F472261
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 647 | 292 | 647 | 420 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100003450|Ga0070699_1000034504 |
| Length | 414 |
| Sequence | VAETRIAQEQLGPGPEQMPFGPEHEPETEWMELNMGPHHPSTHGVLRVRLKLDGEIVRDADADIGYLHTGFEKSFEDKTYTQGITFSDRMDYLAPPINNVGFVSAVEKLIEVDVPPRAQAIRVIMMELARVSSHELWLGTTGLDLGVYSGFFYAWRDRDLALDLNEAYSGVRMMTSFTRVGGVAWDLPDGWLDQLQRFIDVMPARLDDFESMLTDNPIWHQRLKGVGAISAADAIEAGVTGPVLRASGVNYDVRKAFPYCGYEQYDFEVPVGQNGDCYDRYRMRVAEMRQSLRILQQAVDNLPGGPWITSDRKVALPPRSELSKSMEAVIHQFRLVSEGFKGPVGDVYSFVESPRGELGFYLVSDGTNKPYRMKVRPPSFCNLQSLRKLVQGVLVADVIAIMGSLDFILGDCDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 100 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 145 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 146 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 147 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 148 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 153 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 154 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 159 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 160 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 161 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 162 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 171 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 172 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 173 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 174 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 175 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 176 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 177 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 178 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 179 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 180 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 181 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 182 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 183 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 184 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 185 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 186 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 187 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 188 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 189 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 190 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 225 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 226 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 227 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 228 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 229 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 230 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 233 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 234 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 235 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 236 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 237 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 238 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 239 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 240 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 241 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 242 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 272 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 273 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 283 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 288 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 289 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 292 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.09 |
| Nodule | 0 |
| Rhizoplane | 12.36 |
| Rhizosphere | 80.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1004847 | 3300000546 | Bacteria | 1482 |
| 2 | LJQas_1000809 | 3300000549 | Bacteria | 4928 |
| 3 | JGI25406J46586_10003565 | 3300003203 | Bacteria | 7300 |
| 4 | JGI25407J50210_10000444 | 3300003373 | Bacteria | 8139 |
| 5 | JGI25407J50210_10000682 | 3300003373 | Bacteria | 7026 |
| 6 | JGI25407J50210_10001845 | 3300003373 | Bacteria | 4902 |
| 7 | JGI25407J50210_10008207 | 3300003373 | Bacteria | 2631 |
| 8 | Ga0065707_10000837 | 3300005295 | Bacteria | 18551 |
| 9 | Ga0070683_100047627 | 3300005329 | Bacteria | 3961 |
| 10 | Ga0070683_100092454 | 3300005329 | Bacteria | 2841 |
| 11 | Ga0070680_100254925 | 3300005336 | Bacteria | 1484 |
| 12 | Ga0070682_100050461 | 3300005337 | Bacteria | 2597 |
| 13 | Ga0070682_100145669 | 3300005337 | Bacteria | 1620 |
| 14 | Ga0068868_100016295 | 3300005338 | Bacteria | 5515 |
| 15 | Ga0068868_100085151 | 3300005338 | Bacteria | 2539 |
| 16 | Ga0068868_100101654 | 3300005338 | Bacteria | 2327 |
| 17 | Ga0070660_100001669 | 3300005339 | Bacteria | 15240 |
| 18 | Ga0070660_100010862 | 3300005339 | Bacteria | 6445 |
| 19 | Ga0070689_100215807 | 3300005340 | Bacteria | 1572 |
| 20 | Ga0070691_10065235 | 3300005341 | Bacteria | 1758 |
| 21 | Ga0070692_10038048 | 3300005345 | Bacteria | 2449 |
| 22 | Ga0070668_100030302 | 3300005347 | Bacteria | 4113 |
| 23 | Ga0070668_100103180 | 3300005347 | Bacteria | 2262 |
| 24 | Ga0070668_100124869 | 3300005347 | Bacteria | 2061 |
| 25 | Ga0070668_100154304 | 3300005347 | Bacteria | 1859 |
| 26 | Ga0070669_100079863 | 3300005353 | Bacteria | 2433 |
| 27 | Ga0070675_100029576 | 3300005354 | Bacteria | 4420 |
| 28 | Ga0070675_100164686 | 3300005354 | Bacteria | 1909 |
| 29 | Ga0070674_100007826 | 3300005356 | Bacteria | 6321 |
| 30 | Ga0070674_100050758 | 3300005356 | Bacteria | 2856 |
| 31 | Ga0070674_100189935 | 3300005356 | Bacteria | 1579 |
| 32 | Ga0070659_100000176 | 3300005366 | Bacteria | 49062 |
| 33 | Ga0070709_10047160 | 3300005434 | Bacteria | 2683 |
| 34 | Ga0070714_100143661 | 3300005435 | Bacteria | 2144 |
| 35 | Ga0070714_100147513 | 3300005435 | Bacteria | 2117 |
| 36 | Ga0070713_100067152 | 3300005436 | Bacteria | 3018 |
| 37 | Ga0070713_100080382 | 3300005436 | Bacteria | 2779 |
| 38 | Ga0070710_10000013 | 3300005437 | Bacteria | 117825 |
| 39 | Ga0070711_100006050 | 3300005439 | Bacteria | 7267 |
| 40 | Ga0070711_100020020 | 3300005439 | Bacteria | 4305 |
| 41 | Ga0070705_100029146 | 3300005440 | Bacteria | 3032 |
| 42 | Ga0070705_100100311 | 3300005440 | Bacteria | 1827 |
| 43 | Ga0070700_100000631 | 3300005441 | Bacteria | 17489 |
| 44 | Ga0070700_100007717 | 3300005441 | Bacteria | 5828 |
| 45 | Ga0070700_100008502 | 3300005441 | Bacteria | 5589 |
| 46 | Ga0070708_100002979 | 3300005445 | Bacteria | 13153 |
| 47 | Ga0070708_100014784 | 3300005445 | Bacteria | 6432 |
| 48 | Ga0070663_100002800 | 3300005455 | Bacteria | 9895 |
| 49 | Ga0070663_100212736 | 3300005455 | Bacteria | 1514 |
| 50 | Ga0070678_100020948 | 3300005456 | Bacteria | 4300 |
| 51 | Ga0070678_100096589 | 3300005456 | Bacteria | 2280 |
| 52 | Ga0070662_100099976 | 3300005457 | Bacteria | 2193 |
| 53 | Ga0070681_10126193 | 3300005458 | Bacteria | 2492 |
| 54 | Ga0068867_100035702 | 3300005459 | Bacteria | 3606 |
| 55 | Ga0070685_10116319 | 3300005466 | Bacteria | 1655 |
| 56 | Ga0070706_100000475 | 3300005467 | Bacteria | 47520 |
| 57 | Ga0070706_100013061 | 3300005467 | Bacteria | 7686 |
| 58 | Ga0070706_100129943 | 3300005467 | Bacteria | 2350 |
| 59 | Ga0070707_100041753 | 3300005468 | Bacteria | 4391 |
| 60 | Ga0070707_100063408 | 3300005468 | Bacteria | 3547 |
| 61 | Ga0070707_100097487 | 3300005468 | Bacteria | 2848 |
| 62 | Ga0070698_100004594 | 3300005471 | Bacteria | 15163 |
| 63 | Ga0070698_100085654 | 3300005471 | Bacteria | 3138 |
| 64 | Ga0070698_100101116 | 3300005471 | Bacteria | 2855 |
| 65 | Ga0070699_100003450 | 3300005518 | Bacteria | 13975 |
| 66 | Ga0070679_100074391 | 3300005530 | Bacteria | 3388 |
| 67 | Ga0070679_100224598 | 3300005530 | Bacteria | 1838 |
| 68 | Ga0070684_100001176 | 3300005535 | Bacteria | 18794 |
| 69 | Ga0070684_100088088 | 3300005535 | Bacteria | 2757 |
| 70 | Ga0070684_100246766 | 3300005535 | Bacteria | 1632 |
| 71 | Ga0070697_100000022 | 3300005536 | Bacteria | 132993 |
| 72 | Ga0070697_100027025 | 3300005536 | Bacteria | 4589 |
| 73 | Ga0070697_100218035 | 3300005536 | Bacteria | 1626 |
| 74 | Ga0068853_100197766 | 3300005539 | Bacteria | 1828 |
| 75 | Ga0070672_100085587 | 3300005543 | Bacteria | 2534 |
| 76 | Ga0070686_100097731 | 3300005544 | Bacteria | 1977 |
| 77 | Ga0070695_100033847 | 3300005545 | Bacteria | 3199 |
| 78 | Ga0070696_100073730 | 3300005546 | Bacteria | 2406 |
| 79 | Ga0070665_100000911 | 3300005548 | Bacteria | 37941 |
| 80 | Ga0070665_100201517 | 3300005548 | Bacteria | 1991 |
| 81 | Ga0070704_100013141 | 3300005549 | Bacteria | 5130 |
| 82 | Ga0070704_100051844 | 3300005549 | Bacteria | 2892 |
| 83 | Ga0070704_100225164 | 3300005549 | Bacteria | 1527 |
| 84 | Ga0070664_100019045 | 3300005564 | Bacteria | 5644 |
| 85 | Ga0070664_100068421 | 3300005564 | Bacteria | 3036 |
| 86 | Ga0068857_100118365 | 3300005577 | Bacteria | 2384 |
| 87 | Ga0068854_100173471 | 3300005578 | Bacteria | 1679 |
| 88 | Ga0068856_100020258 | 3300005614 | Bacteria | 6459 |
| 89 | Ga0070702_100005646 | 3300005615 | Bacteria | 5853 |
| 90 | Ga0070702_100009653 | 3300005615 | Bacteria | 4732 |
| 91 | Ga0070702_100021251 | 3300005615 | Bacteria | 3412 |
| 92 | Ga0070702_100152582 | 3300005615 | Bacteria | 1485 |
| 93 | Ga0068859_100242594 | 3300005617 | Bacteria | 1891 |
| 94 | Ga0068864_100133680 | 3300005618 | Bacteria | 2231 |
| 95 | Ga0068861_100060118 | 3300005719 | Bacteria | 2911 |
| 96 | Ga0081455_10019184 | 3300005937 | Bacteria | 6480 |
| 97 | Ga0081455_10021892 | 3300005937 | Bacteria | 5987 |
| 98 | Ga0081455_10059760 | 3300005937 | Bacteria | 3217 |
| 99 | Ga0081455_10100827 | 3300005937 | Bacteria | 2319 |
| 100 | Ga0081455_10110974 | 3300005937 | Bacteria | 2180 |
| 101 | Ga0081538_10000071 | 3300005981 | Bacteria | 96238 |
| 102 | Ga0081538_10000407 | 3300005981 | Bacteria | 48780 |
| 103 | Ga0081538_10000839 | 3300005981 | Bacteria | 33322 |
| 104 | Ga0081538_10001191 | 3300005981 | Bacteria | 27404 |
| 105 | Ga0081538_10002004 | 3300005981 | Bacteria | 20341 |
| 106 | Ga0081538_10005403 | 3300005981 | Bacteria | 11484 |
| 107 | Ga0081538_10007804 | 3300005981 | Bacteria | 9191 |
| 108 | Ga0081538_10009518 | 3300005981 | Bacteria | 8095 |
| 109 | Ga0081538_10010085 | 3300005981 | Bacteria | 7784 |
| 110 | Ga0081538_10010720 | 3300005981 | Bacteria | 7502 |
| 111 | Ga0081538_10013079 | 3300005981 | Bacteria | 6598 |
| 112 | Ga0081538_10016364 | 3300005981 | Bacteria | 5691 |
| 113 | Ga0081538_10019801 | 3300005981 | Bacteria | 4979 |
| 114 | Ga0081538_10025487 | 3300005981 | Bacteria | 4167 |
| 115 | Ga0081538_10027440 | 3300005981 | Bacteria | 3948 |
| 116 | Ga0081538_10033842 | 3300005981 | Bacteria | 3392 |
| 117 | Ga0081538_10035784 | 3300005981 | Bacteria | 3255 |
| 118 | Ga0081538_10063332 | 3300005981 | Bacteria | 2100 |
| 119 | Ga0081540_1000568 | 3300005983 | Bacteria | 35821 |
| 120 | Ga0081540_1000941 | 3300005983 | Bacteria | 26197 |
| 121 | Ga0081540_1026074 | 3300005983 | Bacteria | 3346 |
| 122 | Ga0081540_1037240 | 3300005983 | Bacteria | 2581 |
| 123 | Ga0081539_10001045 | 3300005985 | Bacteria | 50690 |
| 124 | Ga0081539_10001489 | 3300005985 | Bacteria | 39599 |
| 125 | Ga0081539_10005444 | 3300005985 | Bacteria | 12992 |
| 126 | Ga0081539_10013866 | 3300005985 | Bacteria | 6029 |
| 127 | Ga0081539_10015822 | 3300005985 | Bacteria | 5446 |
| 128 | Ga0081539_10081547 | 3300005985 | Bacteria | 1699 |
| 129 | Ga0070717_10000061 | 3300006028 | Bacteria | 92257 |
| 130 | Ga0070717_10003687 | 3300006028 | Bacteria | 11001 |
| 131 | Ga0070717_10011753 | 3300006028 | Bacteria | 6662 |
| 132 | Ga0070717_10028271 | 3300006028 | Bacteria | 4487 |
| 133 | Ga0070717_10142576 | 3300006028 | Bacteria | 2068 |
| 134 | Ga0075365_10000162 | 3300006038 | Bacteria | 21120 |
| 135 | Ga0075365_10006537 | 3300006038 | Bacteria | 6421 |
| 136 | Ga0075365_10020815 | 3300006038 | Bacteria | 4076 |
| 137 | Ga0075363_100008514 | 3300006048 | Bacteria | 4779 |
| 138 | Ga0075364_10009357 | 3300006051 | Bacteria | 5874 |
| 139 | Ga0075364_10099138 | 3300006051 | Bacteria | 1939 |
| 140 | Ga0075432_10004541 | 3300006058 | Bacteria | 4727 |
| 141 | Ga0070712_100000013 | 3300006175 | Bacteria | 109912 |
| 142 | Ga0070712_100002893 | 3300006175 | Bacteria | 10651 |
| 143 | Ga0075367_10041648 | 3300006178 | Bacteria | 2686 |
| 144 | Ga0075369_10046922 | 3300006186 | Bacteria | 1862 |
| 145 | Ga0075428_100067439 | 3300006844 | Bacteria | 3916 |
| 146 | Ga0075428_100079393 | 3300006844 | Bacteria | 3582 |
| 147 | Ga0075430_100003824 | 3300006846 | Bacteria | 12675 |
| 148 | Ga0075430_100005551 | 3300006846 | Bacteria | 10654 |
| 149 | Ga0075430_100012676 | 3300006846 | Bacteria | 7181 |
| 150 | Ga0075431_100000134 | 3300006847 | Bacteria | 49630 |
| 151 | Ga0075431_100008379 | 3300006847 | Bacteria | 10343 |
| 152 | Ga0075431_100035471 | 3300006847 | Bacteria | 5135 |
| 153 | Ga0075431_100150378 | 3300006847 | Bacteria | 2398 |
| 154 | Ga0075433_10059643 | 3300006852 | Bacteria | 3338 |
| 155 | Ga0075433_10091152 | 3300006852 | Bacteria | 2694 |
| 156 | Ga0075434_100021293 | 3300006871 | Bacteria | 6302 |
| 157 | Ga0075434_100153335 | 3300006871 | Bacteria | 2324 |
| 158 | Ga0075429_100000966 | 3300006880 | Bacteria | 22797 |
| 159 | Ga0075429_100076483 | 3300006880 | Bacteria | 2916 |
| 160 | Ga0068865_100001280 | 3300006881 | Bacteria | 14644 |
| 161 | Ga0068865_100147021 | 3300006881 | Bacteria | 1784 |
| 162 | Ga0075436_100081174 | 3300006914 | Bacteria | 2248 |
| 163 | Ga0097620_100242599 | 3300006931 | Bacteria | 1891 |
| 164 | Ga0075435_100093605 | 3300007076 | Bacteria | 2483 |
| 165 | Ga0075435_100101966 | 3300007076 | Bacteria | 2379 |
| 166 | Ga0099794_10001527 | 3300007265 | Bacteria | 8143 |
| 167 | Ga0105240_10030748 | 3300009093 | Bacteria | 6975 |
| 168 | Ga0111539_10008272 | 3300009094 | Bacteria | 13241 |
| 169 | Ga0111539_10063618 | 3300009094 | Bacteria | 4365 |
| 170 | Ga0111539_10304231 | 3300009094 | Bacteria | 1855 |
| 171 | Ga0105245_10001317 | 3300009098 | Bacteria | 22424 |
| 172 | Ga0105245_10007436 | 3300009098 | Bacteria | 9595 |
| 173 | Ga0105245_10031336 | 3300009098 | Bacteria | 4705 |
| 174 | Ga0105245_10037717 | 3300009098 | Bacteria | 4297 |
| 175 | Ga0105247_10056759 | 3300009101 | Bacteria | 2419 |
| 176 | Ga0114129_10000512 | 3300009147 | Bacteria | 47473 |
| 177 | Ga0114129_10082076 | 3300009147 | Bacteria | 4480 |
| 178 | Ga0114129_10159354 | 3300009147 | Bacteria | 3084 |
| 179 | Ga0114129_10313755 | 3300009147 | Bacteria | 2086 |
| 180 | Ga0105243_10078327 | 3300009148 | Bacteria | 2690 |
| 181 | Ga0105243_10084792 | 3300009148 | Bacteria | 2596 |
| 182 | Ga0105242_10098001 | 3300009176 | Bacteria | 2479 |
| 183 | Ga0105248_10112289 | 3300009177 | Bacteria | 3074 |
| 184 | Ga0105248_10453998 | 3300009177 | Bacteria | 1444 |
| 185 | Ga0105237_10049423 | 3300009545 | Bacteria | 4227 |
| 186 | Ga0105237_10204027 | 3300009545 | Bacteria | 1977 |
| 187 | Ga0105239_10040445 | 3300010375 | Bacteria | 5108 |
| 188 | Ga0105239_10233055 | 3300010375 | Bacteria | 2066 |
| 189 | Ga0105239_10282232 | 3300010375 | Bacteria | 1870 |
| 190 | Ga0157370_10017109 | 3300013104 | Bacteria | 7322 |
| 191 | Ga0157369_10299946 | 3300013105 | Bacteria | 1671 |
| 192 | Ga0157374_10015146 | 3300013296 | Bacteria | 6762 |
| 193 | Ga0157372_10018103 | 3300013307 | Bacteria | 7572 |
| 194 | Ga0157372_10084129 | 3300013307 | Bacteria | 3605 |
| 195 | Ga0157375_10303954 | 3300013308 | Bacteria | 1759 |
| 196 | Ga0163163_10066084 | 3300014325 | Bacteria | 3591 |
| 197 | Ga0163163_10122010 | 3300014325 | Bacteria | 2640 |
| 198 | Ga0163163_10185551 | 3300014325 | Bacteria | 2128 |
| 199 | Ga0157377_10007587 | 3300014745 | Bacteria | 5247 |
| 200 | Ga0157379_10003167 | 3300014968 | Bacteria | 13926 |
| 201 | Ga0157376_10043308 | 3300014969 | Bacteria | 3694 |
| 202 | Ga0157376_10195706 | 3300014969 | Bacteria | 1857 |
| 203 | Ga0213874_10001886 | 3300021377 | Bacteria | 4412 |
| 204 | Ga0213876_10017513 | 3300021384 | Bacteria | 3783 |
| 205 | Ga0213876_10065185 | 3300021384 | Bacteria | 1922 |
| 206 | Ga0213876_10088857 | 3300021384 | Bacteria | 1636 |
| 207 | Ga0213876_10097055 | 3300021384 | Bacteria | 1561 |
| 208 | Ga0213875_10000148 | 3300021388 | Bacteria | 74125 |
| 209 | Ga0213875_10014084 | 3300021388 | Bacteria | 3910 |
| 210 | Ga0207426_1011793 | 3300025302 | Bacteria | 3309 |
| 211 | Ga0207656_10013585 | 3300025321 | Bacteria | 3117 |
| 212 | Ga0207692_10000003 | 3300025898 | Bacteria | 431531 |
| 213 | Ga0207692_10021322 | 3300025898 | Bacteria | 2963 |
| 214 | Ga0207710_10077258 | 3300025900 | Bacteria | 1538 |
| 215 | Ga0207688_10009130 | 3300025901 | Bacteria | 5399 |
| 216 | Ga0207688_10047303 | 3300025901 | Bacteria | 2403 |
| 217 | Ga0207699_10013246 | 3300025906 | Bacteria | 4216 |
| 218 | Ga0207699_10087664 | 3300025906 | Bacteria | 1946 |
| 219 | Ga0207645_10065100 | 3300025907 | Bacteria | 2329 |
| 220 | Ga0207684_10001451 | 3300025910 | Bacteria | 25581 |
| 221 | Ga0207684_10028200 | 3300025910 | Bacteria | 4782 |
| 222 | Ga0207684_10037343 | 3300025910 | Bacteria | 4121 |
| 223 | Ga0207684_10042309 | 3300025910 | Bacteria | 3861 |
| 224 | Ga0207695_10002407 | 3300025913 | Bacteria | 27694 |
| 225 | Ga0207693_10006406 | 3300025915 | Bacteria | 9756 |
| 226 | Ga0207693_10007488 | 3300025915 | Bacteria | 8975 |
| 227 | Ga0207693_10017236 | 3300025915 | Bacteria | 5760 |
| 228 | Ga0207693_10017486 | 3300025915 | Bacteria | 5719 |
| 229 | Ga0207693_10080777 | 3300025915 | Bacteria | 2545 |
| 230 | Ga0207663_10000169 | 3300025916 | Bacteria | 29379 |
| 231 | Ga0207663_10018543 | 3300025916 | Bacteria | 3903 |
| 232 | Ga0207663_10156883 | 3300025916 | Bacteria | 1602 |
| 233 | Ga0207657_10004224 | 3300025919 | Bacteria | 15215 |
| 234 | Ga0207657_10016599 | 3300025919 | Bacteria | 7094 |
| 235 | Ga0207657_10032101 | 3300025919 | Bacteria | 4748 |
| 236 | Ga0207649_10069644 | 3300025920 | Bacteria | 2241 |
| 237 | Ga0207652_10010267 | 3300025921 | Bacteria | 7537 |
| 238 | Ga0207646_10001394 | 3300025922 | Bacteria | 29965 |
| 239 | Ga0207646_10005170 | 3300025922 | Bacteria | 13804 |
| 240 | Ga0207646_10009069 | 3300025922 | Bacteria | 9879 |
| 241 | Ga0207646_10022289 | 3300025922 | Bacteria | 5837 |
| 242 | Ga0207646_10025575 | 3300025922 | Bacteria | 5399 |
| 243 | Ga0207646_10044341 | 3300025922 | Bacteria | 3992 |
| 244 | Ga0207681_10003442 | 3300025923 | Bacteria | 9870 |
| 245 | Ga0207681_10135774 | 3300025923 | Bacteria | 1825 |
| 246 | Ga0207650_10077892 | 3300025925 | Bacteria | 2507 |
| 247 | Ga0207687_10018790 | 3300025927 | Bacteria | 4569 |
| 248 | Ga0207687_10051175 | 3300025927 | Bacteria | 2878 |
| 249 | Ga0207700_10012481 | 3300025928 | Bacteria | 5482 |
| 250 | Ga0207664_10002161 | 3300025929 | Bacteria | 12930 |
| 251 | Ga0207664_10032533 | 3300025929 | Bacteria | 3998 |
| 252 | Ga0207664_10051994 | 3300025929 | Bacteria | 3238 |
| 253 | Ga0207664_10064005 | 3300025929 | Bacteria | 2940 |
| 254 | Ga0207664_10077006 | 3300025929 | Bacteria | 2701 |
| 255 | Ga0207690_10000054 | 3300025932 | Bacteria | 104097 |
| 256 | Ga0207690_10102783 | 3300025932 | Bacteria | 2044 |
| 257 | Ga0207706_10068422 | 3300025933 | Bacteria | 3124 |
| 258 | Ga0207704_10011097 | 3300025938 | Bacteria | 4422 |
| 259 | Ga0207704_10051106 | 3300025938 | Bacteria | 2497 |
| 260 | Ga0207704_10103895 | 3300025938 | Bacteria | 1902 |
| 261 | Ga0207704_10137842 | 3300025938 | Bacteria | 1701 |
| 262 | Ga0207691_10096543 | 3300025940 | Bacteria | 2642 |
| 263 | Ga0207691_10098325 | 3300025940 | Bacteria | 2614 |
| 264 | Ga0207661_10003968 | 3300025944 | Bacteria | 10338 |
| 265 | Ga0207661_10060212 | 3300025944 | Bacteria | 3063 |
| 266 | Ga0207661_10124996 | 3300025944 | Bacteria | 2195 |
| 267 | Ga0207679_10014491 | 3300025945 | Bacteria | 5186 |
| 268 | Ga0207679_10072688 | 3300025945 | Bacteria | 2599 |
| 269 | Ga0207651_10069661 | 3300025960 | Bacteria | 2485 |
| 270 | Ga0207712_10051475 | 3300025961 | Bacteria | 2881 |
| 271 | Ga0207712_10055388 | 3300025961 | Bacteria | 2789 |
| 272 | Ga0207668_10070714 | 3300025972 | Bacteria | 2490 |
| 273 | Ga0207640_10096750 | 3300025981 | Bacteria | 2059 |
| 274 | Ga0207677_10049745 | 3300026023 | Bacteria | 2830 |
| 275 | Ga0207677_10077193 | 3300026023 | Bacteria | 2375 |
| 276 | Ga0207678_10002606 | 3300026067 | Bacteria | 16433 |
| 277 | Ga0207678_10082289 | 3300026067 | Bacteria | 2755 |
| 278 | Ga0207678_10088038 | 3300026067 | Bacteria | 2654 |
| 279 | Ga0207708_10001007 | 3300026075 | Bacteria | 21085 |
| 280 | Ga0207708_10006410 | 3300026075 | Bacteria | 8718 |
| 281 | Ga0207708_10028439 | 3300026075 | Bacteria | 4234 |
| 282 | Ga0207708_10191134 | 3300026075 | Bacteria | 1630 |
| 283 | Ga0207702_10085593 | 3300026078 | Bacteria | 2747 |
| 284 | Ga0207648_10148068 | 3300026089 | Bacteria | 2071 |
| 285 | Ga0207648_10196803 | 3300026089 | Bacteria | 1787 |
| 286 | Ga0207676_10032249 | 3300026095 | Bacteria | 3946 |
| 287 | Ga0207674_10023744 | 3300026116 | Bacteria | 6563 |
| 288 | Ga0207675_100101254 | 3300026118 | Bacteria | 2714 |
| 289 | Ga0207683_10034359 | 3300026121 | Bacteria | 4406 |
| 290 | Ga0207683_10096602 | 3300026121 | Bacteria | 2634 |
| 291 | Ga0207698_10200730 | 3300026142 | Bacteria | 1785 |
| 292 | Ga0209588_1002474 | 3300027671 | Bacteria | 5011 |
| 293 | Ga0207428_10057312 | 3300027907 | Bacteria | 3093 |
| 294 | Ga0207428_10161476 | 3300027907 | Bacteria | 1701 |
| 295 | Ga0207428_10167941 | 3300027907 | Bacteria | 1663 |
| 296 | Ga0268266_10004582 | 3300028379 | Bacteria | 13202 |
| 297 | Ga0265337_1001176 | 3300028556 | Bacteria | 13342 |
| 298 | Ga0265326_10000005 | 3300028558 | Bacteria | 257124 |
| 299 | Ga0265326_10002998 | 3300028558 | Bacteria | 5614 |
| 300 | Ga0265319_1000034 | 3300028563 | Bacteria | 117363 |
| 301 | Ga0265319_1000756 | 3300028563 | Bacteria | 21053 |
| 302 | Ga0265319_1001901 | 3300028563 | Bacteria | 11865 |
| 303 | Ga0265334_10000024 | 3300028573 | Bacteria | 118525 |
| 304 | Ga0265318_10000545 | 3300028577 | Bacteria | 26811 |
| 305 | Ga0265318_10001315 | 3300028577 | Bacteria | 14882 |
| 306 | Ga0265336_10000001 | 3300028666 | Bacteria | 916179 |
| 307 | Ga0265336_10006532 | 3300028666 | Bacteria | 4196 |
| 308 | Ga0265338_10000004 | 3300028800 | Bacteria | 644793 |
| 309 | Ga0265338_10006763 | 3300028800 | Bacteria | 14461 |
| 310 | Ga0265338_10008060 | 3300028800 | Bacteria | 12884 |
| 311 | Ga0265324_10001235 | 3300029957 | Bacteria | 15108 |
| 312 | Ga0265320_10015457 | 3300031240 | Bacteria | 4314 |
| 313 | Ga0265340_10000002 | 3300031247 | Bacteria | 711693 |
| 314 | Ga0265327_10002862 | 3300031251 | Bacteria | 17366 |
| 315 | Ga0265316_10030285 | 3300031344 | Bacteria | 4438 |
| 316 | Ga0307408_100052371 | 3300031548 | Bacteria | 2944 |
| 317 | Ga0307408_100140076 | 3300031548 | Bacteria | 1898 |
| 318 | Ga0265314_10004533 | 3300031711 | Bacteria | 12838 |
| 319 | Ga0307405_10054391 | 3300031731 | Bacteria | 2499 |
| 320 | Ga0307413_10111285 | 3300031824 | Bacteria | 1834 |
| 321 | Ga0307413_10139087 | 3300031824 | Bacteria | 1675 |
| 322 | Ga0307410_10014490 | 3300031852 | Bacteria | 4640 |
| 323 | Ga0307410_10253978 | 3300031852 | Bacteria | 1368 |
| 324 | Ga0307406_10017241 | 3300031901 | Bacteria | 4204 |
| 325 | Ga0307406_10029133 | 3300031901 | Bacteria | 3342 |
| 326 | Ga0307406_10078807 | 3300031901 | Bacteria | 2183 |
| 327 | Ga0307406_10104437 | 3300031901 | Bacteria | 1937 |
| 328 | Ga0307407_10004725 | 3300031903 | Bacteria | 5822 |
| 329 | Ga0307412_10114521 | 3300031911 | Bacteria | 1931 |
| 330 | Ga0307412_10160447 | 3300031911 | Bacteria | 1670 |
| 331 | Ga0307409_100011600 | 3300031995 | Bacteria | 5567 |
| 332 | Ga0307409_100063756 | 3300031995 | Bacteria | 2891 |
| 333 | Ga0307409_100101435 | 3300031995 | Bacteria | 2388 |
| 334 | Ga0307409_100186388 | 3300031995 | Bacteria | 1842 |
| 335 | Ga0307409_100358743 | 3300031995 | Bacteria | 1378 |
| 336 | Ga0307416_100006134 | 3300032002 | Bacteria | 7489 |
| 337 | Ga0307416_100040991 | 3300032002 | Bacteria | 3603 |
| 338 | Ga0307414_10123422 | 3300032004 | Bacteria | 1996 |
| 339 | Ga0307415_100000210 | 3300032126 | Bacteria | 25787 |
| 340 | Ga0307415_100044436 | 3300032126 | Bacteria | 2970 |
| 341 | Ga0307415_100065587 | 3300032126 | Bacteria | 2530 |
| 342 | Ga0307415_100076431 | 3300032126 | Bacteria | 2374 |
| 343 | Ga0373953_0007813 | 3300035117 | Bacteria | 3603 |
| 344 | Ga0373954_0022104 | 3300035118 | Bacteria | 2884 |
| 345 | Ga0395900_0002246 | 3300037418 | Bacteria | 21499 |
| 346 | Ga0395900_0137146 | 3300037418 | Bacteria | 2507 |
| 347 | Ga0395900_0165725 | 3300037418 | Bacteria | 2252 |
| 348 | Ga0395898_0003455 | 3300037466 | Bacteria | 17662 |
| 349 | Ga0395898_0010567 | 3300037466 | Bacteria | 9641 |
| 350 | Ga0395898_0091022 | 3300037466 | Bacteria | 2935 |
| 351 | Ga0395898_0122044 | 3300037466 | Bacteria | 2497 |
| 352 | Ga0395898_0158013 | 3300037466 | Bacteria | 2168 |
| 353 | Ga0395898_0283876 | 3300037466 | Bacteria | 1579 |
| 354 | Ga0395905_0023450 | 3300037471 | Bacteria | 5830 |
| 355 | Ga0395905_0053535 | 3300037471 | Bacteria | 3777 |
| 356 | Ga0395905_0146681 | 3300037471 | Bacteria | 2220 |
| 357 | Ga0436364_0031839 | 3300037853 | Bacteria | 3607 |
| 358 | Ga0436364_1122530 | 3300037853 | Bacteria | 16819 |
| 359 | Ga0436364_1438537 | 3300037853 | Bacteria | 5416 |
| 360 | Ga0395901_0006802 | 3300038443 | Bacteria | 11553 |
| 361 | Ga0395901_0057698 | 3300038443 | Bacteria | 4038 |
| 362 | Ga0395901_0077495 | 3300038443 | Bacteria | 3469 |
| 363 | Ga0395901_0212932 | 3300038443 | Bacteria | 2022 |
| 364 | Ga0395901_0381202 | 3300038443 | Bacteria | 1451 |
| 365 | Ga0436365_0403715 | 3300039437 | Bacteria | 17000 |
| 366 | Ga0436365_0808769 | 3300039437 | Bacteria | 1519 |
| 367 | Ga0436365_0863005 | 3300039437 | Bacteria | 1481 |
| 368 | Ga0436365_1102108 | 3300039437 | Bacteria | 21525 |
| 369 | Ga0436365_1468086 | 3300039437 | Bacteria | 9438 |
| 370 | Ga0436365_1725409 | 3300039437 | Bacteria | 5697 |
| 371 | Ga0436363_0386698 | 3300039450 | Bacteria | 5677 |
| 372 | Ga0436363_1064792 | 3300039450 | Bacteria | 6028 |
| 373 | Ga0436363_1110229 | 3300039450 | Bacteria | 1497 |
| 374 | Ga0436363_1400525 | 3300039450 | Bacteria | 18081 |
| 375 | Ga0436362_0352471 | 3300039453 | Bacteria | 2252 |
| 376 | Ga0436362_0637497 | 3300039453 | Bacteria | 2429 |
| 377 | Ga0436362_1195802 | 3300039453 | Bacteria | 1625 |
| 378 | Ga0439463_029393 | 3300042016 | Bacteria | 1384 |
| 379 | Ga0450902_012806 | 3300042137 | Bacteria | 1346 |
| 380 | Ga0453683_0044080 | 3300044673 | Bacteria | 2798 |
| 381 | Ga0453683_0130110 | 3300044673 | Bacteria | 1586 |
| 382 | Ga0466965_0021066 | 3300044683 | Bacteria | 3137 |
| 383 | Ga0466966_0022394 | 3300044684 | Bacteria | 4147 |
| 384 | Ga0466961_0017029 | 3300044693 | Bacteria | 4667 |
| 385 | Ga0466961_0022190 | 3300044693 | Bacteria | 4084 |
| 386 | Ga0466961_0042579 | 3300044693 | Bacteria | 2911 |
| 387 | Ga0466963_0008578 | 3300044694 | Bacteria | 6134 |
| 388 | Ga0466963_0009122 | 3300044694 | Bacteria | 5964 |
| 389 | Ga0466963_0015641 | 3300044694 | Bacteria | 4705 |
| 390 | Ga0466963_0017524 | 3300044694 | Bacteria | 4465 |
| 391 | Ga0466963_0017976 | 3300044694 | Bacteria | 4411 |
| 392 | Ga0466963_0033878 | 3300044694 | Bacteria | 3320 |
| 393 | Ga0466963_0040185 | 3300044694 | Bacteria | 3066 |
| 394 | Ga0466963_0124490 | 3300044694 | Bacteria | 1776 |
| 395 | Ga0453684_0008064 | 3300044712 | Bacteria | 19044 |
| 396 | Ga0466970_0024812 | 3300044765 | Bacteria | 3136 |
| 397 | Ga0466970_0025564 | 3300044765 | Bacteria | 3092 |
| 398 | Ga0466970_0040102 | 3300044765 | Bacteria | 2486 |
| 399 | Ga0466957_0060757 | 3300044842 | Bacteria | 2318 |
| 400 | Ga0466957_0079669 | 3300044842 | Bacteria | 2038 |
| 401 | Ga0466960_0029510 | 3300044901 | Bacteria | 2517 |
| 402 | Ga0466960_0040981 | 3300044901 | Bacteria | 2192 |
| 403 | Ga0466959_0001464 | 3300045049 | Bacteria | 14467 |
| 404 | Ga0466959_0006901 | 3300045049 | Bacteria | 7927 |
| 405 | Ga0466959_0014631 | 3300045049 | Bacteria | 5708 |
| 406 | Ga0466959_0057063 | 3300045049 | Bacteria | 2848 |
| 407 | Ga0466959_0202441 | 3300045049 | Bacteria | 1382 |
| 408 | Ga0451576_0415728 | 3300045051 | Bacteria | 1411 |
| 409 | Ga0466958_0001617 | 3300045836 | Bacteria | 10842 |
| 410 | Ga0466958_0005363 | 3300045836 | Bacteria | 6889 |
| 411 | Ga0466958_0015156 | 3300045836 | Bacteria | 4412 |
| 412 | Ga0466958_0021420 | 3300045836 | Bacteria | 3778 |
| 413 | Ga0466958_0081711 | 3300045836 | Bacteria | 1989 |
| 414 | Ga0466958_0084658 | 3300045836 | Bacteria | 1956 |
| 415 | Ga0466958_0112636 | 3300045836 | Bacteria | 1699 |
| 416 | Ga0466967_0001002 | 3300045976 | Bacteria | 15413 |
| 417 | Ga0466967_0004740 | 3300045976 | Bacteria | 9253 |
| 418 | Ga0466967_0040152 | 3300045976 | Bacteria | 4027 |
| 419 | Ga0466967_0066665 | 3300045976 | Bacteria | 3208 |
| 420 | Ga0466967_0081421 | 3300045976 | Bacteria | 2924 |
| 421 | Ga0466967_0086414 | 3300045976 | Bacteria | 2841 |
| 422 | Ga0466967_0144983 | 3300045976 | Bacteria | 2214 |
| 423 | Ga0466967_0226275 | 3300045976 | Bacteria | 1779 |
| 424 | Ga0466967_0294484 | 3300045976 | Bacteria | 1560 |
| 425 | Ga0466967_0325591 | 3300045976 | Bacteria | 1483 |
| 426 | Ga0495641_0006906 | 3300046461 | Bacteria | 7243 |
| 427 | Ga0495641_0026307 | 3300046461 | Bacteria | 2840 |
| 428 | Ga0495651_0010955 | 3300046462 | Bacteria | 6975 |
| 429 | Ga0495653_0000536 | 3300046463 | Bacteria | 29053 |
| 430 | Ga0495650_0000053 | 3300046471 | Bacteria | 316684 |
| 431 | Ga0495582_0071752 | 3300046473 | Bacteria | 1916 |
| 432 | Ga0495664_0000073 | 3300046477 | Bacteria | 49243 |
| 433 | Ga0495618_0000046 | 3300046514 | Bacteria | 93942 |
| 434 | Ga0495628_0186278 | 3300046516 | Bacteria | 1568 |
| 435 | Ga0495630_0000241 | 3300046517 | Bacteria | 43800 |
| 436 | Ga0495630_0147751 | 3300046517 | Bacteria | 1788 |
| 437 | Ga0495652_0055641 | 3300046529 | Bacteria | 3363 |
| 438 | Ga0495640_0176729 | 3300046533 | Bacteria | 1362 |
| 439 | Ga0495587_0026741 | 3300046536 | Bacteria | 3515 |
| 440 | Ga0495645_0000022 | 3300046543 | Bacteria | 137019 |
| 441 | Ga0495645_0000119 | 3300046543 | Bacteria | 53463 |
| 442 | Ga0495656_0008515 | 3300046615 | Bacteria | 3664 |
| 443 | Ga0495635_0011412 | 3300046663 | Bacteria | 6232 |
| 444 | Ga0495657_0000226 | 3300046675 | Bacteria | 50909 |
| 445 | Ga0495657_0010844 | 3300046675 | Bacteria | 6841 |
| 446 | Ga0495657_0116251 | 3300046675 | Bacteria | 1689 |
| 447 | Ga0495646_0040811 | 3300046680 | Bacteria | 2855 |
| 448 | Ga0495646_0050644 | 3300046680 | Bacteria | 2517 |
| 449 | Ga0495670_0068787 | 3300046691 | Bacteria | 1790 |
| 450 | Ga0495600_0058520 | 3300046809 | Bacteria | 2517 |
| 451 | Ga0495600_0085604 | 3300046809 | Bacteria | 2057 |
| 452 | Ga0495604_0000148 | 3300047317 | Bacteria | 60608 |
| 453 | Ga0495604_0020614 | 3300047317 | Bacteria | 5264 |
| 454 | Ga0495674_0015458 | 3300047319 | Bacteria | 7132 |
| 455 | Ga0495672_0027013 | 3300047320 | Bacteria | 3654 |
| 456 | Ga0495676_0071845 | 3300047321 | Bacteria | 2659 |
| 457 | Ga0495680_0003599 | 3300047322 | Bacteria | 15170 |
| 458 | Ga0495675_0027217 | 3300047444 | Bacteria | 3644 |
| 459 | Ga0495675_0078228 | 3300047444 | Bacteria | 2083 |
| 460 | Ga0495673_0012407 | 3300047469 | Bacteria | 4522 |
| 461 | Ga0495684_0004277 | 3300047471 | Bacteria | 11140 |
| 462 | Ga0495684_0011380 | 3300047471 | Bacteria | 6870 |
| 463 | Ga0495686_0000011 | 3300047472 | Bacteria | 514750 |
| 464 | Ga0495686_0002303 | 3300047472 | Bacteria | 18261 |
| 465 | Ga0495686_0025906 | 3300047472 | Bacteria | 3840 |
| 466 | Ga0495602_0027711 | 3300048088 | Bacteria | 5440 |
| 467 | Ga0495615_0015247 | 3300048090 | Bacteria | 1638 |
| 468 | Ga0496100_0000450 | 3300048903 | Bacteria | 19877 |
| 469 | Ga0496100_0001662 | 3300048903 | Bacteria | 11028 |
| 470 | Ga0496100_0015709 | 3300048903 | Bacteria | 4425 |
| 471 | Ga0496100_0144837 | 3300048903 | Bacteria | 1688 |
| 472 | Ga0496101_0001032 | 3300048904 | Bacteria | 16420 |
| 473 | Ga0496101_0001988 | 3300048904 | Bacteria | 12406 |
| 474 | Ga0496101_0011341 | 3300048904 | Bacteria | 5911 |
| 475 | Ga0496102_0000040 | 3300048905 | Bacteria | 196737 |
| 476 | Ga0496102_0008080 | 3300048905 | Bacteria | 9001 |
| 477 | Ga0496102_0008194 | 3300048905 | Bacteria | 8941 |
| 478 | Ga0496102_0012915 | 3300048905 | Bacteria | 7232 |
| 479 | Ga0496102_0071006 | 3300048905 | Bacteria | 3197 |
| 480 | Ga0496102_0095397 | 3300048905 | Bacteria | 2757 |
| 481 | Ga0496102_0227128 | 3300048905 | Bacteria | 1760 |
| 482 | Ga0496103_0000067 | 3300048906 | Bacteria | 125906 |
| 483 | Ga0496103_0001681 | 3300048906 | Bacteria | 14474 |
| 484 | Ga0496103_0007171 | 3300048906 | Bacteria | 6649 |
| 485 | Ga0496104_0000006 | 3300048907 | Bacteria | 536446 |
| 486 | Ga0496104_0013656 | 3300048907 | Bacteria | 7322 |
| 487 | Ga0496104_0018185 | 3300048907 | Bacteria | 6410 |
| 488 | Ga0496104_0033875 | 3300048907 | Bacteria | 4760 |
| 489 | Ga0496104_0066277 | 3300048907 | Bacteria | 3428 |
| 490 | Ga0496104_0066408 | 3300048907 | Bacteria | 3425 |
| 491 | Ga0496105_0005449 | 3300048908 | Bacteria | 9654 |
| 492 | Ga0496105_0014697 | 3300048908 | Bacteria | 6232 |
| 493 | Ga0496105_0095153 | 3300048908 | Bacteria | 2460 |
| 494 | Ga0496105_0109754 | 3300048908 | Bacteria | 2277 |
| 495 | Ga0496106_0009964 | 3300048909 | Bacteria | 7016 |
| 496 | Ga0496106_0015340 | 3300048909 | Bacteria | 5670 |
| 497 | Ga0496106_0015875 | 3300048909 | Bacteria | 5571 |
| 498 | Ga0496106_0027332 | 3300048909 | Bacteria | 4249 |
| 499 | Ga0496106_0111245 | 3300048909 | Bacteria | 2133 |
| 500 | Ga0496106_0128685 | 3300048909 | Bacteria | 1984 |
| 501 | Ga0496106_0164714 | 3300048909 | Bacteria | 1754 |
| 502 | Ga0496107_0002155 | 3300048910 | Bacteria | 12647 |
| 503 | Ga0496107_0012518 | 3300048910 | Bacteria | 5922 |
| 504 | Ga0496107_0038123 | 3300048910 | Bacteria | 3449 |
| 505 | Ga0496107_0061867 | 3300048910 | Bacteria | 2711 |
| 506 | Ga0496107_0124848 | 3300048910 | Bacteria | 1898 |
| 507 | Ga0496108_0002529 | 3300048911 | Bacteria | 14633 |
| 508 | Ga0496108_0004671 | 3300048911 | Bacteria | 11040 |
| 509 | Ga0496108_0012091 | 3300048911 | Bacteria | 7018 |
| 510 | Ga0496108_0013342 | 3300048911 | Bacteria | 6700 |
| 511 | Ga0496109_0002676 | 3300048912 | Bacteria | 14960 |
| 512 | Ga0496109_0007698 | 3300048912 | Bacteria | 9129 |
| 513 | Ga0496109_0008856 | 3300048912 | Bacteria | 8565 |
| 514 | Ga0496109_0011949 | 3300048912 | Bacteria | 7476 |
| 515 | Ga0496109_0019443 | 3300048912 | Bacteria | 5991 |
| 516 | Ga0496109_0028889 | 3300048912 | Bacteria | 4964 |
| 517 | Ga0496109_0089498 | 3300048912 | Bacteria | 2846 |
| 518 | Ga0496109_0133062 | 3300048912 | Bacteria | 2322 |
| 519 | Ga0496110_0000064 | 3300048913 | Bacteria | 52955 |
| 520 | Ga0496110_0001092 | 3300048913 | Bacteria | 19117 |
| 521 | Ga0496110_0006623 | 3300048913 | Bacteria | 9201 |
| 522 | Ga0496110_0022612 | 3300048913 | Bacteria | 5341 |
| 523 | Ga0496110_0038804 | 3300048913 | Bacteria | 4145 |
| 524 | Ga0496110_0086550 | 3300048913 | Bacteria | 2798 |
| 525 | Ga0496110_0094887 | 3300048913 | Bacteria | 2671 |
| 526 | Ga0496110_0156942 | 3300048913 | Bacteria | 2061 |
| 527 | Ga0496110_0168470 | 3300048913 | Bacteria | 1987 |
| 528 | Ga0496111_0002025 | 3300048914 | Bacteria | 12063 |
| 529 | Ga0496111_0012371 | 3300048914 | Bacteria | 5775 |
| 530 | Ga0496111_0052557 | 3300048914 | Bacteria | 2942 |
| 531 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 532 | Ga0496112_0000095 | 3300048915 | Bacteria | 57431 |
| 533 | Ga0496112_0005797 | 3300048915 | Bacteria | 10744 |
| 534 | Ga0496112_0020405 | 3300048915 | Bacteria | 6281 |
| 535 | Ga0496112_0053590 | 3300048915 | Bacteria | 3962 |
| 536 | Ga0496112_0089669 | 3300048915 | Bacteria | 3043 |
| 537 | Ga0496112_0292304 | 3300048915 | Bacteria | 1575 |
| 538 | Ga0496113_0030969 | 3300048916 | Bacteria | 3877 |
| 539 | Ga0496113_0066251 | 3300048916 | Bacteria | 2735 |
| 540 | Ga0496114_0010676 | 3300048917 | Bacteria | 7309 |
| 541 | Ga0496114_0070180 | 3300048917 | Bacteria | 2942 |
| 542 | Ga0496115_0000059 | 3300048918 | Bacteria | 102022 |
| 543 | Ga0496115_0000087 | 3300048918 | Bacteria | 86513 |
| 544 | Ga0496115_0005651 | 3300048918 | Bacteria | 9094 |
| 545 | Ga0496115_0010330 | 3300048918 | Bacteria | 6970 |
| 546 | Ga0496115_0074997 | 3300048918 | Bacteria | 2747 |
| 547 | Ga0496115_0205368 | 3300048918 | Bacteria | 1627 |
| 548 | Ga0496117_0039569 | 3300048920 | Bacteria | 3478 |
| 549 | Ga0496119_0066705 | 3300048922 | Bacteria | 2125 |
| 550 | Ga0496121_0002770 | 3300048924 | Bacteria | 26007 |
| 551 | Ga0496121_0101083 | 3300048924 | Bacteria | 2224 |
| 552 | Ga0496124_0115740 | 3300048927 | Bacteria | 2151 |
| 553 | Ga0501031_0008936 | 3300049568 | Bacteria | 6514 |
| 554 | Ga0501032_0004500 | 3300049569 | Bacteria | 10493 |
| 555 | Ga0501032_0068591 | 3300049569 | Bacteria | 2367 |
| 556 | Ga0501033_0121690 | 3300049570 | Bacteria | 1893 |
| 557 | Ga0501034_0008091 | 3300049571 | Bacteria | 11153 |
| 558 | Ga0501034_0050215 | 3300049571 | Bacteria | 4207 |
| 559 | Ga0501036_0052553 | 3300049572 | Bacteria | 3450 |
| 560 | Ga0501036_0058695 | 3300049572 | Bacteria | 3260 |
| 561 | Ga0501037_0118634 | 3300049573 | Bacteria | 1903 |
| 562 | Ga0501038_0005589 | 3300049574 | Bacteria | 11667 |
| 563 | Ga0501038_0046400 | 3300049574 | Bacteria | 3767 |
| 564 | Ga0501039_0068499 | 3300049575 | Bacteria | 2755 |
| 565 | Ga0501039_0078652 | 3300049575 | Bacteria | 2565 |
| 566 | Ga0501040_0010625 | 3300049576 | Bacteria | 6021 |
| 567 | Ga0501040_0223522 | 3300049576 | Bacteria | 1340 |
| 568 | Ga0501041_0086372 | 3300049577 | Bacteria | 1935 |
| 569 | Ga0501042_0025820 | 3300049578 | Bacteria | 4128 |
| 570 | Ga0501042_0104931 | 3300049578 | Bacteria | 2034 |
| 571 | Ga0501042_0160550 | 3300049578 | Bacteria | 1622 |
| 572 | Ga0501046_0002368 | 3300049580 | Bacteria | 17730 |
| 573 | Ga0501046_0062823 | 3300049580 | Bacteria | 2901 |
| 574 | Ga0501048_0015968 | 3300049582 | Bacteria | 5539 |
| 575 | Ga0501048_0046630 | 3300049582 | Bacteria | 3093 |
| 576 | Ga0501067_0081330 | 3300049583 | Bacteria | 1796 |
| 577 | Ga0501068_0022156 | 3300049584 | Bacteria | 3712 |
| 578 | Ga0501069_0001600 | 3300049585 | Bacteria | 11199 |
| 579 | Ga0501069_0057514 | 3300049585 | Bacteria | 2168 |
| 580 | Ga0501070_0041608 | 3300049586 | Bacteria | 3827 |
| 581 | Ga0501070_0072465 | 3300049586 | Bacteria | 2851 |
| 582 | Ga0501071_0177665 | 3300049587 | Bacteria | 1595 |
| 583 | Ga0501072_0014927 | 3300049588 | Bacteria | 5953 |
| 584 | Ga0501072_0016803 | 3300049588 | Bacteria | 5620 |
| 585 | Ga0501072_0037754 | 3300049588 | Bacteria | 3789 |
| 586 | Ga0501072_0156522 | 3300049588 | Bacteria | 1817 |
| 587 | Ga0501073_0007298 | 3300049589 | Bacteria | 8226 |
| 588 | Ga0501073_0179281 | 3300049589 | Bacteria | 1466 |
| 589 | Ga0501074_0108291 | 3300049590 | Bacteria | 1989 |
| 590 | Ga0501074_0156252 | 3300049590 | Bacteria | 1629 |
| 591 | Ga0501075_0022561 | 3300049591 | Bacteria | 4599 |
| 592 | Ga0501075_0136751 | 3300049591 | Bacteria | 1867 |
| 593 | Ga0501077_0117980 | 3300049593 | Bacteria | 1682 |
| 594 | Ga0501079_0167108 | 3300049741 | Bacteria | 1716 |
| 595 | Ga0501080_0012732 | 3300049742 | Bacteria | 7715 |
| 596 | Ga0501083_0021160 | 3300049744 | Bacteria | 4520 |
| 597 | Ga0501035_0023094 | 3300049822 | Bacteria | 5708 |
| 598 | Ga0501044_0222036 | 3300049823 | Bacteria | 1840 |
| 599 | Ga0501045_0010013 | 3300049824 | Bacteria | 6631 |
| 600 | Ga0501045_0067104 | 3300049824 | Bacteria | 2634 |
| 601 | Ga0501045_0162393 | 3300049824 | Bacteria | 1663 |
| 602 | nmdc:mga00v17_14935_c1 | 3300050491 | Bacteria | 4348 |
| 603 | nmdc:mga00v17_24681_c1 | 3300050491 | Bacteria | 3488 |
| 604 | nmdc:mga0yw44_182971_c1 | 3300050492 | Bacteria | 1380 |
| 605 | nmdc:mga0yw44_212097_c1 | 3300050492 | Bacteria | 1281 |
| 606 | nmdc:mga0yw44_92281_c1 | 3300050492 | Bacteria | 1916 |
| 607 | nmdc:mga06z11_12937_c1 | 3300050494 | Bacteria | 3645 |
| 608 | nmdc:mga06z11_25263_c1 | 3300050494 | Bacteria | 2813 |
| 609 | nmdc:mga05p37_145196_c1 | 3300050507 | Bacteria | 2906 |
| 610 | nmdc:mga05p37_223964_c1 | 3300050507 | Bacteria | 2269 |
| 611 | nmdc:mga05p37_39026_c1 | 3300050507 | Bacteria | 5826 |
| 612 | nmdc:mga05p37_820_c1 | 3300050507 | Bacteria | 34830 |
| 613 | nmdc:mga09592_128396_c1 | 3300050508 | Bacteria | 2180 |
| 614 | nmdc:mga09592_14752_c1 | 3300050508 | Bacteria | 6376 |
| 615 | nmdc:mga09592_39660_c1 | 3300050508 | Bacteria | 3956 |
| 616 | nmdc:mga0qj67_1947_c1 | 3300050509 | Bacteria | 14696 |
| 617 | nmdc:mga0qj67_241736_c1 | 3300050509 | Bacteria | 1465 |
| 618 | nmdc:mga0qj67_47848_c1 | 3300050509 | Bacteria | 3379 |
| 619 | nmdc:mga0qj67_64600_c1 | 3300050509 | Bacteria | 2912 |
| 620 | nmdc:mga0qj67_77597_c1 | 3300050509 | Bacteria | 2658 |
| 621 | nmdc:mga06r32_1211_c1 | 3300050510 | Bacteria | 23236 |
| 622 | nmdc:mga06r32_7689_c1 | 3300050510 | Bacteria | 9695 |
| 623 | nmdc:mga08y16_161822_c1 | 3300050511 | Bacteria | 2326 |
| 624 | nmdc:mga08y16_22098_c1 | 3300050511 | Bacteria | 6716 |
| 625 | nmdc:mga0n895_149931_c1 | 3300050512 | Bacteria | 2362 |
| 626 | nmdc:mga0n895_322636_c1 | 3300050512 | Bacteria | 1565 |
| 627 | nmdc:mga0n895_379387_c1 | 3300050512 | Bacteria | 1431 |
| 628 | nmdc:mga0n895_48912_c1 | 3300050512 | Bacteria | 4141 |
| 629 | nmdc:mga0rr50_24371_c1 | 3300050513 | Bacteria | 4189 |
| 630 | nmdc:mga0a205_21039_c1 | 3300050515 | Bacteria | 6167 |
| 631 | nmdc:mga0a205_34741_c1 | 3300050515 | Bacteria | 4838 |
| 632 | nmdc:mga0a205_50302_c1 | 3300050515 | Bacteria | 4023 |
| 633 | nmdc:mga0sz30_41416_c1 | 3300050516 | Bacteria | 1936 |
| 634 | Ga0495601_0001152 | 3300053077 | Bacteria | 14446 |
| 635 | Ga0495601_0013587 | 3300053077 | Bacteria | 4898 |
| 636 | Ga0495612_0000032 | 3300053078 | Bacteria | 78122 |
| 637 | Ga0495595_0048126 | 3300053084 | Bacteria | 1968 |
| 638 | Ga0495619_0018953 | 3300053085 | Bacteria | 4370 |
| 639 | Ga0500556_0000262 | 3300053104 | Bacteria | 41714 |
| 640 | Ga0500616_0004560 | 3300053153 | Bacteria | 9808 |
| 641 | Ga0500616_0006584 | 3300053153 | Bacteria | 7574 |
| 642 | Ga0501084_0033542 | 3300054114 | Bacteria | 4295 |
| 643 | Ga0501084_0063159 | 3300054114 | Bacteria | 3100 |
| 644 | Ga0501082_0022434 | 3300060353 | Bacteria | 5437 |
| 645 | Ga0466962_0039153 | 3300061719 | Bacteria | 2270 |
| 646 | Ga0530510_0008178 | 3300061734 | Bacteria | 7296 |
| 647 | Ga0530510_0029873 | 3300061734 | Bacteria | 3913 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049576 | Ga0501040_0223522 | Ga0501040_0223522_29_1141 | 370 |
| 2 | 3300005468 | Ga0070707_100097487 | Ga0070707_1000974873 | 380 |
| 3 | 3300005471 | Ga0070698_100004594 | Ga0070698_10000459411 | 380 |
| 4 | 3300025922 | Ga0207646_10009069 | Ga0207646_1000906910 | 380 |
| 5 | 3300025922 | Ga0207646_10022289 | Ga0207646_100222897 | 380 |
| 6 | 3300042137 | Ga0450902_012806 | Ga0450902_012806_11_1153 | 380 |
| 7 | 3300050494 | nmdc:mga06z11_12937_c1 | nmdc:mga06z11_12937_c1_1391_2545 | 384 |
| 8 | 3300050507 | nmdc:mga05p37_223964_c1 | nmdc:mga05p37_223964_c1_1075_2229 | 384 |
| 9 | 3300050512 | nmdc:mga0n895_379387_c1 | nmdc:mga0n895_379387_c1_262_1416 | 384 |
| 10 | 3300005329 | Ga0070683_100047627 | Ga0070683_1000476272 | 385 |
| 11 | 3300005338 | Ga0068868_100016295 | Ga0068868_1000162953 | 385 |
| 12 | 3300005441 | Ga0070700_100000631 | Ga0070700_10000063112 | 385 |
| 13 | 3300005456 | Ga0070678_100096589 | Ga0070678_1000965892 | 385 |
| 14 | 3300005466 | Ga0070685_10116319 | Ga0070685_101163192 | 385 |
| 15 | 3300005535 | Ga0070684_100001176 | Ga0070684_10000117614 | 385 |
| 16 | 3300005549 | Ga0070704_100225164 | Ga0070704_1002251642 | 385 |
| 17 | 3300005564 | Ga0070664_100019045 | Ga0070664_1000190454 | 385 |
| 18 | 3300005614 | Ga0068856_100020258 | Ga0068856_1000202583 | 385 |
| 19 | 3300005615 | Ga0070702_100009653 | Ga0070702_1000096536 | 385 |
| 20 | 3300005981 | Ga0081538_10005403 | Ga0081538_100054032 | 385 |
| 21 | 3300006847 | Ga0075431_100008379 | Ga0075431_10000837910 | 385 |
| 22 | 3300006852 | Ga0075433_10059643 | Ga0075433_100596435 | 385 |
| 23 | 3300009094 | Ga0111539_10304231 | Ga0111539_103042312 | 385 |
| 24 | 3300009098 | Ga0105245_10031336 | Ga0105245_100313366 | 385 |
| 25 | 3300009147 | Ga0114129_10000512 | Ga0114129_1000051226 | 385 |
| 26 | 3300013296 | Ga0157374_10015146 | Ga0157374_100151464 | 385 |
| 27 | 3300013307 | Ga0157372_10018103 | Ga0157372_100181034 | 385 |
| 28 | 3300014325 | Ga0163163_10066084 | Ga0163163_100660841 | 385 |
| 29 | 3300025901 | Ga0207688_10009130 | Ga0207688_100091305 | 385 |
| 30 | 3300025915 | Ga0207693_10017236 | Ga0207693_100172364 | 385 |
| 31 | 3300025927 | Ga0207687_10018790 | Ga0207687_100187905 | 385 |
| 32 | 3300025940 | Ga0207691_10096543 | Ga0207691_100965433 | 385 |
| 33 | 3300025945 | Ga0207679_10014491 | Ga0207679_100144913 | 385 |
| 34 | 3300025961 | Ga0207712_10055388 | Ga0207712_100553883 | 385 |
| 35 | 3300025972 | Ga0207668_10070714 | Ga0207668_100707142 | 385 |
| 36 | 3300026067 | Ga0207678_10088038 | Ga0207678_100880383 | 385 |
| 37 | 3300026095 | Ga0207676_10032249 | Ga0207676_100322493 | 385 |
| 38 | 3300044765 | Ga0466970_0025564 | Ga0466970_0025564_687_1862 | 385 |
| 39 | 3300046533 | Ga0495640_0176729 | Ga0495640_0176729_177_1352 | 385 |
| 40 | 3300046809 | Ga0495600_0085604 | Ga0495600_0085604_51_1235 | 385 |
| 41 | 3300048904 | Ga0496101_0011341 | Ga0496101_0011341_2247_3482 | 385 |
| 42 | 3300048905 | Ga0496102_0008194 | Ga0496102_0008194_5780_7015 | 385 |
| 43 | 3300048906 | Ga0496103_0007171 | Ga0496103_0007171_4282_5517 | 385 |
| 44 | 3300048907 | Ga0496104_0018185 | Ga0496104_0018185_2958_4193 | 385 |
| 45 | 3300048908 | Ga0496105_0014697 | Ga0496105_0014697_2295_3530 | 385 |
| 46 | 3300048910 | Ga0496107_0061867 | Ga0496107_0061867_196_1431 | 385 |
| 47 | 3300048911 | Ga0496108_0012091 | Ga0496108_0012091_1207_2442 | 385 |
| 48 | 3300048912 | Ga0496109_0002676 | Ga0496109_0002676_4065_5300 | 385 |
| 49 | 3300048913 | Ga0496110_0038804 | Ga0496110_0038804_719_1954 | 385 |
| 50 | 3300048914 | Ga0496111_0012371 | Ga0496111_0012371_1207_2442 | 385 |
| 51 | 3300048916 | Ga0496113_0030969 | Ga0496113_0030969_1108_2343 | 385 |
| 52 | 3300049571 | Ga0501034_0050215 | Ga0501034_0050215_15_1172 | 385 |
| 53 | 3300049574 | Ga0501038_0046400 | Ga0501038_0046400_540_1748 | 385 |
| 54 | 3300050507 | nmdc:mga05p37_39026_c1 | nmdc:mga05p37_39026_c1_2119_3357 | 385 |
| 55 | 3300050510 | nmdc:mga06r32_7689_c1 | nmdc:mga06r32_7689_c1_110_1336 | 385 |
| 56 | 3300050512 | nmdc:mga0n895_48912_c1 | nmdc:mga0n895_48912_c1_2288_3526 | 385 |
| 57 | 3300050513 | nmdc:mga0rr50_24371_c1 | nmdc:mga0rr50_24371_c1_1360_2586 | 385 |
| 58 | 3300050515 | nmdc:mga0a205_21039_c1 | nmdc:mga0a205_21039_c1_3755_4993 | 385 |
| 59 | 3300050515 | nmdc:mga0a205_34741_c1 | nmdc:mga0a205_34741_c1_3575_4801 | 385 |
| 60 | 3300005347 | Ga0070668_100103180 | Ga0070668_1001031803 | 387 |
| 61 | 3300005445 | Ga0070708_100002979 | Ga0070708_1000029796 | 387 |
| 62 | 3300005467 | Ga0070706_100013061 | Ga0070706_1000130614 | 387 |
| 63 | 3300005468 | Ga0070707_100041753 | Ga0070707_1000417533 | 387 |
| 64 | 3300005468 | Ga0070707_100063408 | Ga0070707_1000634083 | 387 |
| 65 | 3300005471 | Ga0070698_100085654 | Ga0070698_1000856543 | 387 |
| 66 | 3300005536 | Ga0070697_100218035 | Ga0070697_1002180352 | 387 |
| 67 | 3300005985 | Ga0081539_10015822 | Ga0081539_100158226 | 387 |
| 68 | 3300006846 | Ga0075430_100003824 | Ga0075430_1000038246 | 387 |
| 69 | 3300006871 | Ga0075434_100021293 | Ga0075434_1000212934 | 387 |
| 70 | 3300006880 | Ga0075429_100000966 | Ga0075429_1000009669 | 387 |
| 71 | 3300006914 | Ga0075436_100081174 | Ga0075436_1000811743 | 387 |
| 72 | 3300007076 | Ga0075435_100093605 | Ga0075435_1000936053 | 387 |
| 73 | 3300007265 | Ga0099794_10001527 | Ga0099794_100015277 | 387 |
| 74 | 3300009148 | Ga0105243_10084792 | Ga0105243_100847922 | 387 |
| 75 | 3300025910 | Ga0207684_10042309 | Ga0207684_100423096 | 387 |
| 76 | 3300025922 | Ga0207646_10005170 | Ga0207646_1000517015 | 387 |
| 77 | 3300025922 | Ga0207646_10044341 | Ga0207646_100443414 | 387 |
| 78 | 3300027671 | Ga0209588_1002474 | Ga0209588_10024746 | 387 |
| 79 | 3300044673 | Ga0453683_0044080 | Ga0453683_0044080_148_1326 | 387 |
| 80 | 3300044673 | Ga0453683_0130110 | Ga0453683_0130110_313_1491 | 387 |
| 81 | 3300045051 | Ga0451576_0415728 | Ga0451576_0415728_67_1245 | 387 |
| 82 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_500435_501667 | 387 |
| 83 | 3300048915 | Ga0496112_0053590 | Ga0496112_0053590_1239_2513 | 387 |
| 84 | 3300049741 | Ga0501079_0167108 | Ga0501079_0167108_50_1291 | 387 |
| 85 | 3300049823 | Ga0501044_0222036 | Ga0501044_0222036_71_1378 | 387 |
| 86 | 3300050508 | nmdc:mga09592_39660_c1 | nmdc:mga09592_39660_c1_2558_3799 | 387 |
| 87 | 3300050509 | nmdc:mga0qj67_64600_c1 | nmdc:mga0qj67_64600_c1_1081_2322 | 387 |
| 88 | 3300005295 | Ga0065707_10000837 | Ga0065707_1000083710 | 388 |
| 89 | 3300005445 | Ga0070708_100014784 | Ga0070708_1000147847 | 388 |
| 90 | 3300005467 | Ga0070706_100000475 | Ga0070706_10000047524 | 388 |
| 91 | 3300005467 | Ga0070706_100129943 | Ga0070706_1001299431 | 388 |
| 92 | 3300005471 | Ga0070698_100101116 | Ga0070698_1001011163 | 388 |
| 93 | 3300005518 | Ga0070699_100003450 | Ga0070699_1000034504 | 388 |
| 94 | 3300005536 | Ga0070697_100000022 | Ga0070697_1000000227 | 388 |
| 95 | 3300005536 | Ga0070697_100027025 | Ga0070697_1000270254 | 388 |
| 96 | 3300006028 | Ga0070717_10011753 | Ga0070717_100117537 | 388 |
| 97 | 3300006178 | Ga0075367_10041648 | Ga0075367_100416483 | 388 |
| 98 | 3300009147 | Ga0114129_10159354 | Ga0114129_101593543 | 388 |
| 99 | 3300025910 | Ga0207684_10001451 | Ga0207684_100014517 | 388 |
| 100 | 3300025910 | Ga0207684_10028200 | Ga0207684_100282004 | 388 |
| 101 | 3300025910 | Ga0207684_10037343 | Ga0207684_100373433 | 388 |
| 102 | 3300025922 | Ga0207646_10001394 | Ga0207646_1000139415 | 388 |
| 103 | 3300025922 | Ga0207646_10025575 | Ga0207646_100255755 | 388 |
| 104 | 3300044712 | Ga0453684_0008064 | Ga0453684_0008064_15112_16344 | 388 |
| 105 | 3300048920 | Ga0496117_0039569 | Ga0496117_0039569_1430_2638 | 388 |
| 106 | 3300049576 | Ga0501040_0010625 | Ga0501040_0010625_1723_2988 | 388 |
| 107 | 3300049577 | Ga0501041_0086372 | Ga0501041_0086372_187_1452 | 388 |
| 108 | 3300049580 | Ga0501046_0062823 | Ga0501046_0062823_652_1917 | 388 |
| 109 | 3300049582 | Ga0501048_0046630 | Ga0501048_0046630_465_1730 | 388 |
| 110 | 3300049588 | Ga0501072_0014927 | Ga0501072_0014927_3841_5106 | 388 |
| 111 | 3300049593 | Ga0501077_0117980 | Ga0501077_0117980_400_1665 | 388 |
| 112 | 3300049824 | Ga0501045_0010013 | Ga0501045_0010013_1233_2498 | 388 |
| 113 | 3300050492 | nmdc:mga0yw44_182971_c1 | nmdc:mga0yw44_182971_c1_136_1332 | 388 |
| 114 | 3300054114 | Ga0501084_0033542 | Ga0501084_0033542_1691_2956 | 388 |
| 115 | 3300054114 | Ga0501084_0063159 | Ga0501084_0063159_709_1938 | 388 |
| 116 | 3300003373 | JGI25407J50210_10008207 | JGI25407J50210_100082073 | 389 |
| 117 | 3300005345 | Ga0070692_10038048 | Ga0070692_100380483 | 389 |
| 118 | 3300005356 | Ga0070674_100050758 | Ga0070674_1000507583 | 389 |
| 119 | 3300005440 | Ga0070705_100100311 | Ga0070705_1001003111 | 389 |
| 120 | 3300005457 | Ga0070662_100099976 | Ga0070662_1000999762 | 389 |
| 121 | 3300005459 | Ga0068867_100035702 | Ga0068867_1000357024 | 389 |
| 122 | 3300005539 | Ga0068853_100197766 | Ga0068853_1001977662 | 389 |
| 123 | 3300005549 | Ga0070704_100051844 | Ga0070704_1000518443 | 389 |
| 124 | 3300005615 | Ga0070702_100021251 | Ga0070702_1000212514 | 389 |
| 125 | 3300005617 | Ga0068859_100242594 | Ga0068859_1002425942 | 389 |
| 126 | 3300005618 | Ga0068864_100133680 | Ga0068864_1001336802 | 389 |
| 127 | 3300005981 | Ga0081538_10000071 | Ga0081538_1000007155 | 389 |
| 128 | 3300005983 | Ga0081540_1000568 | Ga0081540_100056818 | 389 |
| 129 | 3300005983 | Ga0081540_1000941 | Ga0081540_100094121 | 389 |
| 130 | 3300005983 | Ga0081540_1037240 | Ga0081540_10372402 | 389 |
| 131 | 3300005985 | Ga0081539_10005444 | Ga0081539_1000544410 | 389 |
| 132 | 3300006852 | Ga0075433_10091152 | Ga0075433_100911522 | 389 |
| 133 | 3300006931 | Ga0097620_100242599 | Ga0097620_1002425992 | 389 |
| 134 | 3300009094 | Ga0111539_10063618 | Ga0111539_100636186 | 389 |
| 135 | 3300009101 | Ga0105247_10056759 | Ga0105247_100567593 | 389 |
| 136 | 3300009148 | Ga0105243_10078327 | Ga0105243_100783273 | 389 |
| 137 | 3300009176 | Ga0105242_10098001 | Ga0105242_100980011 | 389 |
| 138 | 3300009177 | Ga0105248_10453998 | Ga0105248_104539982 | 389 |
| 139 | 3300010375 | Ga0105239_10233055 | Ga0105239_102330552 | 389 |
| 140 | 3300014325 | Ga0163163_10122010 | Ga0163163_101220102 | 389 |
| 141 | 3300014968 | Ga0157379_10003167 | Ga0157379_1000316718 | 389 |
| 142 | 3300014969 | Ga0157376_10195706 | Ga0157376_101957062 | 389 |
| 143 | 3300025321 | Ga0207656_10013585 | Ga0207656_100135852 | 389 |
| 144 | 3300025900 | Ga0207710_10077258 | Ga0207710_100772581 | 389 |
| 145 | 3300025923 | Ga0207681_10135774 | Ga0207681_101357742 | 389 |
| 146 | 3300025960 | Ga0207651_10069661 | Ga0207651_100696611 | 389 |
| 147 | 3300025961 | Ga0207712_10051475 | Ga0207712_100514752 | 389 |
| 148 | 3300026023 | Ga0207677_10049745 | Ga0207677_100497453 | 389 |
| 149 | 3300026075 | Ga0207708_10191134 | Ga0207708_101911342 | 389 |
| 150 | 3300026078 | Ga0207702_10085593 | Ga0207702_100855933 | 389 |
| 151 | 3300026089 | Ga0207648_10196803 | Ga0207648_101968032 | 389 |
| 152 | 3300026121 | Ga0207683_10096602 | Ga0207683_100966023 | 389 |
| 153 | 3300027907 | Ga0207428_10161476 | Ga0207428_101614762 | 389 |
| 154 | 3300037418 | Ga0395900_0137146 | Ga0395900_0137146_760_2031 | 389 |
| 155 | 3300037418 | Ga0395900_0165725 | Ga0395900_0165725_91_1398 | 389 |
| 156 | 3300037466 | Ga0395898_0158013 | Ga0395898_0158013_259_1524 | 389 |
| 157 | 3300037466 | Ga0395898_0283876 | Ga0395898_0283876_116_1423 | 389 |
| 158 | 3300038443 | Ga0395901_0057698 | Ga0395901_0057698_571_1836 | 389 |
| 159 | 3300038443 | Ga0395901_0077495 | Ga0395901_0077495_1746_3053 | 389 |
| 160 | 3300038443 | Ga0395901_0381202 | Ga0395901_0381202_145_1419 | 389 |
| 161 | 3300044693 | Ga0466961_0042579 | Ga0466961_0042579_193_1425 | 389 |
| 162 | 3300044694 | Ga0466963_0033878 | Ga0466963_0033878_2010_3251 | 389 |
| 163 | 3300044901 | Ga0466960_0029510 | Ga0466960_0029510_990_2243 | 389 |
| 164 | 3300044901 | Ga0466960_0040981 | Ga0466960_0040981_89_1345 | 389 |
| 165 | 3300045049 | Ga0466959_0057063 | Ga0466959_0057063_1227_2459 | 389 |
| 166 | 3300045976 | Ga0466967_0226275 | Ga0466967_0226275_391_1644 | 389 |
| 167 | 3300045976 | Ga0466967_0294484 | Ga0466967_0294484_267_1520 | 389 |
| 168 | 3300046471 | Ga0495650_0000053 | Ga0495650_0000053_135066_136319 | 389 |
| 169 | 3300046680 | Ga0495646_0050644 | Ga0495646_0050644_894_2108 | 389 |
| 170 | 3300046691 | Ga0495670_0068787 | Ga0495670_0068787_239_1546 | 389 |
| 171 | 3300048903 | Ga0496100_0001662 | Ga0496100_0001662_3704_4960 | 389 |
| 172 | 3300048903 | Ga0496100_0144837 | Ga0496100_0144837_258_1505 | 389 |
| 173 | 3300048904 | Ga0496101_0001988 | Ga0496101_0001988_4663_5919 | 389 |
| 174 | 3300048905 | Ga0496102_0071006 | Ga0496102_0071006_387_1643 | 389 |
| 175 | 3300048905 | Ga0496102_0227128 | Ga0496102_0227128_157_1422 | 389 |
| 176 | 3300048907 | Ga0496104_0013656 | Ga0496104_0013656_3799_5046 | 389 |
| 177 | 3300048908 | Ga0496105_0095153 | Ga0496105_0095153_896_2143 | 389 |
| 178 | 3300048908 | Ga0496105_0109754 | Ga0496105_0109754_583_1848 | 389 |
| 179 | 3300048909 | Ga0496106_0015340 | Ga0496106_0015340_2942_4189 | 389 |
| 180 | 3300048909 | Ga0496106_0015875 | Ga0496106_0015875_3525_4781 | 389 |
| 181 | 3300048909 | Ga0496106_0164714 | Ga0496106_0164714_343_1590 | 389 |
| 182 | 3300048910 | Ga0496107_0002155 | Ga0496107_0002155_6418_7674 | 389 |
| 183 | 3300048911 | Ga0496108_0002529 | Ga0496108_0002529_6124_7371 | 389 |
| 184 | 3300048912 | Ga0496109_0007698 | Ga0496109_0007698_1307_2554 | 389 |
| 185 | 3300048912 | Ga0496109_0011949 | Ga0496109_0011949_3004_4233 | 389 |
| 186 | 3300048912 | Ga0496109_0089498 | Ga0496109_0089498_328_1575 | 389 |
| 187 | 3300048913 | Ga0496110_0001092 | Ga0496110_0001092_2137_3384 | 389 |
| 188 | 3300048913 | Ga0496110_0094887 | Ga0496110_0094887_1269_2498 | 389 |
| 189 | 3300048913 | Ga0496110_0156942 | Ga0496110_0156942_393_1646 | 389 |
| 190 | 3300048914 | Ga0496111_0052557 | Ga0496111_0052557_950_2203 | 389 |
| 191 | 3300048915 | Ga0496112_0020405 | Ga0496112_0020405_4806_6071 | 389 |
| 192 | 3300048915 | Ga0496112_0292304 | Ga0496112_0292304_267_1520 | 389 |
| 193 | 3300048917 | Ga0496114_0070180 | Ga0496114_0070180_120_1376 | 389 |
| 194 | 3300048918 | Ga0496115_0005651 | Ga0496115_0005651_1931_3187 | 389 |
| 195 | 3300048918 | Ga0496115_0205368 | Ga0496115_0205368_145_1392 | 389 |
| 196 | 3300048922 | Ga0496119_0066705 | Ga0496119_0066705_654_1904 | 389 |
| 197 | 3300048924 | Ga0496121_0101083 | Ga0496121_0101083_493_1740 | 389 |
| 198 | 3300049571 | Ga0501034_0008091 | Ga0501034_0008091_6984_8240 | 389 |
| 199 | 3300049583 | Ga0501067_0081330 | Ga0501067_0081330_73_1320 | 389 |
| 200 | 3300050515 | nmdc:mga0a205_50302_c1 | nmdc:mga0a205_50302_c1_2087_3334 | 389 |
| 201 | 3300053153 | Ga0500616_0004560 | Ga0500616_0004560_2549_3802 | 389 |
| 202 | 3300005329 | Ga0070683_100092454 | Ga0070683_1000924543 | 390 |
| 203 | 3300005337 | Ga0070682_100050461 | Ga0070682_1000504612 | 390 |
| 204 | 3300005338 | Ga0068868_100101654 | Ga0068868_1001016542 | 390 |
| 205 | 3300005339 | Ga0070660_100001669 | Ga0070660_1000016695 | 390 |
| 206 | 3300005339 | Ga0070660_100010862 | Ga0070660_1000108627 | 390 |
| 207 | 3300005340 | Ga0070689_100215807 | Ga0070689_1002158072 | 390 |
| 208 | 3300005347 | Ga0070668_100030302 | Ga0070668_1000303022 | 390 |
| 209 | 3300005354 | Ga0070675_100029576 | Ga0070675_1000295763 | 390 |
| 210 | 3300005354 | Ga0070675_100164686 | Ga0070675_1001646862 | 390 |
| 211 | 3300005356 | Ga0070674_100007826 | Ga0070674_1000078265 | 390 |
| 212 | 3300005366 | Ga0070659_100000176 | Ga0070659_10000017637 | 390 |
| 213 | 3300005434 | Ga0070709_10047160 | Ga0070709_100471603 | 390 |
| 214 | 3300005435 | Ga0070714_100143661 | Ga0070714_1001436613 | 390 |
| 215 | 3300005435 | Ga0070714_100147513 | Ga0070714_1001475132 | 390 |
| 216 | 3300005436 | Ga0070713_100067152 | Ga0070713_1000671523 | 390 |
| 217 | 3300005436 | Ga0070713_100080382 | Ga0070713_1000803822 | 390 |
| 218 | 3300005437 | Ga0070710_10000013 | Ga0070710_1000001324 | 390 |
| 219 | 3300005439 | Ga0070711_100006050 | Ga0070711_1000060504 | 390 |
| 220 | 3300005439 | Ga0070711_100020020 | Ga0070711_1000200203 | 390 |
| 221 | 3300005440 | Ga0070705_100029146 | Ga0070705_1000291463 | 390 |
| 222 | 3300005441 | Ga0070700_100008502 | Ga0070700_1000085028 | 390 |
| 223 | 3300005455 | Ga0070663_100002800 | Ga0070663_1000028005 | 390 |
| 224 | 3300005455 | Ga0070663_100212736 | Ga0070663_1002127362 | 390 |
| 225 | 3300005456 | Ga0070678_100020948 | Ga0070678_1000209483 | 390 |
| 226 | 3300005535 | Ga0070684_100246766 | Ga0070684_1002467662 | 390 |
| 227 | 3300005543 | Ga0070672_100085587 | Ga0070672_1000855873 | 390 |
| 228 | 3300005544 | Ga0070686_100097731 | Ga0070686_1000977312 | 390 |
| 229 | 3300005545 | Ga0070695_100033847 | Ga0070695_1000338474 | 390 |
| 230 | 3300005548 | Ga0070665_100000911 | Ga0070665_10000091115 | 390 |
| 231 | 3300005548 | Ga0070665_100201517 | Ga0070665_1002015172 | 390 |
| 232 | 3300005549 | Ga0070704_100013141 | Ga0070704_1000131412 | 390 |
| 233 | 3300005564 | Ga0070664_100068421 | Ga0070664_1000684213 | 390 |
| 234 | 3300005937 | Ga0081455_10110974 | Ga0081455_101109743 | 390 |
| 235 | 3300005981 | Ga0081538_10000407 | Ga0081538_1000040716 | 390 |
| 236 | 3300005981 | Ga0081538_10033842 | Ga0081538_100338422 | 390 |
| 237 | 3300005985 | Ga0081539_10001489 | Ga0081539_1000148922 | 390 |
| 238 | 3300005985 | Ga0081539_10013866 | Ga0081539_100138663 | 390 |
| 239 | 3300006028 | Ga0070717_10000061 | Ga0070717_1000006128 | 390 |
| 240 | 3300006028 | Ga0070717_10003687 | Ga0070717_1000368710 | 390 |
| 241 | 3300006028 | Ga0070717_10028271 | Ga0070717_100282716 | 390 |
| 242 | 3300006028 | Ga0070717_10142576 | Ga0070717_101425763 | 390 |
| 243 | 3300006038 | Ga0075365_10000162 | Ga0075365_1000016227 | 390 |
| 244 | 3300006038 | Ga0075365_10006537 | Ga0075365_100065379 | 390 |
| 245 | 3300006038 | Ga0075365_10020815 | Ga0075365_100208155 | 390 |
| 246 | 3300006048 | Ga0075363_100008514 | Ga0075363_1000085147 | 390 |
| 247 | 3300006051 | Ga0075364_10009357 | Ga0075364_100093578 | 390 |
| 248 | 3300006051 | Ga0075364_10099138 | Ga0075364_100991382 | 390 |
| 249 | 3300006175 | Ga0070712_100000013 | Ga0070712_100000013107 | 390 |
| 250 | 3300006175 | Ga0070712_100002893 | Ga0070712_10000289310 | 390 |
| 251 | 3300006186 | Ga0075369_10046922 | Ga0075369_100469222 | 390 |
| 252 | 3300006847 | Ga0075431_100000134 | Ga0075431_10000013412 | 390 |
| 253 | 3300006847 | Ga0075431_100035471 | Ga0075431_1000354714 | 390 |
| 254 | 3300006871 | Ga0075434_100153335 | Ga0075434_1001533352 | 390 |
| 255 | 3300006881 | Ga0068865_100001280 | Ga0068865_1000012806 | 390 |
| 256 | 3300007076 | Ga0075435_100101966 | Ga0075435_1001019663 | 390 |
| 257 | 3300009093 | Ga0105240_10030748 | Ga0105240_100307487 | 390 |
| 258 | 3300009094 | Ga0111539_10008272 | Ga0111539_100082723 | 390 |
| 259 | 3300009098 | Ga0105245_10001317 | Ga0105245_1000131712 | 390 |
| 260 | 3300009098 | Ga0105245_10007436 | Ga0105245_100074368 | 390 |
| 261 | 3300009177 | Ga0105248_10112289 | Ga0105248_101122894 | 390 |
| 262 | 3300009545 | Ga0105237_10204027 | Ga0105237_102040272 | 390 |
| 263 | 3300010375 | Ga0105239_10040445 | Ga0105239_100404452 | 390 |
| 264 | 3300010375 | Ga0105239_10282232 | Ga0105239_102822322 | 390 |
| 265 | 3300013308 | Ga0157375_10303954 | Ga0157375_103039542 | 390 |
| 266 | 3300014745 | Ga0157377_10007587 | Ga0157377_100075874 | 390 |
| 267 | 3300014969 | Ga0157376_10043308 | Ga0157376_100433083 | 390 |
| 268 | 3300021377 | Ga0213874_10001886 | Ga0213874_100018864 | 390 |
| 269 | 3300021384 | Ga0213876_10017513 | Ga0213876_100175134 | 390 |
| 270 | 3300021384 | Ga0213876_10065185 | Ga0213876_100651852 | 390 |
| 271 | 3300021384 | Ga0213876_10088857 | Ga0213876_100888571 | 390 |
| 272 | 3300021384 | Ga0213876_10097055 | Ga0213876_100970552 | 390 |
| 273 | 3300021388 | Ga0213875_10000148 | Ga0213875_1000014869 | 390 |
| 274 | 3300021388 | Ga0213875_10014084 | Ga0213875_100140845 | 390 |
| 275 | 3300025898 | Ga0207692_10000003 | Ga0207692_10000003154 | 390 |
| 276 | 3300025898 | Ga0207692_10021322 | Ga0207692_100213222 | 390 |
| 277 | 3300025906 | Ga0207699_10013246 | Ga0207699_100132463 | 390 |
| 278 | 3300025906 | Ga0207699_10087664 | Ga0207699_100876642 | 390 |
| 279 | 3300025913 | Ga0207695_10002407 | Ga0207695_1000240725 | 390 |
| 280 | 3300025915 | Ga0207693_10006406 | Ga0207693_100064062 | 390 |
| 281 | 3300025915 | Ga0207693_10007488 | Ga0207693_100074889 | 390 |
| 282 | 3300025915 | Ga0207693_10017486 | Ga0207693_100174867 | 390 |
| 283 | 3300025915 | Ga0207693_10080777 | Ga0207693_100807772 | 390 |
| 284 | 3300025916 | Ga0207663_10000169 | Ga0207663_1000016918 | 390 |
| 285 | 3300025916 | Ga0207663_10018543 | Ga0207663_100185434 | 390 |
| 286 | 3300025916 | Ga0207663_10156883 | Ga0207663_101568832 | 390 |
| 287 | 3300025919 | Ga0207657_10004224 | Ga0207657_100042245 | 390 |
| 288 | 3300025919 | Ga0207657_10016599 | Ga0207657_100165998 | 390 |
| 289 | 3300025923 | Ga0207681_10003442 | Ga0207681_100034428 | 390 |
| 290 | 3300025925 | Ga0207650_10077892 | Ga0207650_100778922 | 390 |
| 291 | 3300025927 | Ga0207687_10051175 | Ga0207687_100511753 | 390 |
| 292 | 3300025928 | Ga0207700_10012481 | Ga0207700_100124812 | 390 |
| 293 | 3300025929 | Ga0207664_10002161 | Ga0207664_100021619 | 390 |
| 294 | 3300025929 | Ga0207664_10032533 | Ga0207664_100325334 | 390 |
| 295 | 3300025929 | Ga0207664_10051994 | Ga0207664_100519944 | 390 |
| 296 | 3300025929 | Ga0207664_10064005 | Ga0207664_100640053 | 390 |
| 297 | 3300025929 | Ga0207664_10077006 | Ga0207664_100770063 | 390 |
| 298 | 3300025932 | Ga0207690_10000054 | Ga0207690_100000549 | 390 |
| 299 | 3300025932 | Ga0207690_10102783 | Ga0207690_101027832 | 390 |
| 300 | 3300025938 | Ga0207704_10011097 | Ga0207704_100110974 | 390 |
| 301 | 3300025938 | Ga0207704_10103895 | Ga0207704_101038952 | 390 |
| 302 | 3300025940 | Ga0207691_10098325 | Ga0207691_100983251 | 390 |
| 303 | 3300025944 | Ga0207661_10124996 | Ga0207661_101249962 | 390 |
| 304 | 3300026023 | Ga0207677_10077193 | Ga0207677_100771933 | 390 |
| 305 | 3300026067 | Ga0207678_10002606 | Ga0207678_100026065 | 390 |
| 306 | 3300026067 | Ga0207678_10082289 | Ga0207678_100822893 | 390 |
| 307 | 3300026075 | Ga0207708_10001007 | Ga0207708_1000100723 | 390 |
| 308 | 3300026121 | Ga0207683_10034359 | Ga0207683_100343593 | 390 |
| 309 | 3300027907 | Ga0207428_10057312 | Ga0207428_100573122 | 390 |
| 310 | 3300028379 | Ga0268266_10004582 | Ga0268266_100045825 | 390 |
| 311 | 3300028556 | Ga0265337_1001176 | Ga0265337_100117610 | 390 |
| 312 | 3300028558 | Ga0265326_10000005 | Ga0265326_1000000573 | 390 |
| 313 | 3300028558 | Ga0265326_10002998 | Ga0265326_100029984 | 390 |
| 314 | 3300028563 | Ga0265319_1000034 | Ga0265319_100003493 | 390 |
| 315 | 3300028563 | Ga0265319_1000756 | Ga0265319_10007564 | 390 |
| 316 | 3300028563 | Ga0265319_1001901 | Ga0265319_100190110 | 390 |
| 317 | 3300028573 | Ga0265334_10000024 | Ga0265334_1000002479 | 390 |
| 318 | 3300028577 | Ga0265318_10000545 | Ga0265318_100005459 | 390 |
| 319 | 3300028577 | Ga0265318_10001315 | Ga0265318_100013155 | 390 |
| 320 | 3300028666 | Ga0265336_10000001 | Ga0265336_10000001298 | 390 |
| 321 | 3300028666 | Ga0265336_10006532 | Ga0265336_100065324 | 390 |
| 322 | 3300028800 | Ga0265338_10000004 | Ga0265338_10000004583 | 390 |
| 323 | 3300028800 | Ga0265338_10006763 | Ga0265338_100067635 | 390 |
| 324 | 3300028800 | Ga0265338_10008060 | Ga0265338_1000806010 | 390 |
| 325 | 3300029957 | Ga0265324_10001235 | Ga0265324_1000123512 | 390 |
| 326 | 3300031240 | Ga0265320_10015457 | Ga0265320_100154573 | 390 |
| 327 | 3300031247 | Ga0265340_10000002 | Ga0265340_10000002583 | 390 |
| 328 | 3300031251 | Ga0265327_10002862 | Ga0265327_100028622 | 390 |
| 329 | 3300031344 | Ga0265316_10030285 | Ga0265316_100302854 | 390 |
| 330 | 3300031711 | Ga0265314_10004533 | Ga0265314_100045338 | 390 |
| 331 | 3300031995 | Ga0307409_100358743 | Ga0307409_1003587431 | 390 |
| 332 | 3300035117 | Ga0373953_0007813 | Ga0373953_0007813_237_1511 | 390 |
| 333 | 3300035118 | Ga0373954_0022104 | Ga0373954_0022104_1537_2811 | 390 |
| 334 | 3300037418 | Ga0395900_0002246 | Ga0395900_0002246_13140_14384 | 390 |
| 335 | 3300037466 | Ga0395898_0003455 | Ga0395898_0003455_13336_14580 | 390 |
| 336 | 3300037466 | Ga0395898_0010567 | Ga0395898_0010567_7081_8442 | 390 |
| 337 | 3300037471 | Ga0395905_0023450 | Ga0395905_0023450_84_1445 | 390 |
| 338 | 3300037471 | Ga0395905_0053535 | Ga0395905_0053535_358_1611 | 390 |
| 339 | 3300037853 | Ga0436364_0031839 | Ga0436364_0031839_1488_2723 | 390 |
| 340 | 3300037853 | Ga0436364_1122530 | Ga0436364_1122530_2232_3476 | 390 |
| 341 | 3300037853 | Ga0436364_1438537 | Ga0436364_1438537_2161_3396 | 390 |
| 342 | 3300038443 | Ga0395901_0006802 | Ga0395901_0006802_2957_4318 | 390 |
| 343 | 3300039437 | Ga0436365_0403715 | Ga0436365_0403715_12753_13994 | 390 |
| 344 | 3300039437 | Ga0436365_0863005 | Ga0436365_0863005_14_1270 | 390 |
| 345 | 3300039437 | Ga0436365_1102108 | Ga0436365_1102108_18694_19956 | 390 |
| 346 | 3300039437 | Ga0436365_1468086 | Ga0436365_1468086_2364_3644 | 390 |
| 347 | 3300039437 | Ga0436365_1725409 | Ga0436365_1725409_741_2021 | 390 |
| 348 | 3300039450 | Ga0436363_0386698 | Ga0436363_0386698_73_1347 | 390 |
| 349 | 3300039450 | Ga0436363_1064792 | Ga0436363_1064792_3307_4587 | 390 |
| 350 | 3300039450 | Ga0436363_1110229 | Ga0436363_1110229_60_1346 | 390 |
| 351 | 3300039450 | Ga0436363_1400525 | Ga0436363_1400525_4633_5871 | 390 |
| 352 | 3300039453 | Ga0436362_0637497 | Ga0436362_0637497_719_1999 | 390 |
| 353 | 3300039453 | Ga0436362_1195802 | Ga0436362_1195802_333_1577 | 390 |
| 354 | 3300044683 | Ga0466965_0021066 | Ga0466965_0021066_1607_2869 | 390 |
| 355 | 3300044684 | Ga0466966_0022394 | Ga0466966_0022394_1170_2444 | 390 |
| 356 | 3300044693 | Ga0466961_0017029 | Ga0466961_0017029_2753_3991 | 390 |
| 357 | 3300044693 | Ga0466961_0022190 | Ga0466961_0022190_1838_3082 | 390 |
| 358 | 3300044694 | Ga0466963_0008578 | Ga0466963_0008578_1125_2387 | 390 |
| 359 | 3300044694 | Ga0466963_0015641 | Ga0466963_0015641_1407_2654 | 390 |
| 360 | 3300044694 | Ga0466963_0017524 | Ga0466963_0017524_2792_4072 | 390 |
| 361 | 3300044694 | Ga0466963_0017976 | Ga0466963_0017976_3152_4393 | 390 |
| 362 | 3300044694 | Ga0466963_0040185 | Ga0466963_0040185_10_1368 | 390 |
| 363 | 3300044765 | Ga0466970_0024812 | Ga0466970_0024812_894_2132 | 390 |
| 364 | 3300044765 | Ga0466970_0040102 | Ga0466970_0040102_692_2050 | 390 |
| 365 | 3300044842 | Ga0466957_0060757 | Ga0466957_0060757_981_2261 | 390 |
| 366 | 3300044842 | Ga0466957_0079669 | Ga0466957_0079669_303_1565 | 390 |
| 367 | 3300045049 | Ga0466959_0001464 | Ga0466959_0001464_9224_10468 | 390 |
| 368 | 3300045049 | Ga0466959_0006901 | Ga0466959_0006901_2366_3724 | 390 |
| 369 | 3300045049 | Ga0466959_0014631 | Ga0466959_0014631_1856_3118 | 390 |
| 370 | 3300045049 | Ga0466959_0202441 | Ga0466959_0202441_55_1329 | 390 |
| 371 | 3300045836 | Ga0466958_0001617 | Ga0466958_0001617_5047_6309 | 390 |
| 372 | 3300045836 | Ga0466958_0005363 | Ga0466958_0005363_5208_6449 | 390 |
| 373 | 3300045836 | Ga0466958_0015156 | Ga0466958_0015156_1403_2761 | 390 |
| 374 | 3300045836 | Ga0466958_0021420 | Ga0466958_0021420_354_1589 | 390 |
| 375 | 3300045836 | Ga0466958_0081711 | Ga0466958_0081711_606_1847 | 390 |
| 376 | 3300045836 | Ga0466958_0084658 | Ga0466958_0084658_205_1476 | 390 |
| 377 | 3300045836 | Ga0466958_0112636 | Ga0466958_0112636_265_1512 | 390 |
| 378 | 3300045976 | Ga0466967_0004740 | Ga0466967_0004740_6764_8026 | 390 |
| 379 | 3300045976 | Ga0466967_0144983 | Ga0466967_0144983_712_1992 | 390 |
| 380 | 3300045976 | Ga0466967_0325591 | Ga0466967_0325591_160_1401 | 390 |
| 381 | 3300046461 | Ga0495641_0026307 | Ga0495641_0026307_127_1416 | 390 |
| 382 | 3300046462 | Ga0495651_0010955 | Ga0495651_0010955_2036_3310 | 390 |
| 383 | 3300046463 | Ga0495653_0000536 | Ga0495653_0000536_25494_26759 | 390 |
| 384 | 3300046473 | Ga0495582_0071752 | Ga0495582_0071752_153_1427 | 390 |
| 385 | 3300046477 | Ga0495664_0000073 | Ga0495664_0000073_1569_2819 | 390 |
| 386 | 3300046514 | Ga0495618_0000046 | Ga0495618_0000046_42786_44063 | 390 |
| 387 | 3300046516 | Ga0495628_0186278 | Ga0495628_0186278_148_1422 | 390 |
| 388 | 3300046517 | Ga0495630_0000241 | Ga0495630_0000241_32417_33703 | 390 |
| 389 | 3300046517 | Ga0495630_0147751 | Ga0495630_0147751_196_1470 | 390 |
| 390 | 3300046529 | Ga0495652_0055641 | Ga0495652_0055641_1110_2384 | 390 |
| 391 | 3300046536 | Ga0495587_0026741 | Ga0495587_0026741_1184_2458 | 390 |
| 392 | 3300046543 | Ga0495645_0000022 | Ga0495645_0000022_23231_24496 | 390 |
| 393 | 3300046543 | Ga0495645_0000119 | Ga0495645_0000119_47120_48364 | 390 |
| 394 | 3300046663 | Ga0495635_0011412 | Ga0495635_0011412_547_1821 | 390 |
| 395 | 3300046675 | Ga0495657_0000226 | Ga0495657_0000226_32438_33724 | 390 |
| 396 | 3300046675 | Ga0495657_0010844 | Ga0495657_0010844_3508_4782 | 390 |
| 397 | 3300046680 | Ga0495646_0040811 | Ga0495646_0040811_736_2010 | 390 |
| 398 | 3300046809 | Ga0495600_0058520 | Ga0495600_0058520_361_1635 | 390 |
| 399 | 3300047317 | Ga0495604_0000148 | Ga0495604_0000148_25028_26284 | 390 |
| 400 | 3300047317 | Ga0495604_0020614 | Ga0495604_0020614_338_1612 | 390 |
| 401 | 3300047319 | Ga0495674_0015458 | Ga0495674_0015458_2127_3401 | 390 |
| 402 | 3300047321 | Ga0495676_0071845 | Ga0495676_0071845_577_1866 | 390 |
| 403 | 3300047322 | Ga0495680_0003599 | Ga0495680_0003599_6653_7927 | 390 |
| 404 | 3300047444 | Ga0495675_0027217 | Ga0495675_0027217_717_1991 | 390 |
| 405 | 3300047444 | Ga0495675_0078228 | Ga0495675_0078228_741_2018 | 390 |
| 406 | 3300047471 | Ga0495684_0004277 | Ga0495684_0004277_4385_5662 | 390 |
| 407 | 3300047471 | Ga0495684_0011380 | Ga0495684_0011380_5523_6797 | 390 |
| 408 | 3300048088 | Ga0495602_0027711 | Ga0495602_0027711_3499_4773 | 390 |
| 409 | 3300048903 | Ga0496100_0000450 | Ga0496100_0000450_11313_12569 | 390 |
| 410 | 3300048903 | Ga0496100_0015709 | Ga0496100_0015709_982_2271 | 390 |
| 411 | 3300048904 | Ga0496101_0001032 | Ga0496101_0001032_13710_14966 | 390 |
| 412 | 3300048905 | Ga0496102_0000040 | Ga0496102_0000040_46186_47424 | 390 |
| 413 | 3300048905 | Ga0496102_0008080 | Ga0496102_0008080_6625_7914 | 390 |
| 414 | 3300048905 | Ga0496102_0012915 | Ga0496102_0012915_243_1547 | 390 |
| 415 | 3300048906 | Ga0496103_0000067 | Ga0496103_0000067_76_1314 | 390 |
| 416 | 3300048906 | Ga0496103_0001681 | Ga0496103_0001681_7362_8651 | 390 |
| 417 | 3300048907 | Ga0496104_0000006 | Ga0496104_0000006_425731_426978 | 390 |
| 418 | 3300048907 | Ga0496104_0033875 | Ga0496104_0033875_2388_3677 | 390 |
| 419 | 3300048907 | Ga0496104_0066277 | Ga0496104_0066277_1542_2816 | 390 |
| 420 | 3300048907 | Ga0496104_0066408 | Ga0496104_0066408_1288_2562 | 390 |
| 421 | 3300048908 | Ga0496105_0005449 | Ga0496105_0005449_8138_9427 | 390 |
| 422 | 3300048909 | Ga0496106_0009964 | Ga0496106_0009964_5373_6662 | 390 |
| 423 | 3300048909 | Ga0496106_0111245 | Ga0496106_0111245_80_1363 | 390 |
| 424 | 3300048909 | Ga0496106_0128685 | Ga0496106_0128685_222_1526 | 390 |
| 425 | 3300048910 | Ga0496107_0012518 | Ga0496107_0012518_355_1644 | 390 |
| 426 | 3300048910 | Ga0496107_0038123 | Ga0496107_0038123_1515_2819 | 390 |
| 427 | 3300048910 | Ga0496107_0124848 | Ga0496107_0124848_220_1503 | 390 |
| 428 | 3300048911 | Ga0496108_0004671 | Ga0496108_0004671_3822_5111 | 390 |
| 429 | 3300048911 | Ga0496108_0013342 | Ga0496108_0013342_4765_6069 | 390 |
| 430 | 3300048912 | Ga0496109_0019443 | Ga0496109_0019443_327_1616 | 390 |
| 431 | 3300048912 | Ga0496109_0028889 | Ga0496109_0028889_1678_2931 | 390 |
| 432 | 3300048912 | Ga0496109_0133062 | Ga0496109_0133062_684_1988 | 390 |
| 433 | 3300048913 | Ga0496110_0000064 | Ga0496110_0000064_5904_7151 | 390 |
| 434 | 3300048913 | Ga0496110_0006623 | Ga0496110_0006623_5572_6861 | 390 |
| 435 | 3300048913 | Ga0496110_0022612 | Ga0496110_0022612_3107_4411 | 390 |
| 436 | 3300048913 | Ga0496110_0086550 | Ga0496110_0086550_70_1341 | 390 |
| 437 | 3300048914 | Ga0496111_0002025 | Ga0496111_0002025_6966_8255 | 390 |
| 438 | 3300048915 | Ga0496112_0000095 | Ga0496112_0000095_18331_19578 | 390 |
| 439 | 3300048915 | Ga0496112_0005797 | Ga0496112_0005797_8597_9871 | 390 |
| 440 | 3300048915 | Ga0496112_0089669 | Ga0496112_0089669_1251_2540 | 390 |
| 441 | 3300048916 | Ga0496113_0066251 | Ga0496113_0066251_129_1433 | 390 |
| 442 | 3300048917 | Ga0496114_0010676 | Ga0496114_0010676_456_1745 | 390 |
| 443 | 3300048918 | Ga0496115_0000059 | Ga0496115_0000059_73008_74288 | 390 |
| 444 | 3300048918 | Ga0496115_0000087 | Ga0496115_0000087_22082_23362 | 390 |
| 445 | 3300048918 | Ga0496115_0010330 | Ga0496115_0010330_351_1640 | 390 |
| 446 | 3300048918 | Ga0496115_0074997 | Ga0496115_0074997_1396_2667 | 390 |
| 447 | 3300048927 | Ga0496124_0115740 | Ga0496124_0115740_576_1817 | 390 |
| 448 | 3300049568 | Ga0501031_0008936 | Ga0501031_0008936_2105_3364 | 390 |
| 449 | 3300049569 | Ga0501032_0004500 | Ga0501032_0004500_8592_9851 | 390 |
| 450 | 3300049570 | Ga0501033_0121690 | Ga0501033_0121690_261_1520 | 390 |
| 451 | 3300049572 | Ga0501036_0052553 | Ga0501036_0052553_440_1699 | 390 |
| 452 | 3300049573 | Ga0501037_0118634 | Ga0501037_0118634_248_1507 | 390 |
| 453 | 3300049574 | Ga0501038_0005589 | Ga0501038_0005589_8488_9747 | 390 |
| 454 | 3300049575 | Ga0501039_0078652 | Ga0501039_0078652_603_1862 | 390 |
| 455 | 3300049578 | Ga0501042_0025820 | Ga0501042_0025820_749_2008 | 390 |
| 456 | 3300049578 | Ga0501042_0160550 | Ga0501042_0160550_349_1593 | 390 |
| 457 | 3300049580 | Ga0501046_0002368 | Ga0501046_0002368_11770_13029 | 390 |
| 458 | 3300049582 | Ga0501048_0015968 | Ga0501048_0015968_3512_4771 | 390 |
| 459 | 3300049584 | Ga0501068_0022156 | Ga0501068_0022156_2213_3472 | 390 |
| 460 | 3300049585 | Ga0501069_0001600 | Ga0501069_0001600_1441_2700 | 390 |
| 461 | 3300049585 | Ga0501069_0057514 | Ga0501069_0057514_351_1634 | 390 |
| 462 | 3300049586 | Ga0501070_0041608 | Ga0501070_0041608_1501_2784 | 390 |
| 463 | 3300049586 | Ga0501070_0072465 | Ga0501070_0072465_1179_2438 | 390 |
| 464 | 3300049587 | Ga0501071_0177665 | Ga0501071_0177665_218_1501 | 390 |
| 465 | 3300049588 | Ga0501072_0016803 | Ga0501072_0016803_525_1808 | 390 |
| 466 | 3300049589 | Ga0501073_0007298 | Ga0501073_0007298_728_1987 | 390 |
| 467 | 3300049589 | Ga0501073_0179281 | Ga0501073_0179281_31_1314 | 390 |
| 468 | 3300049590 | Ga0501074_0156252 | Ga0501074_0156252_74_1357 | 390 |
| 469 | 3300049742 | Ga0501080_0012732 | Ga0501080_0012732_2662_3921 | 390 |
| 470 | 3300049744 | Ga0501083_0021160 | Ga0501083_0021160_1481_2740 | 390 |
| 471 | 3300049822 | Ga0501035_0023094 | Ga0501035_0023094_1790_3049 | 390 |
| 472 | 3300050491 | nmdc:mga00v17_14935_c1 | nmdc:mga00v17_14935_c1_354_1658 | 390 |
| 473 | 3300050491 | nmdc:mga00v17_24681_c1 | nmdc:mga00v17_24681_c1_1453_2745 | 390 |
| 474 | 3300050492 | nmdc:mga0yw44_212097_c1 | nmdc:mga0yw44_212097_c1_23_1267 | 390 |
| 475 | 3300050492 | nmdc:mga0yw44_92281_c1 | nmdc:mga0yw44_92281_c1_594_1877 | 390 |
| 476 | 3300050494 | nmdc:mga06z11_25263_c1 | nmdc:mga06z11_25263_c1_539_1843 | 390 |
| 477 | 3300050508 | nmdc:mga09592_128396_c1 | nmdc:mga09592_128396_c1_709_2013 | 390 |
| 478 | 3300050508 | nmdc:mga09592_14752_c1 | nmdc:mga09592_14752_c1_343_1593 | 390 |
| 479 | 3300050509 | nmdc:mga0qj67_241736_c1 | nmdc:mga0qj67_241736_c1_78_1382 | 390 |
| 480 | 3300050509 | nmdc:mga0qj67_77597_c1 | nmdc:mga0qj67_77597_c1_561_1811 | 390 |
| 481 | 3300050510 | nmdc:mga06r32_1211_c1 | nmdc:mga06r32_1211_c1_12216_13487 | 390 |
| 482 | 3300050511 | nmdc:mga08y16_22098_c1 | nmdc:mga08y16_22098_c1_4437_5708 | 390 |
| 483 | 3300050512 | nmdc:mga0n895_149931_c1 | nmdc:mga0n895_149931_c1_371_1642 | 390 |
| 484 | 3300050516 | nmdc:mga0sz30_41416_c1 | nmdc:mga0sz30_41416_c1_575_1885 | 390 |
| 485 | 3300053077 | Ga0495601_0001152 | Ga0495601_0001152_6983_8269 | 390 |
| 486 | 3300053077 | Ga0495601_0013587 | Ga0495601_0013587_1492_2742 | 390 |
| 487 | 3300053078 | Ga0495612_0000032 | Ga0495612_0000032_28877_30163 | 390 |
| 488 | 3300053084 | Ga0495595_0048126 | Ga0495595_0048126_678_1952 | 390 |
| 489 | 3300053085 | Ga0495619_0018953 | Ga0495619_0018953_1172_2446 | 390 |
| 490 | 3300053104 | Ga0500556_0000262 | Ga0500556_0000262_28466_29719 | 390 |
| 491 | 3300053153 | Ga0500616_0006584 | Ga0500616_0006584_4962_6215 | 390 |
| 492 | 3300060353 | Ga0501082_0022434 | Ga0501082_0022434_244_1503 | 390 |
| 493 | 3300061719 | Ga0466962_0039153 | Ga0466962_0039153_701_2059 | 390 |
| 494 | 3300039453 | Ga0436362_0352471 | Ga0436362_0352471_363_1655 | 391 |
| 495 | 3300003203 | JGI25406J46586_10003565 | JGI25406J46586_100035654 | 392 |
| 496 | 3300005337 | Ga0070682_100145669 | Ga0070682_1001456691 | 392 |
| 497 | 3300005347 | Ga0070668_100154304 | Ga0070668_1001543042 | 392 |
| 498 | 3300005546 | Ga0070696_100073730 | Ga0070696_1000737302 | 392 |
| 499 | 3300005719 | Ga0068861_100060118 | Ga0068861_1000601182 | 392 |
| 500 | 3300005985 | Ga0081539_10001045 | Ga0081539_1000104513 | 392 |
| 501 | 3300006058 | Ga0075432_10004541 | Ga0075432_100045417 | 392 |
| 502 | 3300006847 | Ga0075431_100150378 | Ga0075431_1001503782 | 392 |
| 503 | 3300006880 | Ga0075429_100076483 | Ga0075429_1000764833 | 392 |
| 504 | 3300014325 | Ga0163163_10185551 | Ga0163163_101855512 | 392 |
| 505 | 3300026075 | Ga0207708_10028439 | Ga0207708_100284393 | 392 |
| 506 | 3300031852 | Ga0307410_10253978 | Ga0307410_102539782 | 392 |
| 507 | 3300031995 | Ga0307409_100186388 | Ga0307409_1001863882 | 392 |
| 508 | 3300037466 | Ga0395898_0122044 | Ga0395898_0122044_514_1746 | 392 |
| 509 | 3300037471 | Ga0395905_0146681 | Ga0395905_0146681_470_1729 | 392 |
| 510 | 3300042016 | Ga0439463_029393 | Ga0439463_029393_18_1250 | 392 |
| 511 | 3300050512 | nmdc:mga0n895_322636_c1 | nmdc:mga0n895_322636_c1_164_1399 | 392 |
| 512 | 3300005937 | Ga0081455_10100827 | Ga0081455_101008272 | 393 |
| 513 | 3300039437 | Ga0436365_0808769 | Ga0436365_0808769_178_1470 | 393 |
| 514 | 3300045976 | Ga0466967_0081421 | Ga0466967_0081421_1493_2737 | 393 |
| 515 | 3300048912 | Ga0496109_0008856 | Ga0496109_0008856_3639_4910 | 393 |
| 516 | 3300003373 | JGI25407J50210_10001845 | JGI25407J50210_100018454 | 394 |
| 517 | 3300005937 | Ga0081455_10059760 | Ga0081455_100597602 | 394 |
| 518 | 3300005981 | Ga0081538_10000839 | Ga0081538_1000083927 | 394 |
| 519 | 3300005981 | Ga0081538_10010085 | Ga0081538_1001008512 | 394 |
| 520 | 3300005981 | Ga0081538_10013079 | Ga0081538_100130794 | 394 |
| 521 | 3300005981 | Ga0081538_10063332 | Ga0081538_100633322 | 394 |
| 522 | 3300031731 | Ga0307405_10054391 | Ga0307405_100543913 | 394 |
| 523 | 3300031901 | Ga0307406_10029133 | Ga0307406_100291331 | 394 |
| 524 | 3300031901 | Ga0307406_10078807 | Ga0307406_100788072 | 394 |
| 525 | 3300031995 | Ga0307409_100101435 | Ga0307409_1001014352 | 394 |
| 526 | 3300032126 | Ga0307415_100000210 | Ga0307415_10000021020 | 394 |
| 527 | 3300032126 | Ga0307415_100065587 | Ga0307415_1000655872 | 394 |
| 528 | 3300047320 | Ga0495672_0027013 | Ga0495672_0027013_1040_2302 | 394 |
| 529 | 3300003373 | JGI25407J50210_10000444 | JGI25407J50210_100004449 | 395 |
| 530 | 3300003373 | JGI25407J50210_10000682 | JGI25407J50210_100006823 | 395 |
| 531 | 3300005336 | Ga0070680_100254925 | Ga0070680_1002549252 | 395 |
| 532 | 3300005530 | Ga0070679_100224598 | Ga0070679_1002245982 | 395 |
| 533 | 3300005981 | Ga0081538_10002004 | Ga0081538_1000200425 | 395 |
| 534 | 3300005981 | Ga0081538_10007804 | Ga0081538_1000780412 | 395 |
| 535 | 3300005981 | Ga0081538_10010720 | Ga0081538_100107203 | 395 |
| 536 | 3300005981 | Ga0081538_10016364 | Ga0081538_100163643 | 395 |
| 537 | 3300006844 | Ga0075428_100067439 | Ga0075428_1000674393 | 395 |
| 538 | 3300009147 | Ga0114129_10313755 | Ga0114129_103137553 | 395 |
| 539 | 3300027907 | Ga0207428_10167941 | Ga0207428_101679411 | 395 |
| 540 | 3300031548 | Ga0307408_100140076 | Ga0307408_1001400761 | 395 |
| 541 | 3300031852 | Ga0307410_10014490 | Ga0307410_100144902 | 395 |
| 542 | 3300031901 | Ga0307406_10017241 | Ga0307406_100172414 | 395 |
| 543 | 3300031901 | Ga0307406_10104437 | Ga0307406_101044372 | 395 |
| 544 | 3300031903 | Ga0307407_10004725 | Ga0307407_100047254 | 395 |
| 545 | 3300031911 | Ga0307412_10114521 | Ga0307412_101145212 | 395 |
| 546 | 3300031995 | Ga0307409_100011600 | Ga0307409_1000116004 | 395 |
| 547 | 3300031995 | Ga0307409_100063756 | Ga0307409_1000637563 | 395 |
| 548 | 3300032004 | Ga0307414_10123422 | Ga0307414_101234222 | 395 |
| 549 | 3300032126 | Ga0307415_100044436 | Ga0307415_1000444363 | 395 |
| 550 | 3300049578 | Ga0501042_0104931 | Ga0501042_0104931_184_1440 | 395 |
| 551 | 3300049591 | Ga0501075_0022561 | Ga0501075_0022561_2604_3854 | 395 |
| 552 | 3300050507 | nmdc:mga05p37_145196_c1 | nmdc:mga05p37_145196_c1_1288_2565 | 395 |
| 553 | 3300050511 | nmdc:mga08y16_161822_c1 | nmdc:mga08y16_161822_c1_811_2088 | 395 |
| 554 | 3300061734 | Ga0530510_0008178 | Ga0530510_0008178_4709_5959 | 395 |
| 555 | 3300005937 | Ga0081455_10021892 | Ga0081455_100218922 | 396 |
| 556 | 3300005981 | Ga0081538_10009518 | Ga0081538_100095185 | 396 |
| 557 | 3300005981 | Ga0081538_10025487 | Ga0081538_100254875 | 396 |
| 558 | 3300006846 | Ga0075430_100005551 | Ga0075430_1000055514 | 396 |
| 559 | 3300009147 | Ga0114129_10082076 | Ga0114129_100820762 | 396 |
| 560 | 3300046675 | Ga0495657_0116251 | Ga0495657_0116251_142_1500 | 396 |
| 561 | 3300047472 | Ga0495686_0000011 | Ga0495686_0000011_360401_361789 | 396 |
| 562 | 3300047472 | Ga0495686_0002303 | Ga0495686_0002303_10400_11782 | 396 |
| 563 | 3300049588 | Ga0501072_0037754 | Ga0501072_0037754_1197_2456 | 396 |
| 564 | 3300049591 | Ga0501075_0136751 | Ga0501075_0136751_236_1495 | 396 |
| 565 | 3300049824 | Ga0501045_0162393 | Ga0501045_0162393_356_1615 | 396 |
| 566 | 3300050507 | nmdc:mga05p37_820_c1 | nmdc:mga05p37_820_c1_30613_31872 | 396 |
| 567 | 3300050509 | nmdc:mga0qj67_1947_c1 | nmdc:mga0qj67_1947_c1_6316_7575 | 396 |
| 568 | 3300000549 | LJQas_1000809 | LJQas_10008099 | 397 |
| 569 | 3300044694 | Ga0466963_0009122 | Ga0466963_0009122_932_2182 | 397 |
| 570 | 3300046461 | Ga0495641_0006906 | Ga0495641_0006906_2444_3859 | 397 |
| 571 | 3300046615 | Ga0495656_0008515 | Ga0495656_0008515_818_2224 | 397 |
| 572 | 3300047469 | Ga0495673_0012407 | Ga0495673_0012407_1145_2551 | 397 |
| 573 | 3300047472 | Ga0495686_0025906 | Ga0495686_0025906_2387_3784 | 397 |
| 574 | 3300048090 | Ga0495615_0015247 | Ga0495615_0015247_147_1553 | 397 |
| 575 | 3300005458 | Ga0070681_10126193 | Ga0070681_101261932 | 398 |
| 576 | 3300005530 | Ga0070679_100074391 | Ga0070679_1000743912 | 398 |
| 577 | 3300005577 | Ga0068857_100118365 | Ga0068857_1001183652 | 398 |
| 578 | 3300005981 | Ga0081538_10027440 | Ga0081538_100274401 | 398 |
| 579 | 3300005981 | Ga0081538_10035784 | Ga0081538_100357843 | 398 |
| 580 | 3300006844 | Ga0075428_100079393 | Ga0075428_1000793932 | 398 |
| 581 | 3300009545 | Ga0105237_10049423 | Ga0105237_100494235 | 398 |
| 582 | 3300013104 | Ga0157370_10017109 | Ga0157370_100171096 | 398 |
| 583 | 3300013105 | Ga0157369_10299946 | Ga0157369_102999462 | 398 |
| 584 | 3300013307 | Ga0157372_10084129 | Ga0157372_100841292 | 398 |
| 585 | 3300025919 | Ga0207657_10032101 | Ga0207657_100321014 | 398 |
| 586 | 3300025920 | Ga0207649_10069644 | Ga0207649_100696441 | 398 |
| 587 | 3300025921 | Ga0207652_10010267 | Ga0207652_100102677 | 398 |
| 588 | 3300025944 | Ga0207661_10003968 | Ga0207661_100039684 | 398 |
| 589 | 3300026116 | Ga0207674_10023744 | Ga0207674_100237445 | 398 |
| 590 | 3300031548 | Ga0307408_100052371 | Ga0307408_1000523714 | 398 |
| 591 | 3300037466 | Ga0395898_0091022 | Ga0395898_0091022_65_1330 | 398 |
| 592 | 3300038443 | Ga0395901_0212932 | Ga0395901_0212932_310_1578 | 398 |
| 593 | 3300045976 | Ga0466967_0066665 | Ga0466967_0066665_1075_2328 | 398 |
| 594 | 3300048913 | Ga0496110_0168470 | Ga0496110_0168470_88_1356 | 398 |
| 595 | 3300005983 | Ga0081540_1026074 | Ga0081540_10260742 | 399 |
| 596 | 3300005985 | Ga0081539_10081547 | Ga0081539_100815471 | 399 |
| 597 | 3300026142 | Ga0207698_10200730 | Ga0207698_102007302 | 399 |
| 598 | 3300032126 | Ga0307415_100076431 | Ga0307415_1000764313 | 399 |
| 599 | 3300000546 | LJNas_1004847 | LJNas_10048472 | 400 |
| 600 | 3300005338 | Ga0068868_100085151 | Ga0068868_1000851512 | 400 |
| 601 | 3300005341 | Ga0070691_10065235 | Ga0070691_100652352 | 400 |
| 602 | 3300005347 | Ga0070668_100124869 | Ga0070668_1001248692 | 400 |
| 603 | 3300005353 | Ga0070669_100079863 | Ga0070669_1000798633 | 400 |
| 604 | 3300005356 | Ga0070674_100189935 | Ga0070674_1001899351 | 400 |
| 605 | 3300005441 | Ga0070700_100007717 | Ga0070700_1000077172 | 400 |
| 606 | 3300005535 | Ga0070684_100088088 | Ga0070684_1000880882 | 400 |
| 607 | 3300005578 | Ga0068854_100173471 | Ga0068854_1001734712 | 400 |
| 608 | 3300005615 | Ga0070702_100005646 | Ga0070702_1000056465 | 400 |
| 609 | 3300005615 | Ga0070702_100152582 | Ga0070702_1001525821 | 400 |
| 610 | 3300005937 | Ga0081455_10019184 | Ga0081455_100191846 | 400 |
| 611 | 3300005981 | Ga0081538_10001191 | Ga0081538_1000119137 | 400 |
| 612 | 3300005981 | Ga0081538_10019801 | Ga0081538_100198012 | 400 |
| 613 | 3300006846 | Ga0075430_100012676 | Ga0075430_1000126764 | 400 |
| 614 | 3300006881 | Ga0068865_100147021 | Ga0068865_1001470212 | 400 |
| 615 | 3300009098 | Ga0105245_10037717 | Ga0105245_100377172 | 400 |
| 616 | 3300025302 | Ga0207426_1011793 | Ga0207426_10117933 | 400 |
| 617 | 3300025901 | Ga0207688_10047303 | Ga0207688_100473032 | 400 |
| 618 | 3300025907 | Ga0207645_10065100 | Ga0207645_100651003 | 400 |
| 619 | 3300025933 | Ga0207706_10068422 | Ga0207706_100684222 | 400 |
| 620 | 3300025938 | Ga0207704_10051106 | Ga0207704_100511062 | 400 |
| 621 | 3300025938 | Ga0207704_10137842 | Ga0207704_101378422 | 400 |
| 622 | 3300025944 | Ga0207661_10060212 | Ga0207661_100602123 | 400 |
| 623 | 3300025945 | Ga0207679_10072688 | Ga0207679_100726882 | 400 |
| 624 | 3300025981 | Ga0207640_10096750 | Ga0207640_100967502 | 400 |
| 625 | 3300026075 | Ga0207708_10006410 | Ga0207708_1000641012 | 400 |
| 626 | 3300026089 | Ga0207648_10148068 | Ga0207648_101480682 | 400 |
| 627 | 3300026118 | Ga0207675_100101254 | Ga0207675_1001012542 | 400 |
| 628 | 3300031824 | Ga0307413_10111285 | Ga0307413_101112852 | 400 |
| 629 | 3300031824 | Ga0307413_10139087 | Ga0307413_101390872 | 400 |
| 630 | 3300031911 | Ga0307412_10160447 | Ga0307412_101604472 | 400 |
| 631 | 3300032002 | Ga0307416_100006134 | Ga0307416_1000061348 | 400 |
| 632 | 3300032002 | Ga0307416_100040991 | Ga0307416_1000409912 | 400 |
| 633 | 3300044694 | Ga0466963_0124490 | Ga0466963_0124490_360_1619 | 400 |
| 634 | 3300045976 | Ga0466967_0001002 | Ga0466967_0001002_13156_14436 | 400 |
| 635 | 3300045976 | Ga0466967_0040152 | Ga0466967_0040152_1565_2824 | 400 |
| 636 | 3300045976 | Ga0466967_0086414 | Ga0466967_0086414_1160_2431 | 400 |
| 637 | 3300048905 | Ga0496102_0095397 | Ga0496102_0095397_902_2167 | 400 |
| 638 | 3300048909 | Ga0496106_0027332 | Ga0496106_0027332_1940_3205 | 400 |
| 639 | 3300048924 | Ga0496121_0002770 | Ga0496121_0002770_18672_19973 | 400 |
| 640 | 3300049569 | Ga0501032_0068591 | Ga0501032_0068591_720_1979 | 400 |
| 641 | 3300049572 | Ga0501036_0058695 | Ga0501036_0058695_1010_2269 | 400 |
| 642 | 3300049575 | Ga0501039_0068499 | Ga0501039_0068499_1046_2305 | 400 |
| 643 | 3300049588 | Ga0501072_0156522 | Ga0501072_0156522_497_1765 | 400 |
| 644 | 3300049590 | Ga0501074_0108291 | Ga0501074_0108291_641_1870 | 400 |
| 645 | 3300049824 | Ga0501045_0067104 | Ga0501045_0067104_733_1992 | 400 |
| 646 | 3300050509 | nmdc:mga0qj67_47848_c1 | nmdc:mga0qj67_47848_c1_603_1922 | 400 |
| 647 | 3300061734 | Ga0530510_0029873 | Ga0530510_0029873_945_2204 | 400 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qsn-assembly1.cif.gz_D | bovine complex i in lipid nanodisc, deactive-apo | 0.9676 | 40 | 400 |
| 7vwj-assembly1.cif.gz_Q | matrix arm of deactive state ci from rotenone-nadh dataset | 0.962 | 17 | 400 |
| 6zk9-assembly1.cif.gz_4 | peripheral domain of open complex i during turnover | 0.9618 | 15 | 400 |
| 6g72-assembly1.cif.gz_D | mouse mitochondrial complex i in the deactive state | 0.9603 | 17 | 400 |
| 7r4c-assembly1.cif.gz_D | bovine complex i in the presence of im1761092, deactive class v (composite map) | 0.9599 | 15 | 400 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q23883_16_406_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9466 | 17 | 400 | 1.10.645.10 |
| af_P33599_211_596_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9438 | 17 | 400 | 1.10.645.10 |
| af_P9WJH5_38_440_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9389 | 17 | 400 | 1.10.645.10 |
| af_P16431_180_537_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.937 | 17 | 393 | 1.10.645.10 |
| af_P33599_211_596_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9367 | 17 | 400 | 1.10.645.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5Q0UUT2-F1-model_v4 | NADH-plastoquinone oxidoreductase subunit 7 | 0.9879 | 82 | 296 |
GO:0009535
GO:0016651 GO:0048038 GO:0051287 |
| AF-A0A7M3XQJ2-F1-model_v4 | NADH-quinone oxidoreductase subunit NuoD | 0.9802 | 104 | 271 |
GO:0016651
GO:0048038 GO:0051287 |
| AF-A0A5K1HTL9-F1-model_v4 | NADH-quinone oxidoreductase subunit D domain-containing protein | 0.9772 | 55 | 255 |
GO:0009535
GO:0016651 GO:0048038 GO:0051287 |
| AF-A0A5J4NH96-F1-model_v4 | Complex I-49kD (NADH-ubiquinone oxidoreductase 49 kDa subunit) | 0.9771 | 82 | 390 |
GO:0005739
GO:0006120 GO:0016020 GO:0016651 GO:0048038 GO:0051287 |
| AF-X1TSP0-F1-model_v4 | NADH-quinone oxidoreductase subunit D domain-containing protein | 0.977 | 86 | 241 |
GO:0016651
GO:0048038 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar