F472734
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 653 | 336 | 594 | 385 |
Family's Representative Sequence
| Representative Sequence | 3300003794|Ga0055531_10017668|Ga0055531_100176681 |
| Length | 423 |
| Sequence | MPRLKSRTSSPRPKWSRAESNAVNEVVQPNAIPIVLAQGAPVAKQNLLDLDREGLERFFAETLGEARYRAHQVMKWIHHHYVTDFDQMTDLGKALRSKLQQHAEVRVPNIVFDKPSADGTHKWLLAMGTDGKNAIEAVYIPDKNRGTLCVSSQVGCALNCTFCSTATQGFNRNLSTAEIIGQVWVAARHLGNIPHKQRRLTNVVMMGMGEPLMNXDNVVRAMSVMRDDLGYGLANKRVTLSTSGLVPQIDRLSAESDVSLAVSLHAPNDALRETLVPLNKKYPIVELMASCARYLRANKRRESVTFEYTLMKGINDQPEHARQLARLMRQFDNAVQAAHSGKVNLIPFNPFPGTRYERSGDAEIRAFQKILLDSQVLTMVRRTRGDDIDAACGQLKGQVMDRTRRQAEFNKTLQDGKNRDAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 2 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 3 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 4 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 5 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 6 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 7 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 8 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 9 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 10 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 11 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 12 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 13 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 14 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 15 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 16 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 17 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 18 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 19 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 20 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 21 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 22 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 23 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 24 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 25 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 26 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 27 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 28 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 29 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 30 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 31 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 32 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 33 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 34 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 35 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 36 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 37 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 38 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 39 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 40 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 41 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 42 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 43 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 44 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 45 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 46 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 47 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 48 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 49 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 50 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 51 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 52 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 53 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 54 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 55 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 56 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 57 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 58 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 59 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 60 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 62 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 64 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 65 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 66 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 67 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 68 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 69 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 70 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 71 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 73 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 75 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 88 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 92 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 96 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 97 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 98 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 101 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 102 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 107 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 108 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 109 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 110 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 111 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 129 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 130 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 150 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 219 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 220 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 221 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 222 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 223 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 224 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 225 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 226 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 227 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 228 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 229 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 230 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 231 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 232 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 233 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 234 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 237 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 238 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 239 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 242 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 243 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 244 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 251 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 252 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 253 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 254 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 255 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 256 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 257 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 258 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 259 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 260 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 261 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 276 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 277 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 278 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 279 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 285 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 286 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 287 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 288 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 289 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 290 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 291 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 292 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 293 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 294 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 295 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 296 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 317 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 318 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 322 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 323 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 324 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 327 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 328 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 329 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 330 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 334 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 335 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 336 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.81 |
| Metatranscriptomes | 0.31 |
| Isolates | 8.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 11.49 |
| Nodule | 0.15 |
| Rhizoplane | 3.06 |
| Rhizosphere | 73.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10003192 | 3300002077 | Bacteria | 3365 |
| 2 | JGI25152J39213_1000529 | 3300002773 | Bacteria | 21134 |
| 3 | JGI25150J39212_1000383 | 3300002774 | Bacteria | 21138 |
| 4 | JGI25151J46595_10000041 | 3300003187 | Bacteria | 174472 |
| 5 | JGI25151J46595_10000176 | 3300003187 | Bacteria | 82143 |
| 6 | JGI25153J46596_10000129 | 3300003215 | Bacteria | 82143 |
| 7 | Ga0055526_1000527 | 3300003771 | Bacteria | 30369 |
| 8 | Ga0055526_1001879 | 3300003771 | Bacteria | 14549 |
| 9 | Ga0055526_1004038 | 3300003771 | Bacteria | 9017 |
| 10 | Ga0055537_1000226 | 3300003773 | Bacteria | 41255 |
| 11 | Ga0055537_1001085 | 3300003773 | Bacteria | 11959 |
| 12 | Ga0055524_1000041 | 3300003775 | Bacteria | 156728 |
| 13 | Ga0055524_1020562 | 3300003775 | Bacteria | 2219 |
| 14 | Ga0055536_1008190 | 3300003781 | Bacteria | 4539 |
| 15 | Ga0055536_1011555 | 3300003781 | Bacteria | 3370 |
| 16 | Ga0055536_1011574 | 3300003781 | Bacteria | 3364 |
| 17 | Ga0055536_1014965 | 3300003781 | Bacteria | 2684 |
| 18 | Ga0055534_1000258 | 3300003784 | Bacteria | 36880 |
| 19 | Ga0055534_1000462 | 3300003784 | Bacteria | 23363 |
| 20 | Ga0055534_1011667 | 3300003784 | Bacteria | 1775 |
| 21 | Ga0055528_1000017 | 3300003790 | Bacteria | 156728 |
| 22 | Ga0055528_1000065 | 3300003790 | Bacteria | 85294 |
| 23 | Ga0055530_10019232 | 3300003791 | Bacteria | 2074 |
| 24 | Ga0055530_10019234 | 3300003791 | Bacteria | 2074 |
| 25 | Ga0055531_10011324 | 3300003794 | Bacteria | 4319 |
| 26 | Ga0055531_10017668 | 3300003794 | Bacteria | 2995 |
| 27 | Ga0058692_1000023 | 3300003856 | Bacteria | 237263 |
| 28 | Ga0058692_1000285 | 3300003856 | Bacteria | 26681 |
| 29 | Ga0065704_10000509 | 3300005289 | Bacteria | 25144 |
| 30 | Ga0065704_10070536 | 3300005289 | Bacteria | 21377 |
| 31 | Ga0065704_10111287 | 3300005289 | Bacteria | 1960 |
| 32 | Ga0065704_10112342 | 3300005289 | Bacteria | 1936 |
| 33 | Ga0065715_10018340 | 3300005293 | Bacteria | 2772 |
| 34 | Ga0070676_10009917 | 3300005328 | Bacteria | 5156 |
| 35 | Ga0070676_10045956 | 3300005328 | Bacteria | 2544 |
| 36 | Ga0068869_100012574 | 3300005334 | Bacteria | 5598 |
| 37 | Ga0070666_10000763 | 3300005335 | Bacteria | 19462 |
| 38 | Ga0070666_10012971 | 3300005335 | Bacteria | 5275 |
| 39 | Ga0070666_10027948 | 3300005335 | Bacteria | 3698 |
| 40 | Ga0070666_10032675 | 3300005335 | Bacteria | 3438 |
| 41 | Ga0068868_100102910 | 3300005338 | Bacteria | 2313 |
| 42 | Ga0070660_100003996 | 3300005339 | Bacteria | 10178 |
| 43 | Ga0070660_100081848 | 3300005339 | Bacteria | 2534 |
| 44 | Ga0070661_100006394 | 3300005344 | Bacteria | 8124 |
| 45 | Ga0070661_100019534 | 3300005344 | Bacteria | 4829 |
| 46 | Ga0070668_100006847 | 3300005347 | Bacteria | 8450 |
| 47 | Ga0070668_100016260 | 3300005347 | Bacteria | 5565 |
| 48 | Ga0070668_100025329 | 3300005347 | Bacteria | 4497 |
| 49 | Ga0070668_100070838 | 3300005347 | Bacteria | 2715 |
| 50 | Ga0070668_100125971 | 3300005347 | Bacteria | 2052 |
| 51 | Ga0070669_100011996 | 3300005353 | Bacteria | 6150 |
| 52 | Ga0070671_100046319 | 3300005355 | Bacteria | 3616 |
| 53 | Ga0070674_100048311 | 3300005356 | Bacteria | 2920 |
| 54 | Ga0070674_100186368 | 3300005356 | Bacteria | 1593 |
| 55 | Ga0070659_100019128 | 3300005366 | Bacteria | 5182 |
| 56 | Ga0070659_100027585 | 3300005366 | Bacteria | 4377 |
| 57 | Ga0070667_100000090 | 3300005367 | Bacteria | 112981 |
| 58 | Ga0070667_100001463 | 3300005367 | Bacteria | 21160 |
| 59 | Ga0070667_100016049 | 3300005367 | Bacteria | 6195 |
| 60 | Ga0070667_100027229 | 3300005367 | Bacteria | 4756 |
| 61 | Ga0070667_100033628 | 3300005367 | Bacteria | 4287 |
| 62 | Ga0070667_100076641 | 3300005367 | Bacteria | 2855 |
| 63 | Ga0070667_100103539 | 3300005367 | Bacteria | 2461 |
| 64 | Ga0070667_100116422 | 3300005367 | Bacteria | 2321 |
| 65 | Ga0070667_100348181 | 3300005367 | Bacteria | 1341 |
| 66 | Ga0070714_100188814 | 3300005435 | Bacteria | 1879 |
| 67 | Ga0070663_100001470 | 3300005455 | Bacteria | 12959 |
| 68 | Ga0070663_100025497 | 3300005455 | Bacteria | 3993 |
| 69 | Ga0070663_100095224 | 3300005455 | Bacteria | 2212 |
| 70 | Ga0070663_100115282 | 3300005455 | Bacteria | 2024 |
| 71 | Ga0070678_100006167 | 3300005456 | Bacteria | 7007 |
| 72 | Ga0070678_100011525 | 3300005456 | Bacteria | 5460 |
| 73 | Ga0070662_100033265 | 3300005457 | Bacteria | 3629 |
| 74 | Ga0068867_100254759 | 3300005459 | Bacteria | 1428 |
| 75 | Ga0070685_10001309 | 3300005466 | Bacteria | 13102 |
| 76 | Ga0070685_10045633 | 3300005466 | Bacteria | 2514 |
| 77 | Ga0070679_100014740 | 3300005530 | Bacteria | 7511 |
| 78 | Ga0070679_100021110 | 3300005530 | Bacteria | 6354 |
| 79 | Ga0070679_100021528 | 3300005530 | Bacteria | 6296 |
| 80 | Ga0070684_100091787 | 3300005535 | Bacteria | 2702 |
| 81 | Ga0068853_100000795 | 3300005539 | Bacteria | 21890 |
| 82 | Ga0068853_100009902 | 3300005539 | Bacteria | 7695 |
| 83 | Ga0068853_100214940 | 3300005539 | Bacteria | 1754 |
| 84 | Ga0070672_100002016 | 3300005543 | Bacteria | 12773 |
| 85 | Ga0070672_100007880 | 3300005543 | Bacteria | 7270 |
| 86 | Ga0070672_100018396 | 3300005543 | Bacteria | 5052 |
| 87 | Ga0070693_100004397 | 3300005547 | Bacteria | 6659 |
| 88 | Ga0070665_100000283 | 3300005548 | Bacteria | 82138 |
| 89 | Ga0070665_100001823 | 3300005548 | Bacteria | 24183 |
| 90 | Ga0070665_100022970 | 3300005548 | Bacteria | 6280 |
| 91 | Ga0068855_100014240 | 3300005563 | Bacteria | 9581 |
| 92 | Ga0068855_100105016 | 3300005563 | Bacteria | 3248 |
| 93 | Ga0068855_100151747 | 3300005563 | Bacteria | 2634 |
| 94 | Ga0068855_100285805 | 3300005563 | Bacteria | 1830 |
| 95 | Ga0068857_100094105 | 3300005577 | Bacteria | 2683 |
| 96 | Ga0068854_100141314 | 3300005578 | Bacteria | 1848 |
| 97 | Ga0068856_100002977 | 3300005614 | Bacteria | 17350 |
| 98 | Ga0068856_100098384 | 3300005614 | Bacteria | 2916 |
| 99 | Ga0068856_100340165 | 3300005614 | Bacteria | 1519 |
| 100 | Ga0068852_100005567 | 3300005616 | Bacteria | 9032 |
| 101 | Ga0068852_100021388 | 3300005616 | Bacteria | 5164 |
| 102 | Ga0068852_100093029 | 3300005616 | Bacteria | 2701 |
| 103 | Ga0068852_100196922 | 3300005616 | Bacteria | 1905 |
| 104 | Ga0068859_100002133 | 3300005617 | Bacteria | 20138 |
| 105 | Ga0068859_100046266 | 3300005617 | Bacteria | 4370 |
| 106 | Ga0068864_100016372 | 3300005618 | Bacteria | 6172 |
| 107 | Ga0068864_100047435 | 3300005618 | Bacteria | 3689 |
| 108 | Ga0068851_10005322 | 3300005834 | Bacteria | 5843 |
| 109 | Ga0068851_10012806 | 3300005834 | Bacteria | 3962 |
| 110 | Ga0068863_100000945 | 3300005841 | Bacteria | 29155 |
| 111 | Ga0068863_100042745 | 3300005841 | Bacteria | 4305 |
| 112 | Ga0068863_100045185 | 3300005841 | Bacteria | 4180 |
| 113 | Ga0068863_100060280 | 3300005841 | Bacteria | 3589 |
| 114 | Ga0068863_100100499 | 3300005841 | Bacteria | 2749 |
| 115 | Ga0068863_100148826 | 3300005841 | Bacteria | 2240 |
| 116 | Ga0068858_100007811 | 3300005842 | Bacteria | 10326 |
| 117 | Ga0068860_100001333 | 3300005843 | Bacteria | 26831 |
| 118 | Ga0068860_100079130 | 3300005843 | Bacteria | 3126 |
| 119 | Ga0068860_100171032 | 3300005843 | Bacteria | 2099 |
| 120 | Ga0068862_100000707 | 3300005844 | Bacteria | 34098 |
| 121 | Ga0075363_100080799 | 3300006048 | Bacteria | 1778 |
| 122 | Ga0075364_10000928 | 3300006051 | Bacteria | 15498 |
| 123 | Ga0075367_10009991 | 3300006178 | Bacteria | 4975 |
| 124 | Ga0075369_10014137 | 3300006186 | Bacteria | 3184 |
| 125 | Ga0097621_100147981 | 3300006237 | Bacteria | 2012 |
| 126 | Ga0097621_100186958 | 3300006237 | Bacteria | 1792 |
| 127 | Ga0068871_100012627 | 3300006358 | Bacteria | 6237 |
| 128 | Ga0068871_100027477 | 3300006358 | Bacteria | 4451 |
| 129 | Ga0068871_100066954 | 3300006358 | Bacteria | 2945 |
| 130 | Ga0068871_100195308 | 3300006358 | Bacteria | 1745 |
| 131 | Ga0068865_100007663 | 3300006881 | Bacteria | 6650 |
| 132 | Ga0068865_100024363 | 3300006881 | Bacteria | 3969 |
| 133 | Ga0097620_100002133 | 3300006931 | Bacteria | 20138 |
| 134 | Ga0097620_100046266 | 3300006931 | Bacteria | 4370 |
| 135 | Ga0105251_10000450 | 3300009011 | Bacteria | 39635 |
| 136 | Ga0105251_10017454 | 3300009011 | Bacteria | 3845 |
| 137 | Ga0105240_10001034 | 3300009093 | Bacteria | 49457 |
| 138 | Ga0105240_10018043 | 3300009093 | Bacteria | 9490 |
| 139 | Ga0105245_10253063 | 3300009098 | Bacteria | 1712 |
| 140 | Ga0105243_10087251 | 3300009148 | Bacteria | 2561 |
| 141 | Ga0105243_10167468 | 3300009148 | Bacteria | 1900 |
| 142 | Ga0105241_10010963 | 3300009174 | Bacteria | 6645 |
| 143 | Ga0105241_10011152 | 3300009174 | Bacteria | 6588 |
| 144 | Ga0105241_10017434 | 3300009174 | Bacteria | 5279 |
| 145 | Ga0105241_10127825 | 3300009174 | Bacteria | 2054 |
| 146 | Ga0105241_10187469 | 3300009174 | Bacteria | 1720 |
| 147 | Ga0105242_10000862 | 3300009176 | Bacteria | 23518 |
| 148 | Ga0105248_10000252 | 3300009177 | Bacteria | 62538 |
| 149 | Ga0105248_10009513 | 3300009177 | Bacteria | 10697 |
| 150 | Ga0105248_10159513 | 3300009177 | Bacteria | 2544 |
| 151 | Ga0105248_10179890 | 3300009177 | Bacteria | 2383 |
| 152 | Ga0105248_10380517 | 3300009177 | Bacteria | 1589 |
| 153 | Ga0105237_10000345 | 3300009545 | Bacteria | 65477 |
| 154 | Ga0105237_10013282 | 3300009545 | Bacteria | 8640 |
| 155 | Ga0105237_10048937 | 3300009545 | Bacteria | 4250 |
| 156 | Ga0105238_10001167 | 3300009551 | Bacteria | 26450 |
| 157 | Ga0105238_10002155 | 3300009551 | Bacteria | 19900 |
| 158 | Ga0105238_10016598 | 3300009551 | Bacteria | 7456 |
| 159 | Ga0105238_10025373 | 3300009551 | Bacteria | 6043 |
| 160 | Ga0105238_10337292 | 3300009551 | Bacteria | 1495 |
| 161 | Ga0105249_10002096 | 3300009553 | Bacteria | 17301 |
| 162 | Ga0105249_10034363 | 3300009553 | Bacteria | 4595 |
| 163 | Ga0105249_10124952 | 3300009553 | Bacteria | 2449 |
| 164 | Ga0105249_10206728 | 3300009553 | Bacteria | 1924 |
| 165 | Ga0105032_101421 | 3300009979 | Bacteria | 2195 |
| 166 | Ga0105239_10001370 | 3300010375 | Bacteria | 32700 |
| 167 | Ga0105239_10004199 | 3300010375 | Bacteria | 17302 |
| 168 | Ga0105239_10011975 | 3300010375 | Bacteria | 9670 |
| 169 | Ga0105239_10020971 | 3300010375 | Bacteria | 7211 |
| 170 | Ga0105239_10026783 | 3300010375 | Bacteria | 6345 |
| 171 | Ga0105239_10029639 | 3300010375 | Bacteria | 6017 |
| 172 | Ga0105239_10320343 | 3300010375 | Bacteria | 1748 |
| 173 | Ga0105246_10070137 | 3300011119 | Bacteria | 2464 |
| 174 | Ga0105246_10078960 | 3300011119 | Bacteria | 2339 |
| 175 | Ga0157318_1000036 | 3300012482 | Bacteria | 3715 |
| 176 | Ga0157316_1000061 | 3300012510 | Bacteria | 4622 |
| 177 | Ga0157373_10031695 | 3300013100 | Bacteria | 3805 |
| 178 | Ga0157371_10019209 | 3300013102 | Bacteria | 5042 |
| 179 | Ga0157370_10068303 | 3300013104 | Bacteria | 3359 |
| 180 | Ga0157369_10000027 | 3300013105 | Bacteria | 213988 |
| 181 | Ga0157369_10001075 | 3300013105 | Bacteria | 34218 |
| 182 | Ga0157374_10029789 | 3300013296 | Bacteria | 4949 |
| 183 | Ga0157374_10070752 | 3300013296 | Bacteria | 3288 |
| 184 | Ga0157374_10103391 | 3300013296 | Bacteria | 2733 |
| 185 | Ga0157374_10232606 | 3300013296 | Bacteria | 1811 |
| 186 | Ga0157378_10000016 | 3300013297 | Bacteria | 142649 |
| 187 | Ga0157378_10037698 | 3300013297 | Bacteria | 4284 |
| 188 | Ga0157378_10202570 | 3300013297 | Bacteria | 1877 |
| 189 | Ga0163162_10000107 | 3300013306 | Bacteria | 74745 |
| 190 | Ga0163162_10005036 | 3300013306 | Bacteria | 12733 |
| 191 | Ga0163162_10020014 | 3300013306 | Bacteria | 6573 |
| 192 | Ga0157372_10000662 | 3300013307 | Bacteria | 37834 |
| 193 | Ga0157372_10035029 | 3300013307 | Bacteria | 5523 |
| 194 | Ga0157375_10006575 | 3300013308 | Bacteria | 10118 |
| 195 | Ga0157375_10012067 | 3300013308 | Bacteria | 7652 |
| 196 | Ga0157375_10062762 | 3300013308 | Bacteria | 3693 |
| 197 | Ga0163163_10000117 | 3300014325 | Bacteria | 84938 |
| 198 | Ga0163163_10005615 | 3300014325 | Bacteria | 10868 |
| 199 | Ga0163163_10027823 | 3300014325 | Bacteria | 5421 |
| 200 | Ga0157380_10032552 | 3300014326 | Bacteria | 4012 |
| 201 | Ga0182008_10001932 | 3300014497 | Bacteria | 13367 |
| 202 | Ga0157379_10002463 | 3300014968 | Bacteria | 15500 |
| 203 | Ga0157376_10012479 | 3300014969 | Bacteria | 6308 |
| 204 | Ga0157376_10018524 | 3300014969 | Bacteria | 5341 |
| 205 | Ga0182007_10001075 | 3300015262 | Bacteria | 14873 |
| 206 | Ga0182005_1001036 | 3300015265 | Bacteria | 11761 |
| 207 | Ga0182005_1008264 | 3300015265 | Bacteria | 3074 |
| 208 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 209 | Ga0163161_10075177 | 3300017792 | Bacteria | 2479 |
| 210 | Ga0163161_10087444 | 3300017792 | Bacteria | 2302 |
| 211 | Ga0206349_1053534 | 3300020075 | Bacteria | 3924 |
| 212 | Ga0228598_1007623 | 3300024227 | Bacteria | 2199 |
| 213 | Ga0207425_1000011 | 3300025245 | Bacteria | 550735 |
| 214 | Ga0209129_1000044 | 3300025258 | Bacteria | 298971 |
| 215 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 216 | Ga0209565_1000014 | 3300025263 | Bacteria | 530302 |
| 217 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 218 | Ga0209673_1000065 | 3300025273 | Bacteria | 252799 |
| 219 | Ga0209673_1009750 | 3300025273 | Bacteria | 4122 |
| 220 | Ga0209130_1006994 | 3300025284 | Bacteria | 3558 |
| 221 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 222 | Ga0209675_1000011 | 3300025291 | Bacteria | 520597 |
| 223 | Ga0209675_1010448 | 3300025291 | Bacteria | 3167 |
| 224 | Ga0209676_1000011 | 3300025292 | Bacteria | 860463 |
| 225 | Ga0209676_1000170 | 3300025292 | Bacteria | 154647 |
| 226 | Ga0209676_1000324 | 3300025292 | Bacteria | 92019 |
| 227 | Ga0209676_1000400 | 3300025292 | Bacteria | 79157 |
| 228 | Ga0209025_1000012 | 3300025294 | Bacteria | 924362 |
| 229 | Ga0209025_1000015 | 3300025294 | Bacteria | 808120 |
| 230 | Ga0209025_1022153 | 3300025294 | Bacteria | 3384 |
| 231 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 232 | Ga0209564_1000775 | 3300025295 | Bacteria | 44355 |
| 233 | Ga0209564_1005053 | 3300025295 | Bacteria | 7714 |
| 234 | Ga0209758_1000018 | 3300025297 | Bacteria | 753320 |
| 235 | Ga0209758_1010564 | 3300025297 | Bacteria | 5503 |
| 236 | Ga0209758_1021717 | 3300025297 | Bacteria | 2980 |
| 237 | Ga0209050_1000932 | 3300025298 | Bacteria | 38288 |
| 238 | Ga0209050_1002408 | 3300025298 | Bacteria | 16165 |
| 239 | Ga0209050_1002409 | 3300025298 | Bacteria | 16158 |
| 240 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 241 | Ga0209256_1006041 | 3300025299 | Bacteria | 6612 |
| 242 | Ga0209051_1003709 | 3300025303 | Bacteria | 9852 |
| 243 | Ga0209051_1005139 | 3300025303 | Bacteria | 7765 |
| 244 | Ga0209257_1000014 | 3300025304 | Bacteria | 946850 |
| 245 | Ga0209257_1000065 | 3300025304 | Bacteria | 353604 |
| 246 | Ga0209257_1000170 | 3300025304 | Bacteria | 169384 |
| 247 | Ga0209257_1000793 | 3300025304 | Bacteria | 46093 |
| 248 | Ga0209257_1001655 | 3300025304 | Bacteria | 25316 |
| 249 | Ga0209257_1007564 | 3300025304 | Bacteria | 6514 |
| 250 | Ga0207697_10073104 | 3300025315 | Bacteria | 1439 |
| 251 | Ga0207656_10012718 | 3300025321 | Bacteria | 3205 |
| 252 | Ga0207713_1001361 | 3300025735 | Bacteria | 19874 |
| 253 | Ga0207713_1016417 | 3300025735 | Bacteria | 3756 |
| 254 | Ga0207680_10000249 | 3300025903 | Bacteria | 25802 |
| 255 | Ga0207680_10079557 | 3300025903 | Bacteria | 2056 |
| 256 | Ga0207680_10084775 | 3300025903 | Bacteria | 2000 |
| 257 | Ga0207680_10165534 | 3300025903 | Bacteria | 1486 |
| 258 | Ga0207647_10000440 | 3300025904 | Bacteria | 33864 |
| 259 | Ga0207647_10003399 | 3300025904 | Bacteria | 11928 |
| 260 | Ga0207645_10015322 | 3300025907 | Bacteria | 5097 |
| 261 | Ga0207645_10018230 | 3300025907 | Bacteria | 4623 |
| 262 | Ga0207645_10202740 | 3300025907 | Bacteria | 1305 |
| 263 | Ga0207705_10254637 | 3300025909 | Bacteria | 1339 |
| 264 | Ga0207654_10003999 | 3300025911 | Bacteria | 7423 |
| 265 | Ga0207654_10026748 | 3300025911 | Bacteria | 3128 |
| 266 | Ga0207654_10132176 | 3300025911 | Bacteria | 1581 |
| 267 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 268 | Ga0207695_10000094 | 3300025913 | Bacteria | 265779 |
| 269 | Ga0207695_10003459 | 3300025913 | Bacteria | 22244 |
| 270 | Ga0207695_10004403 | 3300025913 | Bacteria | 19258 |
| 271 | Ga0207695_10006570 | 3300025913 | Bacteria | 15048 |
| 272 | Ga0207695_10015845 | 3300025913 | Bacteria | 8854 |
| 273 | Ga0207671_10000870 | 3300025914 | Bacteria | 38250 |
| 274 | Ga0207671_10009115 | 3300025914 | Bacteria | 8334 |
| 275 | Ga0207671_10010311 | 3300025914 | Bacteria | 7723 |
| 276 | Ga0207671_10013380 | 3300025914 | Bacteria | 6536 |
| 277 | Ga0207663_10149490 | 3300025916 | Bacteria | 1637 |
| 278 | Ga0207657_10000801 | 3300025919 | Bacteria | 33295 |
| 279 | Ga0207657_10004721 | 3300025919 | Bacteria | 14378 |
| 280 | Ga0207657_10046209 | 3300025919 | Bacteria | 3815 |
| 281 | Ga0207649_10007737 | 3300025920 | Bacteria | 5847 |
| 282 | Ga0207649_10027746 | 3300025920 | Bacteria | 3326 |
| 283 | Ga0207652_10012848 | 3300025921 | Bacteria | 6769 |
| 284 | Ga0207681_10009793 | 3300025923 | Bacteria | 5862 |
| 285 | Ga0207681_10039873 | 3300025923 | Bacteria | 3121 |
| 286 | Ga0207694_10000733 | 3300025924 | Bacteria | 29483 |
| 287 | Ga0207694_10003366 | 3300025924 | Bacteria | 12732 |
| 288 | Ga0207694_10050784 | 3300025924 | Bacteria | 3213 |
| 289 | Ga0207694_10086833 | 3300025924 | Bacteria | 2463 |
| 290 | Ga0207687_10085530 | 3300025927 | Bacteria | 2288 |
| 291 | Ga0207644_10003282 | 3300025931 | Bacteria | 10452 |
| 292 | Ga0207644_10033944 | 3300025931 | Bacteria | 3570 |
| 293 | Ga0207706_10010468 | 3300025933 | Bacteria | 8474 |
| 294 | Ga0207706_10046446 | 3300025933 | Bacteria | 3845 |
| 295 | Ga0207686_10014945 | 3300025934 | Bacteria | 4332 |
| 296 | Ga0207709_10002040 | 3300025935 | Bacteria | 13078 |
| 297 | Ga0207709_10051238 | 3300025935 | Bacteria | 2529 |
| 298 | Ga0207704_10001698 | 3300025938 | Bacteria | 9855 |
| 299 | Ga0207691_10002771 | 3300025940 | Bacteria | 17083 |
| 300 | Ga0207691_10004997 | 3300025940 | Bacteria | 12793 |
| 301 | Ga0207691_10008633 | 3300025940 | Bacteria | 9779 |
| 302 | Ga0207691_10023735 | 3300025940 | Bacteria | 5773 |
| 303 | Ga0207711_10001221 | 3300025941 | Bacteria | 24350 |
| 304 | Ga0207711_10005518 | 3300025941 | Bacteria | 10697 |
| 305 | Ga0207689_10012269 | 3300025942 | Bacteria | 7330 |
| 306 | Ga0207689_10161275 | 3300025942 | Bacteria | 1847 |
| 307 | Ga0207661_10149969 | 3300025944 | Bacteria | 2015 |
| 308 | Ga0207679_10037747 | 3300025945 | Bacteria | 3437 |
| 309 | Ga0207667_10002665 | 3300025949 | Bacteria | 22067 |
| 310 | Ga0207667_10007120 | 3300025949 | Bacteria | 13500 |
| 311 | Ga0207667_10095622 | 3300025949 | Bacteria | 3066 |
| 312 | Ga0207667_10131902 | 3300025949 | Bacteria | 2573 |
| 313 | Ga0207712_10002072 | 3300025961 | Bacteria | 13168 |
| 314 | Ga0207668_10010635 | 3300025972 | Bacteria | 5567 |
| 315 | Ga0207668_10039806 | 3300025972 | Bacteria | 3167 |
| 316 | Ga0207668_10042883 | 3300025972 | Bacteria | 3067 |
| 317 | Ga0207668_10132507 | 3300025972 | Bacteria | 1905 |
| 318 | Ga0207640_10172976 | 3300025981 | Bacteria | 1611 |
| 319 | Ga0207658_10000111 | 3300025986 | Bacteria | 89180 |
| 320 | Ga0207658_10015506 | 3300025986 | Bacteria | 5228 |
| 321 | Ga0207658_10176254 | 3300025986 | Bacteria | 1766 |
| 322 | Ga0207658_10228572 | 3300025986 | Bacteria | 1569 |
| 323 | Ga0207677_10052806 | 3300026023 | Bacteria | 2763 |
| 324 | Ga0207703_10009557 | 3300026035 | Bacteria | 7614 |
| 325 | Ga0207639_10000129 | 3300026041 | Bacteria | 55422 |
| 326 | Ga0207639_10000598 | 3300026041 | Bacteria | 24826 |
| 327 | Ga0207639_10004972 | 3300026041 | Bacteria | 8953 |
| 328 | Ga0207639_10015772 | 3300026041 | Bacteria | 5332 |
| 329 | Ga0207639_10027225 | 3300026041 | Bacteria | 4162 |
| 330 | Ga0207639_10097461 | 3300026041 | Bacteria | 2368 |
| 331 | Ga0207678_10000802 | 3300026067 | Bacteria | 28836 |
| 332 | Ga0207678_10004034 | 3300026067 | Bacteria | 13211 |
| 333 | Ga0207678_10033275 | 3300026067 | Bacteria | 4492 |
| 334 | Ga0207678_10108637 | 3300026067 | Bacteria | 2366 |
| 335 | Ga0207702_10015437 | 3300026078 | Bacteria | 6326 |
| 336 | Ga0207702_10067833 | 3300026078 | Bacteria | 3063 |
| 337 | Ga0207641_10038660 | 3300026088 | Bacteria | 3989 |
| 338 | Ga0207641_10061591 | 3300026088 | Bacteria | 3200 |
| 339 | Ga0207641_10183606 | 3300026088 | Bacteria | 1917 |
| 340 | Ga0207648_10003832 | 3300026089 | Bacteria | 15709 |
| 341 | Ga0207648_10049012 | 3300026089 | Bacteria | 3698 |
| 342 | Ga0207648_10100903 | 3300026089 | Bacteria | 2529 |
| 343 | Ga0207648_10231139 | 3300026089 | Bacteria | 1645 |
| 344 | Ga0207676_10014192 | 3300026095 | Bacteria | 5723 |
| 345 | Ga0207674_10005372 | 3300026116 | Bacteria | 15240 |
| 346 | Ga0207674_10097705 | 3300026116 | Bacteria | 2921 |
| 347 | Ga0207675_100016430 | 3300026118 | Bacteria | 6912 |
| 348 | Ga0207683_10005014 | 3300026121 | Bacteria | 11371 |
| 349 | Ga0207683_10014136 | 3300026121 | Bacteria | 6801 |
| 350 | Ga0207683_10015477 | 3300026121 | Bacteria | 6497 |
| 351 | Ga0207683_10077385 | 3300026121 | Bacteria | 2946 |
| 352 | Ga0207698_10004306 | 3300026142 | Bacteria | 8668 |
| 353 | Ga0207698_10211021 | 3300026142 | Bacteria | 1747 |
| 354 | Ga0207698_10293291 | 3300026142 | Bacteria | 1510 |
| 355 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 356 | Ga0209371_1000059 | 3300027312 | Bacteria | 237154 |
| 357 | Ga0209999_1000930 | 3300027543 | Bacteria | 4921 |
| 358 | Ga0209982_1000034 | 3300027552 | Bacteria | 12378 |
| 359 | Ga0209970_1003495 | 3300027614 | Bacteria | 2637 |
| 360 | Ga0209983_1000431 | 3300027665 | Bacteria | 9055 |
| 361 | Ga0209971_1000355 | 3300027682 | Bacteria | 12576 |
| 362 | Ga0209974_10026507 | 3300027876 | Bacteria | 1918 |
| 363 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 364 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 365 | Ga0268266_10227572 | 3300028379 | Bacteria | 1716 |
| 366 | Ga0268266_10283744 | 3300028379 | Bacteria | 1540 |
| 367 | Ga0268265_10015894 | 3300028380 | Bacteria | 5162 |
| 368 | Ga0268265_10160234 | 3300028380 | Bacteria | 1910 |
| 369 | Ga0268264_10013736 | 3300028381 | Bacteria | 6663 |
| 370 | Ga0268264_10045565 | 3300028381 | Bacteria | 3641 |
| 371 | Ga0307515_10135444 | 3300028794 | Bacteria | 2682 |
| 372 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 373 | Ga0268256_1000055 | 3300030500 | Bacteria | 237299 |
| 374 | Ga0316177_1199532 | 3300030731 | Bacteria | 5482 |
| 375 | Ga0316176_1113068 | 3300030732 | Bacteria | 4242 |
| 376 | Ga0316183_1135259 | 3300030742 | Bacteria | 2131 |
| 377 | Ga0316181_1062290 | 3300030744 | Bacteria | 4282 |
| 378 | Ga0307513_10004310 | 3300031456 | Bacteria | 19017 |
| 379 | Ga0307508_10128799 | 3300031616 | Bacteria | 2134 |
| 380 | Ga0316575_10010769 | 3300031665 | Bacteria | 3369 |
| 381 | Ga0307516_10070265 | 3300031730 | Bacteria | 3365 |
| 382 | Ga0307413_10001879 | 3300031824 | Bacteria | 8298 |
| 383 | Ga0307413_10006252 | 3300031824 | Bacteria | 5410 |
| 384 | Ga0307413_10070248 | 3300031824 | Bacteria | 2201 |
| 385 | Ga0307406_10116425 | 3300031901 | Bacteria | 1849 |
| 386 | Ga0307409_100011535 | 3300031995 | Bacteria | 5580 |
| 387 | Ga0307416_100141209 | 3300032002 | Bacteria | 2189 |
| 388 | Ga0307416_100230389 | 3300032002 | Bacteria | 1785 |
| 389 | Ga0307414_10000505 | 3300032004 | Bacteria | 20299 |
| 390 | Ga0307414_10002258 | 3300032004 | Bacteria | 10067 |
| 391 | Ga0307414_10011622 | 3300032004 | Bacteria | 5171 |
| 392 | Ga0307414_10028371 | 3300032004 | Bacteria | 3630 |
| 393 | Ga0307414_10123757 | 3300032004 | Bacteria | 1993 |
| 394 | Ga0307411_10014421 | 3300032005 | Bacteria | 4396 |
| 395 | Ga0307411_10065797 | 3300032005 | Bacteria | 2432 |
| 396 | Ga0316593_10002956 | 3300032168 | Bacteria | 4134 |
| 397 | Ga0373937_0221820 | 3300036401 | Bacteria | 1780 |
| 398 | Ga0316582_0033025 | 3300036647 | Bacteria | 3175 |
| 399 | Ga0395899_0073839 | 3300037312 | Bacteria | 2493 |
| 400 | Ga0395899_0188143 | 3300037312 | Bacteria | 1446 |
| 401 | Ga0395900_0083754 | 3300037418 | Bacteria | 3276 |
| 402 | Ga0395905_0000800 | 3300037471 | Bacteria | 41323 |
| 403 | Ga0395905_0023575 | 3300037471 | Bacteria | 5814 |
| 404 | Ga0395905_0065319 | 3300037471 | Bacteria | 3406 |
| 405 | Ga0395901_0197290 | 3300038443 | Bacteria | 2110 |
| 406 | Ga0237819_00005 | 3300038705 | Bacteria | 79509 |
| 407 | Ga0237819_02007 | 3300038705 | Bacteria | 4538 |
| 408 | Ga0439436_0007087 | 3300041404 | Bacteria | 3451 |
| 409 | Ga0439436_0011150 | 3300041404 | Bacteria | 2732 |
| 410 | Ga0439465_0022285 | 3300041413 | Bacteria | 1989 |
| 411 | Ga0451787_216685 | 3300041441 | Bacteria | 2625 |
| 412 | Ga0451797_0066798 | 3300041453 | Bacteria | 1572 |
| 413 | Ga0451797_1048131 | 3300041453 | Bacteria | 2061 |
| 414 | Ga0451800_0480575 | 3300041459 | Bacteria | 6323 |
| 415 | Ga0451802_0237918 | 3300041460 | Bacteria | 14021 |
| 416 | Ga0451806_272703 | 3300041462 | Bacteria | 2936 |
| 417 | Ga0451807_0148074 | 3300041486 | Bacteria | 3326 |
| 418 | Ga0451807_1405164 | 3300041486 | Bacteria | 3395 |
| 419 | Ga0451837_0160044 | 3300041494 | Bacteria | 1966 |
| 420 | Ga0451837_0569604 | 3300041494 | Bacteria | 2017 |
| 421 | Ga0451843_0823885 | 3300041509 | Bacteria | 2947 |
| 422 | Ga0451843_0841619 | 3300041509 | Bacteria | 1476 |
| 423 | Ga0451843_1136542 | 3300041509 | Bacteria | 5586 |
| 424 | Ga0439445_0005628 | 3300042004 | Bacteria | 2861 |
| 425 | Ga0439432_002206 | 3300042006 | Bacteria | 7354 |
| 426 | Ga0439449_0000269 | 3300042007 | Bacteria | 18742 |
| 427 | Ga0439449_0002020 | 3300042007 | Bacteria | 7986 |
| 428 | Ga0439449_0003846 | 3300042007 | Bacteria | 5819 |
| 429 | Ga0439452_018440 | 3300042010 | Bacteria | 1859 |
| 430 | Ga0451577_0018786 | 3300042876 | Bacteria | 6360 |
| 431 | Ga0466972_0004716 | 3300044658 | Bacteria | 6826 |
| 432 | Ga0453684_0000377 | 3300044712 | Bacteria | 183445 |
| 433 | Ga0466970_0028960 | 3300044765 | Bacteria | 2913 |
| 434 | Ga0451576_0000033 | 3300045051 | Bacteria | 393131 |
| 435 | Ga0495638_0012115 | 3300046460 | Bacteria | 5921 |
| 436 | Ga0495639_0059204 | 3300046475 | Bacteria | 1753 |
| 437 | Ga0495607_0037125 | 3300046501 | Bacteria | 2928 |
| 438 | Ga0495606_0014127 | 3300046507 | Bacteria | 6251 |
| 439 | Ga0495630_0195106 | 3300046517 | Bacteria | 1545 |
| 440 | Ga0495663_0002038 | 3300046525 | Bacteria | 6193 |
| 441 | Ga0495598_0000343 | 3300046537 | Bacteria | 8312 |
| 442 | Ga0495656_0000880 | 3300046615 | Bacteria | 9718 |
| 443 | Ga0495656_0010177 | 3300046615 | Bacteria | 3410 |
| 444 | Ga0495668_0003099 | 3300046616 | Bacteria | 12850 |
| 445 | Ga0495657_0085790 | 3300046675 | Bacteria | 2029 |
| 446 | Ga0495658_0008047 | 3300046683 | Bacteria | 5220 |
| 447 | Ga0495671_0004630 | 3300046692 | Bacteria | 8156 |
| 448 | Ga0495636_0002531 | 3300047318 | Bacteria | 7018 |
| 449 | Ga0495636_0007001 | 3300047318 | Bacteria | 4436 |
| 450 | Ga0495685_017384 | 3300047447 | Bacteria | 2463 |
| 451 | Ga0496102_0028982 | 3300048905 | Bacteria | 4949 |
| 452 | Ga0496103_0095728 | 3300048906 | Bacteria | 1876 |
| 453 | Ga0496104_0000022 | 3300048907 | Bacteria | 237390 |
| 454 | Ga0496105_0000028 | 3300048908 | Bacteria | 145917 |
| 455 | Ga0496108_0018117 | 3300048911 | Bacteria | 5762 |
| 456 | Ga0496110_0121067 | 3300048913 | Bacteria | 2357 |
| 457 | Ga0496111_0048587 | 3300048914 | Bacteria | 3056 |
| 458 | Ga0496112_0104966 | 3300048915 | Bacteria | 2795 |
| 459 | Ga0496114_0019032 | 3300048917 | Bacteria | 5563 |
| 460 | Ga0496114_0028888 | 3300048917 | Bacteria | 4555 |
| 461 | Ga0496114_0097876 | 3300048917 | Bacteria | 2500 |
| 462 | Ga0496115_0000113 | 3300048918 | Bacteria | 74536 |
| 463 | Ga0496117_0005126 | 3300048920 | Bacteria | 13994 |
| 464 | Ga0496117_0005460 | 3300048920 | Bacteria | 13337 |
| 465 | Ga0496117_0008711 | 3300048920 | Bacteria | 9586 |
| 466 | Ga0496117_0011118 | 3300048920 | Bacteria | 8093 |
| 467 | Ga0496117_0065667 | 3300048920 | Bacteria | 2465 |
| 468 | Ga0496118_0000361 | 3300048921 | Bacteria | 76982 |
| 469 | Ga0496118_0001754 | 3300048921 | Bacteria | 31454 |
| 470 | Ga0496118_0007909 | 3300048921 | Bacteria | 11133 |
| 471 | Ga0496118_0011022 | 3300048921 | Bacteria | 8878 |
| 472 | Ga0496118_0012398 | 3300048921 | Bacteria | 8189 |
| 473 | Ga0496118_0012849 | 3300048921 | Bacteria | 7988 |
| 474 | Ga0496119_0072034 | 3300048922 | Bacteria | 2020 |
| 475 | Ga0496120_0000161 | 3300048923 | Bacteria | 112351 |
| 476 | Ga0496120_0004656 | 3300048923 | Bacteria | 11339 |
| 477 | Ga0496121_0002940 | 3300048924 | Bacteria | 24917 |
| 478 | Ga0496122_0000129 | 3300048925 | Bacteria | 173688 |
| 479 | Ga0496122_0004925 | 3300048925 | Bacteria | 16187 |
| 480 | Ga0496122_0024787 | 3300048925 | Bacteria | 5239 |
| 481 | Ga0496123_0000113 | 3300048926 | Bacteria | 163689 |
| 482 | Ga0496123_0000234 | 3300048926 | Bacteria | 112524 |
| 483 | Ga0496123_0035130 | 3300048926 | Bacteria | 3577 |
| 484 | Ga0496124_0000312 | 3300048927 | Bacteria | 89996 |
| 485 | Ga0496124_0005295 | 3300048927 | Bacteria | 14586 |
| 486 | Ga0496124_0007326 | 3300048927 | Bacteria | 11757 |
| 487 | Ga0496124_0028051 | 3300048927 | Bacteria | 5039 |
| 488 | Ga0496124_0081727 | 3300048927 | Bacteria | 2654 |
| 489 | Ga0496124_0108641 | 3300048927 | Bacteria | 2236 |
| 490 | Ga0496125_0046564 | 3300048928 | Bacteria | 3637 |
| 491 | Ga0496126_0000226 | 3300048929 | Bacteria | 122150 |
| 492 | Ga0496126_0010455 | 3300048929 | Bacteria | 9720 |
| 493 | Ga0496126_0017881 | 3300048929 | Bacteria | 7054 |
| 494 | Ga0496126_0044784 | 3300048929 | Bacteria | 4072 |
| 495 | Ga0496126_0212717 | 3300048929 | Bacteria | 1627 |
| 496 | Ga0501290_000312 | 3300049513 | Bacteria | 7960 |
| 497 | Ga0501031_0009223 | 3300049568 | Bacteria | 6414 |
| 498 | Ga0501031_0012719 | 3300049568 | Bacteria | 5497 |
| 499 | Ga0501031_0018154 | 3300049568 | Bacteria | 4576 |
| 500 | Ga0501032_0005711 | 3300049569 | Bacteria | 9209 |
| 501 | Ga0501032_0043004 | 3300049569 | Bacteria | 3062 |
| 502 | Ga0501032_0044418 | 3300049569 | Bacteria | 3007 |
| 503 | Ga0501032_0117210 | 3300049569 | Bacteria | 1760 |
| 504 | Ga0501033_0002102 | 3300049570 | Bacteria | 17249 |
| 505 | Ga0501033_0003201 | 3300049570 | Bacteria | 13559 |
| 506 | Ga0501033_0124383 | 3300049570 | Bacteria | 1870 |
| 507 | Ga0501034_0000321 | 3300049571 | Bacteria | 84273 |
| 508 | Ga0501034_0001241 | 3300049571 | Bacteria | 34650 |
| 509 | Ga0501034_0002220 | 3300049571 | Bacteria | 23969 |
| 510 | Ga0501034_0007828 | 3300049571 | Bacteria | 11365 |
| 511 | Ga0501034_0015065 | 3300049571 | Bacteria | 7949 |
| 512 | Ga0501034_0020678 | 3300049571 | Bacteria | 6722 |
| 513 | Ga0501034_0024369 | 3300049571 | Bacteria | 6154 |
| 514 | Ga0501034_0025544 | 3300049571 | Bacteria | 6015 |
| 515 | Ga0501034_0076547 | 3300049571 | Bacteria | 3352 |
| 516 | Ga0501034_0145620 | 3300049571 | Bacteria | 2346 |
| 517 | Ga0501036_0009476 | 3300049572 | Bacteria | 8009 |
| 518 | Ga0501036_0012483 | 3300049572 | Bacteria | 7043 |
| 519 | Ga0501036_0068642 | 3300049572 | Bacteria | 2999 |
| 520 | Ga0501036_0084218 | 3300049572 | Bacteria | 2688 |
| 521 | Ga0501037_0059735 | 3300049573 | Bacteria | 2781 |
| 522 | Ga0501037_0088630 | 3300049573 | Bacteria | 2239 |
| 523 | Ga0501038_0001697 | 3300049574 | Bacteria | 20435 |
| 524 | Ga0501038_0013042 | 3300049574 | Bacteria | 7580 |
| 525 | Ga0501038_0109290 | 3300049574 | Bacteria | 2291 |
| 526 | Ga0501038_0255737 | 3300049574 | Bacteria | 1386 |
| 527 | Ga0501039_0010405 | 3300049575 | Bacteria | 7090 |
| 528 | Ga0501039_0052722 | 3300049575 | Bacteria | 3146 |
| 529 | Ga0501039_0127207 | 3300049575 | Bacteria | 1999 |
| 530 | Ga0501042_0181237 | 3300049578 | Bacteria | 1520 |
| 531 | Ga0501042_0243572 | 3300049578 | Bacteria | 1297 |
| 532 | Ga0501043_0001923 | 3300049579 | Bacteria | 17777 |
| 533 | Ga0501043_0055551 | 3300049579 | Bacteria | 3111 |
| 534 | Ga0501046_0000711 | 3300049580 | Bacteria | 32113 |
| 535 | Ga0501046_0102379 | 3300049580 | Bacteria | 2196 |
| 536 | Ga0501047_0009134 | 3300049581 | Bacteria | 9360 |
| 537 | Ga0501047_0018688 | 3300049581 | Bacteria | 6646 |
| 538 | Ga0501047_0021722 | 3300049581 | Bacteria | 6162 |
| 539 | Ga0501047_0050671 | 3300049581 | Bacteria | 4009 |
| 540 | Ga0501047_0076004 | 3300049581 | Bacteria | 3232 |
| 541 | Ga0501047_0087405 | 3300049581 | Bacteria | 2994 |
| 542 | Ga0501047_0110912 | 3300049581 | Bacteria | 2626 |
| 543 | Ga0501047_0272202 | 3300049581 | Bacteria | 1540 |
| 544 | Ga0501048_0003997 | 3300049582 | Bacteria | 11200 |
| 545 | Ga0501048_0129665 | 3300049582 | Bacteria | 1783 |
| 546 | Ga0501067_0002024 | 3300049583 | Bacteria | 11183 |
| 547 | Ga0501069_0001475 | 3300049585 | Bacteria | 11585 |
| 548 | Ga0501069_0023615 | 3300049585 | Bacteria | 3354 |
| 549 | Ga0501070_0007640 | 3300049586 | Bacteria | 9177 |
| 550 | Ga0501070_0007684 | 3300049586 | Bacteria | 9148 |
| 551 | Ga0501070_0085710 | 3300049586 | Bacteria | 2608 |
| 552 | Ga0501070_0206211 | 3300049586 | Bacteria | 1614 |
| 553 | Ga0501071_0024476 | 3300049587 | Bacteria | 4224 |
| 554 | Ga0501071_0040766 | 3300049587 | Bacteria | 3324 |
| 555 | Ga0501072_0140078 | 3300049588 | Bacteria | 1928 |
| 556 | Ga0501073_0003789 | 3300049589 | Bacteria | 11370 |
| 557 | Ga0501073_0023900 | 3300049589 | Bacteria | 4388 |
| 558 | Ga0501073_0337979 | 3300049589 | Bacteria | 1039 |
| 559 | Ga0501074_0005942 | 3300049590 | Bacteria | 8801 |
| 560 | Ga0501074_0102431 | 3300049590 | Bacteria | 2049 |
| 561 | Ga0501252_002416 | 3300049682 | Bacteria | 1852 |
| 562 | Ga0501257_030932 | 3300049686 | Bacteria | 1290 |
| 563 | Ga0501225_0006270 | 3300049705 | Bacteria | 3475 |
| 564 | Ga0501080_0001158 | 3300049742 | Bacteria | 21765 |
| 565 | Ga0501080_0036180 | 3300049742 | Bacteria | 4609 |
| 566 | Ga0501080_0038645 | 3300049742 | Bacteria | 4455 |
| 567 | Ga0501080_0050384 | 3300049742 | Bacteria | 3875 |
| 568 | Ga0501080_0153045 | 3300049742 | Bacteria | 2131 |
| 569 | Ga0501080_0164102 | 3300049742 | Bacteria | 2050 |
| 570 | Ga0501083_0005792 | 3300049744 | Bacteria | 8750 |
| 571 | Ga0501266_001457 | 3300049763 | Bacteria | 3017 |
| 572 | Ga0501268_004448 | 3300049765 | Bacteria | 1976 |
| 573 | Ga0501275_000448 | 3300049772 | Bacteria | 4638 |
| 574 | Ga0501035_0039953 | 3300049822 | Bacteria | 4242 |
| 575 | Ga0501035_0170498 | 3300049822 | Bacteria | 1880 |
| 576 | Ga0501035_0178869 | 3300049822 | Bacteria | 1828 |
| 577 | Ga0501044_0006764 | 3300049823 | Bacteria | 12636 |
| 578 | Ga0501044_0034267 | 3300049823 | Bacteria | 5326 |
| 579 | Ga0501044_0075050 | 3300049823 | Bacteria | 3433 |
| 580 | Ga0501044_0247133 | 3300049823 | Bacteria | 1726 |
| 581 | nmdc:mga00v17_15305_c1 | 3300050491 | Bacteria | 4305 |
| 582 | nmdc:mga00v17_47069_c1 | 3300050491 | Bacteria | 2612 |
| 583 | nmdc:mga00v17_9295_c1 | 3300050491 | Bacteria | 5316 |
| 584 | Ga0500610_0004301 | 3300053079 | Bacteria | 5626 |
| 585 | Ga0500643_012592 | 3300053087 | Bacteria | 3024 |
| 586 | Ga0500651_0000070 | 3300053093 | Bacteria | 67252 |
| 587 | Ga0500651_0007332 | 3300053093 | Bacteria | 6436 |
| 588 | Ga0500634_0000217 | 3300053161 | Bacteria | 18600 |
| 589 | Ga0500634_0059678 | 3300053161 | Bacteria | 2028 |
| 590 | Ga0501084_0052834 | 3300054114 | Bacteria | 3399 |
| 591 | Ga0501084_0090788 | 3300054114 | Bacteria | 2565 |
| 592 | Ga0501084_0108965 | 3300054114 | Bacteria | 2327 |
| 593 | Ga0501082_0002570 | 3300060353 | Bacteria | 15874 |
| 594 | Ga0501082_0225836 | 3300060353 | Bacteria | 1629 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049581 | Ga0501047_0272202 | Ga0501047_0272202_558_1529 | 323 |
| 2 | 3300049589 | Ga0501073_0337979 | Ga0501073_0337979_57_1028 | 323 |
| 3 | 3300024227 | Ga0228598_1007623 | Ga0228598_10076232 | 324 |
| 4 | 3300048927 | Ga0496124_0081727 | Ga0496124_0081727_1579_2631 | 336 |
| 5 | 3300005356 | Ga0070674_100048311 | Ga0070674_1000483113 | 353 |
| 6 | 3300005843 | Ga0068860_100171032 | Ga0068860_1001710322 | 353 |
| 7 | 3300014326 | Ga0157380_10032552 | Ga0157380_100325523 | 353 |
| 8 | 3300006048 | Ga0075363_100080799 | Ga0075363_1000807992 | 355 |
| 9 | 3300053161 | Ga0500634_0059678 | Ga0500634_0059678_207_1358 | 355 |
| 10 | 3300005339 | Ga0070660_100003996 | Ga0070660_1000039964 | 356 |
| 11 | 3300005530 | Ga0070679_100021110 | Ga0070679_1000211103 | 356 |
| 12 | 3300005530 | Ga0070679_100021528 | Ga0070679_1000215286 | 356 |
| 13 | 3300005563 | Ga0068855_100285805 | Ga0068855_1002858053 | 356 |
| 14 | 3300025913 | Ga0207695_10015845 | Ga0207695_100158454 | 356 |
| 15 | 3300025919 | Ga0207657_10046209 | Ga0207657_100462094 | 356 |
| 16 | 3300025921 | Ga0207652_10012848 | Ga0207652_100128482 | 356 |
| 17 | 3300048920 | Ga0496117_0065667 | Ga0496117_0065667_971_2158 | 361 |
| 18 | 3300048921 | Ga0496118_0001754 | Ga0496118_0001754_14588_15775 | 361 |
| 19 | 3300013308 | Ga0157375_10062762 | Ga0157375_100627624 | 362 |
| 20 | iso_pu_bacteria | 2576861471 | 2578458622 | 363 |
| 21 | iso_pu_bacteria | 2857442823 | 2857446039 | 363 |
| 22 | iso_pu_bacteria | 2894414249 | 2894415547 | 363 |
| 23 | 3300031665 | Ga0316575_10010769 | Ga0316575_100107695 | 364 |
| 24 | 3300032168 | Ga0316593_10002956 | Ga0316593_100029563 | 364 |
| 25 | 3300036647 | Ga0316582_0033025 | Ga0316582_0033025_1793_2920 | 364 |
| 26 | 3300013102 | Ga0157371_10019209 | Ga0157371_100192092 | 365 |
| 27 | 3300030732 | Ga0316176_1113068 | Ga0316176_11130684 | 365 |
| 28 | 3300031824 | Ga0307413_10070248 | Ga0307413_100702482 | 365 |
| 29 | 3300046460 | Ga0495638_0012115 | Ga0495638_0012115_242_1411 | 365 |
| 30 | 3300048920 | Ga0496117_0005126 | Ga0496117_0005126_11257_12438 | 365 |
| 31 | 3300048920 | Ga0496117_0005460 | Ga0496117_0005460_157_1308 | 365 |
| 32 | 3300048920 | Ga0496117_0011118 | Ga0496117_0011118_6685_7833 | 365 |
| 33 | 3300048921 | Ga0496118_0007909 | Ga0496118_0007909_168_1319 | 365 |
| 34 | 3300048921 | Ga0496118_0012849 | Ga0496118_0012849_6574_7722 | 365 |
| 35 | 3300048922 | Ga0496119_0072034 | Ga0496119_0072034_261_1409 | 365 |
| 36 | 3300048923 | Ga0496120_0000161 | Ga0496120_0000161_13205_14386 | 365 |
| 37 | 3300048923 | Ga0496120_0004656 | Ga0496120_0004656_9914_11062 | 365 |
| 38 | 3300048925 | Ga0496122_0004925 | Ga0496122_0004925_13045_14226 | 365 |
| 39 | 3300048926 | Ga0496123_0000234 | Ga0496123_0000234_13179_14360 | 365 |
| 40 | 3300048926 | Ga0496123_0035130 | Ga0496123_0035130_223_1371 | 365 |
| 41 | 3300048927 | Ga0496124_0005295 | Ga0496124_0005295_223_1404 | 365 |
| 42 | 3300048927 | Ga0496124_0108641 | Ga0496124_0108641_807_1955 | 365 |
| 43 | 3300048928 | Ga0496125_0046564 | Ga0496125_0046564_124_1272 | 365 |
| 44 | 3300048929 | Ga0496126_0010455 | Ga0496126_0010455_259_1407 | 365 |
| 45 | iso_pu_bacteria | 2547132130 | 2547502810 | 365 |
| 46 | iso_pu_bacteria | 2643221579 | 2643906005 | 365 |
| 47 | iso_pu_bacteria | 2643221581 | 2643916573 | 365 |
| 48 | iso_pu_bacteria | 2747842428 | 2747948262 | 365 |
| 49 | iso_pu_bacteria | 2747842501 | 2748017975 | 365 |
| 50 | iso_pu_bacteria | 2765235840 | 2765578758 | 365 |
| 51 | iso_pu_bacteria | 2816332141 | 2816516817 | 365 |
| 52 | iso_pu_bacteria | 2818991457 | 2819663138 | 365 |
| 53 | iso_pu_bacteria | 2842391507 | 2842393250 | 365 |
| 54 | iso_pu_bacteria | 2842780639 | 2842783910 | 365 |
| 55 | iso_pu_bacteria | 2852649853 | 2852651012 | 365 |
| 56 | iso_pu_bacteria | 2852684882 | 2852685878 | 365 |
| 57 | iso_pu_bacteria | 2874220319 | 2874221386 | 365 |
| 58 | iso_pu_bacteria | 2919089067 | 2919091892 | 365 |
| 59 | iso_pu_bacteria | 2919130084 | 2919133724 | 365 |
| 60 | iso_pu_bacteria | 2919134579 | 2919137991 | 365 |
| 61 | iso_pu_bacteria | 2923516293 | 2923518349 | 365 |
| 62 | iso_pu_bacteria | 2928496128 | 2928496355 | 365 |
| 63 | iso_pu_bacteria | 2929195423 | 2929197541 | 365 |
| 64 | iso_pu_bacteria | 2931380184 | 2931380974 | 365 |
| 65 | iso_pu_bacteria | 2937610967 | 2937612195 | 365 |
| 66 | iso_pu_bacteria | 2939589442 | 2939590831 | 365 |
| 67 | iso_pu_bacteria | 2939622612 | 2939623033 | 365 |
| 68 | iso_pu_bacteria | 2939626828 | 2939629794 | 365 |
| 69 | iso_pu_bacteria | 2941475908 | 2941478111 | 365 |
| 70 | iso_pu_bacteria | 2961047084 | 2961048152 | 365 |
| 71 | iso_pu_bacteria | 2961064222 | 2961065155 | 365 |
| 72 | iso_pu_bacteria | 2974307012 | 2974309141 | 365 |
| 73 | iso_pu_bacteria | 2977247770 | 2977249858 | 365 |
| 74 | iso_pu_bacteria | 2984514374 | 2984515651 | 365 |
| 75 | iso_pu_bacteria | 2987605356 | 2987606042 | 365 |
| 76 | iso_pu_bacteria | 8002869464 | 8002872144 | 365 |
| 77 | iso_pu_bacteria | 8021622325 | 8021622736 | 365 |
| 78 | iso_pu_bacteria | 8021648035 | 8021649547 | 365 |
| 79 | 3300005543 | Ga0070672_100002016 | Ga0070672_1000020166 | 366 |
| 80 | 3300025940 | Ga0207691_10004997 | Ga0207691_100049976 | 366 |
| 81 | 3300041413 | Ga0439465_0022285 | Ga0439465_0022285_15_1151 | 366 |
| 82 | 3300049568 | Ga0501031_0009223 | Ga0501031_0009223_3528_4715 | 366 |
| 83 | 3300049571 | Ga0501034_0145620 | Ga0501034_0145620_536_1723 | 366 |
| 84 | 3300049572 | Ga0501036_0012483 | Ga0501036_0012483_3782_4969 | 366 |
| 85 | 3300049581 | Ga0501047_0018688 | Ga0501047_0018688_3612_4799 | 366 |
| 86 | 3300049742 | Ga0501080_0036180 | Ga0501080_0036180_1876_3063 | 366 |
| 87 | 3300049822 | Ga0501035_0178869 | Ga0501035_0178869_624_1811 | 366 |
| 88 | 3300049823 | Ga0501044_0075050 | Ga0501044_0075050_11_1198 | 366 |
| 89 | iso_pu_bacteria | 2571042365 | 2572253997 | 366 |
| 90 | iso_pu_bacteria | 2643221559 | 2643817737 | 366 |
| 91 | iso_pu_bacteria | 2643221573 | 2643878962 | 366 |
| 92 | iso_pu_bacteria | 2643221612 | 2644079522 | 366 |
| 93 | iso_pu_bacteria | 2643221720 | 2644660278 | 366 |
| 94 | iso_pu_bacteria | 2643221727 | 2644694964 | 366 |
| 95 | iso_pu_bacteria | 2643221728 | 2644697580 | 366 |
| 96 | iso_pu_bacteria | 2842757796 | 2842758344 | 366 |
| 97 | iso_pu_bacteria | 2895498888 | 2895504107 | 366 |
| 98 | iso_pu_bacteria | 2895511927 | 2895515461 | 366 |
| 99 | iso_pu_bacteria | 2895522137 | 2895525028 | 366 |
| 100 | iso_pu_bacteria | 2895525241 | 2895527737 | 366 |
| 101 | iso_pu_bacteria | 2919513703 | 2919514608 | 366 |
| 102 | iso_pu_bacteria | 2919675420 | 2919676651 | 366 |
| 103 | iso_pu_bacteria | 2941489479 | 2941490728 | 366 |
| 104 | iso_pu_bacteria | 2995948881 | 2995951316 | 366 |
| 105 | iso_pu_bacteria | 8003014200 | 8003014358 | 366 |
| 106 | 3300005618 | Ga0068864_100047435 | Ga0068864_1000474352 | 367 |
| 107 | 3300005841 | Ga0068863_100148826 | Ga0068863_1001488262 | 367 |
| 108 | 3300009177 | Ga0105248_10380517 | Ga0105248_103805172 | 367 |
| 109 | 3300012482 | Ga0157318_1000036 | Ga0157318_10000363 | 367 |
| 110 | 3300012510 | Ga0157316_1000061 | Ga0157316_10000615 | 367 |
| 111 | 3300032004 | Ga0307414_10002258 | Ga0307414_100022586 | 367 |
| 112 | 3300046615 | Ga0495656_0010177 | Ga0495656_0010177_1434_2594 | 367 |
| 113 | 3300047318 | Ga0495636_0007001 | Ga0495636_0007001_3102_4262 | 367 |
| 114 | 3300048913 | Ga0496110_0121067 | Ga0496110_0121067_427_1587 | 367 |
| 115 | 3300048914 | Ga0496111_0048587 | Ga0496111_0048587_1586_2746 | 367 |
| 116 | 3300048917 | Ga0496114_0028888 | Ga0496114_0028888_706_1866 | 367 |
| 117 | 3300049587 | Ga0501071_0040766 | Ga0501071_0040766_29_1210 | 367 |
| 118 | iso_pu_bacteria | 2643221593 | 2643973996 | 367 |
| 119 | iso_pu_bacteria | 2643221695 | 2644529260 | 367 |
| 120 | 3300002773 | JGI25152J39213_1000529 | JGI25152J39213_10005295 | 368 |
| 121 | 3300002774 | JGI25150J39212_1000383 | JGI25150J39212_100038315 | 368 |
| 122 | 3300003187 | JGI25151J46595_10000176 | JGI25151J46595_1000017624 | 368 |
| 123 | 3300003215 | JGI25153J46596_10000129 | JGI25153J46596_1000012924 | 368 |
| 124 | 3300003771 | Ga0055526_1001879 | Ga0055526_100187912 | 368 |
| 125 | 3300003771 | Ga0055526_1004038 | Ga0055526_10040386 | 368 |
| 126 | 3300003773 | Ga0055537_1001085 | Ga0055537_10010857 | 368 |
| 127 | 3300003775 | Ga0055524_1020562 | Ga0055524_10205621 | 368 |
| 128 | 3300003781 | Ga0055536_1008190 | Ga0055536_10081904 | 368 |
| 129 | 3300003781 | Ga0055536_1011555 | Ga0055536_10115553 | 368 |
| 130 | 3300003781 | Ga0055536_1011574 | Ga0055536_10115743 | 368 |
| 131 | 3300003781 | Ga0055536_1014965 | Ga0055536_10149653 | 368 |
| 132 | 3300003784 | Ga0055534_1000258 | Ga0055534_10002589 | 368 |
| 133 | 3300003784 | Ga0055534_1011667 | Ga0055534_10116672 | 368 |
| 134 | 3300003790 | Ga0055528_1000065 | Ga0055528_100006558 | 368 |
| 135 | 3300003791 | Ga0055530_10019232 | Ga0055530_100192322 | 368 |
| 136 | 3300003791 | Ga0055530_10019234 | Ga0055530_100192342 | 368 |
| 137 | 3300003794 | Ga0055531_10011324 | Ga0055531_100113243 | 368 |
| 138 | 3300003794 | Ga0055531_10017668 | Ga0055531_100176681 | 368 |
| 139 | 3300003856 | Ga0058692_1000023 | Ga0058692_100002363 | 368 |
| 140 | 3300003856 | Ga0058692_1000285 | Ga0058692_100028521 | 368 |
| 141 | 3300005289 | Ga0065704_10000509 | Ga0065704_1000050910 | 368 |
| 142 | 3300005289 | Ga0065704_10070536 | Ga0065704_100705363 | 368 |
| 143 | 3300005289 | Ga0065704_10111287 | Ga0065704_101112872 | 368 |
| 144 | 3300005289 | Ga0065704_10112342 | Ga0065704_101123422 | 368 |
| 145 | 3300005435 | Ga0070714_100188814 | Ga0070714_1001888142 | 368 |
| 146 | 3300005548 | Ga0070665_100022970 | Ga0070665_1000229702 | 368 |
| 147 | 3300006051 | Ga0075364_10000928 | Ga0075364_100009287 | 368 |
| 148 | 3300006178 | Ga0075367_10009991 | Ga0075367_100099912 | 368 |
| 149 | 3300006186 | Ga0075369_10014137 | Ga0075369_100141374 | 368 |
| 150 | 3300009011 | Ga0105251_10000450 | Ga0105251_1000045021 | 368 |
| 151 | 3300009011 | Ga0105251_10017454 | Ga0105251_100174542 | 368 |
| 152 | 3300009148 | Ga0105243_10087251 | Ga0105243_100872512 | 368 |
| 153 | 3300009148 | Ga0105243_10167468 | Ga0105243_101674682 | 368 |
| 154 | 3300014497 | Ga0182008_10001932 | Ga0182008_100019322 | 368 |
| 155 | 3300015262 | Ga0182007_10001075 | Ga0182007_100010754 | 368 |
| 156 | 3300015265 | Ga0182005_1001036 | Ga0182005_10010362 | 368 |
| 157 | 3300015265 | Ga0182005_1008264 | Ga0182005_10082642 | 368 |
| 158 | 3300017792 | Ga0163161_10075177 | Ga0163161_100751772 | 368 |
| 159 | 3300017792 | Ga0163161_10087444 | Ga0163161_100874442 | 368 |
| 160 | 3300020075 | Ga0206349_1053534 | Ga0206349_10535342 | 368 |
| 161 | 3300025245 | Ga0207425_1000011 | Ga0207425_1000011120 | 368 |
| 162 | 3300025258 | Ga0209129_1000044 | Ga0209129_100004467 | 368 |
| 163 | 3300025263 | Ga0209565_1000014 | Ga0209565_100001434 | 368 |
| 164 | 3300025273 | Ga0209673_1000065 | Ga0209673_1000065171 | 368 |
| 165 | 3300025273 | Ga0209673_1009750 | Ga0209673_10097502 | 368 |
| 166 | 3300025284 | Ga0209130_1006994 | Ga0209130_10069944 | 368 |
| 167 | 3300025291 | Ga0209675_1000011 | Ga0209675_1000011314 | 368 |
| 168 | 3300025291 | Ga0209675_1010448 | Ga0209675_10104483 | 368 |
| 169 | 3300025292 | Ga0209676_1000011 | Ga0209676_1000011735 | 368 |
| 170 | 3300025292 | Ga0209676_1000170 | Ga0209676_100017081 | 368 |
| 171 | 3300025292 | Ga0209676_1000324 | Ga0209676_100032471 | 368 |
| 172 | 3300025292 | Ga0209676_1000400 | Ga0209676_100040072 | 368 |
| 173 | 3300025294 | Ga0209025_1000012 | Ga0209025_1000012433 | 368 |
| 174 | 3300025294 | Ga0209025_1022153 | Ga0209025_10221534 | 368 |
| 175 | 3300025295 | Ga0209564_1000775 | Ga0209564_100077528 | 368 |
| 176 | 3300025295 | Ga0209564_1005053 | Ga0209564_10050536 | 368 |
| 177 | 3300025297 | Ga0209758_1000018 | Ga0209758_1000018224 | 368 |
| 178 | 3300025297 | Ga0209758_1021717 | Ga0209758_10217172 | 368 |
| 179 | 3300025298 | Ga0209050_1000932 | Ga0209050_100093219 | 368 |
| 180 | 3300025298 | Ga0209050_1002408 | Ga0209050_10024085 | 368 |
| 181 | 3300025298 | Ga0209050_1002409 | Ga0209050_100240912 | 368 |
| 182 | 3300025299 | Ga0209256_1006041 | Ga0209256_10060414 | 368 |
| 183 | 3300025303 | Ga0209051_1003709 | Ga0209051_10037094 | 368 |
| 184 | 3300025304 | Ga0209257_1000014 | Ga0209257_1000014794 | 368 |
| 185 | 3300025304 | Ga0209257_1000065 | Ga0209257_1000065342 | 368 |
| 186 | 3300025304 | Ga0209257_1000170 | Ga0209257_1000170116 | 368 |
| 187 | 3300025304 | Ga0209257_1000793 | Ga0209257_100079337 | 368 |
| 188 | 3300025304 | Ga0209257_1001655 | Ga0209257_100165513 | 368 |
| 189 | 3300025304 | Ga0209257_1007564 | Ga0209257_10075643 | 368 |
| 190 | 3300025735 | Ga0207713_1001361 | Ga0207713_100136115 | 368 |
| 191 | 3300025735 | Ga0207713_1016417 | Ga0207713_10164174 | 368 |
| 192 | 3300025935 | Ga0207709_10002040 | Ga0207709_100020407 | 368 |
| 193 | 3300025935 | Ga0207709_10051238 | Ga0207709_100512382 | 368 |
| 194 | 3300025972 | Ga0207668_10010635 | Ga0207668_100106352 | 368 |
| 195 | 3300027312 | Ga0209371_1000004 | Ga0209371_1000004187 | 368 |
| 196 | 3300027312 | Ga0209371_1000059 | Ga0209371_100005963 | 368 |
| 197 | 3300028379 | Ga0268266_10283744 | Ga0268266_102837442 | 368 |
| 198 | 3300028794 | Ga0307515_10135444 | Ga0307515_101354442 | 368 |
| 199 | 3300030500 | Ga0268256_1000005 | Ga0268256_1000005857 | 368 |
| 200 | 3300030500 | Ga0268256_1000055 | Ga0268256_1000055135 | 368 |
| 201 | 3300030742 | Ga0316183_1135259 | Ga0316183_11352592 | 368 |
| 202 | 3300030744 | Ga0316181_1062290 | Ga0316181_10622902 | 368 |
| 203 | 3300031456 | Ga0307513_10004310 | Ga0307513_1000431015 | 368 |
| 204 | 3300031824 | Ga0307413_10001879 | Ga0307413_100018794 | 368 |
| 205 | 3300032004 | Ga0307414_10000505 | Ga0307414_100005054 | 368 |
| 206 | 3300032004 | Ga0307414_10011622 | Ga0307414_100116225 | 368 |
| 207 | 3300032004 | Ga0307414_10028371 | Ga0307414_100283712 | 368 |
| 208 | 3300032005 | Ga0307411_10065797 | Ga0307411_100657972 | 368 |
| 209 | 3300038705 | Ga0237819_00005 | Ga0237819_00005_52259_53464 | 368 |
| 210 | 3300038705 | Ga0237819_02007 | Ga0237819_02007_2756_3961 | 368 |
| 211 | 3300041404 | Ga0439436_0011150 | Ga0439436_0011150_1322_2584 | 368 |
| 212 | 3300041459 | Ga0451800_0480575 | Ga0451800_0480575_1268_2473 | 368 |
| 213 | 3300041462 | Ga0451806_272703 | Ga0451806_272703_1316_2521 | 368 |
| 214 | 3300041486 | Ga0451807_0148074 | Ga0451807_0148074_510_1664 | 368 |
| 215 | 3300041486 | Ga0451807_1405164 | Ga0451807_1405164_2125_3330 | 368 |
| 216 | 3300041509 | Ga0451843_1136542 | Ga0451843_1136542_3172_4326 | 368 |
| 217 | 3300042004 | Ga0439445_0005628 | Ga0439445_0005628_45_1214 | 368 |
| 218 | 3300042007 | Ga0439449_0000269 | Ga0439449_0000269_15129_16355 | 368 |
| 219 | 3300042007 | Ga0439449_0002020 | Ga0439449_0002020_4626_5876 | 368 |
| 220 | 3300042007 | Ga0439449_0003846 | Ga0439449_0003846_1670_2956 | 368 |
| 221 | 3300042010 | Ga0439452_018440 | Ga0439452_018440_231_1481 | 368 |
| 222 | 3300046501 | Ga0495607_0037125 | Ga0495607_0037125_1441_2652 | 368 |
| 223 | 3300046507 | Ga0495606_0014127 | Ga0495606_0014127_4644_5855 | 368 |
| 224 | 3300046525 | Ga0495663_0002038 | Ga0495663_0002038_1661_2815 | 368 |
| 225 | 3300046615 | Ga0495656_0000880 | Ga0495656_0000880_3315_4568 | 368 |
| 226 | 3300046692 | Ga0495671_0004630 | Ga0495671_0004630_565_1719 | 368 |
| 227 | 3300048917 | Ga0496114_0019032 | Ga0496114_0019032_2094_3317 | 368 |
| 228 | 3300048925 | Ga0496122_0024787 | Ga0496122_0024787_322_1533 | 368 |
| 229 | 3300048927 | Ga0496124_0000312 | Ga0496124_0000312_34085_35296 | 368 |
| 230 | 3300048927 | Ga0496124_0007326 | Ga0496124_0007326_10311_11516 | 368 |
| 231 | 3300048927 | Ga0496124_0028051 | Ga0496124_0028051_202_1407 | 368 |
| 232 | 3300048929 | Ga0496126_0017881 | Ga0496126_0017881_826_2037 | 368 |
| 233 | 3300049570 | Ga0501033_0124383 | Ga0501033_0124383_32_1288 | 368 |
| 234 | 3300049571 | Ga0501034_0000321 | Ga0501034_0000321_63340_64563 | 368 |
| 235 | 3300049574 | Ga0501038_0109290 | Ga0501038_0109290_535_1791 | 368 |
| 236 | 3300049575 | Ga0501039_0127207 | Ga0501039_0127207_559_1815 | 368 |
| 237 | 3300049581 | Ga0501047_0110912 | Ga0501047_0110912_659_1918 | 368 |
| 238 | 3300049705 | Ga0501225_0006270 | Ga0501225_0006270_2096_3265 | 368 |
| 239 | 3300049822 | Ga0501035_0170498 | Ga0501035_0170498_555_1814 | 368 |
| 240 | 3300049823 | Ga0501044_0247133 | Ga0501044_0247133_216_1475 | 368 |
| 241 | 3300050491 | nmdc:mga00v17_15305_c1 | nmdc:mga00v17_15305_c1_858_2027 | 368 |
| 242 | 3300003187 | JGI25151J46595_10000041 | JGI25151J46595_1000004118 | 369 |
| 243 | 3300003771 | Ga0055526_1000527 | Ga0055526_100052718 | 369 |
| 244 | 3300003773 | Ga0055537_1000226 | Ga0055537_10002265 | 369 |
| 245 | 3300003775 | Ga0055524_1000041 | Ga0055524_1000041119 | 369 |
| 246 | 3300003784 | Ga0055534_1000462 | Ga0055534_10004627 | 369 |
| 247 | 3300003790 | Ga0055528_1000017 | Ga0055528_1000017119 | 369 |
| 248 | 3300005293 | Ga0065715_10018340 | Ga0065715_100183402 | 369 |
| 249 | 3300005339 | Ga0070660_100081848 | Ga0070660_1000818482 | 369 |
| 250 | 3300005347 | Ga0070668_100016260 | Ga0070668_1000162604 | 369 |
| 251 | 3300005355 | Ga0070671_100046319 | Ga0070671_1000463192 | 369 |
| 252 | 3300005356 | Ga0070674_100186368 | Ga0070674_1001863682 | 369 |
| 253 | 3300005366 | Ga0070659_100019128 | Ga0070659_1000191285 | 369 |
| 254 | 3300005543 | Ga0070672_100007880 | Ga0070672_1000078804 | 369 |
| 255 | 3300009098 | Ga0105245_10253063 | Ga0105245_102530632 | 369 |
| 256 | 3300009177 | Ga0105248_10009513 | Ga0105248_100095134 | 369 |
| 257 | 3300009979 | Ga0105032_101421 | Ga0105032_1014212 | 369 |
| 258 | 3300015689 | Ga0183360_10001 | Ga0183360_100011880 | 369 |
| 259 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000011940 | 369 |
| 260 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000011940 | 369 |
| 261 | 3300025291 | Ga0209675_1000001 | Ga0209675_1000001593 | 369 |
| 262 | 3300025294 | Ga0209025_1000015 | Ga0209025_1000015586 | 369 |
| 263 | 3300025295 | Ga0209564_1000001 | Ga0209564_1000001755 | 369 |
| 264 | 3300025297 | Ga0209758_1010564 | Ga0209758_10105644 | 369 |
| 265 | 3300025299 | Ga0209256_1000002 | Ga0209256_1000002798 | 369 |
| 266 | 3300025919 | Ga0207657_10004721 | Ga0207657_100047215 | 369 |
| 267 | 3300025923 | Ga0207681_10009793 | Ga0207681_100097936 | 369 |
| 268 | 3300025931 | Ga0207644_10003282 | Ga0207644_100032825 | 369 |
| 269 | 3300025940 | Ga0207691_10002771 | Ga0207691_1000277112 | 369 |
| 270 | 3300025941 | Ga0207711_10005518 | Ga0207711_100055184 | 369 |
| 271 | 3300025945 | Ga0207679_10037747 | Ga0207679_100377474 | 369 |
| 272 | 3300025972 | Ga0207668_10132507 | Ga0207668_101325072 | 369 |
| 273 | 3300026089 | Ga0207648_10231139 | Ga0207648_102311391 | 369 |
| 274 | 3300027543 | Ga0209999_1000930 | Ga0209999_10009304 | 369 |
| 275 | 3300027552 | Ga0209982_1000034 | Ga0209982_10000348 | 369 |
| 276 | 3300027614 | Ga0209970_1003495 | Ga0209970_10034953 | 369 |
| 277 | 3300027665 | Ga0209983_1000431 | Ga0209983_10004313 | 369 |
| 278 | 3300027682 | Ga0209971_1000355 | Ga0209971_10003555 | 369 |
| 279 | 3300027876 | Ga0209974_10026507 | Ga0209974_100265072 | 369 |
| 280 | 3300030731 | Ga0316177_1199532 | Ga0316177_11995324 | 369 |
| 281 | 3300031730 | Ga0307516_10070265 | Ga0307516_100702652 | 369 |
| 282 | 3300031824 | Ga0307413_10006252 | Ga0307413_100062523 | 369 |
| 283 | 3300031901 | Ga0307406_10116425 | Ga0307406_101164252 | 369 |
| 284 | 3300031995 | Ga0307409_100011535 | Ga0307409_1000115355 | 369 |
| 285 | 3300032002 | Ga0307416_100230389 | Ga0307416_1002303892 | 369 |
| 286 | 3300032004 | Ga0307414_10123757 | Ga0307414_101237572 | 369 |
| 287 | 3300032005 | Ga0307411_10014421 | Ga0307411_100144214 | 369 |
| 288 | 3300037312 | Ga0395899_0073839 | Ga0395899_0073839_903_2111 | 369 |
| 289 | 3300037312 | Ga0395899_0188143 | Ga0395899_0188143_193_1428 | 369 |
| 290 | 3300037418 | Ga0395900_0083754 | Ga0395900_0083754_401_1609 | 369 |
| 291 | 3300037471 | Ga0395905_0000800 | Ga0395905_0000800_13795_15003 | 369 |
| 292 | 3300037471 | Ga0395905_0023575 | Ga0395905_0023575_2429_3637 | 369 |
| 293 | 3300037471 | Ga0395905_0065319 | Ga0395905_0065319_170_1396 | 369 |
| 294 | 3300038443 | Ga0395901_0197290 | Ga0395901_0197290_144_1352 | 369 |
| 295 | 3300041404 | Ga0439436_0007087 | Ga0439436_0007087_458_1705 | 369 |
| 296 | 3300041453 | Ga0451797_1048131 | Ga0451797_1048131_146_1297 | 369 |
| 297 | 3300041494 | Ga0451837_0160044 | Ga0451837_0160044_605_1756 | 369 |
| 298 | 3300041509 | Ga0451843_0823885 | Ga0451843_0823885_467_1618 | 369 |
| 299 | 3300042006 | Ga0439432_002206 | Ga0439432_002206_4938_6191 | 369 |
| 300 | 3300042876 | Ga0451577_0018786 | Ga0451577_0018786_2114_3322 | 369 |
| 301 | 3300046537 | Ga0495598_0000343 | Ga0495598_0000343_3777_5012 | 369 |
| 302 | 3300046616 | Ga0495668_0003099 | Ga0495668_0003099_8241_9548 | 369 |
| 303 | 3300047318 | Ga0495636_0002531 | Ga0495636_0002531_3746_4990 | 369 |
| 304 | 3300047447 | Ga0495685_017384 | Ga0495685_017384_38_1282 | 369 |
| 305 | 3300048911 | Ga0496108_0018117 | Ga0496108_0018117_1553_2761 | 369 |
| 306 | 3300048915 | Ga0496112_0104966 | Ga0496112_0104966_551_1759 | 369 |
| 307 | 3300048924 | Ga0496121_0002940 | Ga0496121_0002940_15099_16424 | 369 |
| 308 | 3300049513 | Ga0501290_000312 | Ga0501290_000312_4983_6173 | 369 |
| 309 | 3300049571 | Ga0501034_0001241 | Ga0501034_0001241_10367_11524 | 369 |
| 310 | 3300049571 | Ga0501034_0015065 | Ga0501034_0015065_1784_2992 | 369 |
| 311 | 3300049682 | Ga0501252_002416 | Ga0501252_002416_289_1506 | 369 |
| 312 | 3300049686 | Ga0501257_030932 | Ga0501257_030932_42_1259 | 369 |
| 313 | 3300049763 | Ga0501266_001457 | Ga0501266_001457_266_1519 | 369 |
| 314 | 3300049765 | Ga0501268_004448 | Ga0501268_004448_116_1333 | 369 |
| 315 | 3300049772 | Ga0501275_000448 | Ga0501275_000448_2850_4040 | 369 |
| 316 | 3300050491 | nmdc:mga00v17_47069_c1 | nmdc:mga00v17_47069_c1_1412_2584 | 369 |
| 317 | 3300050491 | nmdc:mga00v17_9295_c1 | nmdc:mga00v17_9295_c1_2280_3452 | 369 |
| 318 | 3300053161 | Ga0500634_0000217 | Ga0500634_0000217_9997_11211 | 369 |
| 319 | 3300002077 | JGI24744J21845_10003192 | JGI24744J21845_100031922 | 370 |
| 320 | 3300005328 | Ga0070676_10009917 | Ga0070676_100099174 | 370 |
| 321 | 3300005328 | Ga0070676_10045956 | Ga0070676_100459562 | 370 |
| 322 | 3300005334 | Ga0068869_100012574 | Ga0068869_1000125745 | 370 |
| 323 | 3300005335 | Ga0070666_10000763 | Ga0070666_1000076318 | 370 |
| 324 | 3300005335 | Ga0070666_10012971 | Ga0070666_100129714 | 370 |
| 325 | 3300005335 | Ga0070666_10027948 | Ga0070666_100279483 | 370 |
| 326 | 3300005335 | Ga0070666_10032675 | Ga0070666_100326753 | 370 |
| 327 | 3300005338 | Ga0068868_100102910 | Ga0068868_1001029101 | 370 |
| 328 | 3300005344 | Ga0070661_100006394 | Ga0070661_1000063944 | 370 |
| 329 | 3300005344 | Ga0070661_100019534 | Ga0070661_1000195342 | 370 |
| 330 | 3300005347 | Ga0070668_100006847 | Ga0070668_1000068477 | 370 |
| 331 | 3300005347 | Ga0070668_100025329 | Ga0070668_1000253292 | 370 |
| 332 | 3300005347 | Ga0070668_100070838 | Ga0070668_1000708383 | 370 |
| 333 | 3300005347 | Ga0070668_100125971 | Ga0070668_1001259713 | 370 |
| 334 | 3300005353 | Ga0070669_100011996 | Ga0070669_1000119965 | 370 |
| 335 | 3300005366 | Ga0070659_100027585 | Ga0070659_1000275852 | 370 |
| 336 | 3300005367 | Ga0070667_100000090 | Ga0070667_10000009018 | 370 |
| 337 | 3300005367 | Ga0070667_100001463 | Ga0070667_10000146311 | 370 |
| 338 | 3300005367 | Ga0070667_100016049 | Ga0070667_1000160494 | 370 |
| 339 | 3300005367 | Ga0070667_100027229 | Ga0070667_1000272293 | 370 |
| 340 | 3300005367 | Ga0070667_100033628 | Ga0070667_1000336283 | 370 |
| 341 | 3300005367 | Ga0070667_100076641 | Ga0070667_1000766413 | 370 |
| 342 | 3300005367 | Ga0070667_100103539 | Ga0070667_1001035392 | 370 |
| 343 | 3300005367 | Ga0070667_100116422 | Ga0070667_1001164223 | 370 |
| 344 | 3300005367 | Ga0070667_100348181 | Ga0070667_1003481812 | 370 |
| 345 | 3300005455 | Ga0070663_100001470 | Ga0070663_1000014706 | 370 |
| 346 | 3300005455 | Ga0070663_100025497 | Ga0070663_1000254971 | 370 |
| 347 | 3300005455 | Ga0070663_100095224 | Ga0070663_1000952242 | 370 |
| 348 | 3300005455 | Ga0070663_100115282 | Ga0070663_1001152822 | 370 |
| 349 | 3300005456 | Ga0070678_100006167 | Ga0070678_1000061674 | 370 |
| 350 | 3300005456 | Ga0070678_100011525 | Ga0070678_1000115252 | 370 |
| 351 | 3300005457 | Ga0070662_100033265 | Ga0070662_1000332654 | 370 |
| 352 | 3300005459 | Ga0068867_100254759 | Ga0068867_1002547592 | 370 |
| 353 | 3300005466 | Ga0070685_10001309 | Ga0070685_1000130910 | 370 |
| 354 | 3300005466 | Ga0070685_10045633 | Ga0070685_100456333 | 370 |
| 355 | 3300005530 | Ga0070679_100014740 | Ga0070679_1000147404 | 370 |
| 356 | 3300005535 | Ga0070684_100091787 | Ga0070684_1000917872 | 370 |
| 357 | 3300005539 | Ga0068853_100000795 | Ga0068853_10000079516 | 370 |
| 358 | 3300005539 | Ga0068853_100009902 | Ga0068853_1000099027 | 370 |
| 359 | 3300005539 | Ga0068853_100214940 | Ga0068853_1002149401 | 370 |
| 360 | 3300005543 | Ga0070672_100018396 | Ga0070672_1000183964 | 370 |
| 361 | 3300005547 | Ga0070693_100004397 | Ga0070693_1000043972 | 370 |
| 362 | 3300005548 | Ga0070665_100000283 | Ga0070665_10000028316 | 370 |
| 363 | 3300005548 | Ga0070665_100001823 | Ga0070665_10000182317 | 370 |
| 364 | 3300005563 | Ga0068855_100014240 | Ga0068855_1000142408 | 370 |
| 365 | 3300005563 | Ga0068855_100105016 | Ga0068855_1001050162 | 370 |
| 366 | 3300005563 | Ga0068855_100151747 | Ga0068855_1001517474 | 370 |
| 367 | 3300005577 | Ga0068857_100094105 | Ga0068857_1000941054 | 370 |
| 368 | 3300005578 | Ga0068854_100141314 | Ga0068854_1001413142 | 370 |
| 369 | 3300005614 | Ga0068856_100002977 | Ga0068856_1000029774 | 370 |
| 370 | 3300005614 | Ga0068856_100098384 | Ga0068856_1000983844 | 370 |
| 371 | 3300005614 | Ga0068856_100340165 | Ga0068856_1003401652 | 370 |
| 372 | 3300005616 | Ga0068852_100005567 | Ga0068852_1000055675 | 370 |
| 373 | 3300005616 | Ga0068852_100021388 | Ga0068852_1000213882 | 370 |
| 374 | 3300005616 | Ga0068852_100093029 | Ga0068852_1000930293 | 370 |
| 375 | 3300005616 | Ga0068852_100196922 | Ga0068852_1001969222 | 370 |
| 376 | 3300005617 | Ga0068859_100002133 | Ga0068859_1000021335 | 370 |
| 377 | 3300005617 | Ga0068859_100046266 | Ga0068859_1000462663 | 370 |
| 378 | 3300005618 | Ga0068864_100016372 | Ga0068864_1000163723 | 370 |
| 379 | 3300005834 | Ga0068851_10005322 | Ga0068851_100053224 | 370 |
| 380 | 3300005834 | Ga0068851_10012806 | Ga0068851_100128064 | 370 |
| 381 | 3300005841 | Ga0068863_100000945 | Ga0068863_10000094526 | 370 |
| 382 | 3300005841 | Ga0068863_100042745 | Ga0068863_1000427452 | 370 |
| 383 | 3300005841 | Ga0068863_100045185 | Ga0068863_1000451855 | 370 |
| 384 | 3300005841 | Ga0068863_100060280 | Ga0068863_1000602804 | 370 |
| 385 | 3300005841 | Ga0068863_100100499 | Ga0068863_1001004994 | 370 |
| 386 | 3300005842 | Ga0068858_100007811 | Ga0068858_1000078114 | 370 |
| 387 | 3300005843 | Ga0068860_100001333 | Ga0068860_1000013333 | 370 |
| 388 | 3300005843 | Ga0068860_100079130 | Ga0068860_1000791303 | 370 |
| 389 | 3300005844 | Ga0068862_100000707 | Ga0068862_1000007073 | 370 |
| 390 | 3300006237 | Ga0097621_100147981 | Ga0097621_1001479812 | 370 |
| 391 | 3300006237 | Ga0097621_100186958 | Ga0097621_1001869582 | 370 |
| 392 | 3300006358 | Ga0068871_100012627 | Ga0068871_1000126272 | 370 |
| 393 | 3300006358 | Ga0068871_100027477 | Ga0068871_1000274774 | 370 |
| 394 | 3300006358 | Ga0068871_100066954 | Ga0068871_1000669542 | 370 |
| 395 | 3300006358 | Ga0068871_100195308 | Ga0068871_1001953081 | 370 |
| 396 | 3300006881 | Ga0068865_100007663 | Ga0068865_1000076635 | 370 |
| 397 | 3300006881 | Ga0068865_100024363 | Ga0068865_1000243634 | 370 |
| 398 | 3300006931 | Ga0097620_100002133 | Ga0097620_1000021335 | 370 |
| 399 | 3300006931 | Ga0097620_100046266 | Ga0097620_1000462663 | 370 |
| 400 | 3300009093 | Ga0105240_10001034 | Ga0105240_100010347 | 370 |
| 401 | 3300009093 | Ga0105240_10018043 | Ga0105240_100180435 | 370 |
| 402 | 3300009174 | Ga0105241_10010963 | Ga0105241_100109633 | 370 |
| 403 | 3300009174 | Ga0105241_10011152 | Ga0105241_100111524 | 370 |
| 404 | 3300009174 | Ga0105241_10017434 | Ga0105241_100174344 | 370 |
| 405 | 3300009174 | Ga0105241_10127825 | Ga0105241_101278252 | 370 |
| 406 | 3300009174 | Ga0105241_10187469 | Ga0105241_101874692 | 370 |
| 407 | 3300009176 | Ga0105242_10000862 | Ga0105242_1000086221 | 370 |
| 408 | 3300009177 | Ga0105248_10000252 | Ga0105248_100002524 | 370 |
| 409 | 3300009177 | Ga0105248_10159513 | Ga0105248_101595132 | 370 |
| 410 | 3300009177 | Ga0105248_10179890 | Ga0105248_101798901 | 370 |
| 411 | 3300009545 | Ga0105237_10000345 | Ga0105237_1000034517 | 370 |
| 412 | 3300009545 | Ga0105237_10013282 | Ga0105237_100132828 | 370 |
| 413 | 3300009545 | Ga0105237_10048937 | Ga0105237_100489372 | 370 |
| 414 | 3300009551 | Ga0105238_10001167 | Ga0105238_100011675 | 370 |
| 415 | 3300009551 | Ga0105238_10002155 | Ga0105238_1000215510 | 370 |
| 416 | 3300009551 | Ga0105238_10016598 | Ga0105238_100165984 | 370 |
| 417 | 3300009551 | Ga0105238_10025373 | Ga0105238_100253733 | 370 |
| 418 | 3300009551 | Ga0105238_10337292 | Ga0105238_103372921 | 370 |
| 419 | 3300009553 | Ga0105249_10002096 | Ga0105249_100020969 | 370 |
| 420 | 3300009553 | Ga0105249_10034363 | Ga0105249_100343634 | 370 |
| 421 | 3300009553 | Ga0105249_10124952 | Ga0105249_101249523 | 370 |
| 422 | 3300009553 | Ga0105249_10206728 | Ga0105249_102067282 | 370 |
| 423 | 3300010375 | Ga0105239_10001370 | Ga0105239_1000137019 | 370 |
| 424 | 3300010375 | Ga0105239_10004199 | Ga0105239_100041992 | 370 |
| 425 | 3300010375 | Ga0105239_10011975 | Ga0105239_100119758 | 370 |
| 426 | 3300010375 | Ga0105239_10020971 | Ga0105239_100209714 | 370 |
| 427 | 3300010375 | Ga0105239_10026783 | Ga0105239_100267835 | 370 |
| 428 | 3300010375 | Ga0105239_10029639 | Ga0105239_100296395 | 370 |
| 429 | 3300010375 | Ga0105239_10320343 | Ga0105239_103203432 | 370 |
| 430 | 3300011119 | Ga0105246_10070137 | Ga0105246_100701372 | 370 |
| 431 | 3300011119 | Ga0105246_10078960 | Ga0105246_100789602 | 370 |
| 432 | 3300013100 | Ga0157373_10031695 | Ga0157373_100316953 | 370 |
| 433 | 3300013104 | Ga0157370_10068303 | Ga0157370_100683032 | 370 |
| 434 | 3300013105 | Ga0157369_10000027 | Ga0157369_10000027138 | 370 |
| 435 | 3300013105 | Ga0157369_10001075 | Ga0157369_1000107523 | 370 |
| 436 | 3300013296 | Ga0157374_10029789 | Ga0157374_100297894 | 370 |
| 437 | 3300013296 | Ga0157374_10070752 | Ga0157374_100707522 | 370 |
| 438 | 3300013296 | Ga0157374_10103391 | Ga0157374_101033913 | 370 |
| 439 | 3300013296 | Ga0157374_10232606 | Ga0157374_102326062 | 370 |
| 440 | 3300013297 | Ga0157378_10000016 | Ga0157378_1000001663 | 370 |
| 441 | 3300013297 | Ga0157378_10037698 | Ga0157378_100376984 | 370 |
| 442 | 3300013297 | Ga0157378_10202570 | Ga0157378_102025702 | 370 |
| 443 | 3300013306 | Ga0163162_10000107 | Ga0163162_1000010741 | 370 |
| 444 | 3300013306 | Ga0163162_10005036 | Ga0163162_1000503611 | 370 |
| 445 | 3300013306 | Ga0163162_10020014 | Ga0163162_100200144 | 370 |
| 446 | 3300013307 | Ga0157372_10000662 | Ga0157372_1000066231 | 370 |
| 447 | 3300013307 | Ga0157372_10035029 | Ga0157372_100350294 | 370 |
| 448 | 3300013308 | Ga0157375_10006575 | Ga0157375_100065758 | 370 |
| 449 | 3300013308 | Ga0157375_10012067 | Ga0157375_100120674 | 370 |
| 450 | 3300014325 | Ga0163163_10000117 | Ga0163163_1000011714 | 370 |
| 451 | 3300014325 | Ga0163163_10005615 | Ga0163163_1000561510 | 370 |
| 452 | 3300014325 | Ga0163163_10027823 | Ga0163163_100278232 | 370 |
| 453 | 3300014968 | Ga0157379_10002463 | Ga0157379_100024635 | 370 |
| 454 | 3300014969 | Ga0157376_10012479 | Ga0157376_100124794 | 370 |
| 455 | 3300014969 | Ga0157376_10018524 | Ga0157376_100185244 | 370 |
| 456 | 3300025303 | Ga0209051_1005139 | Ga0209051_10051395 | 370 |
| 457 | 3300025315 | Ga0207697_10073104 | Ga0207697_100731042 | 370 |
| 458 | 3300025321 | Ga0207656_10012718 | Ga0207656_100127181 | 370 |
| 459 | 3300025903 | Ga0207680_10000249 | Ga0207680_100002492 | 370 |
| 460 | 3300025903 | Ga0207680_10079557 | Ga0207680_100795572 | 370 |
| 461 | 3300025903 | Ga0207680_10084775 | Ga0207680_100847752 | 370 |
| 462 | 3300025903 | Ga0207680_10165534 | Ga0207680_101655342 | 370 |
| 463 | 3300025904 | Ga0207647_10000440 | Ga0207647_1000044025 | 370 |
| 464 | 3300025904 | Ga0207647_10003399 | Ga0207647_100033995 | 370 |
| 465 | 3300025907 | Ga0207645_10015322 | Ga0207645_100153224 | 370 |
| 466 | 3300025907 | Ga0207645_10018230 | Ga0207645_100182304 | 370 |
| 467 | 3300025907 | Ga0207645_10202740 | Ga0207645_102027402 | 370 |
| 468 | 3300025909 | Ga0207705_10254637 | Ga0207705_102546372 | 370 |
| 469 | 3300025911 | Ga0207654_10003999 | Ga0207654_100039994 | 370 |
| 470 | 3300025911 | Ga0207654_10026748 | Ga0207654_100267483 | 370 |
| 471 | 3300025911 | Ga0207654_10132176 | Ga0207654_101321762 | 370 |
| 472 | 3300025913 | Ga0207695_10000007 | Ga0207695_10000007475 | 370 |
| 473 | 3300025913 | Ga0207695_10000094 | Ga0207695_1000009484 | 370 |
| 474 | 3300025913 | Ga0207695_10003459 | Ga0207695_1000345916 | 370 |
| 475 | 3300025913 | Ga0207695_10004403 | Ga0207695_100044038 | 370 |
| 476 | 3300025913 | Ga0207695_10006570 | Ga0207695_100065707 | 370 |
| 477 | 3300025914 | Ga0207671_10000870 | Ga0207671_100008709 | 370 |
| 478 | 3300025914 | Ga0207671_10009115 | Ga0207671_100091157 | 370 |
| 479 | 3300025914 | Ga0207671_10010311 | Ga0207671_100103113 | 370 |
| 480 | 3300025914 | Ga0207671_10013380 | Ga0207671_100133803 | 370 |
| 481 | 3300025916 | Ga0207663_10149490 | Ga0207663_101494902 | 370 |
| 482 | 3300025919 | Ga0207657_10000801 | Ga0207657_100008014 | 370 |
| 483 | 3300025920 | Ga0207649_10007737 | Ga0207649_100077374 | 370 |
| 484 | 3300025920 | Ga0207649_10027746 | Ga0207649_100277463 | 370 |
| 485 | 3300025923 | Ga0207681_10039873 | Ga0207681_100398734 | 370 |
| 486 | 3300025924 | Ga0207694_10000733 | Ga0207694_100007337 | 370 |
| 487 | 3300025924 | Ga0207694_10003366 | Ga0207694_100033663 | 370 |
| 488 | 3300025924 | Ga0207694_10050784 | Ga0207694_100507843 | 370 |
| 489 | 3300025924 | Ga0207694_10086833 | Ga0207694_100868333 | 370 |
| 490 | 3300025927 | Ga0207687_10085530 | Ga0207687_100855303 | 370 |
| 491 | 3300025931 | Ga0207644_10033944 | Ga0207644_100339442 | 370 |
| 492 | 3300025933 | Ga0207706_10010468 | Ga0207706_100104684 | 370 |
| 493 | 3300025933 | Ga0207706_10046446 | Ga0207706_100464464 | 370 |
| 494 | 3300025934 | Ga0207686_10014945 | Ga0207686_100149454 | 370 |
| 495 | 3300025938 | Ga0207704_10001698 | Ga0207704_100016988 | 370 |
| 496 | 3300025940 | Ga0207691_10008633 | Ga0207691_100086338 | 370 |
| 497 | 3300025940 | Ga0207691_10023735 | Ga0207691_100237355 | 370 |
| 498 | 3300025941 | Ga0207711_10001221 | Ga0207711_100012216 | 370 |
| 499 | 3300025942 | Ga0207689_10012269 | Ga0207689_100122695 | 370 |
| 500 | 3300025942 | Ga0207689_10161275 | Ga0207689_101612752 | 370 |
| 501 | 3300025944 | Ga0207661_10149969 | Ga0207661_101499692 | 370 |
| 502 | 3300025949 | Ga0207667_10002665 | Ga0207667_100026656 | 370 |
| 503 | 3300025949 | Ga0207667_10007120 | Ga0207667_100071204 | 370 |
| 504 | 3300025949 | Ga0207667_10095622 | Ga0207667_100956223 | 370 |
| 505 | 3300025949 | Ga0207667_10131902 | Ga0207667_101319022 | 370 |
| 506 | 3300025961 | Ga0207712_10002072 | Ga0207712_100020724 | 370 |
| 507 | 3300025972 | Ga0207668_10039806 | Ga0207668_100398064 | 370 |
| 508 | 3300025972 | Ga0207668_10042883 | Ga0207668_100428833 | 370 |
| 509 | 3300025981 | Ga0207640_10172976 | Ga0207640_101729762 | 370 |
| 510 | 3300025986 | Ga0207658_10000111 | Ga0207658_1000011142 | 370 |
| 511 | 3300025986 | Ga0207658_10015506 | Ga0207658_100155064 | 370 |
| 512 | 3300025986 | Ga0207658_10176254 | Ga0207658_101762542 | 370 |
| 513 | 3300025986 | Ga0207658_10228572 | Ga0207658_102285722 | 370 |
| 514 | 3300026023 | Ga0207677_10052806 | Ga0207677_100528062 | 370 |
| 515 | 3300026035 | Ga0207703_10009557 | Ga0207703_100095572 | 370 |
| 516 | 3300026041 | Ga0207639_10000129 | Ga0207639_100001298 | 370 |
| 517 | 3300026041 | Ga0207639_10000598 | Ga0207639_1000059811 | 370 |
| 518 | 3300026041 | Ga0207639_10004972 | Ga0207639_100049725 | 370 |
| 519 | 3300026041 | Ga0207639_10015772 | Ga0207639_100157722 | 370 |
| 520 | 3300026041 | Ga0207639_10027225 | Ga0207639_100272252 | 370 |
| 521 | 3300026041 | Ga0207639_10097461 | Ga0207639_100974612 | 370 |
| 522 | 3300026067 | Ga0207678_10000802 | Ga0207678_1000080213 | 370 |
| 523 | 3300026067 | Ga0207678_10004034 | Ga0207678_100040347 | 370 |
| 524 | 3300026067 | Ga0207678_10033275 | Ga0207678_100332752 | 370 |
| 525 | 3300026067 | Ga0207678_10108637 | Ga0207678_101086372 | 370 |
| 526 | 3300026078 | Ga0207702_10015437 | Ga0207702_100154374 | 370 |
| 527 | 3300026078 | Ga0207702_10067833 | Ga0207702_100678334 | 370 |
| 528 | 3300026088 | Ga0207641_10038660 | Ga0207641_100386603 | 370 |
| 529 | 3300026088 | Ga0207641_10061591 | Ga0207641_100615914 | 370 |
| 530 | 3300026088 | Ga0207641_10183606 | Ga0207641_101836062 | 370 |
| 531 | 3300026089 | Ga0207648_10003832 | Ga0207648_1000383211 | 370 |
| 532 | 3300026089 | Ga0207648_10049012 | Ga0207648_100490122 | 370 |
| 533 | 3300026089 | Ga0207648_10100903 | Ga0207648_101009033 | 370 |
| 534 | 3300026095 | Ga0207676_10014192 | Ga0207676_100141925 | 370 |
| 535 | 3300026116 | Ga0207674_10005372 | Ga0207674_100053729 | 370 |
| 536 | 3300026116 | Ga0207674_10097705 | Ga0207674_100977053 | 370 |
| 537 | 3300026118 | Ga0207675_100016430 | Ga0207675_1000164306 | 370 |
| 538 | 3300026121 | Ga0207683_10005014 | Ga0207683_100050146 | 370 |
| 539 | 3300026121 | Ga0207683_10014136 | Ga0207683_100141362 | 370 |
| 540 | 3300026121 | Ga0207683_10015477 | Ga0207683_100154776 | 370 |
| 541 | 3300026121 | Ga0207683_10077385 | Ga0207683_100773853 | 370 |
| 542 | 3300026142 | Ga0207698_10004306 | Ga0207698_100043063 | 370 |
| 543 | 3300026142 | Ga0207698_10211021 | Ga0207698_102110212 | 370 |
| 544 | 3300026142 | Ga0207698_10293291 | Ga0207698_102932912 | 370 |
| 545 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000012277 | 370 |
| 546 | 3300028379 | Ga0268266_10000006 | Ga0268266_10000006416 | 370 |
| 547 | 3300028379 | Ga0268266_10227572 | Ga0268266_102275722 | 370 |
| 548 | 3300028380 | Ga0268265_10015894 | Ga0268265_100158944 | 370 |
| 549 | 3300028380 | Ga0268265_10160234 | Ga0268265_101602342 | 370 |
| 550 | 3300028381 | Ga0268264_10013736 | Ga0268264_100137363 | 370 |
| 551 | 3300028381 | Ga0268264_10045565 | Ga0268264_100455652 | 370 |
| 552 | 3300031616 | Ga0307508_10128799 | Ga0307508_101287992 | 370 |
| 553 | 3300032002 | Ga0307416_100141209 | Ga0307416_1001412092 | 370 |
| 554 | 3300036401 | Ga0373937_0221820 | Ga0373937_0221820_296_1408 | 370 |
| 555 | 3300041441 | Ga0451787_216685 | Ga0451787_216685_198_1310 | 370 |
| 556 | 3300041453 | Ga0451797_0066798 | Ga0451797_0066798_202_1320 | 370 |
| 557 | 3300041460 | Ga0451802_0237918 | Ga0451802_0237918_4238_5350 | 370 |
| 558 | 3300041494 | Ga0451837_0569604 | Ga0451837_0569604_334_1446 | 370 |
| 559 | 3300041509 | Ga0451843_0841619 | Ga0451843_0841619_174_1286 | 370 |
| 560 | 3300044658 | Ga0466972_0004716 | Ga0466972_0004716_4195_5379 | 370 |
| 561 | 3300044712 | Ga0453684_0000377 | Ga0453684_0000377_81910_83067 | 370 |
| 562 | 3300044765 | Ga0466970_0028960 | Ga0466970_0028960_1451_2635 | 370 |
| 563 | 3300045051 | Ga0451576_0000033 | Ga0451576_0000033_100379_101536 | 370 |
| 564 | 3300046475 | Ga0495639_0059204 | Ga0495639_0059204_199_1311 | 370 |
| 565 | 3300046517 | Ga0495630_0195106 | Ga0495630_0195106_206_1318 | 370 |
| 566 | 3300046675 | Ga0495657_0085790 | Ga0495657_0085790_874_2013 | 370 |
| 567 | 3300046683 | Ga0495658_0008047 | Ga0495658_0008047_1457_2569 | 370 |
| 568 | 3300048905 | Ga0496102_0028982 | Ga0496102_0028982_3032_4144 | 370 |
| 569 | 3300048906 | Ga0496103_0095728 | Ga0496103_0095728_528_1643 | 370 |
| 570 | 3300048907 | Ga0496104_0000022 | Ga0496104_0000022_57575_58687 | 370 |
| 571 | 3300048908 | Ga0496105_0000028 | Ga0496105_0000028_18508_19620 | 370 |
| 572 | 3300048917 | Ga0496114_0097876 | Ga0496114_0097876_70_1182 | 370 |
| 573 | 3300048918 | Ga0496115_0000113 | Ga0496115_0000113_48633_49745 | 370 |
| 574 | 3300048920 | Ga0496117_0008711 | Ga0496117_0008711_2257_3369 | 370 |
| 575 | 3300048921 | Ga0496118_0000361 | Ga0496118_0000361_5124_6236 | 370 |
| 576 | 3300048921 | Ga0496118_0011022 | Ga0496118_0011022_5869_7017 | 370 |
| 577 | 3300048921 | Ga0496118_0012398 | Ga0496118_0012398_2049_3161 | 370 |
| 578 | 3300048925 | Ga0496122_0000129 | Ga0496122_0000129_46378_47493 | 370 |
| 579 | 3300048926 | Ga0496123_0000113 | Ga0496123_0000113_156635_157750 | 370 |
| 580 | 3300048929 | Ga0496126_0000226 | Ga0496126_0000226_85279_86391 | 370 |
| 581 | 3300048929 | Ga0496126_0044784 | Ga0496126_0044784_488_1603 | 370 |
| 582 | 3300048929 | Ga0496126_0212717 | Ga0496126_0212717_19_1131 | 370 |
| 583 | 3300049568 | Ga0501031_0012719 | Ga0501031_0012719_4063_5175 | 370 |
| 584 | 3300049568 | Ga0501031_0018154 | Ga0501031_0018154_869_1981 | 370 |
| 585 | 3300049569 | Ga0501032_0005711 | Ga0501032_0005711_853_1971 | 370 |
| 586 | 3300049569 | Ga0501032_0043004 | Ga0501032_0043004_840_1952 | 370 |
| 587 | 3300049569 | Ga0501032_0044418 | Ga0501032_0044418_169_1281 | 370 |
| 588 | 3300049569 | Ga0501032_0117210 | Ga0501032_0117210_168_1280 | 370 |
| 589 | 3300049570 | Ga0501033_0002102 | Ga0501033_0002102_7544_8656 | 370 |
| 590 | 3300049570 | Ga0501033_0003201 | Ga0501033_0003201_297_1409 | 370 |
| 591 | 3300049571 | Ga0501034_0002220 | Ga0501034_0002220_17362_18474 | 370 |
| 592 | 3300049571 | Ga0501034_0007828 | Ga0501034_0007828_6449_7561 | 370 |
| 593 | 3300049571 | Ga0501034_0020678 | Ga0501034_0020678_94_1212 | 370 |
| 594 | 3300049571 | Ga0501034_0024369 | Ga0501034_0024369_4577_5689 | 370 |
| 595 | 3300049571 | Ga0501034_0025544 | Ga0501034_0025544_3654_4778 | 370 |
| 596 | 3300049571 | Ga0501034_0076547 | Ga0501034_0076547_1317_2429 | 370 |
| 597 | 3300049572 | Ga0501036_0009476 | Ga0501036_0009476_4897_6009 | 370 |
| 598 | 3300049572 | Ga0501036_0068642 | Ga0501036_0068642_1087_2199 | 370 |
| 599 | 3300049572 | Ga0501036_0084218 | Ga0501036_0084218_1447_2565 | 370 |
| 600 | 3300049573 | Ga0501037_0059735 | Ga0501037_0059735_1458_2576 | 370 |
| 601 | 3300049573 | Ga0501037_0088630 | Ga0501037_0088630_564_1676 | 370 |
| 602 | 3300049574 | Ga0501038_0001697 | Ga0501038_0001697_15426_16538 | 370 |
| 603 | 3300049574 | Ga0501038_0013042 | Ga0501038_0013042_6063_7181 | 370 |
| 604 | 3300049574 | Ga0501038_0255737 | Ga0501038_0255737_48_1160 | 370 |
| 605 | 3300049575 | Ga0501039_0010405 | Ga0501039_0010405_3902_5014 | 370 |
| 606 | 3300049575 | Ga0501039_0052722 | Ga0501039_0052722_1889_3001 | 370 |
| 607 | 3300049578 | Ga0501042_0181237 | Ga0501042_0181237_75_1187 | 370 |
| 608 | 3300049578 | Ga0501042_0243572 | Ga0501042_0243572_145_1257 | 370 |
| 609 | 3300049579 | Ga0501043_0001923 | Ga0501043_0001923_5109_6221 | 370 |
| 610 | 3300049579 | Ga0501043_0055551 | Ga0501043_0055551_1304_2416 | 370 |
| 611 | 3300049580 | Ga0501046_0000711 | Ga0501046_0000711_21853_22965 | 370 |
| 612 | 3300049580 | Ga0501046_0102379 | Ga0501046_0102379_976_2106 | 370 |
| 613 | 3300049581 | Ga0501047_0009134 | Ga0501047_0009134_2307_3425 | 370 |
| 614 | 3300049581 | Ga0501047_0021722 | Ga0501047_0021722_2986_4098 | 370 |
| 615 | 3300049581 | Ga0501047_0050671 | Ga0501047_0050671_2012_3124 | 370 |
| 616 | 3300049581 | Ga0501047_0076004 | Ga0501047_0076004_2024_3136 | 370 |
| 617 | 3300049581 | Ga0501047_0087405 | Ga0501047_0087405_1198_2310 | 370 |
| 618 | 3300049582 | Ga0501048_0003997 | Ga0501048_0003997_9306_10418 | 370 |
| 619 | 3300049582 | Ga0501048_0129665 | Ga0501048_0129665_342_1454 | 370 |
| 620 | 3300049583 | Ga0501067_0002024 | Ga0501067_0002024_5936_7054 | 370 |
| 621 | 3300049585 | Ga0501069_0001475 | Ga0501069_0001475_9335_10447 | 370 |
| 622 | 3300049585 | Ga0501069_0023615 | Ga0501069_0023615_396_1514 | 370 |
| 623 | 3300049586 | Ga0501070_0007640 | Ga0501070_0007640_3164_4282 | 370 |
| 624 | 3300049586 | Ga0501070_0007684 | Ga0501070_0007684_3924_5048 | 370 |
| 625 | 3300049586 | Ga0501070_0085710 | Ga0501070_0085710_359_1471 | 370 |
| 626 | 3300049586 | Ga0501070_0206211 | Ga0501070_0206211_227_1357 | 370 |
| 627 | 3300049587 | Ga0501071_0024476 | Ga0501071_0024476_937_2049 | 370 |
| 628 | 3300049588 | Ga0501072_0140078 | Ga0501072_0140078_701_1819 | 370 |
| 629 | 3300049589 | Ga0501073_0003789 | Ga0501073_0003789_5357_6475 | 370 |
| 630 | 3300049589 | Ga0501073_0023900 | Ga0501073_0023900_174_1286 | 370 |
| 631 | 3300049590 | Ga0501074_0005942 | Ga0501074_0005942_3952_5076 | 370 |
| 632 | 3300049590 | Ga0501074_0102431 | Ga0501074_0102431_467_1579 | 370 |
| 633 | 3300049742 | Ga0501080_0001158 | Ga0501080_0001158_19992_21116 | 370 |
| 634 | 3300049742 | Ga0501080_0001158 | Ga0501080_0001158_5040_6170 | 370 |
| 635 | 3300049742 | Ga0501080_0038645 | Ga0501080_0038645_1445_2557 | 370 |
| 636 | 3300049742 | Ga0501080_0050384 | Ga0501080_0050384_223_1341 | 370 |
| 637 | 3300049742 | Ga0501080_0153045 | Ga0501080_0153045_923_2035 | 370 |
| 638 | 3300049742 | Ga0501080_0164102 | Ga0501080_0164102_15_1127 | 370 |
| 639 | 3300049744 | Ga0501083_0005792 | Ga0501083_0005792_6943_8061 | 370 |
| 640 | 3300049822 | Ga0501035_0039953 | Ga0501035_0039953_2012_3124 | 370 |
| 641 | 3300049823 | Ga0501044_0006764 | Ga0501044_0006764_9361_10473 | 370 |
| 642 | 3300049823 | Ga0501044_0034267 | Ga0501044_0034267_2735_3853 | 370 |
| 643 | 3300053079 | Ga0500610_0004301 | Ga0500610_0004301_3870_4982 | 370 |
| 644 | 3300053087 | Ga0500643_012592 | Ga0500643_012592_378_1493 | 370 |
| 645 | 3300053093 | Ga0500651_0000070 | Ga0500651_0000070_28258_29376 | 370 |
| 646 | 3300053093 | Ga0500651_0007332 | Ga0500651_0007332_4334_5461 | 370 |
| 647 | 3300054114 | Ga0501084_0052834 | Ga0501084_0052834_531_1643 | 370 |
| 648 | 3300054114 | Ga0501084_0090788 | Ga0501084_0090788_528_1658 | 370 |
| 649 | 3300054114 | Ga0501084_0108965 | Ga0501084_0108965_819_1931 | 370 |
| 650 | 3300060353 | Ga0501082_0002570 | Ga0501082_0002570_1263_2375 | 370 |
| 651 | 3300060353 | Ga0501082_0225836 | Ga0501082_0225836_13_1125 | 370 |
| 652 | iso_pu_bacteria | 2524614729 | 2525556598 | 370 |
| 653 | iso_pu_bacteria | 2627854209 | 2630648194 | 370 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rfa-assembly2.cif.gz_A | x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine | 0.9668 | 5 | 335 |
| 4pl1-assembly2.cif.gz_A | x-ray crystal structure of c118a rlmn from escherichia coli with s-adenosylmethionine | 0.9656 | 5 | 334 |
| 3rfa-assembly2.cif.gz_A | x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine | 0.9583 | 5 | 335 |
| 4pl1-assembly2.cif.gz_A | x-ray crystal structure of c118a rlmn from escherichia coli with s-adenosylmethionine | 0.9571 | 5 | 334 |
| 5hr6-assembly2.cif.gz_B | x-ray crystal structure of c118a rlmn with cross-linked trna purified from escherichia coli | 0.9391 | 6 | 354 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rfaB01 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; | 0.9976 | 5 | 66 | 1.10.150.530 |
| 4pl1B01 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; | 0.9943 | 5 | 66 | 1.10.150.530 |
| af_P36979_1_78_1.10.150.530 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; | 0.9928 | 5 | 66 | 1.10.150.530 |
| 3rfaA01 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; | 0.9887 | 5 | 66 | 1.10.150.530 |
| 3rfaB01 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; | 0.9818 | 5 | 66 | 1.10.150.530 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I4VRV1-F1-model_v4 | Dual-specificity RNA methyltransferase RlmN (EC 2.1.1.192) (23S rRNA (adenine(2503)-C(2))-methyltransferase) (23S rRNA m2A2503 methyltransferase) (Ribosomal RNA large subunit methyltransferase N) (tRNA (adenine(37)-C(2))-methyltransferase) (tRNA m2A37 methyltransferase) | 0.9796 | 3 | 311 |
GO:0000049
GO:0002935 GO:0005737 GO:0019843 GO:0030488 GO:0046872 GO:0051539 GO:0070040 GO:0070475 |
| AF-A0A351NM17-F1-model_v4 | deleted | 0.9788 | 5 | 96 |
|
| AF-A0A350QFG5-F1-model_v4 | Bifunctional tRNA (Adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN | 0.9784 | 3 | 94 |
GO:0008168
GO:0030488 GO:0070475 |
| AF-A0A2X3GYV8-F1-model_v4 | Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.192) | 0.9765 | 166 | 309 |
GO:0002935
GO:0030488 GO:0046872 GO:0051539 GO:0070040 GO:0070475 |
| AF-A0A7V2WS51-F1-model_v4 | Radical SAM protein | 0.9708 | 5 | 233 |
GO:0003824
GO:0030488 GO:0046872 GO:0051539 GO:0070475 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar