteria 1936
33 Ga0065715_10018340 3300005293 Bacteria 2772
34 Ga0070676_10009917 3300005328 Bacteria 5156
35 Ga0070676_10045956 3300005328 Bacteria 2544
36 Ga0068869_100012574 3300005334 Bacteria 5598
37 Ga0070666_10000763 3300005335 Bacteria 19462
38 Ga0070666_10012971 3300005335 Bacteria 5275
39 Ga0070666_10027948 3300005335 Bacteria 3698
40 Ga0070666_10032675 3300005335 Bacteria 3438
41 Ga0068868_100102910 3300005338 Bacteria 2313
42 Ga0070660_100003996 3300005339 Bacteria 10178
43 Ga0070660_100081848 3300005339 Bacteria 2534
44 Ga0070661_100006394 3300005344 Bacteria 8124
45 Ga0070661_100019534 3300005344 Bacteria 4829
46 Ga0070668_100006847 3300005347 Bacteria 8450
47 Ga0070668_100016260 3300005347 Bacteria 5565
48 Ga0070668_100025329 3300005347 Bacteria 4497
49 Ga0070668_100070838 3300005347 Bacteria 2715
50 Ga0070668_100125971 3300005347 Bacteria 2052
51 Ga0070669_100011996 3300005353 Bacteria 6150
52 Ga0070671_100046319 3300005355 Bacteria 3616
53 Ga0070674_100048311 3300005356 Bacteria 2920
54 Ga0070674_100186368 3300005356 Bacteria 1593
55 Ga0070659_100019128 3300005366 Bacteria 5182
56 Ga0070659_100027585 3300005366 Bacteria 4377
57 Ga0070667_100000090 3300005367 Bacteria 112981
58 Ga0070667_100001463 3300005367 Bacteria 21160
59 Ga0070667_100016049 3300005367 Bacteria 6195
60 Ga0070667_100027229 3300005367 Bacteria 4756
61 Ga0070667_100033628 3300005367 Bacteria 4287
62 Ga0070667_100076641 3300005367 Bacteria 2855
63 Ga0070667_100103539 3300005367 Bacteria 2461
64 Ga0070667_100116422 3300005367 Bacteria 2321
65 Ga0070667_100348181 3300005367 Bacteria 1341
66 Ga0070714_100188814 3300005435 Bacteria 1879
67 Ga0070663_100001470 3300005455 Bacteria 12959
68 Ga0070663_100025497 3300005455 Bacteria 3993
69 Ga0070663_100095224 3300005455 Bacteria 2212
70 Ga0070663_100115282 3300005455 Bacteria 2024
71 Ga0070678_100006167 3300005456 Bacteria 7007
72 Ga0070678_100011525 3300005456 Bacteria 5460
73 Ga0070662_100033265 3300005457 Bacteria 3629
74 Ga0068867_100254759 3300005459 Bacteria 1428
75 Ga0070685_10001309 3300005466 Bacteria 13102
76 Ga0070685_10045633 3300005466 Bacteria 2514
77 Ga0070679_100014740 3300005530 Bacteria 7511
78 Ga0070679_100021110 3300005530 Bacteria 6354
79 Ga0070679_100021528 3300005530 Bacteria 6296
80 Ga0070684_100091787 3300005535 Bacteria 2702
81 Ga0068853_100000795 3300005539 Bacteria 21890
82 Ga0068853_100009902 3300005539 Bacteria 7695
83 Ga0068853_100214940 3300005539 Bacteria 1754
84 Ga0070672_100002016 3300005543 Bacteria 12773
85 Ga0070672_100007880 3300005543 Bacteria 7270
86 Ga0070672_100018396 3300005543 Bacteria 5052
87 Ga0070693_100004397 3300005547 Bacteria 6659
88 Ga0070665_100000283 3300005548 Bacteria 82138
89 Ga0070665_100001823 3300005548 Bacteria 24183
90 Ga0070665_100022970 3300005548 Bacteria 6280
91 Ga0068855_100014240 3300005563 Bacteria 9581
92 Ga0068855_100105016 3300005563 Bacteria 3248
93 Ga0068855_100151747 3300005563 Bacteria 2634
94 Ga0068855_100285805 3300005563 Bacteria 1830
95 Ga0068857_100094105 3300005577 Bacteria 2683
96 Ga0068854_100141314 3300005578 Bacteria 1848
97 Ga0068856_100002977 3300005614 Bacteria 17350
98 Ga0068856_100098384 3300005614 Bacteria 2916
99 Ga0068856_100340165 3300005614 Bacteria 1519
100 Ga0068852_100005567 3300005616 Bacteria 9032
101 Ga0068852_100021388 3300005616 Bacteria 5164
102 Ga0068852_100093029 3300005616 Bacteria 2701
103 Ga0068852_100196922 3300005616 Bacteria 1905
104 Ga0068859_100002133 3300005617 Bacteria 20138
105 Ga0068859_100046266 3300005617 Bacteria 4370
106 Ga0068864_100016372 3300005618 Bacteria 6172
107 Ga0068864_100047435 3300005618 Bacteria 3689
108 Ga0068851_10005322 3300005834 Bacteria 5843
109 Ga0068851_10012806 3300005834 Bacteria 3962
110 Ga0068863_100000945 3300005841 Bacteria 29155
111 Ga0068863_100042745 3300005841 Bacteria 4305
112 Ga0068863_100045185 3300005841 Bacteria 4180
113 Ga0068863_100060280 3300005841 Bacteria 3589
114 Ga0068863_100100499 3300005841 Bacteria 2749
115 Ga0068863_100148826 3300005841 Bacteria 2240
116 Ga0068858_100007811 3300005842 Bacteria 10326
117 Ga0068860_100001333 3300005843 Bacteria 26831
118 Ga0068860_100079130 3300005843 Bacteria 3126
119 Ga0068860_100171032 3300005843 Bacteria 2099
120 Ga0068862_100000707 3300005844 Bacteria 34098
121 Ga0075363_100080799 3300006048 Bacteria 1778
122 Ga0075364_10000928 3300006051 Bacteria 15498
123 Ga0075367_10009991 3300006178 Bacteria 4975
124 Ga0075369_10014137 3300006186 Bacteria 3184
125 Ga0097621_100147981 3300006237 Bacteria 2012
126 Ga0097621_100186958 3300006237 Bacteria 1792
127 Ga0068871_100012627 3300006358 Bacteria 6237
128 Ga0068871_100027477 3300006358 Bacteria 4451
129 Ga0068871_100066954 3300006358 Bacteria 2945
130 Ga0068871_100195308 3300006358 Bacteria 1745
131 Ga0068865_100007663 3300006881 Bacteria 6650
132 Ga0068865_100024363 3300006881 Bacteria 3969
133 Ga0097620_100002133 3300006931 Bacteria 20138
134 Ga0097620_100046266 3300006931 Bacteria 4370
135 Ga0105251_10000450 3300009011 Bacteria 39635
136 Ga0105251_10017454 3300009011 Bacteria 3845
137 Ga0105240_10001034 3300009093 Bacteria 49457
138 Ga0105240_10018043 3300009093 Bacteria 9490
139 Ga0105245_10253063 3300009098 Bacteria 1712
140 Ga0105243_10087251 3300009148 Bacteria 2561
141 Ga0105243_10167468 3300009148 Bacteria 1900
142 Ga0105241_10010963 3300009174 Bacteria 6645
143 Ga0105241_10011152 3300009174 Bacteria 6588
144 Ga0105241_10017434 3300009174 Bacteria 5279
145 Ga0105241_10127825 3300009174 Bacteria 2054
146 Ga0105241_10187469 3300009174 Bacteria 1720
147 Ga0105242_10000862 3300009176 Bacteria 23518
148 Ga0105248_10000252 3300009177 Bacteria 62538
149 Ga0105248_10009513 3300009177 Bacteria 10697
150 Ga0105248_10159513 3300009177 Bacteria 2544
151 Ga0105248_10179890 3300009177 Bacteria 2383
152 Ga0105248_10380517 3300009177 Bacteria 1589
153 Ga0105237_10000345 3300009545 Bacteria 65477
154 Ga0105237_10013282 3300009545 Bacteria 8640
155 Ga0105237_10048937 3300009545 Bacteria 4250
156 Ga0105238_10001167 3300009551 Bacteria 26450
157 Ga0105238_10002155 3300009551 Bacteria 19900
158 Ga0105238_10016598 3300009551 Bacteria 7456
159 Ga0105238_10025373 3300009551 Bacteria 6043
160 Ga0105238_10337292 3300009551 Bacteria 1495
161 Ga0105249_10002096 3300009553 Bacteria 17301
162 Ga0105249_10034363 3300009553 Bacteria 4595
163 Ga0105249_10124952 3300009553 Bacteria 2449
164 Ga0105249_10206728 3300009553 Bacteria 1924
165 Ga0105032_101421 3300009979 Bacteria 2195
166 Ga0105239_10001370 3300010375 Bacteria 32700
167 Ga0105239_10004199 3300010375 Bacteria 17302
168 Ga0105239_10011975 3300010375 Bacteria 9670
169 Ga0105239_10020971 3300010375 Bacteria 7211
170 Ga0105239_10026783 3300010375 Bacteria 6345
171 Ga0105239_10029639 3300010375 Bacteria 6017
172 Ga0105239_10320343 3300010375 Bacteria 1748
173 Ga0105246_10070137 3300011119 Bacteria 2464
174 Ga0105246_10078960 3300011119 Bacteria 2339
175 Ga0157318_1000036 3300012482 Bacteria 3715
176 Ga0157316_1000061 3300012510 Bacteria 4622
177 Ga0157373_10031695 3300013100 Bacteria 3805
178 Ga0157371_10019209 3300013102 Bacteria 5042
179 Ga0157370_10068303 3300013104 Bacteria 3359
180 Ga0157369_10000027 3300013105 Bacteria 213988
181 Ga0157369_10001075 3300013105 Bacteria 34218
182 Ga0157374_10029789 3300013296 Bacteria 4949
183 Ga0157374_10070752 3300013296 Bacteria 3288
184 Ga0157374_10103391 3300013296 Bacteria 2733
185 Ga0157374_10232606 3300013296 Bacteria 1811
186 Ga0157378_10000016 3300013297 Bacteria 142649
187 Ga0157378_10037698 3300013297 Bacteria 4284
188 Ga0157378_10202570 3300013297 Bacteria 1877
189 Ga0163162_10000107 3300013306 Bacteria 74745
190 Ga0163162_10005036 3300013306 Bacteria 12733
191 Ga0163162_10020014 3300013306 Bacteria 6573
192 Ga0157372_10000662 3300013307 Bacteria 37834
193 Ga0157372_10035029 3300013307 Bacteria 5523
194 Ga0157375_10006575 3300013308 Bacteria 10118
195 Ga0157375_10012067 3300013308 Bacteria 7652
196 Ga0157375_10062762 3300013308 Bacteria 3693
197 Ga0163163_10000117 3300014325 Bacteria 84938
198 Ga0163163_10005615 3300014325 Bacteria 10868
199 Ga0163163_10027823 3300014325 Bacteria 5421
200 Ga0157380_10032552 3300014326 Bacteria 4012
201 Ga0182008_10001932 3300014497 Bacteria 13367
202 Ga0157379_10002463 3300014968 Bacteria 15500
203 Ga0157376_10012479 3300014969 Bacteria 6308
204 Ga0157376_10018524 3300014969 Bacteria 5341
205 Ga0182007_10001075 3300015262 Bacteria 14873
206 Ga0182005_1001036 3300015265 Bacteria 11761
207 Ga0182005_1008264 3300015265 Bacteria 3074
208 Ga0183360_10001 3300015689 Bacteria 3943671
209 Ga0163161_10075177 3300017792 Bacteria 2479
210 Ga0163161_10087444 3300017792 Bacteria 2302
211 Ga0206349_1053534 3300020075 Bacteria 3924
212 Ga0228598_1007623 3300024227 Bacteria 2199
213 Ga0207425_1000011 3300025245 Bacteria 550735
214 Ga0209129_1000044 3300025258 Bacteria 298971
215 Ga0209565_1000001 3300025263 Bacteria 2950419
216 Ga0209565_1000014 3300025263 Bacteria 530302
217 Ga0209673_1000001 3300025273 Bacteria 3176258
218 Ga0209673_1000065 3300025273 Bacteria 252799
219 Ga0209673_1009750 3300025273 Bacteria 4122
220 Ga0209130_1006994 3300025284 Bacteria 3558
221 Ga0209675_1000001 3300025291 Bacteria 2950293
222 Ga0209675_1000011 3300025291 Bacteria 520597
223 Ga0209675_1010448 3300025291 Bacteria 3167
224 Ga0209676_1000011 3300025292 Bacteria 860463
225 Ga0209676_1000170 3300025292 Bacteria 154647
226 Ga0209676_1000324 3300025292 Bacteria 92019
227 Ga0209676_1000400 3300025292 Bacteria 79157
228 Ga0209025_1000012 3300025294 Bacteria 924362
229 Ga0209025_1000015 3300025294 Bacteria 808120
230 Ga0209025_1022153 3300025294 Bacteria 3384
231 Ga0209564_1000001 3300025295 Bacteria 3176258
232 Ga0209564_1000775 3300025295 Bacteria 44355
233 Ga0209564_1005053 3300025295 Bacteria 7714
234 Ga0209758_1000018 3300025297 Bacteria 753320
235 Ga0209758_1010564 3300025297 Bacteria 5503
236 Ga0209758_1021717 3300025297 Bacteria 2980
237 Ga0209050_1000932 3300025298 Bacteria 38288
238 Ga0209050_1002408 3300025298 Bacteria 16165
239 Ga0209050_1002409 3300025298 Bacteria 16158
240 Ga0209256_1000002 3300025299 Bacteria 1906740
241 Ga0209256_1006041 3300025299 Bacteria 6612
242 Ga0209051_1003709 3300025303 Bacteria 9852
243 Ga0209051_1005139 3300025303 Bacteria 7765
244 Ga0209257_1000014 3300025304 Bacteria 946850
245 Ga0209257_1000065 3300025304 Bacteria 353604
246 Ga0209257_1000170 3300025304 Bacteria 169384
247 Ga0209257_1000793 3300025304 Bacteria 46093
248 Ga0209257_1001655 3300025304 Bacteria 25316
249 Ga0209257_1007564 3300025304 Bacteria 6514
250 Ga0207697_10073104 3300025315 Bacteria 1439
251 Ga0207656_10012718 3300025321 Bacteria 3205
252 Ga0207713_1001361 3300025735 Bacteria 19874
253 Ga0207713_1016417 3300025735 Bacteria 3756
254 Ga0207680_10000249 3300025903 Bacteria 25802
255 Ga0207680_10079557 3300025903 Bacteria 2056
256 Ga0207680_10084775 3300025903 Bacteria 2000
257 Ga0207680_10165534 3300025903 Bacteria 1486
258 Ga0207647_10000440 3300025904 Bacteria 33864
259 Ga0207647_10003399 3300025904 Bacteria 11928
260 Ga0207645_10015322 3300025907 Bacteria 5097
261 Ga0207645_10018230 3300025907 Bacteria 4623
262 Ga0207645_10202740 3300025907 Bacteria 1305
263 Ga0207705_10254637 3300025909 Bacteria 1339
264 Ga0207654_10003999 3300025911 Bacteria 7423
265 Ga0207654_10026748 3300025911 Bacteria 3128
266 Ga0207654_10132176 3300025911 Bacteria 1581
267 Ga0207695_10000007 3300025913 Bacteria 1092551
268 Ga0207695_10000094 3300025913 Bacteria 265779
269 Ga0207695_10003459 3300025913 Bacteria 22244
270 Ga0207695_10004403 3300025913 Bacteria 19258
271 Ga0207695_10006570 3300025913 Bacteria 15048
272 Ga0207695_10015845 3300025913 Bacteria 8854
273 Ga0207671_10000870 3300025914 Bacteria 38250
274 Ga0207671_10009115 3300025914 Bacteria 8334
275 Ga0207671_10010311 3300025914 Bacteria 7723
276 Ga0207671_10013380 3300025914 Bacteria 6536
277 Ga0207663_10149490 3300025916 Bacteria 1637
278 Ga0207657_10000801 3300025919 Bacteria 33295
279 Ga0207657_10004721 3300025919 Bacteria 14378
280 Ga0207657_10046209 3300025919 Bacteria 3815
281 Ga0207649_10007737 3300025920 Bacteria 5847
282 Ga0207649_10027746 3300025920 Bacteria 3326
283 Ga0207652_10012848 3300025921 Bacteria 6769
284 Ga0207681_10009793 3300025923 Bacteria 5862
285 Ga0207681_10039873 3300025923 Bacteria 3121
286 Ga0207694_10000733 3300025924 Bacteria 29483
287 Ga0207694_10003366 3300025924 Bacteria 12732
288 Ga0207694_10050784 3300025924 Bacteria 3213
289 Ga0207694_10086833 3300025924 Bacteria 2463
290 Ga0207687_10085530 3300025927 Bacteria 2288
291 Ga0207644_10003282 3300025931 Bacteria 10452
292 Ga0207644_10033944 3300025931 Bacteria 3570
293 Ga0207706_10010468 3300025933 Bacteria 8474
294 Ga0207706_10046446 3300025933 Bacteria 3845
295 Ga0207686_10014945 3300025934 Bacteria 4332
296 Ga0207709_10002040 3300025935 Bacteria 13078
297 Ga0207709_10051238 3300025935 Bacteria 2529
298 Ga0207704_10001698 3300025938 Bacteria 9855
299 Ga0207691_10002771 3300025940 Bacteria 17083
300 Ga0207691_10004997 3300025940 Bacteria 12793
301 Ga0207691_10008633 3300025940 Bacteria 9779
302 Ga0207691_10023735 3300025940 Bacteria 5773
303 Ga0207711_10001221 3300025941 Bacteria 24350
304 Ga0207711_10005518 3300025941 Bacteria 10697
305 Ga0207689_10012269 3300025942 Bacteria 7330
306 Ga0207689_10161275 3300025942 Bacteria 1847
307 Ga0207661_10149969 3300025944 Bacteria 2015
308 Ga0207679_10037747 3300025945 Bacteria 3437
309 Ga0207667_10002665 3300025949 Bacteria 22067
310 Ga0207667_10007120 3300025949 Bacteria 13500
311 Ga0207667_10095622 3300025949 Bacteria 3066
312 Ga0207667_10131902 3300025949 Bacteria 2573
313 Ga0207712_10002072 3300025961 Bacteria 13168
314 Ga0207668_10010635 3300025972 Bacteria 5567
315 Ga0207668_10039806 3300025972 Bacteria 3167
316 Ga0207668_10042883 3300025972 Bacteria 3067
317 Ga0207668_10132507 3300025972 Bacteria 1905
318 Ga0207640_10172976 3300025981 Bacteria 1611
319 Ga0207658_10000111 3300025986 Bacteria 89180
320 Ga0207658_10015506 3300025986 Bacteria 5228
321 Ga0207658_10176254 3300025986 Bacteria 1766
322 Ga0207658_10228572 3300025986 Bacteria 1569
323 Ga0207677_10052806 3300026023 Bacteria 2763
324 Ga0207703_10009557 3300026035 Bacteria 7614
325 Ga0207639_10000129 3300026041 Bacteria 55422
326 Ga0207639_10000598 3300026041 Bacteria 24826
327 Ga0207639_10004972 3300026041 Bacteria 8953
328 Ga0207639_10015772 3300026041 Bacteria 5332
329 Ga0207639_10027225 3300026041 Bacteria 4162
330 Ga0207639_10097461 3300026041 Bacteria 2368
331 Ga0207678_10000802 3300026067 Bacteria 28836
332 Ga0207678_10004034 3300026067 Bacteria 13211
333 Ga0207678_10033275 3300026067 Bacteria 4492
334 Ga0207678_10108637 3300026067 Bacteria 2366
335 Ga0207702_10015437 3300026078 Bacteria 6326
336 Ga0207702_10067833 3300026078 Bacteria 3063
337 Ga0207641_10038660 3300026088 Bacteria 3989
338 Ga0207641_10061591 3300026088 Bacteria 3200
339 Ga0207641_10183606 3300026088 Bacteria 1917
340 Ga0207648_10003832 3300026089 Bacteria 15709
341 Ga0207648_10049012 3300026089 Bacteria 3698
342 Ga0207648_10100903 3300026089 Bacteria 2529
343 Ga0207648_10231139 3300026089 Bacteria 1645
344 Ga0207676_10014192 3300026095 Bacteria 5723
345 Ga0207674_10005372 3300026116 Bacteria 15240
346 Ga0207674_10097705 3300026116 Bacteria 2921
347 Ga0207675_100016430 3300026118 Bacteria 6912
348 Ga0207683_10005014 3300026121 Bacteria 11371
349 Ga0207683_10014136 3300026121 Bacteria 6801
350 Ga0207683_10015477 3300026121 Bacteria 6497
351 Ga0207683_10077385 3300026121 Bacteria 2946
352 Ga0207698_10004306 3300026142 Bacteria 8668
353 Ga0207698_10211021 3300026142 Bacteria 1747
354 Ga0207698_10293291 3300026142 Bacteria 1510
355 Ga0209371_1000004 3300027312 Bacteria 1098197
356 Ga0209371_1000059 3300027312 Bacteria 237154
357 Ga0209999_1000930 3300027543 Bacteria 4921
358 Ga0209982_1000034 3300027552 Bacteria 12378
359 Ga0209970_1003495 3300027614 Bacteria 2637
360 Ga0209983_1000431 3300027665 Bacteria 9055
361 Ga0209971_1000355 3300027682 Bacteria 12576
362 Ga0209974_10026507 3300027876 Bacteria 1918
363 Ga0268266_10000001 3300028379 Bacteria 4040580
364 Ga0268266_10000006 3300028379 Bacteria 1410021
365 Ga0268266_10227572 3300028379 Bacteria 1716
366 Ga0268266_10283744 3300028379 Bacteria 1540
367 Ga0268265_10015894 3300028380 Bacteria 5162
368 Ga0268265_10160234 3300028380 Bacteria 1910
369 Ga0268264_10013736 3300028381 Bacteria 6663
370 Ga0268264_10045565 3300028381 Bacteria 3641
371 Ga0307515_10135444 3300028794 Bacteria 2682
372 Ga0268256_1000005 3300030500 Bacteria 1082342
373 Ga0268256_1000055 3300030500 Bacteria 237299
374 Ga0316177_1199532 3300030731 Bacteria 5482
375 Ga0316176_1113068 3300030732 Bacteria 4242
376 Ga0316183_1135259 3300030742 Bacteria 2131
377 Ga0316181_1062290 3300030744 Bacteria 4282
378 Ga0307513_10004310 3300031456 Bacteria 19017
379 Ga0307508_10128799 3300031616 Bacteria 2134
380 Ga0316575_10010769 3300031665 Bacteria 3369
381 Ga0307516_10070265 3300031730 Bacteria 3365
382 Ga0307413_10001879 3300031824 Bacteria 8298
383 Ga0307413_10006252 3300031824 Bacteria 5410
384 Ga0307413_10070248 3300031824 Bacteria 2201
385 Ga0307406_10116425 3300031901 Bacteria 1849
386 Ga0307409_100011535 3300031995 Bacteria 5580
387 Ga0307416_100141209 3300032002 Bacteria 2189
388 Ga0307416_100230389 3300032002 Bacteria 1785
389 Ga0307414_10000505 3300032004 Bacteria 20299
390 Ga0307414_10002258 3300032004 Bacteria 10067
391 Ga0307414_10011622 3300032004 Bacteria 5171
392 Ga0307414_10028371 3300032004 Bacteria 3630
393 Ga0307414_10123757 3300032004 Bacteria 1993
394 Ga0307411_10014421 3300032005 Bacteria 4396
395 Ga0307411_10065797 3300032005 Bacteria 2432
396 Ga0316593_10002956 3300032168 Bacteria 4134
397 Ga0373937_0221820 3300036401 Bacteria 1780
398 Ga0316582_0033025 3300036647 Bacteria 3175
399 Ga0395899_0073839 3300037312 Bacteria 2493
400 Ga0395899_0188143 3300037312 Bacteria 1446
401 Ga0395900_0083754 3300037418 Bacteria 3276
402 Ga0395905_0000800 3300037471 Bacteria 41323
403 Ga0395905_0023575 3300037471 Bacteria 5814
404 Ga0395905_0065319 3300037471 Bacteria 3406
405 Ga0395901_0197290 3300038443 Bacteria 2110
406 Ga0237819_00005 3300038705 Bacteria 79509
407 Ga0237819_02007 3300038705 Bacteria 4538
408 Ga0439436_0007087 3300041404 Bacteria 3451
409 Ga0439436_0011150 3300041404 Bacteria 2732
410 Ga0439465_0022285 3300041413 Bacteria 1989
411 Ga0451787_216685 3300041441 Bacteria 2625
412 Ga0451797_0066798 3300041453 Bacteria 1572
413 Ga0451797_1048131 3300041453 Bacteria 2061
414 Ga0451800_0480575 3300041459 Bacteria 6323
415 Ga0451802_0237918 3300041460 Bacteria 14021
416 Ga0451806_272703 3300041462 Bacteria 2936
417 Ga0451807_0148074 3300041486 Bacteria 3326
418 Ga0451807_1405164 3300041486 Bacteria 3395
419 Ga0451837_0160044 3300041494 Bacteria 1966
420 Ga0451837_0569604 3300041494 Bacteria 2017
421 Ga0451843_0823885 3300041509 Bacteria 2947
422 Ga0451843_0841619 3300041509 Bacteria 1476
423 Ga0451843_1136542 3300041509 Bacteria 5586
424 Ga0439445_0005628 3300042004 Bacteria 2861
425 Ga0439432_002206 3300042006 Bacteria 7354
426 Ga0439449_0000269 3300042007 Bacteria 18742
427 Ga0439449_0002020 3300042007 Bacteria 7986
428 Ga0439449_0003846 3300042007 Bacteria 5819
429 Ga0439452_018440 3300042010 Bacteria 1859
430 Ga0451577_0018786 3300042876 Bacteria 6360
431 Ga0466972_0004716 3300044658 Bacteria 6826
432 Ga0453684_0000377 3300044712 Bacteria 183445
433 Ga0466970_0028960 3300044765 Bacteria 2913
434 Ga0451576_0000033 3300045051 Bacteria 393131
435 Ga0495638_0012115 3300046460 Bacteria 5921
436 Ga0495639_0059204 3300046475 Bacteria 1753
437 Ga0495607_0037125 3300046501 Bacteria 2928
438 Ga0495606_0014127 3300046507 Bacteria 6251
439 Ga0495630_0195106 3300046517 Bacteria 1545
440 Ga0495663_0002038 3300046525 Bacteria 6193
441 Ga0495598_0000343 3300046537 Bacteria 8312
442 Ga0495656_0000880 3300046615 Bacteria 9718
443 Ga0495656_0010177 3300046615 Bacteria 3410
444 Ga0495668_0003099 3300046616 Bacteria 12850
445 Ga0495657_0085790 3300046675 Bacteria 2029
446 Ga0495658_0008047 3300046683 Bacteria 5220
447 Ga0495671_0004630 3300046692 Bacteria 8156
448 Ga0495636_0002531 3300047318 Bacteria 7018
449 Ga0495636_0007001 3300047318 Bacteria 4436
450 Ga0495685_017384 3300047447 Bacteria 2463
451 Ga0496102_0028982 3300048905 Bacteria 4949
452 Ga0496103_0095728 3300048906 Bacteria 1876
453 Ga0496104_0000022 3300048907 Bacteria 237390
454 Ga0496105_0000028 3300048908 Bacteria 145917
455 Ga0496108_0018117 3300048911 Bacteria 5762
456 Ga0496110_0121067 3300048913 Bacteria 2357
457 Ga0496111_0048587 3300048914 Bacteria 3056
458 Ga0496112_0104966 3300048915 Bacteria 2795
459 Ga0496114_0019032 3300048917 Bacteria 5563
460 Ga0496114_0028888 3300048917 Bacteria 4555
461 Ga0496114_0097876 3300048917 Bacteria 2500
462 Ga0496115_0000113 3300048918 Bacteria 74536
463 Ga0496117_0005126 3300048920 Bacteria 13994
464 Ga0496117_0005460 3300048920 Bacteria 13337
465 Ga0496117_0008711 3300048920 Bacteria 9586
466 Ga0496117_0011118 3300048920 Bacteria 8093
467 Ga0496117_0065667 3300048920 Bacteria 2465
468 Ga0496118_0000361 3300048921 Bacteria 76982
469 Ga0496118_0001754 3300048921 Bacteria 31454
470 Ga0496118_0007909 3300048921 Bacteria 11133
471 Ga0496118_0011022 3300048921 Bacteria 8878
472 Ga0496118_0012398 3300048921 Bacteria 8189
473 Ga0496118_0012849 3300048921 Bacteria 7988
474 Ga0496119_0072034 3300048922 Bacteria 2020
475 Ga0496120_0000161 3300048923 Bacteria 112351
476 Ga0496120_0004656 3300048923 Bacteria 11339
477 Ga0496121_0002940 3300048924 Bacteria 24917
478 Ga0496122_0000129 3300048925 Bacteria 173688
479 Ga0496122_0004925 3300048925 Bacteria 16187
480 Ga0496122_0024787 3300048925 Bacteria 5239
481 Ga0496123_0000113 3300048926 Bacteria 163689
482 Ga0496123_0000234 3300048926 Bacteria 112524
483 Ga0496123_0035130 3300048926 Bacteria 3577
484 Ga0496124_0000312 3300048927 Bacteria 89996
485 Ga0496124_0005295 3300048927 Bacteria 14586
486 Ga0496124_0007326 3300048927 Bacteria 11757
487 Ga0496124_0028051 3300048927 Bacteria 5039
488 Ga0496124_0081727 3300048927 Bacteria 2654
489 Ga0496124_0108641 3300048927 Bacteria 2236
490 Ga0496125_0046564 3300048928 Bacteria 3637
491 Ga0496126_0000226 3300048929 Bacteria 122150
492 Ga0496126_0010455 3300048929 Bacteria 9720
493 Ga0496126_0017881 3300048929 Bacteria 7054
494 Ga0496126_0044784 3300048929 Bacteria 4072
495 Ga0496126_0212717 3300048929 Bacteria 1627
496 Ga0501290_000312 3300049513 Bacteria 7960
497 Ga0501031_0009223 3300049568 Bacteria 6414
498 Ga0501031_0012719 3300049568 Bacteria 5497
499 Ga0501031_0018154 3300049568 Bacteria 4576
500 Ga0501032_0005711 3300049569 Bacteria 9209
501 Ga0501032_0043004 3300049569 Bacteria 3062
502 Ga0501032_0044418 3300049569 Bacteria 3007
503 Ga0501032_0117210 3300049569 Bacteria 1760
504 Ga0501033_0002102 3300049570 Bacteria 17249
505 Ga0501033_0003201 3300049570 Bacteria 13559
506 Ga0501033_0124383 3300049570 Bacteria 1870
507 Ga0501034_0000321 3300049571 Bacteria 84273
508 Ga0501034_0001241 3300049571 Bacteria 34650
509 Ga0501034_0002220 3300049571 Bacteria 23969
510 Ga0501034_0007828 3300049571 Bacteria 11365
511 Ga0501034_0015065 3300049571 Bacteria 7949
512 Ga0501034_0020678 3300049571 Bacteria 6722
513 Ga0501034_0024369 3300049571 Bacteria 6154
514 Ga0501034_0025544 3300049571 Bacteria 6015
515 Ga0501034_0076547 3300049571 Bacteria 3352
516 Ga0501034_0145620 3300049571 Bacteria 2346
517 Ga0501036_0009476 3300049572 Bacteria 8009
518 Ga0501036_0012483 3300049572 Bacteria 7043
519 Ga0501036_0068642 3300049572 Bacteria 2999
520 Ga0501036_0084218 3300049572 Bacteria 2688
521 Ga0501037_0059735 3300049573 Bacteria 2781
522 Ga0501037_0088630 3300049573 Bacteria 2239
523 Ga0501038_0001697 3300049574 Bacteria 20435
524 Ga0501038_0013042 3300049574 Bacteria 7580
525 Ga0501038_0109290 3300049574 Bacteria 2291
526 Ga0501038_0255737 3300049574 Bacteria 1386
527 Ga0501039_0010405 3300049575 Bacteria 7090
528 Ga0501039_0052722 3300049575 Bacteria 3146
529 Ga0501039_0127207 3300049575 Bacteria 1999
530 Ga0501042_0181237 3300049578 Bacteria 1520
531 Ga0501042_0243572 3300049578 Bacteria 1297
532 Ga0501043_0001923 3300049579 Bacteria 17777
533 Ga0501043_0055551 3300049579 Bacteria 3111
534 Ga0501046_0000711 3300049580 Bacteria 32113
535 Ga0501046_0102379 3300049580 Bacteria 2196
536 Ga0501047_0009134 3300049581 Bacteria 9360
537 Ga0501047_0018688 3300049581 Bacteria 6646
538 Ga0501047_0021722 3300049581 Bacteria 6162
539 Ga0501047_0050671 3300049581 Bacteria 4009
540 Ga0501047_0076004 3300049581 Bacteria 3232
541 Ga0501047_0087405 3300049581 Bacteria 2994
542 Ga0501047_0110912 3300049581 Bacteria 2626
543 Ga0501047_0272202 3300049581 Bacteria 1540
544 Ga0501048_0003997 3300049582 Bacteria 11200
545 Ga0501048_0129665 3300049582 Bacteria 1783
546 Ga0501067_0002024 3300049583 Bacteria 11183
547 Ga0501069_0001475 3300049585 Bacteria 11585
548 Ga0501069_0023615 3300049585 Bacteria 3354
549 Ga0501070_0007640 3300049586 Bacteria 9177
550 Ga0501070_0007684 3300049586 Bacteria 9148
551 Ga0501070_0085710 3300049586 Bacteria 2608
552 Ga0501070_0206211 3300049586 Bacteria 1614
553 Ga0501071_0024476 3300049587 Bacteria 4224
554 Ga0501071_0040766 3300049587 Bacteria 3324
555 Ga0501072_0140078 3300049588 Bacteria 1928
556 Ga0501073_0003789 3300049589 Bacteria 11370
557 Ga0501073_0023900 3300049589 Bacteria 4388
558 Ga0501073_0337979 3300049589 Bacteria 1039
559 Ga0501074_0005942 3300049590 Bacteria 8801
560 Ga0501074_0102431 3300049590 Bacteria 2049
561 Ga0501252_002416 3300049682 Bacteria 1852
562 Ga0501257_030932 3300049686 Bacteria 1290
563 Ga0501225_0006270 3300049705 Bacteria 3475
564 Ga0501080_0001158 3300049742 Bacteria 21765
565 Ga0501080_0036180 3300049742 Bacteria 4609
566 Ga0501080_0038645 3300049742 Bacteria 4455
567 Ga0501080_0050384 3300049742 Bacteria 3875
568 Ga0501080_0153045 3300049742 Bacteria 2131
569 Ga0501080_0164102 3300049742 Bacteria 2050
570 Ga0501083_0005792 3300049744 Bacteria 8750
571 Ga0501266_001457 3300049763 Bacteria 3017
572 Ga0501268_004448 3300049765 Bacteria 1976
573 Ga0501275_000448 3300049772 Bacteria 4638
574 Ga0501035_0039953 3300049822 Bacteria 4242
575 Ga0501035_0170498 3300049822 Bacteria 1880
576 Ga0501035_0178869 3300049822 Bacteria 1828
577 Ga0501044_0006764 3300049823 Bacteria 12636
578 Ga0501044_0034267 3300049823 Bacteria 5326
579 Ga0501044_0075050 3300049823 Bacteria 3433
580 Ga0501044_0247133 3300049823 Bacteria 1726
581 nmdc:mga00v17_15305_c1 3300050491 Bacteria 4305
582 nmdc:mga00v17_47069_c1 3300050491 Bacteria 2612
583 nmdc:mga00v17_9295_c1 3300050491 Bacteria 5316
584 Ga0500610_0004301 3300053079 Bacteria 5626
585 Ga0500643_012592 3300053087 Bacteria 3024
586 Ga0500651_0000070 3300053093 Bacteria 67252
587 Ga0500651_0007332 3300053093 Bacteria 6436
588 Ga0500634_0000217 3300053161 Bacteria 18600
589 Ga0500634_0059678 3300053161 Bacteria 2028
590 Ga0501084_0052834 3300054114 Bacteria 3399
591 Ga0501084_0090788 3300054114 Bacteria 2565
592 Ga0501084_0108965 3300054114 Bacteria 2327
593 Ga0501082_0002570 3300060353 Bacteria 15874
594 Ga0501082_0225836 3300060353 Bacteria 1629

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0272202 Ga0501047_0272202_558_1529 323
2 3300049589 Ga0501073_0337979 Ga0501073_0337979_57_1028 323
3 3300024227 Ga0228598_1007623 Ga0228598_10076232 324
4 3300048927 Ga0496124_0081727 Ga0496124_0081727_1579_2631 336
5 3300005356 Ga0070674_100048311 Ga0070674_1000483113 353
6 3300005843 Ga0068860_100171032 Ga0068860_1001710322 353
7 3300014326 Ga0157380_10032552 Ga0157380_100325523 353
8 3300006048 Ga0075363_100080799 Ga0075363_1000807992 355
9 3300053161 Ga0500634_0059678 Ga0500634_0059678_207_1358 355
10 3300005339 Ga0070660_100003996 Ga0070660_1000039964 356
11 3300005530 Ga0070679_100021110 Ga0070679_1000211103 356
12 3300005530 Ga0070679_100021528 Ga0070679_1000215286 356
13 3300005563 Ga0068855_100285805 Ga0068855_1002858053 356
14 3300025913 Ga0207695_10015845 Ga0207695_100158454 356
15 3300025919 Ga0207657_10046209 Ga0207657_100462094 356
16 3300025921 Ga0207652_10012848 Ga0207652_100128482 356
17 3300048920 Ga0496117_0065667 Ga0496117_0065667_971_2158 361
18 3300048921 Ga0496118_0001754 Ga0496118_0001754_14588_15775 361
19 3300013308 Ga0157375_10062762 Ga0157375_100627624 362
20 iso_pu_bacteria 2576861471 2578458622 363
21 iso_pu_bacteria 2857442823 2857446039 363
22 iso_pu_bacteria 2894414249 2894415547 363
23 3300031665 Ga0316575_10010769 Ga0316575_100107695 364
24 3300032168 Ga0316593_10002956 Ga0316593_100029563 364
25 3300036647 Ga0316582_0033025 Ga0316582_0033025_1793_2920 364
26 3300013102 Ga0157371_10019209 Ga0157371_100192092 365
27 3300030732 Ga0316176_1113068 Ga0316176_11130684 365
28 3300031824 Ga0307413_10070248 Ga0307413_100702482 365
29 3300046460 Ga0495638_0012115 Ga0495638_0012115_242_1411 365
30 3300048920 Ga0496117_0005126 Ga0496117_0005126_11257_12438 365
31 3300048920 Ga0496117_0005460 Ga0496117_0005460_157_1308 365
32 3300048920 Ga0496117_0011118 Ga0496117_0011118_6685_7833 365
33 3300048921 Ga0496118_0007909 Ga0496118_0007909_168_1319 365
34 3300048921 Ga0496118_0012849 Ga0496118_0012849_6574_7722 365
35 3300048922 Ga0496119_0072034 Ga0496119_0072034_261_1409 365
36 3300048923 Ga0496120_0000161 Ga0496120_0000161_13205_14386 365
37 3300048923 Ga0496120_0004656 Ga0496120_0004656_9914_11062 365
38 3300048925 Ga0496122_0004925 Ga0496122_0004925_13045_14226 365
39 3300048926 Ga0496123_0000234 Ga0496123_0000234_13179_14360 365
40 3300048926 Ga0496123_0035130 Ga0496123_0035130_223_1371 365
41 3300048927 Ga0496124_0005295 Ga0496124_0005295_223_1404 365
42 3300048927 Ga0496124_0108641 Ga0496124_0108641_807_1955 365
43 3300048928 Ga0496125_0046564 Ga0496125_0046564_124_1272 365
44 3300048929 Ga0496126_0010455 Ga0496126_0010455_259_1407 365
45 iso_pu_bacteria 2547132130 2547502810 365
46 iso_pu_bacteria 2643221579 2643906005 365
47 iso_pu_bacteria 2643221581 2643916573 365
48 iso_pu_bacteria 2747842428 2747948262 365
49 iso_pu_bacteria 2747842501 2748017975 365
50 iso_pu_bacteria 2765235840 2765578758 365
51 iso_pu_bacteria 2816332141 2816516817 365
52 iso_pu_bacteria 2818991457 2819663138 365
53 iso_pu_bacteria 2842391507 2842393250 365
54 iso_pu_bacteria 2842780639 2842783910 365
55 iso_pu_bacteria 2852649853 2852651012 365
56 iso_pu_bacteria 2852684882 2852685878 365
57 iso_pu_bacteria 2874220319 2874221386 365
58 iso_pu_bacteria 2919089067 2919091892 365
59 iso_pu_bacteria 2919130084 2919133724 365
60 iso_pu_bacteria 2919134579 2919137991 365
61 iso_pu_bacteria 2923516293 2923518349 365
62 iso_pu_bacteria 2928496128 2928496355 365
63 iso_pu_bacteria 2929195423 2929197541 365
64 iso_pu_bacteria 2931380184 2931380974 365
65 iso_pu_bacteria 2937610967 2937612195 365
66 iso_pu_bacteria 2939589442 2939590831 365
67 iso_pu_bacteria 2939622612 2939623033 365
68 iso_pu_bacteria 2939626828 2939629794 365
69 iso_pu_bacteria 2941475908 2941478111 365
70 iso_pu_bacteria 2961047084 2961048152 365
71 iso_pu_bacteria 2961064222 2961065155 365
72 iso_pu_bacteria 2974307012 2974309141 365
73 iso_pu_bacteria 2977247770 2977249858 365
74 iso_pu_bacteria 2984514374 2984515651 365
75 iso_pu_bacteria 2987605356 2987606042 365
76 iso_pu_bacteria 8002869464 8002872144 365
77 iso_pu_bacteria 8021622325 8021622736 365
78 iso_pu_bacteria 8021648035 8021649547 365
79 3300005543 Ga0070672_100002016 Ga0070672_1000020166 366
80 3300025940 Ga0207691_10004997 Ga0207691_100049976 366
81 3300041413 Ga0439465_0022285 Ga0439465_0022285_15_1151 366
82 3300049568 Ga0501031_0009223 Ga0501031_0009223_3528_4715 366
83 3300049571 Ga0501034_0145620 Ga0501034_0145620_536_1723 366
84 3300049572 Ga0501036_0012483 Ga0501036_0012483_3782_4969 366
85 3300049581 Ga0501047_0018688 Ga0501047_0018688_3612_4799 366
86 3300049742 Ga0501080_0036180 Ga0501080_0036180_1876_3063 366
87 3300049822 Ga0501035_0178869 Ga0501035_0178869_624_1811 366
88 3300049823 Ga0501044_0075050 Ga0501044_0075050_11_1198 366
89 iso_pu_bacteria 2571042365 2572253997 366
90 iso_pu_bacteria 2643221559 2643817737 366
91 iso_pu_bacteria 2643221573 2643878962 366
92 iso_pu_bacteria 2643221612 2644079522 366
93 iso_pu_bacteria 2643221720 2644660278 366
94 iso_pu_bacteria 2643221727 2644694964 366
95 iso_pu_bacteria 2643221728 2644697580 366
96 iso_pu_bacteria 2842757796 2842758344 366
97 iso_pu_bacteria 2895498888 2895504107 366
98 iso_pu_bacteria 2895511927 2895515461 366
99 iso_pu_bacteria 2895522137 2895525028 366
100 iso_pu_bacteria 2895525241 2895527737 366
101 iso_pu_bacteria 2919513703 2919514608 366
102 iso_pu_bacteria 2919675420 2919676651 366
103 iso_pu_bacteria 2941489479 2941490728 366
104 iso_pu_bacteria 2995948881 2995951316 366
105 iso_pu_bacteria 8003014200 8003014358 366
106 3300005618 Ga0068864_100047435 Ga0068864_1000474352 367
107 3300005841 Ga0068863_100148826 Ga0068863_1001488262 367
108 3300009177 Ga0105248_10380517 Ga0105248_103805172 367
109 3300012482 Ga0157318_1000036 Ga0157318_10000363 367
110 3300012510 Ga0157316_1000061 Ga0157316_10000615 367
111 3300032004 Ga0307414_10002258 Ga0307414_100022586 367
112 3300046615 Ga0495656_0010177 Ga0495656_0010177_1434_2594 367
113 3300047318 Ga0495636_0007001 Ga0495636_0007001_3102_4262 367
114 3300048913 Ga0496110_0121067 Ga0496110_0121067_427_1587 367
115 3300048914 Ga0496111_0048587 Ga0496111_0048587_1586_2746 367
116 3300048917 Ga0496114_0028888 Ga0496114_0028888_706_1866 367
117 3300049587 Ga0501071_0040766 Ga0501071_0040766_29_1210 367
118 iso_pu_bacteria 2643221593 2643973996 367
119 iso_pu_bacteria 2643221695 2644529260 367
120 3300002773 JGI25152J39213_1000529 JGI25152J39213_10005295 368
121 3300002774 JGI25150J39212_1000383 JGI25150J39212_100038315 368
122 3300003187 JGI25151J46595_10000176 JGI25151J46595_1000017624 368
123 3300003215 JGI25153J46596_10000129 JGI25153J46596_1000012924 368
124 3300003771 Ga0055526_1001879 Ga0055526_100187912 368
125 3300003771 Ga0055526_1004038 Ga0055526_10040386 368
126 3300003773 Ga0055537_1001085 Ga0055537_10010857 368
127 3300003775 Ga0055524_1020562 Ga0055524_10205621 368
128 3300003781 Ga0055536_1008190 Ga0055536_10081904 368
129 3300003781 Ga0055536_1011555 Ga0055536_10115553 368
130 3300003781 Ga0055536_1011574 Ga0055536_10115743 368
131 3300003781 Ga0055536_1014965 Ga0055536_10149653 368
132 3300003784 Ga0055534_1000258 Ga0055534_10002589 368
133 3300003784 Ga0055534_1011667 Ga0055534_10116672 368
134 3300003790 Ga0055528_1000065 Ga0055528_100006558 368
135 3300003791 Ga0055530_10019232 Ga0055530_100192322 368
136 3300003791 Ga0055530_10019234 Ga0055530_100192342 368
137 3300003794 Ga0055531_10011324 Ga0055531_100113243 368
138 3300003794 Ga0055531_10017668 Ga0055531_100176681 368
139 3300003856 Ga0058692_1000023 Ga0058692_100002363 368
140 3300003856 Ga0058692_1000285 Ga0058692_100028521 368
141 3300005289 Ga0065704_10000509 Ga0065704_1000050910 368
142 3300005289 Ga0065704_10070536 Ga0065704_100705363 368
143 3300005289 Ga0065704_10111287 Ga0065704_101112872 368
144 3300005289 Ga0065704_10112342 Ga0065704_101123422 368
145 3300005435 Ga0070714_100188814 Ga0070714_1001888142 368
146 3300005548 Ga0070665_100022970 Ga0070665_1000229702 368
147 3300006051 Ga0075364_10000928 Ga0075364_100009287 368
148 3300006178 Ga0075367_10009991 Ga0075367_100099912 368
149 3300006186 Ga0075369_10014137 Ga0075369_100141374 368
150 3300009011 Ga0105251_10000450 Ga0105251_1000045021 368
151 3300009011 Ga0105251_10017454 Ga0105251_100174542 368
152 3300009148 Ga0105243_10087251 Ga0105243_100872512 368
153 3300009148 Ga0105243_10167468 Ga0105243_101674682 368
154 3300014497 Ga0182008_10001932 Ga0182008_100019322 368
155 3300015262 Ga0182007_10001075 Ga0182007_100010754 368
156 3300015265 Ga0182005_1001036 Ga0182005_10010362 368
157 3300015265 Ga0182005_1008264 Ga0182005_10082642 368
158 3300017792 Ga0163161_10075177 Ga0163161_100751772 368
159 3300017792 Ga0163161_10087444 Ga0163161_100874442 368
160 3300020075 Ga0206349_1053534 Ga0206349_10535342 368
161 3300025245 Ga0207425_1000011 Ga0207425_1000011120 368
162 3300025258 Ga0209129_1000044 Ga0209129_100004467 368
163 3300025263 Ga0209565_1000014 Ga0209565_100001434 368
164 3300025273 Ga0209673_1000065 Ga0209673_1000065171 368
165 3300025273 Ga0209673_1009750 Ga0209673_10097502 368
166 3300025284 Ga0209130_1006994 Ga0209130_10069944 368
167 3300025291 Ga0209675_1000011 Ga0209675_1000011314 368
168 3300025291 Ga0209675_1010448 Ga0209675_10104483 368
169 3300025292 Ga0209676_1000011 Ga0209676_1000011735 368
170 3300025292 Ga0209676_1000170 Ga0209676_100017081 368
171 3300025292 Ga0209676_1000324 Ga0209676_100032471 368
172 3300025292 Ga0209676_1000400 Ga0209676_100040072 368
173 3300025294 Ga0209025_1000012 Ga0209025_1000012433 368
174 3300025294 Ga0209025_1022153 Ga0209025_10221534 368
175 3300025295 Ga0209564_1000775 Ga0209564_100077528 368
176 3300025295 Ga0209564_1005053 Ga0209564_10050536 368
177 3300025297 Ga0209758_1000018 Ga0209758_1000018224 368
178 3300025297 Ga0209758_1021717 Ga0209758_10217172 368
179 3300025298 Ga0209050_1000932 Ga0209050_100093219 368
180 3300025298 Ga0209050_1002408 Ga0209050_10024085 368
181 3300025298 Ga0209050_1002409 Ga0209050_100240912 368
182 3300025299 Ga0209256_1006041 Ga0209256_10060414 368
183 3300025303 Ga0209051_1003709 Ga0209051_10037094 368
184 3300025304 Ga0209257_1000014 Ga0209257_1000014794 368
185 3300025304 Ga0209257_1000065 Ga0209257_1000065342 368
186 3300025304 Ga0209257_1000170 Ga0209257_1000170116 368
187 3300025304 Ga0209257_1000793 Ga0209257_100079337 368
188 3300025304 Ga0209257_1001655 Ga0209257_100165513 368
189 3300025304 Ga0209257_1007564 Ga0209257_10075643 368
190 3300025735 Ga0207713_1001361 Ga0207713_100136115 368
191 3300025735 Ga0207713_1016417 Ga0207713_10164174 368
192 3300025935 Ga0207709_10002040 Ga0207709_100020407 368
193 3300025935 Ga0207709_10051238 Ga0207709_100512382 368
194 3300025972 Ga0207668_10010635 Ga0207668_100106352 368
195 3300027312 Ga0209371_1000004 Ga0209371_1000004187 368
196 3300027312 Ga0209371_1000059 Ga0209371_100005963 368
197 3300028379 Ga0268266_10283744 Ga0268266_102837442 368
198 3300028794 Ga0307515_10135444 Ga0307515_101354442 368
199 3300030500 Ga0268256_1000005 Ga0268256_1000005857 368
200 3300030500 Ga0268256_1000055 Ga0268256_1000055135 368
201 3300030742 Ga0316183_1135259 Ga0316183_11352592 368
202 3300030744 Ga0316181_1062290 Ga0316181_10622902 368
203 3300031456 Ga0307513_10004310 Ga0307513_1000431015 368
204 3300031824 Ga0307413_10001879 Ga0307413_100018794 368
205 3300032004 Ga0307414_10000505 Ga0307414_100005054 368
206 3300032004 Ga0307414_10011622 Ga0307414_100116225 368
207 3300032004 Ga0307414_10028371 Ga0307414_100283712 368
208 3300032005 Ga0307411_10065797 Ga0307411_100657972 368
209 3300038705 Ga0237819_00005 Ga0237819_00005_52259_53464 368
210 3300038705 Ga0237819_02007 Ga0237819_02007_2756_3961 368
211 3300041404 Ga0439436_0011150 Ga0439436_0011150_1322_2584 368
212 3300041459 Ga0451800_0480575 Ga0451800_0480575_1268_2473 368
213 3300041462 Ga0451806_272703 Ga0451806_272703_1316_2521 368
214 3300041486 Ga0451807_0148074 Ga0451807_0148074_510_1664 368
215 3300041486 Ga0451807_1405164 Ga0451807_1405164_2125_3330 368
216 3300041509 Ga0451843_1136542 Ga0451843_1136542_3172_4326 368
217 3300042004 Ga0439445_0005628 Ga0439445_0005628_45_1214 368
218 3300042007 Ga0439449_0000269 Ga0439449_0000269_15129_16355 368
219 3300042007 Ga0439449_0002020 Ga0439449_0002020_4626_5876 368
220 3300042007 Ga0439449_0003846 Ga0439449_0003846_1670_2956 368
221 3300042010 Ga0439452_018440 Ga0439452_018440_231_1481 368
222 3300046501 Ga0495607_0037125 Ga0495607_0037125_1441_2652 368
223 3300046507 Ga0495606_0014127 Ga0495606_0014127_4644_5855 368
224 3300046525 Ga0495663_0002038 Ga0495663_0002038_1661_2815 368
225 3300046615 Ga0495656_0000880 Ga0495656_0000880_3315_4568 368
226 3300046692 Ga0495671_0004630 Ga0495671_0004630_565_1719 368
227 3300048917 Ga0496114_0019032 Ga0496114_0019032_2094_3317 368
228 3300048925 Ga0496122_0024787 Ga0496122_0024787_322_1533 368
229 3300048927 Ga0496124_0000312 Ga0496124_0000312_34085_35296 368
230 3300048927 Ga0496124_0007326 Ga0496124_0007326_10311_11516 368
231 3300048927 Ga0496124_0028051 Ga0496124_0028051_202_1407 368
232 3300048929 Ga0496126_0017881 Ga0496126_0017881_826_2037 368
233 3300049570 Ga0501033_0124383 Ga0501033_0124383_32_1288 368
234 3300049571 Ga0501034_0000321 Ga0501034_0000321_63340_64563 368
235 3300049574 Ga0501038_0109290 Ga0501038_0109290_535_1791 368
236 3300049575 Ga0501039_0127207 Ga0501039_0127207_559_1815 368
237 3300049581 Ga0501047_0110912 Ga0501047_0110912_659_1918 368
238 3300049705 Ga0501225_0006270 Ga0501225_0006270_2096_3265 368
239 3300049822 Ga0501035_0170498 Ga0501035_0170498_555_1814 368
240 3300049823 Ga0501044_0247133 Ga0501044_0247133_216_1475 368
241 3300050491 nmdc:mga00v17_15305_c1 nmdc:mga00v17_15305_c1_858_2027 368
242 3300003187 JGI25151J46595_10000041 JGI25151J46595_1000004118 369
243 3300003771 Ga0055526_1000527 Ga0055526_100052718 369
244 3300003773 Ga0055537_1000226 Ga0055537_10002265 369
245 3300003775 Ga0055524_1000041 Ga0055524_1000041119 369
246 3300003784 Ga0055534_1000462 Ga0055534_10004627 369
247 3300003790 Ga0055528_1000017 Ga0055528_1000017119 369
248 3300005293 Ga0065715_10018340 Ga0065715_100183402 369
249 3300005339 Ga0070660_100081848 Ga0070660_1000818482 369
250 3300005347 Ga0070668_100016260 Ga0070668_1000162604 369
251 3300005355 Ga0070671_100046319 Ga0070671_1000463192 369
252 3300005356 Ga0070674_100186368 Ga0070674_1001863682 369
253 3300005366 Ga0070659_100019128 Ga0070659_1000191285 369
254 3300005543 Ga0070672_100007880 Ga0070672_1000078804 369
255 3300009098 Ga0105245_10253063 Ga0105245_102530632 369
256 3300009177 Ga0105248_10009513 Ga0105248_100095134 369
257 3300009979 Ga0105032_101421 Ga0105032_1014212 369
258 3300015689 Ga0183360_10001 Ga0183360_100011880 369
259 3300025263 Ga0209565_1000001 Ga0209565_10000011940 369
260 3300025273 Ga0209673_1000001 Ga0209673_10000011940 369
261 3300025291 Ga0209675_1000001 Ga0209675_1000001593 369
262 3300025294 Ga0209025_1000015 Ga0209025_1000015586 369
263 3300025295 Ga0209564_1000001 Ga0209564_1000001755 369
264 3300025297 Ga0209758_1010564 Ga0209758_10105644 369
265 3300025299 Ga0209256_1000002 Ga0209256_1000002798 369
266 3300025919 Ga0207657_10004721 Ga0207657_100047215 369
267 3300025923 Ga0207681_10009793 Ga0207681_100097936 369
268 3300025931 Ga0207644_10003282 Ga0207644_100032825 369
269 3300025940 Ga0207691_10002771 Ga0207691_1000277112 369
270 3300025941 Ga0207711_10005518 Ga0207711_100055184 369
271 3300025945 Ga0207679_10037747 Ga0207679_100377474 369
272 3300025972 Ga0207668_10132507 Ga0207668_101325072 369
273 3300026089 Ga0207648_10231139 Ga0207648_102311391 369
274 3300027543 Ga0209999_1000930 Ga0209999_10009304 369
275 3300027552 Ga0209982_1000034 Ga0209982_10000348 369
276 3300027614 Ga0209970_1003495 Ga0209970_10034953 369
277 3300027665 Ga0209983_1000431 Ga0209983_10004313 369
278 3300027682 Ga0209971_1000355 Ga0209971_10003555 369
279 3300027876 Ga0209974_10026507 Ga0209974_100265072 369
280 3300030731 Ga0316177_1199532 Ga0316177_11995324 369
281 3300031730 Ga0307516_10070265 Ga0307516_100702652 369
282 3300031824 Ga0307413_10006252 Ga0307413_100062523 369
283 3300031901 Ga0307406_10116425 Ga0307406_101164252 369
284 3300031995 Ga0307409_100011535 Ga0307409_1000115355 369
285 3300032002 Ga0307416_100230389 Ga0307416_1002303892 369
286 3300032004 Ga0307414_10123757 Ga0307414_101237572 369
287 3300032005 Ga0307411_10014421 Ga0307411_100144214 369
288 3300037312 Ga0395899_0073839 Ga0395899_0073839_903_2111 369
289 3300037312 Ga0395899_0188143 Ga0395899_0188143_193_1428 369
290 3300037418 Ga0395900_0083754 Ga0395900_0083754_401_1609 369
291 3300037471 Ga0395905_0000800 Ga0395905_0000800_13795_15003 369
292 3300037471 Ga0395905_0023575 Ga0395905_0023575_2429_3637 369
293 3300037471 Ga0395905_0065319 Ga0395905_0065319_170_1396 369
294 3300038443 Ga0395901_0197290 Ga0395901_0197290_144_1352 369
295 3300041404 Ga0439436_0007087 Ga0439436_0007087_458_1705 369
296 3300041453 Ga0451797_1048131 Ga0451797_1048131_146_1297 369
297 3300041494 Ga0451837_0160044 Ga0451837_0160044_605_1756 369
298 3300041509 Ga0451843_0823885 Ga0451843_0823885_467_1618 369
299 3300042006 Ga0439432_002206 Ga0439432_002206_4938_6191 369
300 3300042876 Ga0451577_0018786 Ga0451577_0018786_2114_3322 369
301 3300046537 Ga0495598_0000343 Ga0495598_0000343_3777_5012 369
302 3300046616 Ga0495668_0003099 Ga0495668_0003099_8241_9548 369
303 3300047318 Ga0495636_0002531 Ga0495636_0002531_3746_4990 369
304 3300047447 Ga0495685_017384 Ga0495685_017384_38_1282 369
305 3300048911 Ga0496108_0018117 Ga0496108_0018117_1553_2761 369
306 3300048915 Ga0496112_0104966 Ga0496112_0104966_551_1759 369
307 3300048924 Ga0496121_0002940 Ga0496121_0002940_15099_16424 369
308 3300049513 Ga0501290_000312 Ga0501290_000312_4983_6173 369
309 3300049571 Ga0501034_0001241 Ga0501034_0001241_10367_11524 369
310 3300049571 Ga0501034_0015065 Ga0501034_0015065_1784_2992 369
311 3300049682 Ga0501252_002416 Ga0501252_002416_289_1506 369
312 3300049686 Ga0501257_030932 Ga0501257_030932_42_1259 369
313 3300049763 Ga0501266_001457 Ga0501266_001457_266_1519 369
314 3300049765 Ga0501268_004448 Ga0501268_004448_116_1333 369
315 3300049772 Ga0501275_000448 Ga0501275_000448_2850_4040 369
316 3300050491 nmdc:mga00v17_47069_c1 nmdc:mga00v17_47069_c1_1412_2584 369
317 3300050491 nmdc:mga00v17_9295_c1 nmdc:mga00v17_9295_c1_2280_3452 369
318 3300053161 Ga0500634_0000217 Ga0500634_0000217_9997_11211 369
319 3300002077 JGI24744J21845_10003192 JGI24744J21845_100031922 370
320 3300005328 Ga0070676_10009917 Ga0070676_100099174 370
321 3300005328 Ga0070676_10045956 Ga0070676_100459562 370
322 3300005334 Ga0068869_100012574 Ga0068869_1000125745 370
323 3300005335 Ga0070666_10000763 Ga0070666_1000076318 370
324 3300005335 Ga0070666_10012971 Ga0070666_100129714 370
325 3300005335 Ga0070666_10027948 Ga0070666_100279483 370
326 3300005335 Ga0070666_10032675 Ga0070666_100326753 370
327 3300005338 Ga0068868_100102910 Ga0068868_1001029101 370
328 3300005344 Ga0070661_100006394 Ga0070661_1000063944 370
329 3300005344 Ga0070661_100019534 Ga0070661_1000195342 370
330 3300005347 Ga0070668_100006847 Ga0070668_1000068477 370
331 3300005347 Ga0070668_100025329 Ga0070668_1000253292 370
332 3300005347 Ga0070668_100070838 Ga0070668_1000708383 370
333 3300005347 Ga0070668_100125971 Ga0070668_1001259713 370
334 3300005353 Ga0070669_100011996 Ga0070669_1000119965 370
335 3300005366 Ga0070659_100027585 Ga0070659_1000275852 370
336 3300005367 Ga0070667_100000090 Ga0070667_10000009018 370
337 3300005367 Ga0070667_100001463 Ga0070667_10000146311 370
338 3300005367 Ga0070667_100016049 Ga0070667_1000160494 370
339 3300005367 Ga0070667_100027229 Ga0070667_1000272293 370
340 3300005367 Ga0070667_100033628 Ga0070667_1000336283 370
341 3300005367 Ga0070667_100076641 Ga0070667_1000766413 370
342 3300005367 Ga0070667_100103539 Ga0070667_1001035392 370
343 3300005367 Ga0070667_100116422 Ga0070667_1001164223 370
344 3300005367 Ga0070667_100348181 Ga0070667_1003481812 370
345 3300005455 Ga0070663_100001470 Ga0070663_1000014706 370
346 3300005455 Ga0070663_100025497 Ga0070663_1000254971 370
347 3300005455 Ga0070663_100095224 Ga0070663_1000952242 370
348 3300005455 Ga0070663_100115282 Ga0070663_1001152822 370
349 3300005456 Ga0070678_100006167 Ga0070678_1000061674 370
350 3300005456 Ga0070678_100011525 Ga0070678_1000115252 370
351 3300005457 Ga0070662_100033265 Ga0070662_1000332654 370
352 3300005459 Ga0068867_100254759 Ga0068867_1002547592 370
353 3300005466 Ga0070685_10001309 Ga0070685_1000130910 370
354 3300005466 Ga0070685_10045633 Ga0070685_100456333 370
355 3300005530 Ga0070679_100014740 Ga0070679_1000147404 370
356 3300005535 Ga0070684_100091787 Ga0070684_1000917872 370
357 3300005539 Ga0068853_100000795 Ga0068853_10000079516 370
358 3300005539 Ga0068853_100009902 Ga0068853_1000099027 370
359 3300005539 Ga0068853_100214940 Ga0068853_1002149401 370
360 3300005543 Ga0070672_100018396 Ga0070672_1000183964 370
361 3300005547 Ga0070693_100004397 Ga0070693_1000043972 370
362 3300005548 Ga0070665_100000283 Ga0070665_10000028316 370
363 3300005548 Ga0070665_100001823 Ga0070665_10000182317 370
364 3300005563 Ga0068855_100014240 Ga0068855_1000142408 370
365 3300005563 Ga0068855_100105016 Ga0068855_1001050162 370
366 3300005563 Ga0068855_100151747 Ga0068855_1001517474 370
367 3300005577 Ga0068857_100094105 Ga0068857_1000941054 370
368 3300005578 Ga0068854_100141314 Ga0068854_1001413142 370
369 3300005614 Ga0068856_100002977 Ga0068856_1000029774 370
370 3300005614 Ga0068856_100098384 Ga0068856_1000983844 370
371 3300005614 Ga0068856_100340165 Ga0068856_1003401652 370
372 3300005616 Ga0068852_100005567 Ga0068852_1000055675 370
373 3300005616 Ga0068852_100021388 Ga0068852_1000213882 370
374 3300005616 Ga0068852_100093029 Ga0068852_1000930293 370
375 3300005616 Ga0068852_100196922 Ga0068852_1001969222 370
376 3300005617 Ga0068859_100002133 Ga0068859_1000021335 370
377 3300005617 Ga0068859_100046266 Ga0068859_1000462663 370
378 3300005618 Ga0068864_100016372 Ga0068864_1000163723 370
379 3300005834 Ga0068851_10005322 Ga0068851_100053224 370
380 3300005834 Ga0068851_10012806 Ga0068851_100128064 370
381 3300005841 Ga0068863_100000945 Ga0068863_10000094526 370
382 3300005841 Ga0068863_100042745 Ga0068863_1000427452 370
383 3300005841 Ga0068863_100045185 Ga0068863_1000451855 370
384 3300005841 Ga0068863_100060280 Ga0068863_1000602804 370
385 3300005841 Ga0068863_100100499 Ga0068863_1001004994 370
386 3300005842 Ga0068858_100007811 Ga0068858_1000078114 370
387 3300005843 Ga0068860_100001333 Ga0068860_1000013333 370
388 3300005843 Ga0068860_100079130 Ga0068860_1000791303 370
389 3300005844 Ga0068862_100000707 Ga0068862_1000007073 370
390 3300006237 Ga0097621_100147981 Ga0097621_1001479812 370
391 3300006237 Ga0097621_100186958 Ga0097621_1001869582 370
392 3300006358 Ga0068871_100012627 Ga0068871_1000126272 370
393 3300006358 Ga0068871_100027477 Ga0068871_1000274774 370
394 3300006358 Ga0068871_100066954 Ga0068871_1000669542 370
395 3300006358 Ga0068871_100195308 Ga0068871_1001953081 370
396 3300006881 Ga0068865_100007663 Ga0068865_1000076635 370
397 3300006881 Ga0068865_100024363 Ga0068865_1000243634 370
398 3300006931 Ga0097620_100002133 Ga0097620_1000021335 370
399 3300006931 Ga0097620_100046266 Ga0097620_1000462663 370
400 3300009093 Ga0105240_10001034 Ga0105240_100010347 370
401 3300009093 Ga0105240_10018043 Ga0105240_100180435 370
402 3300009174 Ga0105241_10010963 Ga0105241_100109633 370
403 3300009174 Ga0105241_10011152 Ga0105241_100111524 370
404 3300009174 Ga0105241_10017434 Ga0105241_100174344 370
405 3300009174 Ga0105241_10127825 Ga0105241_101278252 370
406 3300009174 Ga0105241_10187469 Ga0105241_101874692 370
407 3300009176 Ga0105242_10000862 Ga0105242_1000086221 370
408 3300009177 Ga0105248_10000252 Ga0105248_100002524 370
409 3300009177 Ga0105248_10159513 Ga0105248_101595132 370
410 3300009177 Ga0105248_10179890 Ga0105248_101798901 370
411 3300009545 Ga0105237_10000345 Ga0105237_1000034517 370
412 3300009545 Ga0105237_10013282 Ga0105237_100132828 370
413 3300009545 Ga0105237_10048937 Ga0105237_100489372 370
414 3300009551 Ga0105238_10001167 Ga0105238_100011675 370
415 3300009551 Ga0105238_10002155 Ga0105238_1000215510 370
416 3300009551 Ga0105238_10016598 Ga0105238_100165984 370
417 3300009551 Ga0105238_10025373 Ga0105238_100253733 370
418 3300009551 Ga0105238_10337292 Ga0105238_103372921 370
419 3300009553 Ga0105249_10002096 Ga0105249_100020969 370
420 3300009553 Ga0105249_10034363 Ga0105249_100343634 370
421 3300009553 Ga0105249_10124952 Ga0105249_101249523 370
422 3300009553 Ga0105249_10206728 Ga0105249_102067282 370
423 3300010375 Ga0105239_10001370 Ga0105239_1000137019 370
424 3300010375 Ga0105239_10004199 Ga0105239_100041992 370
425 3300010375 Ga0105239_10011975 Ga0105239_100119758 370
426 3300010375 Ga0105239_10020971 Ga0105239_100209714 370
427 3300010375 Ga0105239_10026783 Ga0105239_100267835 370
428 3300010375 Ga0105239_10029639 Ga0105239_100296395 370
429 3300010375 Ga0105239_10320343 Ga0105239_103203432 370
430 3300011119 Ga0105246_10070137 Ga0105246_100701372 370
431 3300011119 Ga0105246_10078960 Ga0105246_100789602 370
432 3300013100 Ga0157373_10031695 Ga0157373_100316953 370
433 3300013104 Ga0157370_10068303 Ga0157370_100683032 370
434 3300013105 Ga0157369_10000027 Ga0157369_10000027138 370
435 3300013105 Ga0157369_10001075 Ga0157369_1000107523 370
436 3300013296 Ga0157374_10029789 Ga0157374_100297894 370
437 3300013296 Ga0157374_10070752 Ga0157374_100707522 370
438 3300013296 Ga0157374_10103391 Ga0157374_101033913 370
439 3300013296 Ga0157374_10232606 Ga0157374_102326062 370
440 3300013297 Ga0157378_10000016 Ga0157378_1000001663 370
441 3300013297 Ga0157378_10037698 Ga0157378_100376984 370
442 3300013297 Ga0157378_10202570 Ga0157378_102025702 370
443 3300013306 Ga0163162_10000107 Ga0163162_1000010741 370
444 3300013306 Ga0163162_10005036 Ga0163162_1000503611 370
445 3300013306 Ga0163162_10020014 Ga0163162_100200144 370
446 3300013307 Ga0157372_10000662 Ga0157372_1000066231 370
447 3300013307 Ga0157372_10035029 Ga0157372_100350294 370
448 3300013308 Ga0157375_10006575 Ga0157375_100065758 370
449 3300013308 Ga0157375_10012067 Ga0157375_100120674 370
450 3300014325 Ga0163163_10000117 Ga0163163_1000011714 370
451 3300014325 Ga0163163_10005615 Ga0163163_1000561510 370
452 3300014325 Ga0163163_10027823 Ga0163163_100278232 370
453 3300014968 Ga0157379_10002463 Ga0157379_100024635 370
454 3300014969 Ga0157376_10012479 Ga0157376_100124794 370
455 3300014969 Ga0157376_10018524 Ga0157376_100185244 370
456 3300025303 Ga0209051_1005139 Ga0209051_10051395 370
457 3300025315 Ga0207697_10073104 Ga0207697_100731042 370
458 3300025321 Ga0207656_10012718 Ga0207656_100127181 370
459 3300025903 Ga0207680_10000249 Ga0207680_100002492 370
460 3300025903 Ga0207680_10079557 Ga0207680_100795572 370
461 3300025903 Ga0207680_10084775 Ga0207680_100847752 370
462 3300025903 Ga0207680_10165534 Ga0207680_101655342 370
463 3300025904 Ga0207647_10000440 Ga0207647_1000044025 370
464 3300025904 Ga0207647_10003399 Ga0207647_100033995 370
465 3300025907 Ga0207645_10015322 Ga0207645_100153224 370
466 3300025907 Ga0207645_10018230 Ga0207645_100182304 370
467 3300025907 Ga0207645_10202740 Ga0207645_102027402 370
468 3300025909 Ga0207705_10254637 Ga0207705_102546372 370
469 3300025911 Ga0207654_10003999 Ga0207654_100039994 370
470 3300025911 Ga0207654_10026748 Ga0207654_100267483 370
471 3300025911 Ga0207654_10132176 Ga0207654_101321762 370
472 3300025913 Ga0207695_10000007 Ga0207695_10000007475 370
473 3300025913 Ga0207695_10000094 Ga0207695_1000009484 370
474 3300025913 Ga0207695_10003459 Ga0207695_1000345916 370
475 3300025913 Ga0207695_10004403 Ga0207695_100044038 370
476 3300025913 Ga0207695_10006570 Ga0207695_100065707 370
477 3300025914 Ga0207671_10000870 Ga0207671_100008709 370
478 3300025914 Ga0207671_10009115 Ga0207671_100091157 370
479 3300025914 Ga0207671_10010311 Ga0207671_100103113 370
480 3300025914 Ga0207671_10013380 Ga0207671_100133803 370
481 3300025916 Ga0207663_10149490 Ga0207663_101494902 370
482 3300025919 Ga0207657_10000801 Ga0207657_100008014 370
483 3300025920 Ga0207649_10007737 Ga0207649_100077374 370
484 3300025920 Ga0207649_10027746 Ga0207649_100277463 370
485 3300025923 Ga0207681_10039873 Ga0207681_100398734 370
486 3300025924 Ga0207694_10000733 Ga0207694_100007337 370
487 3300025924 Ga0207694_10003366 Ga0207694_100033663 370
488 3300025924 Ga0207694_10050784 Ga0207694_100507843 370
489 3300025924 Ga0207694_10086833 Ga0207694_100868333 370
490 3300025927 Ga0207687_10085530 Ga0207687_100855303 370
491 3300025931 Ga0207644_10033944 Ga0207644_100339442 370
492 3300025933 Ga0207706_10010468 Ga0207706_100104684 370
493 3300025933 Ga0207706_10046446 Ga0207706_100464464 370
494 3300025934 Ga0207686_10014945 Ga0207686_100149454 370
495 3300025938 Ga0207704_10001698 Ga0207704_100016988 370
496 3300025940 Ga0207691_10008633 Ga0207691_100086338 370
497 3300025940 Ga0207691_10023735 Ga0207691_100237355 370
498 3300025941 Ga0207711_10001221 Ga0207711_100012216 370
499 3300025942 Ga0207689_10012269 Ga0207689_100122695 370
500 3300025942 Ga0207689_10161275 Ga0207689_101612752 370
501 3300025944 Ga0207661_10149969 Ga0207661_101499692 370
502 3300025949 Ga0207667_10002665 Ga0207667_100026656 370
503 3300025949 Ga0207667_10007120 Ga0207667_100071204 370
504 3300025949 Ga0207667_10095622 Ga0207667_100956223 370
505 3300025949 Ga0207667_10131902 Ga0207667_101319022 370
506 3300025961 Ga0207712_10002072 Ga0207712_100020724 370
507 3300025972 Ga0207668_10039806 Ga0207668_100398064 370
508 3300025972 Ga0207668_10042883 Ga0207668_100428833 370
509 3300025981 Ga0207640_10172976 Ga0207640_101729762 370
510 3300025986 Ga0207658_10000111 Ga0207658_1000011142 370
511 3300025986 Ga0207658_10015506 Ga0207658_100155064 370
512 3300025986 Ga0207658_10176254 Ga0207658_101762542 370
513 3300025986 Ga0207658_10228572 Ga0207658_102285722 370
514 3300026023 Ga0207677_10052806 Ga0207677_100528062 370
515 3300026035 Ga0207703_10009557 Ga0207703_100095572 370
516 3300026041 Ga0207639_10000129 Ga0207639_100001298 370
517 3300026041 Ga0207639_10000598 Ga0207639_1000059811 370
518 3300026041 Ga0207639_10004972 Ga0207639_100049725 370
519 3300026041 Ga0207639_10015772 Ga0207639_100157722 370
520 3300026041 Ga0207639_10027225 Ga0207639_100272252 370
521 3300026041 Ga0207639_10097461 Ga0207639_100974612 370
522 3300026067 Ga0207678_10000802 Ga0207678_1000080213 370
523 3300026067 Ga0207678_10004034 Ga0207678_100040347 370
524 3300026067 Ga0207678_10033275 Ga0207678_100332752 370
525 3300026067 Ga0207678_10108637 Ga0207678_101086372 370
526 3300026078 Ga0207702_10015437 Ga0207702_100154374 370
527 3300026078 Ga0207702_10067833 Ga0207702_100678334 370
528 3300026088 Ga0207641_10038660 Ga0207641_100386603 370
529 3300026088 Ga0207641_10061591 Ga0207641_100615914 370
530 3300026088 Ga0207641_10183606 Ga0207641_101836062 370
531 3300026089 Ga0207648_10003832 Ga0207648_1000383211 370
532 3300026089 Ga0207648_10049012 Ga0207648_100490122 370
533 3300026089 Ga0207648_10100903 Ga0207648_101009033 370
534 3300026095 Ga0207676_10014192 Ga0207676_100141925 370
535 3300026116 Ga0207674_10005372 Ga0207674_100053729 370
536 3300026116 Ga0207674_10097705 Ga0207674_100977053 370
537 3300026118 Ga0207675_100016430 Ga0207675_1000164306 370
538 3300026121 Ga0207683_10005014 Ga0207683_100050146 370
539 3300026121 Ga0207683_10014136 Ga0207683_100141362 370
540 3300026121 Ga0207683_10015477 Ga0207683_100154776 370
541 3300026121 Ga0207683_10077385 Ga0207683_100773853 370
542 3300026142 Ga0207698_10004306 Ga0207698_100043063 370
543 3300026142 Ga0207698_10211021 Ga0207698_102110212 370
544 3300026142 Ga0207698_10293291 Ga0207698_102932912 370
545 3300028379 Ga0268266_10000001 Ga0268266_100000012277 370
546 3300028379 Ga0268266_10000006 Ga0268266_10000006416 370
547 3300028379 Ga0268266_10227572 Ga0268266_102275722 370
548 3300028380 Ga0268265_10015894 Ga0268265_100158944 370
549 3300028380 Ga0268265_10160234 Ga0268265_101602342 370
550 3300028381 Ga0268264_10013736 Ga0268264_100137363 370
551 3300028381 Ga0268264_10045565 Ga0268264_100455652 370
552 3300031616 Ga0307508_10128799 Ga0307508_101287992 370
553 3300032002 Ga0307416_100141209 Ga0307416_1001412092 370
554 3300036401 Ga0373937_0221820 Ga0373937_0221820_296_1408 370
555 3300041441 Ga0451787_216685 Ga0451787_216685_198_1310 370
556 3300041453 Ga0451797_0066798 Ga0451797_0066798_202_1320 370
557 3300041460 Ga0451802_0237918 Ga0451802_0237918_4238_5350 370
558 3300041494 Ga0451837_0569604 Ga0451837_0569604_334_1446 370
559 3300041509 Ga0451843_0841619 Ga0451843_0841619_174_1286 370
560 3300044658 Ga0466972_0004716 Ga0466972_0004716_4195_5379 370
561 3300044712 Ga0453684_0000377 Ga0453684_0000377_81910_83067 370
562 3300044765 Ga0466970_0028960 Ga0466970_0028960_1451_2635 370
563 3300045051 Ga0451576_0000033 Ga0451576_0000033_100379_101536 370
564 3300046475 Ga0495639_0059204 Ga0495639_0059204_199_1311 370
565 3300046517 Ga0495630_0195106 Ga0495630_0195106_206_1318 370
566 3300046675 Ga0495657_0085790 Ga0495657_0085790_874_2013 370
567 3300046683 Ga0495658_0008047 Ga0495658_0008047_1457_2569 370
568 3300048905 Ga0496102_0028982 Ga0496102_0028982_3032_4144 370
569 3300048906 Ga0496103_0095728 Ga0496103_0095728_528_1643 370
570 3300048907 Ga0496104_0000022 Ga0496104_0000022_57575_58687 370
571 3300048908 Ga0496105_0000028 Ga0496105_0000028_18508_19620 370
572 3300048917 Ga0496114_0097876 Ga0496114_0097876_70_1182 370
573 3300048918 Ga0496115_0000113 Ga0496115_0000113_48633_49745 370
574 3300048920 Ga0496117_0008711 Ga0496117_0008711_2257_3369 370
575 3300048921 Ga0496118_0000361 Ga0496118_0000361_5124_6236 370
576 3300048921 Ga0496118_0011022 Ga0496118_0011022_5869_7017 370
577 3300048921 Ga0496118_0012398 Ga0496118_0012398_2049_3161 370
578 3300048925 Ga0496122_0000129 Ga0496122_0000129_46378_47493 370
579 3300048926 Ga0496123_0000113 Ga0496123_0000113_156635_157750 370
580 3300048929 Ga0496126_0000226 Ga0496126_0000226_85279_86391 370
581 3300048929 Ga0496126_0044784 Ga0496126_0044784_488_1603 370
582 3300048929 Ga0496126_0212717 Ga0496126_0212717_19_1131 370
583 3300049568 Ga0501031_0012719 Ga0501031_0012719_4063_5175 370
584 3300049568 Ga0501031_0018154 Ga0501031_0018154_869_1981 370
585 3300049569 Ga0501032_0005711 Ga0501032_0005711_853_1971 370
586 3300049569 Ga0501032_0043004 Ga0501032_0043004_840_1952 370
587 3300049569 Ga0501032_0044418 Ga0501032_0044418_169_1281 370
588 3300049569 Ga0501032_0117210 Ga0501032_0117210_168_1280 370
589 3300049570 Ga0501033_0002102 Ga0501033_0002102_7544_8656 370
590 3300049570 Ga0501033_0003201 Ga0501033_0003201_297_1409 370
591 3300049571 Ga0501034_0002220 Ga0501034_0002220_17362_18474 370
592 3300049571 Ga0501034_0007828 Ga0501034_0007828_6449_7561 370
593 3300049571 Ga0501034_0020678 Ga0501034_0020678_94_1212 370
594 3300049571 Ga0501034_0024369 Ga0501034_0024369_4577_5689 370
595 3300049571 Ga0501034_0025544 Ga0501034_0025544_3654_4778 370
596 3300049571 Ga0501034_0076547 Ga0501034_0076547_1317_2429 370
597 3300049572 Ga0501036_0009476 Ga0501036_0009476_4897_6009 370
598 3300049572 Ga0501036_0068642 Ga0501036_0068642_1087_2199 370
599 3300049572 Ga0501036_0084218 Ga0501036_0084218_1447_2565 370
600 3300049573 Ga0501037_0059735 Ga0501037_0059735_1458_2576 370
601 3300049573 Ga0501037_0088630 Ga0501037_0088630_564_1676 370
602 3300049574 Ga0501038_0001697 Ga0501038_0001697_15426_16538 370
603 3300049574 Ga0501038_0013042 Ga0501038_0013042_6063_7181 370
604 3300049574 Ga0501038_0255737 Ga0501038_0255737_48_1160 370
605 3300049575 Ga0501039_0010405 Ga0501039_0010405_3902_5014 370
606 3300049575 Ga0501039_0052722 Ga0501039_0052722_1889_3001 370
607 3300049578 Ga0501042_0181237 Ga0501042_0181237_75_1187 370
608 3300049578 Ga0501042_0243572 Ga0501042_0243572_145_1257 370
609 3300049579 Ga0501043_0001923 Ga0501043_0001923_5109_6221 370
610 3300049579 Ga0501043_0055551 Ga0501043_0055551_1304_2416 370
611 3300049580 Ga0501046_0000711 Ga0501046_0000711_21853_22965 370
612 3300049580 Ga0501046_0102379 Ga0501046_0102379_976_2106 370
613 3300049581 Ga0501047_0009134 Ga0501047_0009134_2307_3425 370
614 3300049581 Ga0501047_0021722 Ga0501047_0021722_2986_4098 370
615 3300049581 Ga0501047_0050671 Ga0501047_0050671_2012_3124 370
616 3300049581 Ga0501047_0076004 Ga0501047_0076004_2024_3136 370
617 3300049581 Ga0501047_0087405 Ga0501047_0087405_1198_2310 370
618 3300049582 Ga0501048_0003997 Ga0501048_0003997_9306_10418 370
619 3300049582 Ga0501048_0129665 Ga0501048_0129665_342_1454 370
620 3300049583 Ga0501067_0002024 Ga0501067_0002024_5936_7054 370
621 3300049585 Ga0501069_0001475 Ga0501069_0001475_9335_10447 370
622 3300049585 Ga0501069_0023615 Ga0501069_0023615_396_1514 370
623 3300049586 Ga0501070_0007640 Ga0501070_0007640_3164_4282 370
624 3300049586 Ga0501070_0007684 Ga0501070_0007684_3924_5048 370
625 3300049586 Ga0501070_0085710 Ga0501070_0085710_359_1471 370
626 3300049586 Ga0501070_0206211 Ga0501070_0206211_227_1357 370
627 3300049587 Ga0501071_0024476 Ga0501071_0024476_937_2049 370
628 3300049588 Ga0501072_0140078 Ga0501072_0140078_701_1819 370
629 3300049589 Ga0501073_0003789 Ga0501073_0003789_5357_6475 370
630 3300049589 Ga0501073_0023900 Ga0501073_0023900_174_1286 370
631 3300049590 Ga0501074_0005942 Ga0501074_0005942_3952_5076 370
632 3300049590 Ga0501074_0102431 Ga0501074_0102431_467_1579 370
633 3300049742 Ga0501080_0001158 Ga0501080_0001158_19992_21116 370
634 3300049742 Ga0501080_0001158 Ga0501080_0001158_5040_6170 370
635 3300049742 Ga0501080_0038645 Ga0501080_0038645_1445_2557 370
636 3300049742 Ga0501080_0050384 Ga0501080_0050384_223_1341 370
637 3300049742 Ga0501080_0153045 Ga0501080_0153045_923_2035 370
638 3300049742 Ga0501080_0164102 Ga0501080_0164102_15_1127 370
639 3300049744 Ga0501083_0005792 Ga0501083_0005792_6943_8061 370
640 3300049822 Ga0501035_0039953 Ga0501035_0039953_2012_3124 370
641 3300049823 Ga0501044_0006764 Ga0501044_0006764_9361_10473 370
642 3300049823 Ga0501044_0034267 Ga0501044_0034267_2735_3853 370
643 3300053079 Ga0500610_0004301 Ga0500610_0004301_3870_4982 370
644 3300053087 Ga0500643_012592 Ga0500643_012592_378_1493 370
645 3300053093 Ga0500651_0000070 Ga0500651_0000070_28258_29376 370
646 3300053093 Ga0500651_0007332 Ga0500651_0007332_4334_5461 370
647 3300054114 Ga0501084_0052834 Ga0501084_0052834_531_1643 370
648 3300054114 Ga0501084_0090788 Ga0501084_0090788_528_1658 370
649 3300054114 Ga0501084_0108965 Ga0501084_0108965_819_1931 370
650 3300060353 Ga0501082_0002570 Ga0501082_0002570_1263_2375 370
651 3300060353 Ga0501082_0225836 Ga0501082_0225836_13_1125 370
652 iso_pu_bacteria 2524614729 2525556598 370
653 iso_pu_bacteria 2627854209 2630648194 370

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21016

RlmN_N

Ribosomal RNA large subunit methyltransferase N-terminal domain

45

105

0.96

PF04055

Radical_SAM

Radical SAM superfamily

150

325

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rfa-assembly2.cif.gz_A x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine 0.9668 5 335
4pl1-assembly2.cif.gz_A x-ray crystal structure of c118a rlmn from escherichia coli with s-adenosylmethionine 0.9656 5 334
3rfa-assembly2.cif.gz_A x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine 0.9583 5 335
4pl1-assembly2.cif.gz_A x-ray crystal structure of c118a rlmn from escherichia coli with s-adenosylmethionine 0.9571 5 334
5hr6-assembly2.cif.gz_B x-ray crystal structure of c118a rlmn with cross-linked trna purified from escherichia coli 0.9391 6 354
ID Description Score Start End Superfamily
3rfaB01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9976 5 66 1.10.150.530
4pl1B01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9943 5 66 1.10.150.530
af_P36979_1_78_1.10.150.530 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9928 5 66 1.10.150.530
3rfaA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9887 5 66 1.10.150.530
3rfaB01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9818 5 66 1.10.150.530
ID Description Score Start End GO Terms
AF-I4VRV1-F1-model_v4 Dual-specificity RNA methyltransferase RlmN (EC 2.1.1.192) (23S rRNA (adenine(2503)-C(2))-methyltransferase) (23S rRNA m2A2503 methyltransferase) (Ribosomal RNA large subunit methyltransferase N) (tRNA (adenine(37)-C(2))-methyltransferase) (tRNA m2A37 methyltransferase) 0.9796 3 311 GO:0000049
GO:0002935
GO:0005737
GO:0019843
GO:0030488
GO:0046872
GO:0051539
GO:0070040
GO:0070475
AF-A0A351NM17-F1-model_v4 deleted 0.9788 5 96
AF-A0A350QFG5-F1-model_v4 Bifunctional tRNA (Adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN 0.9784 3 94 GO:0008168
GO:0030488
GO:0070475
AF-A0A2X3GYV8-F1-model_v4 Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.192) 0.9765 166 309 GO:0002935
GO:0030488
GO:0046872
GO:0051539
GO:0070040
GO:0070475
AF-A0A7V2WS51-F1-model_v4 Radical SAM protein 0.9708 5 233 GO:0003824
GO:0030488
GO:0046872
GO:0051539
GO:0070475

Feature Viewer

pLDDT pTM Quality
86.32 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map