F472261

General Info

Members Datasets Scaffolds Average Seq Length
647 292 647 420

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100003450|Ga0070699_1000034504
Length 414
Sequence VAETRIAQEQLGPGPEQMPFGPEHEPETEWMELNMGPHHPSTHGVLRVRLKLDGEIVRDADADIGYLHTGFEKSFEDKTYTQGITFSDRMDYLAPPINNVGFVSAVEKLIEVDVPPRAQAIRVIMMELARVSSHELWLGTTGLDLGVYSGFFYAWRDRDLALDLNEAYSGVRMMTSFTRVGGVAWDLPDGWLDQLQRFIDVMPARLDDFESMLTDNPIWHQRLKGVGAISAADAIEAGVTGPVLRASGVNYDVRKAFPYCGYEQYDFEVPVGQNGDCYDRYRMRVAEMRQSLRILQQAVDNLPGGPWITSDRKVALPPRSELSKSMEAVIHQFRLVSEGFKGPVGDVYSFVESPRGELGFYLVSDGTNKPYRMKVRPPSFCNLQSLRKLVQGVLVADVIAIMGSLDFILGDCDR

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
144 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
145 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
146 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
147 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
148 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
178 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
285 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
288 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.09
Nodule 0
Rhizoplane 12.36
Rhizosphere 80.68
Stem 0
Stem Tuber 0
Unclassified 3.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1004847 3300000546 Bacteria 1482
2 LJQas_1000809 3300000549 Bacteria 4928
3 JGI25406J46586_10003565 3300003203 Bacteria 7300
4 JGI25407J50210_10000444 3300003373 Bacteria 8139
5 JGI25407J50210_10000682 3300003373 Bacteria 7026
6 JGI25407J50210_10001845 3300003373 Bacteria 4902
7 JGI25407J50210_10008207 3300003373 Bacteria 2631
8 Ga0065707_10000837 3300005295 Bacteria 18551
9 Ga0070683_100047627 3300005329 Bacteria 3961
10 Ga0070683_100092454 3300005329 Bacteria 2841
11 Ga0070680_100254925 3300005336 Bacteria 1484
12 Ga0070682_100050461 3300005337 Bacteria 2597
13 Ga0070682_100145669 3300005337 Bacteria 1620
14 Ga0068868_100016295 3300005338 Bacteria 5515
15 Ga0068868_100085151 3300005338 Bacteria 2539
16 Ga0068868_100101654 3300005338 Bacteria 2327
17 Ga0070660_100001669 3300005339 Bacteria 15240
18 Ga0070660_100010862 3300005339 Bacteria 6445
19 Ga0070689_100215807 3300005340 Bacteria 1572
20 Ga0070691_10065235 3300005341 Bacteria 1758
21 Ga0070692_10038048 3300005345 Bacteria 2449
22 Ga0070668_100030302 3300005347 Bacteria 4113
23 Ga0070668_100103180 3300005347 Bacteria 2262
24 Ga0070668_100124869 3300005347 Bacteria 2061
25 Ga0070668_100154304 3300005347 Bacteria 1859
26 Ga0070669_100079863 3300005353 Bacteria 2433
27 Ga0070675_100029576 3300005354 Bacteria 4420
28 Ga0070675_100164686 3300005354 Bacteria 1909
29 Ga0070674_100007826 3300005356 Bacteria 6321
30 Ga0070674_100050758 3300005356 Bacteria 2856
31 Ga0070674_100189935 3300005356 Bacteria 1579
32 Ga0070659_100000176 3300005366 Bacteria 49062
33 Ga0070709_10047160 3300005434 Bacteria 2683
34 Ga0070714_100143661 3300005435 Bacteria 2144
35 Ga0070714_100147513 3300005435 Bacteria 2117
36 Ga0070713_100067152 3300005436 Bacteria 3018
37 Ga0070713_100080382 3300005436 Bacteria 2779
38 Ga0070710_10000013 3300005437 Bacteria 117825
39 Ga0070711_100006050 3300005439 Bacteria 7267
40 Ga0070711_100020020 3300005439 Bacteria 4305
41 Ga0070705_100029146 3300005440 Bacteria 3032
42 Ga0070705_100100311 3300005440 Bacteria 1827
43 Ga0070700_100000631 3300005441 Bacteria 17489
44 Ga0070700_100007717 3300005441 Bacteria 5828
45 Ga0070700_100008502 3300005441 Bacteria 5589
46 Ga0070708_100002979 3300005445 Bacteria 13153
47 Ga0070708_100014784 3300005445 Bacteria 6432
48 Ga0070663_100002800 3300005455 Bacteria 9895
49 Ga0070663_100212736 3300005455 Bacteria 1514
50 Ga0070678_100020948 3300005456 Bacteria 4300
51 Ga0070678_100096589 3300005456 Bacteria 2280
52 Ga0070662_100099976 3300005457 Bacteria 2193
53 Ga0070681_10126193 3300005458 Bacteria 2492
54 Ga0068867_100035702 3300005459 Bacteria 3606
55 Ga0070685_10116319 3300005466 Bacteria 1655
56 Ga0070706_100000475 3300005467 Bacteria 47520
57 Ga0070706_100013061 3300005467 Bacteria 7686
58 Ga0070706_100129943 3300005467 Bacteria 2350
59 Ga0070707_100041753 3300005468 Bacteria 4391
60 Ga0070707_100063408 3300005468 Bacteria 3547
61 Ga0070707_100097487 3300005468 Bacteria 2848
62 Ga0070698_100004594 3300005471 Bacteria 15163
63 Ga0070698_100085654 3300005471 Bacteria 3138
64 Ga0070698_100101116 3300005471 Bacteria 2855
65 Ga0070699_100003450 3300005518 Bacteria 13975
66 Ga0070679_100074391 3300005530 Bacteria 3388
67 Ga0070679_100224598 3300005530 Bacteria 1838
68 Ga0070684_100001176 3300005535 Bacteria 18794
69 Ga0070684_100088088 3300005535 Bacteria 2757
70 Ga0070684_100246766 3300005535 Bacteria 1632
71 Ga0070697_100000022 3300005536 Bacteria 132993
72 Ga0070697_100027025 3300005536 Bacteria 4589
73 Ga0070697_100218035 3300005536 Bacteria 1626
74 Ga0068853_100197766 3300005539 Bacteria 1828
75 Ga0070672_100085587 3300005543 Bacteria 2534
76 Ga0070686_100097731 3300005544 Bacteria 1977
77 Ga0070695_100033847 3300005545 Bacteria 3199
78 Ga0070696_100073730 3300005546 Bacteria 2406
79 Ga0070665_100000911 3300005548 Bacteria 37941
80 Ga0070665_100201517 3300005548 Bacteria 1991
81 Ga0070704_100013141 3300005549 Bacteria 5130
82 Ga0070704_100051844 3300005549 Bacteria 2892
83 Ga0070704_100225164 3300005549 Bacteria 1527
84 Ga0070664_100019045 3300005564 Bacteria 5644
85 Ga0070664_100068421 3300005564 Bacteria 3036
86 Ga0068857_100118365 3300005577 Bacteria 2384
87 Ga0068854_100173471 3300005578 Bacteria 1679
88 Ga0068856_100020258 3300005614 Bacteria 6459
89 Ga0070702_100005646 3300005615 Bacteria 5853
90 Ga0070702_100009653 3300005615 Bacteria 4732
91 Ga0070702_100021251 3300005615 Bacteria 3412
92 Ga0070702_100152582 3300005615 Bacteria 1485
93 Ga0068859_100242594 3300005617 Bacteria 1891
94 Ga0068864_100133680 3300005618 Bacteria 2231
95 Ga0068861_100060118 3300005719 Bacteria 2911
96 Ga0081455_10019184 3300005937 Bacteria 6480
97 Ga0081455_10021892 3300005937 Bacteria 5987
98 Ga0081455_10059760 3300005937 Bacteria 3217
99 Ga0081455_10100827 3300005937 Bacteria 2319
100 Ga0081455_10110974 3300005937 Bacteria 2180
101 Ga0081538_10000071 3300005981 Bacteria 96238
102 Ga0081538_10000407 3300005981 Bacteria 48780
103 Ga0081538_10000839 3300005981 Bacteria 33322
104 Ga0081538_10001191 3300005981 Bacteria 27404
105 Ga0081538_10002004 3300005981 Bacteria 20341
106 Ga0081538_10005403 3300005981 Bacteria 11484
107 Ga0081538_10007804 3300005981 Bacteria 9191
108 Ga0081538_10009518 3300005981 Bacteria 8095
109 Ga0081538_10010085 3300005981 Bacteria 7784
110 Ga0081538_10010720 3300005981 Bacteria 7502
111 Ga0081538_10013079 3300005981 Bacteria 6598
112 Ga0081538_10016364 3300005981 Bacteria 5691
113 Ga0081538_10019801 3300005981 Bacteria 4979
114 Ga0081538_10025487 3300005981 Bacteria 4167
115 Ga0081538_10027440 3300005981 Bacteria 3948
116 Ga0081538_10033842 3300005981 Bacteria 3392
117 Ga0081538_10035784 3300005981 Bacteria 3255
118 Ga0081538_10063332 3300005981 Bacteria 2100
119 Ga0081540_1000568 3300005983 Bacteria 35821
120 Ga0081540_1000941 3300005983 Bacteria 26197
121 Ga0081540_1026074 3300005983 Bacteria 3346
122 Ga0081540_1037240 3300005983 Bacteria 2581
123 Ga0081539_10001045 3300005985 Bacteria 50690
124 Ga0081539_10001489 3300005985 Bacteria 39599
125 Ga0081539_10005444 3300005985 Bacteria 12992
126 Ga0081539_10013866 3300005985 Bacteria 6029
127 Ga0081539_10015822 3300005985 Bacteria 5446
128 Ga0081539_10081547 3300005985 Bacteria 1699
129 Ga0070717_10000061 3300006028 Bacteria 92257
130 Ga0070717_10003687 3300006028 Bacteria 11001
131 Ga0070717_10011753 3300006028 Bacteria 6662
132 Ga0070717_10028271 3300006028 Bacteria 4487
133 Ga0070717_10142576 3300006028 Bacteria 2068
134 Ga0075365_10000162 3300006038 Bacteria 21120
135 Ga0075365_10006537 3300006038 Bacteria 6421
136 Ga0075365_10020815 3300006038 Bacteria 4076
137 Ga0075363_100008514 3300006048 Bacteria 4779
138 Ga0075364_10009357 3300006051 Bacteria 5874
139 Ga0075364_10099138 3300006051 Bacteria 1939
140 Ga0075432_10004541 3300006058 Bacteria 4727
141 Ga0070712_100000013 3300006175 Bacteria 109912
142 Ga0070712_100002893 3300006175 Bacteria 10651
143 Ga0075367_10041648 3300006178 Bacteria 2686
144 Ga0075369_10046922 3300006186 Bacteria 1862
145 Ga0075428_100067439 3300006844 Bacteria 3916
146 Ga0075428_100079393 3300006844 Bacteria 3582
147 Ga0075430_100003824 3300006846 Bacteria 12675
148 Ga0075430_100005551 3300006846 Bacteria 10654
149 Ga0075430_100012676 3300006846 Bacteria 7181
150 Ga0075431_100000134 3300006847 Bacteria 49630
151 Ga0075431_100008379 3300006847 Bacteria 10343
152 Ga0075431_100035471 3300006847 Bacteria 5135
153 Ga0075431_100150378 3300006847 Bacteria 2398
154 Ga0075433_10059643 3300006852 Bacteria 3338
155 Ga0075433_10091152 3300006852 Bacteria 2694
156 Ga0075434_100021293 3300006871 Bacteria 6302
157 Ga0075434_100153335 3300006871 Bacteria 2324
158 Ga0075429_100000966 3300006880 Bacteria 22797
159 Ga0075429_100076483 3300006880 Bacteria 2916
160 Ga0068865_100001280 3300006881 Bacteria 14644
161 Ga0068865_100147021 3300006881 Bacteria 1784
162 Ga0075436_100081174 3300006914 Bacteria 2248
163 Ga0097620_100242599 3300006931 Bacteria 1891
164 Ga0075435_100093605 3300007076 Bacteria 2483
165 Ga0075435_100101966 3300007076 Bacteria 2379
166 Ga0099794_10001527 3300007265 Bacteria 8143
167 Ga0105240_10030748 3300009093 Bacteria 6975
168 Ga0111539_10008272 3300009094 Bacteria 13241
169 Ga0111539_10063618 3300009094 Bacteria 4365
170 Ga0111539_10304231 3300009094 Bacteria 1855
171 Ga0105245_10001317 3300009098 Bacteria 22424
172 Ga0105245_10007436 3300009098 Bacteria 9595
173 Ga0105245_10031336 3300009098 Bacteria 4705
174 Ga0105245_10037717 3300009098 Bacteria 4297
175 Ga0105247_10056759 3300009101 Bacteria 2419
176 Ga0114129_10000512 3300009147 Bacteria 47473
177 Ga0114129_10082076 3300009147 Bacteria 4480
178 Ga0114129_10159354 3300009147 Bacteria 3084
179 Ga0114129_10313755 3300009147 Bacteria 2086
180 Ga0105243_10078327 3300009148 Bacteria 2690
181 Ga0105243_10084792 3300009148 Bacteria 2596
182 Ga0105242_10098001 3300009176 Bacteria 2479
183 Ga0105248_10112289 3300009177 Bacteria 3074
184 Ga0105248_10453998 3300009177 Bacteria 1444
185 Ga0105237_10049423 3300009545 Bacteria 4227
186 Ga0105237_10204027 3300009545 Bacteria 1977
187 Ga0105239_10040445 3300010375 Bacteria 5108
188 Ga0105239_10233055 3300010375 Bacteria 2066
189 Ga0105239_10282232 3300010375 Bacteria 1870
190 Ga0157370_10017109 3300013104 Bacteria 7322
191 Ga0157369_10299946 3300013105 Bacteria 1671
192 Ga0157374_10015146 3300013296 Bacteria 6762
193 Ga0157372_10018103 3300013307 Bacteria 7572
194 Ga0157372_10084129 3300013307 Bacteria 3605
195 Ga0157375_10303954 3300013308 Bacteria 1759
196 Ga0163163_10066084 3300014325 Bacteria 3591
197 Ga0163163_10122010 3300014325 Bacteria 2640
198 Ga0163163_10185551 3300014325 Bacteria 2128
199 Ga0157377_10007587 3300014745 Bacteria 5247
200 Ga0157379_10003167 3300014968 Bacteria 13926
201 Ga0157376_10043308 3300014969 Bacteria 3694
202 Ga0157376_10195706 3300014969 Bacteria 1857
203 Ga0213874_10001886 3300021377 Bacteria 4412
204 Ga0213876_10017513 3300021384 Bacteria 3783
205 Ga0213876_10065185 3300021384 Bacteria 1922
206 Ga0213876_10088857 3300021384 Bacteria 1636
207 Ga0213876_10097055 3300021384 Bacteria 1561
208 Ga0213875_10000148 3300021388 Bacteria 74125
209 Ga0213875_10014084 3300021388 Bacteria 3910
210 Ga0207426_1011793 3300025302 Bacteria 3309
211 Ga0207656_10013585 3300025321 Bacteria 3117
212 Ga0207692_10000003 3300025898 Bacteria 431531
213 Ga0207692_10021322 3300025898 Bacteria 2963
214 Ga0207710_10077258 3300025900 Bacteria 1538
215 Ga0207688_10009130 3300025901 Bacteria 5399
216 Ga0207688_10047303 3300025901 Bacteria 2403
217 Ga0207699_10013246 3300025906 Bacteria 4216
218 Ga0207699_10087664 3300025906 Bacteria 1946
219 Ga0207645_10065100 3300025907 Bacteria 2329
220 Ga0207684_10001451 3300025910 Bacteria 25581
221 Ga0207684_10028200 3300025910 Bacteria 4782
222 Ga0207684_10037343 3300025910 Bacteria 4121
223 Ga0207684_10042309 3300025910 Bacteria 3861
224 Ga0207695_10002407 3300025913 Bacteria 27694
225 Ga0207693_10006406 3300025915 Bacteria 9756
226 Ga0207693_10007488 3300025915 Bacteria 8975
227 Ga0207693_10017236 3300025915 Bacteria 5760
228 Ga0207693_10017486 3300025915 Bacteria 5719
229 Ga0207693_10080777 3300025915 Bacteria 2545
230 Ga0207663_10000169 3300025916 Bacteria 29379
231 Ga0207663_10018543 3300025916 Bacteria 3903
232 Ga0207663_10156883 3300025916 Bacteria 1602
233 Ga0207657_10004224 3300025919 Bacteria 15215
234 Ga0207657_10016599 3300025919 Bacteria 7094
235 Ga0207657_10032101 3300025919 Bacteria 4748
236 Ga0207649_10069644 3300025920 Bacteria 2241
237 Ga0207652_10010267 3300025921 Bacteria 7537
238 Ga0207646_10001394 3300025922 Bacteria 29965
239 Ga0207646_10005170 3300025922 Bacteria 13804
240 Ga0207646_10009069 3300025922 Bacteria 9879
241 Ga0207646_10022289 3300025922 Bacteria 5837
242 Ga0207646_10025575 3300025922 Bacteria 5399
243 Ga0207646_10044341 3300025922 Bacteria 3992
244 Ga0207681_10003442 3300025923 Bacteria 9870
245 Ga0207681_10135774 3300025923 Bacteria 1825
246 Ga0207650_10077892 3300025925 Bacteria 2507
247 Ga0207687_10018790 3300025927 Bacteria 4569
248 Ga0207687_10051175 3300025927 Bacteria 2878
249 Ga0207700_10012481 3300025928 Bacteria 5482
250 Ga0207664_10002161 3300025929 Bacteria 12930
251 Ga0207664_10032533 3300025929 Bacteria 3998
252 Ga0207664_10051994 3300025929 Bacteria 3238
253 Ga0207664_10064005 3300025929 Bacteria 2940
254 Ga0207664_10077006 3300025929 Bacteria 2701
255 Ga0207690_10000054 3300025932 Bacteria 104097
256 Ga0207690_10102783 3300025932 Bacteria 2044
257 Ga0207706_10068422 3300025933 Bacteria 3124
258 Ga0207704_10011097 3300025938 Bacteria 4422
259 Ga0207704_10051106 3300025938 Bacteria 2497
260 Ga0207704_10103895 3300025938 Bacteria 1902
261 Ga0207704_10137842 3300025938 Bacteria 1701
262 Ga0207691_10096543 3300025940 Bacteria 2642
263 Ga0207691_10098325 3300025940 Bacteria 2614
264 Ga0207661_10003968 3300025944 Bacteria 10338
265 Ga0207661_10060212 3300025944 Bacteria 3063
266 Ga0207661_10124996 3300025944 Bacteria 2195
267 Ga0207679_10014491 3300025945 Bacteria 5186
268 Ga0207679_10072688 3300025945 Bacteria 2599
269 Ga0207651_10069661 3300025960 Bacteria 2485
270 Ga0207712_10051475 3300025961 Bacteria 2881
271 Ga0207712_10055388 3300025961 Bacteria 2789
272 Ga0207668_10070714 3300025972 Bacteria 2490
273 Ga0207640_10096750 3300025981 Bacteria 2059
274 Ga0207677_10049745 3300026023 Bacteria 2830
275 Ga0207677_10077193 3300026023 Bacteria 2375
276 Ga0207678_10002606 3300026067 Bacteria 16433
277 Ga0207678_10082289 3300026067 Bacteria 2755
278 Ga0207678_10088038 3300026067 Bacteria 2654
279 Ga0207708_10001007 3300026075 Bacteria 21085
280 Ga0207708_10006410 3300026075 Bacteria 8718
281 Ga0207708_10028439 3300026075 Bacteria 4234
282 Ga0207708_10191134 3300026075 Bacteria 1630
283 Ga0207702_10085593 3300026078 Bacteria 2747
284 Ga0207648_10148068 3300026089 Bacteria 2071
285 Ga0207648_10196803 3300026089 Bacteria 1787
286 Ga0207676_10032249 3300026095 Bacteria 3946
287 Ga0207674_10023744 3300026116 Bacteria 6563
288 Ga0207675_100101254 3300026118 Bacteria 2714
289 Ga0207683_10034359 3300026121 Bacteria 4406
290 Ga0207683_10096602 3300026121 Bacteria 2634
291 Ga0207698_10200730 3300026142 Bacteria 1785
292 Ga0209588_1002474 3300027671 Bacteria 5011
293 Ga0207428_10057312 3300027907 Bacteria 3093
294 Ga0207428_10161476 3300027907 Bacteria 1701
295 Ga0207428_10167941 3300027907 Bacteria 1663
296 Ga0268266_10004582 3300028379 Bacteria 13202
297 Ga0265337_1001176 3300028556 Bacteria 13342
298 Ga0265326_10000005 3300028558 Bacteria 257124
299 Ga0265326_10002998 3300028558 Bacteria 5614
300 Ga0265319_1000034 3300028563 Bacteria 117363
301 Ga0265319_1000756 3300028563 Bacteria 21053
302 Ga0265319_1001901 3300028563 Bacteria 11865
303 Ga0265334_10000024 3300028573 Bacteria 118525
304 Ga0265318_10000545 3300028577 Bacteria 26811
305 Ga0265318_10001315 3300028577 Bacteria 14882
306 Ga0265336_10000001 3300028666 Bacteria 916179
307 Ga0265336_10006532 3300028666 Bacteria 4196
308 Ga0265338_10000004 3300028800 Bacteria 644793
309 Ga0265338_10006763 3300028800 Bacteria 14461
310 Ga0265338_10008060 3300028800 Bacteria 12884
311 Ga0265324_10001235 3300029957 Bacteria 15108
312 Ga0265320_10015457 3300031240 Bacteria 4314
313 Ga0265340_10000002 3300031247 Bacteria 711693
314 Ga0265327_10002862 3300031251 Bacteria 17366
315 Ga0265316_10030285 3300031344 Bacteria 4438
316 Ga0307408_100052371 3300031548 Bacteria 2944
317 Ga0307408_100140076 3300031548 Bacteria 1898
318 Ga0265314_10004533 3300031711 Bacteria 12838
319 Ga0307405_10054391 3300031731 Bacteria 2499
320 Ga0307413_10111285 3300031824 Bacteria 1834
321 Ga0307413_10139087 3300031824 Bacteria 1675
322 Ga0307410_10014490 3300031852 Bacteria 4640
323 Ga0307410_10253978 3300031852 Bacteria 1368
324 Ga0307406_10017241 3300031901 Bacteria 4204
325 Ga0307406_10029133 3300031901 Bacteria 3342
326 Ga0307406_10078807 3300031901 Bacteria 2183
327 Ga0307406_10104437 3300031901 Bacteria 1937
328 Ga0307407_10004725 3300031903 Bacteria 5822
329 Ga0307412_10114521 3300031911 Bacteria 1931
330 Ga0307412_10160447 3300031911 Bacteria 1670
331 Ga0307409_100011600 3300031995 Bacteria 5567
332 Ga0307409_100063756 3300031995 Bacteria 2891
333 Ga0307409_100101435 3300031995 Bacteria 2388
334 Ga0307409_100186388 3300031995 Bacteria 1842
335 Ga0307409_100358743 3300031995 Bacteria 1378
336 Ga0307416_100006134 3300032002 Bacteria 7489
337 Ga0307416_100040991 3300032002 Bacteria 3603
338 Ga0307414_10123422 3300032004 Bacteria 1996
339 Ga0307415_100000210 3300032126 Bacteria 25787
340 Ga0307415_100044436 3300032126 Bacteria 2970
341 Ga0307415_100065587 3300032126 Bacteria 2530
342 Ga0307415_100076431 3300032126 Bacteria 2374
343 Ga0373953_0007813 3300035117 Bacteria 3603
344 Ga0373954_0022104 3300035118 Bacteria 2884
345 Ga0395900_0002246 3300037418 Bacteria 21499
346 Ga0395900_0137146 3300037418 Bacteria 2507
347 Ga0395900_0165725 3300037418 Bacteria 2252
348 Ga0395898_0003455 3300037466 Bacteria 17662
349 Ga0395898_0010567 3300037466 Bacteria 9641
350 Ga0395898_0091022 3300037466 Bacteria 2935
351 Ga0395898_0122044 3300037466 Bacteria 2497
352 Ga0395898_0158013 3300037466 Bacteria 2168
353 Ga0395898_0283876 3300037466 Bacteria 1579
354 Ga0395905_0023450 3300037471 Bacteria 5830
355 Ga0395905_0053535 3300037471 Bacteria 3777
356 Ga0395905_0146681 3300037471 Bacteria 2220
357 Ga0436364_0031839 3300037853 Bacteria 3607
358 Ga0436364_1122530 3300037853 Bacteria 16819
359 Ga0436364_1438537 3300037853 Bacteria 5416
360 Ga0395901_0006802 3300038443 Bacteria 11553
361 Ga0395901_0057698 3300038443 Bacteria 4038
362 Ga0395901_0077495 3300038443 Bacteria 3469
363 Ga0395901_0212932 3300038443 Bacteria 2022
364 Ga0395901_0381202 3300038443 Bacteria 1451
365 Ga0436365_0403715 3300039437 Bacteria 17000
366 Ga0436365_0808769 3300039437 Bacteria 1519
367 Ga0436365_0863005 3300039437 Bacteria 1481
368 Ga0436365_1102108 3300039437 Bacteria 21525
369 Ga0436365_1468086 3300039437 Bacteria 9438
370 Ga0436365_1725409 3300039437 Bacteria 5697
371 Ga0436363_0386698 3300039450 Bacteria 5677
372 Ga0436363_1064792 3300039450 Bacteria 6028
373 Ga0436363_1110229 3300039450 Bacteria 1497
374 Ga0436363_1400525 3300039450 Bacteria 18081
375 Ga0436362_0352471 3300039453 Bacteria 2252
376 Ga0436362_0637497 3300039453 Bacteria 2429
377 Ga0436362_1195802 3300039453 Bacteria 1625
378 Ga0439463_029393 3300042016 Bacteria 1384
379 Ga0450902_012806 3300042137 Bacteria 1346
380 Ga0453683_0044080 3300044673 Bacteria 2798
381 Ga0453683_0130110 3300044673 Bacteria 1586
382 Ga0466965_0021066 3300044683 Bacteria 3137
383 Ga0466966_0022394 3300044684 Bacteria 4147
384 Ga0466961_0017029 3300044693 Bacteria 4667
385 Ga0466961_0022190 3300044693 Bacteria 4084
386 Ga0466961_0042579 3300044693 Bacteria 2911
387 Ga0466963_0008578 3300044694 Bacteria 6134
388 Ga0466963_0009122 3300044694 Bacteria 5964
389 Ga0466963_0015641 3300044694 Bacteria 4705
390 Ga0466963_0017524 3300044694 Bacteria 4465
391 Ga0466963_0017976 3300044694 Bacteria 4411
392 Ga0466963_0033878 3300044694 Bacteria 3320
393 Ga0466963_0040185 3300044694 Bacteria 3066
394 Ga0466963_0124490 3300044694 Bacteria 1776
395 Ga0453684_0008064 3300044712 Bacteria 19044
396 Ga0466970_0024812 3300044765 Bacteria 3136
397 Ga0466970_0025564 3300044765 Bacteria 3092
398 Ga0466970_0040102 3300044765 Bacteria 2486
399 Ga0466957_0060757 3300044842 Bacteria 2318
400 Ga0466957_0079669 3300044842 Bacteria 2038
401 Ga0466960_0029510 3300044901 Bacteria 2517
402 Ga0466960_0040981 3300044901 Bacteria 2192
403 Ga0466959_0001464 3300045049 Bacteria 14467
404 Ga0466959_0006901 3300045049 Bacteria 7927
405 Ga0466959_0014631 3300045049 Bacteria 5708
406 Ga0466959_0057063 3300045049 Bacteria 2848
407 Ga0466959_0202441 3300045049 Bacteria 1382
408 Ga0451576_0415728 3300045051 Bacteria 1411
409 Ga0466958_0001617 3300045836 Bacteria 10842
410 Ga0466958_0005363 3300045836 Bacteria 6889
411 Ga0466958_0015156 3300045836 Bacteria 4412
412 Ga0466958_0021420 3300045836 Bacteria 3778
413 Ga0466958_0081711 3300045836 Bacteria 1989
414 Ga0466958_0084658 3300045836 Bacteria 1956
415 Ga0466958_0112636 3300045836 Bacteria 1699
416 Ga0466967_0001002 3300045976 Bacteria 15413
417 Ga0466967_0004740 3300045976 Bacteria 9253
418 Ga0466967_0040152 3300045976 Bacteria 4027
419 Ga0466967_0066665 3300045976 Bacteria 3208
420 Ga0466967_0081421 3300045976 Bacteria 2924
421 Ga0466967_0086414 3300045976 Bacteria 2841
422 Ga0466967_0144983 3300045976 Bacteria 2214
423 Ga0466967_0226275 3300045976 Bacteria 1779
424 Ga0466967_0294484 3300045976 Bacteria 1560
425 Ga0466967_0325591 3300045976 Bacteria 1483
426 Ga0495641_0006906 3300046461 Bacteria 7243
427 Ga0495641_0026307 3300046461 Bacteria 2840
428 Ga0495651_0010955 3300046462 Bacteria 6975
429 Ga0495653_0000536 3300046463 Bacteria 29053
430 Ga0495650_0000053 3300046471 Bacteria 316684
431 Ga0495582_0071752 3300046473 Bacteria 1916
432 Ga0495664_0000073 3300046477 Bacteria 49243
433 Ga0495618_0000046 3300046514 Bacteria 93942
434 Ga0495628_0186278 3300046516 Bacteria 1568
435 Ga0495630_0000241 3300046517 Bacteria 43800
436 Ga0495630_0147751 3300046517 Bacteria 1788
437 Ga0495652_0055641 3300046529 Bacteria 3363
438 Ga0495640_0176729 3300046533 Bacteria 1362
439 Ga0495587_0026741 3300046536 Bacteria 3515
440 Ga0495645_0000022 3300046543 Bacteria 137019
441 Ga0495645_0000119 3300046543 Bacteria 53463
442 Ga0495656_0008515 3300046615 Bacteria 3664
443 Ga0495635_0011412 3300046663 Bacteria 6232
444 Ga0495657_0000226 3300046675 Bacteria 50909
445 Ga0495657_0010844 3300046675 Bacteria 6841
446 Ga0495657_0116251 3300046675 Bacteria 1689
447 Ga0495646_0040811 3300046680 Bacteria 2855
448 Ga0495646_0050644 3300046680 Bacteria 2517
449 Ga0495670_0068787 3300046691 Bacteria 1790
450 Ga0495600_0058520 3300046809 Bacteria 2517
451 Ga0495600_0085604 3300046809 Bacteria 2057
452 Ga0495604_0000148 3300047317 Bacteria 60608
453 Ga0495604_0020614 3300047317 Bacteria 5264
454 Ga0495674_0015458 3300047319 Bacteria 7132
455 Ga0495672_0027013 3300047320 Bacteria 3654
456 Ga0495676_0071845 3300047321 Bacteria 2659
457 Ga0495680_0003599 3300047322 Bacteria 15170
458 Ga0495675_0027217 3300047444 Bacteria 3644
459 Ga0495675_0078228 3300047444 Bacteria 2083
460 Ga0495673_0012407 3300047469 Bacteria 4522
461 Ga0495684_0004277 3300047471 Bacteria 11140
462 Ga0495684_0011380 3300047471 Bacteria 6870
463 Ga0495686_0000011 3300047472 Bacteria 514750
464 Ga0495686_0002303 3300047472 Bacteria 18261
465 Ga0495686_0025906 3300047472 Bacteria 3840
466 Ga0495602_0027711 3300048088 Bacteria 5440
467 Ga0495615_0015247 3300048090 Bacteria 1638
468 Ga0496100_0000450 3300048903 Bacteria 19877
469 Ga0496100_0001662 3300048903 Bacteria 11028
470 Ga0496100_0015709 3300048903 Bacteria 4425
471 Ga0496100_0144837 3300048903 Bacteria 1688
472 Ga0496101_0001032 3300048904 Bacteria 16420
473 Ga0496101_0001988 3300048904 Bacteria 12406
474 Ga0496101_0011341 3300048904 Bacteria 5911
475 Ga0496102_0000040 3300048905 Bacteria 196737
476 Ga0496102_0008080 3300048905 Bacteria 9001
477 Ga0496102_0008194 3300048905 Bacteria 8941
478 Ga0496102_0012915 3300048905 Bacteria 7232
479 Ga0496102_0071006 3300048905 Bacteria 3197
480 Ga0496102_0095397 3300048905 Bacteria 2757
481 Ga0496102_0227128 3300048905 Bacteria 1760
482 Ga0496103_0000067 3300048906 Bacteria 125906
483 Ga0496103_0001681 3300048906 Bacteria 14474
484 Ga0496103_0007171 3300048906 Bacteria 6649
485 Ga0496104_0000006 3300048907 Bacteria 536446
486 Ga0496104_0013656 3300048907 Bacteria 7322
487 Ga0496104_0018185 3300048907 Bacteria 6410
488 Ga0496104_0033875 3300048907 Bacteria 4760
489 Ga0496104_0066277 3300048907 Bacteria 3428
490 Ga0496104_0066408 3300048907 Bacteria 3425
491 Ga0496105_0005449 3300048908 Bacteria 9654
492 Ga0496105_0014697 3300048908 Bacteria 6232
493 Ga0496105_0095153 3300048908 Bacteria 2460
494 Ga0496105_0109754 3300048908 Bacteria 2277
495 Ga0496106_0009964 3300048909 Bacteria 7016
496 Ga0496106_0015340 3300048909 Bacteria 5670
497 Ga0496106_0015875 3300048909 Bacteria 5571
498 Ga0496106_0027332 3300048909 Bacteria 4249
499 Ga0496106_0111245 3300048909 Bacteria 2133
500 Ga0496106_0128685 3300048909 Bacteria 1984
501 Ga0496106_0164714 3300048909 Bacteria 1754
502 Ga0496107_0002155 3300048910 Bacteria 12647
503 Ga0496107_0012518 3300048910 Bacteria 5922
504 Ga0496107_0038123 3300048910 Bacteria 3449
505 Ga0496107_0061867 3300048910 Bacteria 2711
506 Ga0496107_0124848 3300048910 Bacteria 1898
507 Ga0496108_0002529 3300048911 Bacteria 14633
508 Ga0496108_0004671 3300048911 Bacteria 11040
509 Ga0496108_0012091 3300048911 Bacteria 7018
510 Ga0496108_0013342 3300048911 Bacteria 6700
511 Ga0496109_0002676 3300048912 Bacteria 14960
512 Ga0496109_0007698 3300048912 Bacteria 9129
513 Ga0496109_0008856 3300048912 Bacteria 8565
514 Ga0496109_0011949 3300048912 Bacteria 7476
515 Ga0496109_0019443 3300048912 Bacteria 5991
516 Ga0496109_0028889 3300048912 Bacteria 4964
517 Ga0496109_0089498 3300048912 Bacteria 2846
518 Ga0496109_0133062 3300048912 Bacteria 2322
519 Ga0496110_0000064 3300048913 Bacteria 52955
520 Ga0496110_0001092 3300048913 Bacteria 19117
521 Ga0496110_0006623 3300048913 Bacteria 9201
522 Ga0496110_0022612 3300048913 Bacteria 5341
523 Ga0496110_0038804 3300048913 Bacteria 4145
524 Ga0496110_0086550 3300048913 Bacteria 2798
525 Ga0496110_0094887 3300048913 Bacteria 2671
526 Ga0496110_0156942 3300048913 Bacteria 2061
527 Ga0496110_0168470 3300048913 Bacteria 1987
528 Ga0496111_0002025 3300048914 Bacteria 12063
529 Ga0496111_0012371 3300048914 Bacteria 5775
530 Ga0496111_0052557 3300048914 Bacteria 2942
531 Ga0496112_0000003 3300048915 Bacteria 660147
532 Ga0496112_0000095 3300048915 Bacteria 57431
533 Ga0496112_0005797 3300048915 Bacteria 10744
534 Ga0496112_0020405 3300048915 Bacteria 6281
535 Ga0496112_0053590 3300048915 Bacteria 3962
536 Ga0496112_0089669 3300048915 Bacteria 3043
537 Ga0496112_0292304 3300048915 Bacteria 1575
538 Ga0496113_0030969 3300048916 Bacteria 3877
539 Ga0496113_0066251 3300048916 Bacteria 2735
540 Ga0496114_0010676 3300048917 Bacteria 7309
541 Ga0496114_0070180 3300048917 Bacteria 2942
542 Ga0496115_0000059 3300048918 Bacteria 102022
543 Ga0496115_0000087 3300048918 Bacteria 86513
544 Ga0496115_0005651 3300048918 Bacteria 9094
545 Ga0496115_0010330 3300048918 Bacteria 6970
546 Ga0496115_0074997 3300048918 Bacteria 2747
547 Ga0496115_0205368 3300048918 Bacteria 1627
548 Ga0496117_0039569 3300048920 Bacteria 3478
549 Ga0496119_0066705 3300048922 Bacteria 2125
550 Ga0496121_0002770 3300048924 Bacteria 26007
551 Ga0496121_0101083 3300048924 Bacteria 2224
552 Ga0496124_0115740 3300048927 Bacteria 2151
553 Ga0501031_0008936 3300049568 Bacteria 6514
554 Ga0501032_0004500 3300049569 Bacteria 10493
555 Ga0501032_0068591 3300049569 Bacteria 2367
556 Ga0501033_0121690 3300049570 Bacteria 1893
557 Ga0501034_0008091 3300049571 Bacteria 11153
558 Ga0501034_0050215 3300049571 Bacteria 4207
559 Ga0501036_0052553 3300049572 Bacteria 3450
560 Ga0501036_0058695 3300049572 Bacteria 3260
561 Ga0501037_0118634 3300049573 Bacteria 1903
562 Ga0501038_0005589 3300049574 Bacteria 11667
563 Ga0501038_0046400 3300049574 Bacteria 3767
564 Ga0501039_0068499 3300049575 Bacteria 2755
565 Ga0501039_0078652 3300049575 Bacteria 2565
566 Ga0501040_0010625 3300049576 Bacteria 6021
567 Ga0501040_0223522 3300049576 Bacteria 1340
568 Ga0501041_0086372 3300049577 Bacteria 1935
569 Ga0501042_0025820 3300049578 Bacteria 4128
570 Ga0501042_0104931 3300049578 Bacteria 2034
571 Ga0501042_0160550 3300049578 Bacteria 1622
572 Ga0501046_0002368 3300049580 Bacteria 17730
573 Ga0501046_0062823 3300049580 Bacteria 2901
574 Ga0501048_0015968 3300049582 Bacteria 5539
575 Ga0501048_0046630 3300049582 Bacteria 3093
576 Ga0501067_0081330 3300049583 Bacteria 1796
577 Ga0501068_0022156 3300049584 Bacteria 3712
578 Ga0501069_0001600 3300049585 Bacteria 11199
579 Ga0501069_0057514 3300049585 Bacteria 2168
580 Ga0501070_0041608 3300049586 Bacteria 3827
581 Ga0501070_0072465 3300049586 Bacteria 2851
582 Ga0501071_0177665 3300049587 Bacteria 1595
583 Ga0501072_0014927 3300049588 Bacteria 5953
584 Ga0501072_0016803 3300049588 Bacteria 5620
585 Ga0501072_0037754 3300049588 Bacteria 3789
586 Ga0501072_0156522 3300049588 Bacteria 1817
587 Ga0501073_0007298 3300049589 Bacteria 8226
588 Ga0501073_0179281 3300049589 Bacteria 1466
589 Ga0501074_0108291 3300049590 Bacteria 1989
590 Ga0501074_0156252 3300049590 Bacteria 1629
591 Ga0501075_0022561 3300049591 Bacteria 4599
592 Ga0501075_0136751 3300049591 Bacteria 1867
593 Ga0501077_0117980 3300049593 Bacteria 1682
594 Ga0501079_0167108 3300049741 Bacteria 1716
595 Ga0501080_0012732 3300049742 Bacteria 7715
596 Ga0501083_0021160 3300049744 Bacteria 4520
597 Ga0501035_0023094 3300049822 Bacteria 5708
598 Ga0501044_0222036 3300049823 Bacteria 1840
599 Ga0501045_0010013 3300049824 Bacteria 6631
600 Ga0501045_0067104 3300049824 Bacteria 2634
601 Ga0501045_0162393 3300049824 Bacteria 1663
602 nmdc:mga00v17_14935_c1 3300050491 Bacteria 4348
603 nmdc:mga00v17_24681_c1 3300050491 Bacteria 3488
604 nmdc:mga0yw44_182971_c1 3300050492 Bacteria 1380
605 nmdc:mga0yw44_212097_c1 3300050492 Bacteria 1281
606 nmdc:mga0yw44_92281_c1 3300050492 Bacteria 1916
607 nmdc:mga06z11_12937_c1 3300050494 Bacteria 3645
608 nmdc:mga06z11_25263_c1 3300050494 Bacteria 2813
609 nmdc:mga05p37_145196_c1 3300050507 Bacteria 2906
610 nmdc:mga05p37_223964_c1 3300050507 Bacteria 2269
611 nmdc:mga05p37_39026_c1 3300050507 Bacteria 5826
612 nmdc:mga05p37_820_c1 3300050507 Bacteria 34830
613 nmdc:mga09592_128396_c1 3300050508 Bacteria 2180
614 nmdc:mga09592_14752_c1 3300050508 Bacteria 6376
615 nmdc:mga09592_39660_c1 3300050508 Bacteria 3956
616 nmdc:mga0qj67_1947_c1 3300050509 Bacteria 14696
617 nmdc:mga0qj67_241736_c1 3300050509 Bacteria 1465
618 nmdc:mga0qj67_47848_c1 3300050509 Bacteria 3379
619 nmdc:mga0qj67_64600_c1 3300050509 Bacteria 2912
620 nmdc:mga0qj67_77597_c1 3300050509 Bacteria 2658
621 nmdc:mga06r32_1211_c1 3300050510 Bacteria 23236
622 nmdc:mga06r32_7689_c1 3300050510 Bacteria 9695
623 nmdc:mga08y16_161822_c1 3300050511 Bacteria 2326
624 nmdc:mga08y16_22098_c1 3300050511 Bacteria 6716
625 nmdc:mga0n895_149931_c1 3300050512 Bacteria 2362
626 nmdc:mga0n895_322636_c1 3300050512 Bacteria 1565
627 nmdc:mga0n895_379387_c1 3300050512 Bacteria 1431
628 nmdc:mga0n895_48912_c1 3300050512 Bacteria 4141
629 nmdc:mga0rr50_24371_c1 3300050513 Bacteria 4189
630 nmdc:mga0a205_21039_c1 3300050515 Bacteria 6167
631 nmdc:mga0a205_34741_c1 3300050515 Bacteria 4838
632 nmdc:mga0a205_50302_c1 3300050515 Bacteria 4023
633 nmdc:mga0sz30_41416_c1 3300050516 Bacteria 1936
634 Ga0495601_0001152 3300053077 Bacteria 14446
635 Ga0495601_0013587 3300053077 Bacteria 4898
636 Ga0495612_0000032 3300053078 Bacteria 78122
637 Ga0495595_0048126 3300053084 Bacteria 1968
638 Ga0495619_0018953 3300053085 Bacteria 4370
639 Ga0500556_0000262 3300053104 Bacteria 41714
640 Ga0500616_0004560 3300053153 Bacteria 9808
641 Ga0500616_0006584 3300053153 Bacteria 7574
642 Ga0501084_0033542 3300054114 Bacteria 4295
643 Ga0501084_0063159 3300054114 Bacteria 3100
644 Ga0501082_0022434 3300060353 Bacteria 5437
645 Ga0466962_0039153 3300061719 Bacteria 2270
646 Ga0530510_0008178 3300061734 Bacteria 7296
647 Ga0530510_0029873 3300061734 Bacteria 3913

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0223522 Ga0501040_0223522_29_1141 370
2 3300005468 Ga0070707_100097487 Ga0070707_1000974873 380
3 3300005471 Ga0070698_100004594 Ga0070698_10000459411 380
4 3300025922 Ga0207646_10009069 Ga0207646_1000906910 380
5 3300025922 Ga0207646_10022289 Ga0207646_100222897 380
6 3300042137 Ga0450902_012806 Ga0450902_012806_11_1153 380
7 3300050494 nmdc:mga06z11_12937_c1 nmdc:mga06z11_12937_c1_1391_2545 384
8 3300050507 nmdc:mga05p37_223964_c1 nmdc:mga05p37_223964_c1_1075_2229 384
9 3300050512 nmdc:mga0n895_379387_c1 nmdc:mga0n895_379387_c1_262_1416 384
10 3300005329 Ga0070683_100047627 Ga0070683_1000476272 385
11 3300005338 Ga0068868_100016295 Ga0068868_1000162953 385
12 3300005441 Ga0070700_100000631 Ga0070700_10000063112 385
13 3300005456 Ga0070678_100096589 Ga0070678_1000965892 385
14 3300005466 Ga0070685_10116319 Ga0070685_101163192 385
15 3300005535 Ga0070684_100001176 Ga0070684_10000117614 385
16 3300005549 Ga0070704_100225164 Ga0070704_1002251642 385
17 3300005564 Ga0070664_100019045 Ga0070664_1000190454 385
18 3300005614 Ga0068856_100020258 Ga0068856_1000202583 385
19 3300005615 Ga0070702_100009653 Ga0070702_1000096536 385
20 3300005981 Ga0081538_10005403 Ga0081538_100054032 385
21 3300006847 Ga0075431_100008379 Ga0075431_10000837910 385
22 3300006852 Ga0075433_10059643 Ga0075433_100596435 385
23 3300009094 Ga0111539_10304231 Ga0111539_103042312 385
24 3300009098 Ga0105245_10031336 Ga0105245_100313366 385
25 3300009147 Ga0114129_10000512 Ga0114129_1000051226 385
26 3300013296 Ga0157374_10015146 Ga0157374_100151464 385
27 3300013307 Ga0157372_10018103 Ga0157372_100181034 385
28 3300014325 Ga0163163_10066084 Ga0163163_100660841 385
29 3300025901 Ga0207688_10009130 Ga0207688_100091305 385
30 3300025915 Ga0207693_10017236 Ga0207693_100172364 385
31 3300025927 Ga0207687_10018790 Ga0207687_100187905 385
32 3300025940 Ga0207691_10096543 Ga0207691_100965433 385
33 3300025945 Ga0207679_10014491 Ga0207679_100144913 385
34 3300025961 Ga0207712_10055388 Ga0207712_100553883 385
35 3300025972 Ga0207668_10070714 Ga0207668_100707142 385
36 3300026067 Ga0207678_10088038 Ga0207678_100880383 385
37 3300026095 Ga0207676_10032249 Ga0207676_100322493 385
38 3300044765 Ga0466970_0025564 Ga0466970_0025564_687_1862 385
39 3300046533 Ga0495640_0176729 Ga0495640_0176729_177_1352 385
40 3300046809 Ga0495600_0085604 Ga0495600_0085604_51_1235 385
41 3300048904 Ga0496101_0011341 Ga0496101_0011341_2247_3482 385
42 3300048905 Ga0496102_0008194 Ga0496102_0008194_5780_7015 385
43 3300048906 Ga0496103_0007171 Ga0496103_0007171_4282_5517 385
44 3300048907 Ga0496104_0018185 Ga0496104_0018185_2958_4193 385
45 3300048908 Ga0496105_0014697 Ga0496105_0014697_2295_3530 385
46 3300048910 Ga0496107_0061867 Ga0496107_0061867_196_1431 385
47 3300048911 Ga0496108_0012091 Ga0496108_0012091_1207_2442 385
48 3300048912 Ga0496109_0002676 Ga0496109_0002676_4065_5300 385
49 3300048913 Ga0496110_0038804 Ga0496110_0038804_719_1954 385
50 3300048914 Ga0496111_0012371 Ga0496111_0012371_1207_2442 385
51 3300048916 Ga0496113_0030969 Ga0496113_0030969_1108_2343 385
52 3300049571 Ga0501034_0050215 Ga0501034_0050215_15_1172 385
53 3300049574 Ga0501038_0046400 Ga0501038_0046400_540_1748 385
54 3300050507 nmdc:mga05p37_39026_c1 nmdc:mga05p37_39026_c1_2119_3357 385
55 3300050510 nmdc:mga06r32_7689_c1 nmdc:mga06r32_7689_c1_110_1336 385
56 3300050512 nmdc:mga0n895_48912_c1 nmdc:mga0n895_48912_c1_2288_3526 385
57 3300050513 nmdc:mga0rr50_24371_c1 nmdc:mga0rr50_24371_c1_1360_2586 385
58 3300050515 nmdc:mga0a205_21039_c1 nmdc:mga0a205_21039_c1_3755_4993 385
59 3300050515 nmdc:mga0a205_34741_c1 nmdc:mga0a205_34741_c1_3575_4801 385
60 3300005347 Ga0070668_100103180 Ga0070668_1001031803 387
61 3300005445 Ga0070708_100002979 Ga0070708_1000029796 387
62 3300005467 Ga0070706_100013061 Ga0070706_1000130614 387
63 3300005468 Ga0070707_100041753 Ga0070707_1000417533 387
64 3300005468 Ga0070707_100063408 Ga0070707_1000634083 387
65 3300005471 Ga0070698_100085654 Ga0070698_1000856543 387
66 3300005536 Ga0070697_100218035 Ga0070697_1002180352 387
67 3300005985 Ga0081539_10015822 Ga0081539_100158226 387
68 3300006846 Ga0075430_100003824 Ga0075430_1000038246 387
69 3300006871 Ga0075434_100021293 Ga0075434_1000212934 387
70 3300006880 Ga0075429_100000966 Ga0075429_1000009669 387
71 3300006914 Ga0075436_100081174 Ga0075436_1000811743 387
72 3300007076 Ga0075435_100093605 Ga0075435_1000936053 387
73 3300007265 Ga0099794_10001527 Ga0099794_100015277 387
74 3300009148 Ga0105243_10084792 Ga0105243_100847922 387
75 3300025910 Ga0207684_10042309 Ga0207684_100423096 387
76 3300025922 Ga0207646_10005170 Ga0207646_1000517015 387
77 3300025922 Ga0207646_10044341 Ga0207646_100443414 387
78 3300027671 Ga0209588_1002474 Ga0209588_10024746 387
79 3300044673 Ga0453683_0044080 Ga0453683_0044080_148_1326 387
80 3300044673 Ga0453683_0130110 Ga0453683_0130110_313_1491 387
81 3300045051 Ga0451576_0415728 Ga0451576_0415728_67_1245 387
82 3300048915 Ga0496112_0000003 Ga0496112_0000003_500435_501667 387
83 3300048915 Ga0496112_0053590 Ga0496112_0053590_1239_2513 387
84 3300049741 Ga0501079_0167108 Ga0501079_0167108_50_1291 387
85 3300049823 Ga0501044_0222036 Ga0501044_0222036_71_1378 387
86 3300050508 nmdc:mga09592_39660_c1 nmdc:mga09592_39660_c1_2558_3799 387
87 3300050509 nmdc:mga0qj67_64600_c1 nmdc:mga0qj67_64600_c1_1081_2322 387
88 3300005295 Ga0065707_10000837 Ga0065707_1000083710 388
89 3300005445 Ga0070708_100014784 Ga0070708_1000147847 388
90 3300005467 Ga0070706_100000475 Ga0070706_10000047524 388
91 3300005467 Ga0070706_100129943 Ga0070706_1001299431 388
92 3300005471 Ga0070698_100101116 Ga0070698_1001011163 388
93 3300005518 Ga0070699_100003450 Ga0070699_1000034504 388
94 3300005536 Ga0070697_100000022 Ga0070697_1000000227 388
95 3300005536 Ga0070697_100027025 Ga0070697_1000270254 388
96 3300006028 Ga0070717_10011753 Ga0070717_100117537 388
97 3300006178 Ga0075367_10041648 Ga0075367_100416483 388
98 3300009147 Ga0114129_10159354 Ga0114129_101593543 388
99 3300025910 Ga0207684_10001451 Ga0207684_100014517 388
100 3300025910 Ga0207684_10028200 Ga0207684_100282004 388
101 3300025910 Ga0207684_10037343 Ga0207684_100373433 388
102 3300025922 Ga0207646_10001394 Ga0207646_1000139415 388
103 3300025922 Ga0207646_10025575 Ga0207646_100255755 388
104 3300044712 Ga0453684_0008064 Ga0453684_0008064_15112_16344 388
105 3300048920 Ga0496117_0039569 Ga0496117_0039569_1430_2638 388
106 3300049576 Ga0501040_0010625 Ga0501040_0010625_1723_2988 388
107 3300049577 Ga0501041_0086372 Ga0501041_0086372_187_1452 388
108 3300049580 Ga0501046_0062823 Ga0501046_0062823_652_1917 388
109 3300049582 Ga0501048_0046630 Ga0501048_0046630_465_1730 388
110 3300049588 Ga0501072_0014927 Ga0501072_0014927_3841_5106 388
111 3300049593 Ga0501077_0117980 Ga0501077_0117980_400_1665 388
112 3300049824 Ga0501045_0010013 Ga0501045_0010013_1233_2498 388
113 3300050492 nmdc:mga0yw44_182971_c1 nmdc:mga0yw44_182971_c1_136_1332 388
114 3300054114 Ga0501084_0033542 Ga0501084_0033542_1691_2956 388
115 3300054114 Ga0501084_0063159 Ga0501084_0063159_709_1938 388
116 3300003373 JGI25407J50210_10008207 JGI25407J50210_100082073 389
117 3300005345 Ga0070692_10038048 Ga0070692_100380483 389
118 3300005356 Ga0070674_100050758 Ga0070674_1000507583 389
119 3300005440 Ga0070705_100100311 Ga0070705_1001003111 389
120 3300005457 Ga0070662_100099976 Ga0070662_1000999762 389
121 3300005459 Ga0068867_100035702 Ga0068867_1000357024 389
122 3300005539 Ga0068853_100197766 Ga0068853_1001977662 389
123 3300005549 Ga0070704_100051844 Ga0070704_1000518443 389
124 3300005615 Ga0070702_100021251 Ga0070702_1000212514 389
125 3300005617 Ga0068859_100242594 Ga0068859_1002425942 389
126 3300005618 Ga0068864_100133680 Ga0068864_1001336802 389
127 3300005981 Ga0081538_10000071 Ga0081538_1000007155 389
128 3300005983 Ga0081540_1000568 Ga0081540_100056818 389
129 3300005983 Ga0081540_1000941 Ga0081540_100094121 389
130 3300005983 Ga0081540_1037240 Ga0081540_10372402 389
131 3300005985 Ga0081539_10005444 Ga0081539_1000544410 389
132 3300006852 Ga0075433_10091152 Ga0075433_100911522 389
133 3300006931 Ga0097620_100242599 Ga0097620_1002425992 389
134 3300009094 Ga0111539_10063618 Ga0111539_100636186 389
135 3300009101 Ga0105247_10056759 Ga0105247_100567593 389
136 3300009148 Ga0105243_10078327 Ga0105243_100783273 389
137 3300009176 Ga0105242_10098001 Ga0105242_100980011 389
138 3300009177 Ga0105248_10453998 Ga0105248_104539982 389
139 3300010375 Ga0105239_10233055 Ga0105239_102330552 389
140 3300014325 Ga0163163_10122010 Ga0163163_101220102 389
141 3300014968 Ga0157379_10003167 Ga0157379_1000316718 389
142 3300014969 Ga0157376_10195706 Ga0157376_101957062 389
143 3300025321 Ga0207656_10013585 Ga0207656_100135852 389
144 3300025900 Ga0207710_10077258 Ga0207710_100772581 389
145 3300025923 Ga0207681_10135774 Ga0207681_101357742 389
146 3300025960 Ga0207651_10069661 Ga0207651_100696611 389
147 3300025961 Ga0207712_10051475 Ga0207712_100514752 389
148 3300026023 Ga0207677_10049745 Ga0207677_100497453 389
149 3300026075 Ga0207708_10191134 Ga0207708_101911342 389
150 3300026078 Ga0207702_10085593 Ga0207702_100855933 389
151 3300026089 Ga0207648_10196803 Ga0207648_101968032 389
152 3300026121 Ga0207683_10096602 Ga0207683_100966023 389
153 3300027907 Ga0207428_10161476 Ga0207428_101614762 389
154 3300037418 Ga0395900_0137146 Ga0395900_0137146_760_2031 389
155 3300037418 Ga0395900_0165725 Ga0395900_0165725_91_1398 389
156 3300037466 Ga0395898_0158013 Ga0395898_0158013_259_1524 389
157 3300037466 Ga0395898_0283876 Ga0395898_0283876_116_1423 389
158 3300038443 Ga0395901_0057698 Ga0395901_0057698_571_1836 389
159 3300038443 Ga0395901_0077495 Ga0395901_0077495_1746_3053 389
160 3300038443 Ga0395901_0381202 Ga0395901_0381202_145_1419 389
161 3300044693 Ga0466961_0042579 Ga0466961_0042579_193_1425 389
162 3300044694 Ga0466963_0033878 Ga0466963_0033878_2010_3251 389
163 3300044901 Ga0466960_0029510 Ga0466960_0029510_990_2243 389
164 3300044901 Ga0466960_0040981 Ga0466960_0040981_89_1345 389
165 3300045049 Ga0466959_0057063 Ga0466959_0057063_1227_2459 389
166 3300045976 Ga0466967_0226275 Ga0466967_0226275_391_1644 389
167 3300045976 Ga0466967_0294484 Ga0466967_0294484_267_1520 389
168 3300046471 Ga0495650_0000053 Ga0495650_0000053_135066_136319 389
169 3300046680 Ga0495646_0050644 Ga0495646_0050644_894_2108 389
170 3300046691 Ga0495670_0068787 Ga0495670_0068787_239_1546 389
171 3300048903 Ga0496100_0001662 Ga0496100_0001662_3704_4960 389
172 3300048903 Ga0496100_0144837 Ga0496100_0144837_258_1505 389
173 3300048904 Ga0496101_0001988 Ga0496101_0001988_4663_5919 389
174 3300048905 Ga0496102_0071006 Ga0496102_0071006_387_1643 389
175 3300048905 Ga0496102_0227128 Ga0496102_0227128_157_1422 389
176 3300048907 Ga0496104_0013656 Ga0496104_0013656_3799_5046 389
177 3300048908 Ga0496105_0095153 Ga0496105_0095153_896_2143 389
178 3300048908 Ga0496105_0109754 Ga0496105_0109754_583_1848 389
179 3300048909 Ga0496106_0015340 Ga0496106_0015340_2942_4189 389
180 3300048909 Ga0496106_0015875 Ga0496106_0015875_3525_4781 389
181 3300048909 Ga0496106_0164714 Ga0496106_0164714_343_1590 389
182 3300048910 Ga0496107_0002155 Ga0496107_0002155_6418_7674 389
183 3300048911 Ga0496108_0002529 Ga0496108_0002529_6124_7371 389
184 3300048912 Ga0496109_0007698 Ga0496109_0007698_1307_2554 389
185 3300048912 Ga0496109_0011949 Ga0496109_0011949_3004_4233 389
186 3300048912 Ga0496109_0089498 Ga0496109_0089498_328_1575 389
187 3300048913 Ga0496110_0001092 Ga0496110_0001092_2137_3384 389
188 3300048913 Ga0496110_0094887 Ga0496110_0094887_1269_2498 389
189 3300048913 Ga0496110_0156942 Ga0496110_0156942_393_1646 389
190 3300048914 Ga0496111_0052557 Ga0496111_0052557_950_2203 389
191 3300048915 Ga0496112_0020405 Ga0496112_0020405_4806_6071 389
192 3300048915 Ga0496112_0292304 Ga0496112_0292304_267_1520 389
193 3300048917 Ga0496114_0070180 Ga0496114_0070180_120_1376 389
194 3300048918 Ga0496115_0005651 Ga0496115_0005651_1931_3187 389
195 3300048918 Ga0496115_0205368 Ga0496115_0205368_145_1392 389
196 3300048922 Ga0496119_0066705 Ga0496119_0066705_654_1904 389
197 3300048924 Ga0496121_0101083 Ga0496121_0101083_493_1740 389
198 3300049571 Ga0501034_0008091 Ga0501034_0008091_6984_8240 389
199 3300049583 Ga0501067_0081330 Ga0501067_0081330_73_1320 389
200 3300050515 nmdc:mga0a205_50302_c1 nmdc:mga0a205_50302_c1_2087_3334 389
201 3300053153 Ga0500616_0004560 Ga0500616_0004560_2549_3802 389
202 3300005329 Ga0070683_100092454 Ga0070683_1000924543 390
203 3300005337 Ga0070682_100050461 Ga0070682_1000504612 390
204 3300005338 Ga0068868_100101654 Ga0068868_1001016542 390
205 3300005339 Ga0070660_100001669 Ga0070660_1000016695 390
206 3300005339 Ga0070660_100010862 Ga0070660_1000108627 390
207 3300005340 Ga0070689_100215807 Ga0070689_1002158072 390
208 3300005347 Ga0070668_100030302 Ga0070668_1000303022 390
209 3300005354 Ga0070675_100029576 Ga0070675_1000295763 390
210 3300005354 Ga0070675_100164686 Ga0070675_1001646862 390
211 3300005356 Ga0070674_100007826 Ga0070674_1000078265 390
212 3300005366 Ga0070659_100000176 Ga0070659_10000017637 390
213 3300005434 Ga0070709_10047160 Ga0070709_100471603 390
214 3300005435 Ga0070714_100143661 Ga0070714_1001436613 390
215 3300005435 Ga0070714_100147513 Ga0070714_1001475132 390
216 3300005436 Ga0070713_100067152 Ga0070713_1000671523 390
217 3300005436 Ga0070713_100080382 Ga0070713_1000803822 390
218 3300005437 Ga0070710_10000013 Ga0070710_1000001324 390
219 3300005439 Ga0070711_100006050 Ga0070711_1000060504 390
220 3300005439 Ga0070711_100020020 Ga0070711_1000200203 390
221 3300005440 Ga0070705_100029146 Ga0070705_1000291463 390
222 3300005441 Ga0070700_100008502 Ga0070700_1000085028 390
223 3300005455 Ga0070663_100002800 Ga0070663_1000028005 390
224 3300005455 Ga0070663_100212736 Ga0070663_1002127362 390
225 3300005456 Ga0070678_100020948 Ga0070678_1000209483 390
226 3300005535 Ga0070684_100246766 Ga0070684_1002467662 390
227 3300005543 Ga0070672_100085587 Ga0070672_1000855873 390
228 3300005544 Ga0070686_100097731 Ga0070686_1000977312 390
229 3300005545 Ga0070695_100033847 Ga0070695_1000338474 390
230 3300005548 Ga0070665_100000911 Ga0070665_10000091115 390
231 3300005548 Ga0070665_100201517 Ga0070665_1002015172 390
232 3300005549 Ga0070704_100013141 Ga0070704_1000131412 390
233 3300005564 Ga0070664_100068421 Ga0070664_1000684213 390
234 3300005937 Ga0081455_10110974 Ga0081455_101109743 390
235 3300005981 Ga0081538_10000407 Ga0081538_1000040716 390
236 3300005981 Ga0081538_10033842 Ga0081538_100338422 390
237 3300005985 Ga0081539_10001489 Ga0081539_1000148922 390
238 3300005985 Ga0081539_10013866 Ga0081539_100138663 390
239 3300006028 Ga0070717_10000061 Ga0070717_1000006128 390
240 3300006028 Ga0070717_10003687 Ga0070717_1000368710 390
241 3300006028 Ga0070717_10028271 Ga0070717_100282716 390
242 3300006028 Ga0070717_10142576 Ga0070717_101425763 390
243 3300006038 Ga0075365_10000162 Ga0075365_1000016227 390
244 3300006038 Ga0075365_10006537 Ga0075365_100065379 390
245 3300006038 Ga0075365_10020815 Ga0075365_100208155 390
246 3300006048 Ga0075363_100008514 Ga0075363_1000085147 390
247 3300006051 Ga0075364_10009357 Ga0075364_100093578 390
248 3300006051 Ga0075364_10099138 Ga0075364_100991382 390
249 3300006175 Ga0070712_100000013 Ga0070712_100000013107 390
250 3300006175 Ga0070712_100002893 Ga0070712_10000289310 390
251 3300006186 Ga0075369_10046922 Ga0075369_100469222 390
252 3300006847 Ga0075431_100000134 Ga0075431_10000013412 390
253 3300006847 Ga0075431_100035471 Ga0075431_1000354714 390
254 3300006871 Ga0075434_100153335 Ga0075434_1001533352 390
255 3300006881 Ga0068865_100001280 Ga0068865_1000012806 390
256 3300007076 Ga0075435_100101966 Ga0075435_1001019663 390
257 3300009093 Ga0105240_10030748 Ga0105240_100307487 390
258 3300009094 Ga0111539_10008272 Ga0111539_100082723 390
259 3300009098 Ga0105245_10001317 Ga0105245_1000131712 390
260 3300009098 Ga0105245_10007436 Ga0105245_100074368 390
261 3300009177 Ga0105248_10112289 Ga0105248_101122894 390
262 3300009545 Ga0105237_10204027 Ga0105237_102040272 390
263 3300010375 Ga0105239_10040445 Ga0105239_100404452 390
264 3300010375 Ga0105239_10282232 Ga0105239_102822322 390
265 3300013308 Ga0157375_10303954 Ga0157375_103039542 390
266 3300014745 Ga0157377_10007587 Ga0157377_100075874 390
267 3300014969 Ga0157376_10043308 Ga0157376_100433083 390
268 3300021377 Ga0213874_10001886 Ga0213874_100018864 390
269 3300021384 Ga0213876_10017513 Ga0213876_100175134 390
270 3300021384 Ga0213876_10065185 Ga0213876_100651852 390
271 3300021384 Ga0213876_10088857 Ga0213876_100888571 390
272 3300021384 Ga0213876_10097055 Ga0213876_100970552 390
273 3300021388 Ga0213875_10000148 Ga0213875_1000014869 390
274 3300021388 Ga0213875_10014084 Ga0213875_100140845 390
275 3300025898 Ga0207692_10000003 Ga0207692_10000003154 390
276 3300025898 Ga0207692_10021322 Ga0207692_100213222 390
277 3300025906 Ga0207699_10013246 Ga0207699_100132463 390
278 3300025906 Ga0207699_10087664 Ga0207699_100876642 390
279 3300025913 Ga0207695_10002407 Ga0207695_1000240725 390
280 3300025915 Ga0207693_10006406 Ga0207693_100064062 390
281 3300025915 Ga0207693_10007488 Ga0207693_100074889 390
282 3300025915 Ga0207693_10017486 Ga0207693_100174867 390
283 3300025915 Ga0207693_10080777 Ga0207693_100807772 390
284 3300025916 Ga0207663_10000169 Ga0207663_1000016918 390
285 3300025916 Ga0207663_10018543 Ga0207663_100185434 390
286 3300025916 Ga0207663_10156883 Ga0207663_101568832 390
287 3300025919 Ga0207657_10004224 Ga0207657_100042245 390
288 3300025919 Ga0207657_10016599 Ga0207657_100165998 390
289 3300025923 Ga0207681_10003442 Ga0207681_100034428 390
290 3300025925 Ga0207650_10077892 Ga0207650_100778922 390
291 3300025927 Ga0207687_10051175 Ga0207687_100511753 390
292 3300025928 Ga0207700_10012481 Ga0207700_100124812 390
293 3300025929 Ga0207664_10002161 Ga0207664_100021619 390
294 3300025929 Ga0207664_10032533 Ga0207664_100325334 390
295 3300025929 Ga0207664_10051994 Ga0207664_100519944 390
296 3300025929 Ga0207664_10064005 Ga0207664_100640053 390
297 3300025929 Ga0207664_10077006 Ga0207664_100770063 390
298 3300025932 Ga0207690_10000054 Ga0207690_100000549 390
299 3300025932 Ga0207690_10102783 Ga0207690_101027832 390
300 3300025938 Ga0207704_10011097 Ga0207704_100110974 390
301 3300025938 Ga0207704_10103895 Ga0207704_101038952 390
302 3300025940 Ga0207691_10098325 Ga0207691_100983251 390
303 3300025944 Ga0207661_10124996 Ga0207661_101249962 390
304 3300026023 Ga0207677_10077193 Ga0207677_100771933 390
305 3300026067 Ga0207678_10002606 Ga0207678_100026065 390
306 3300026067 Ga0207678_10082289 Ga0207678_100822893 390
307 3300026075 Ga0207708_10001007 Ga0207708_1000100723 390
308 3300026121 Ga0207683_10034359 Ga0207683_100343593 390
309 3300027907 Ga0207428_10057312 Ga0207428_100573122 390
310 3300028379 Ga0268266_10004582 Ga0268266_100045825 390
311 3300028556 Ga0265337_1001176 Ga0265337_100117610 390
312 3300028558 Ga0265326_10000005 Ga0265326_1000000573 390
313 3300028558 Ga0265326_10002998 Ga0265326_100029984 390
314 3300028563 Ga0265319_1000034 Ga0265319_100003493 390
315 3300028563 Ga0265319_1000756 Ga0265319_10007564 390
316 3300028563 Ga0265319_1001901 Ga0265319_100190110 390
317 3300028573 Ga0265334_10000024 Ga0265334_1000002479 390
318 3300028577 Ga0265318_10000545 Ga0265318_100005459 390
319 3300028577 Ga0265318_10001315 Ga0265318_100013155 390
320 3300028666 Ga0265336_10000001 Ga0265336_10000001298 390
321 3300028666 Ga0265336_10006532 Ga0265336_100065324 390
322 3300028800 Ga0265338_10000004 Ga0265338_10000004583 390
323 3300028800 Ga0265338_10006763 Ga0265338_100067635 390
324 3300028800 Ga0265338_10008060 Ga0265338_1000806010 390
325 3300029957 Ga0265324_10001235 Ga0265324_1000123512 390
326 3300031240 Ga0265320_10015457 Ga0265320_100154573 390
327 3300031247 Ga0265340_10000002 Ga0265340_10000002583 390
328 3300031251 Ga0265327_10002862 Ga0265327_100028622 390
329 3300031344 Ga0265316_10030285 Ga0265316_100302854 390
330 3300031711 Ga0265314_10004533 Ga0265314_100045338 390
331 3300031995 Ga0307409_100358743 Ga0307409_1003587431 390
332 3300035117 Ga0373953_0007813 Ga0373953_0007813_237_1511 390
333 3300035118 Ga0373954_0022104 Ga0373954_0022104_1537_2811 390
334 3300037418 Ga0395900_0002246 Ga0395900_0002246_13140_14384 390
335 3300037466 Ga0395898_0003455 Ga0395898_0003455_13336_14580 390
336 3300037466 Ga0395898_0010567 Ga0395898_0010567_7081_8442 390
337 3300037471 Ga0395905_0023450 Ga0395905_0023450_84_1445 390
338 3300037471 Ga0395905_0053535 Ga0395905_0053535_358_1611 390
339 3300037853 Ga0436364_0031839 Ga0436364_0031839_1488_2723 390
340 3300037853 Ga0436364_1122530 Ga0436364_1122530_2232_3476 390
341 3300037853 Ga0436364_1438537 Ga0436364_1438537_2161_3396 390
342 3300038443 Ga0395901_0006802 Ga0395901_0006802_2957_4318 390
343 3300039437 Ga0436365_0403715 Ga0436365_0403715_12753_13994 390
344 3300039437 Ga0436365_0863005 Ga0436365_0863005_14_1270 390
345 3300039437 Ga0436365_1102108 Ga0436365_1102108_18694_19956 390
346 3300039437 Ga0436365_1468086 Ga0436365_1468086_2364_3644 390
347 3300039437 Ga0436365_1725409 Ga0436365_1725409_741_2021 390
348 3300039450 Ga0436363_0386698 Ga0436363_0386698_73_1347 390
349 3300039450 Ga0436363_1064792 Ga0436363_1064792_3307_4587 390
350 3300039450 Ga0436363_1110229 Ga0436363_1110229_60_1346 390
351 3300039450 Ga0436363_1400525 Ga0436363_1400525_4633_5871 390
352 3300039453 Ga0436362_0637497 Ga0436362_0637497_719_1999 390
353 3300039453 Ga0436362_1195802 Ga0436362_1195802_333_1577 390
354 3300044683 Ga0466965_0021066 Ga0466965_0021066_1607_2869 390
355 3300044684 Ga0466966_0022394 Ga0466966_0022394_1170_2444 390
356 3300044693 Ga0466961_0017029 Ga0466961_0017029_2753_3991 390
357 3300044693 Ga0466961_0022190 Ga0466961_0022190_1838_3082 390
358 3300044694 Ga0466963_0008578 Ga0466963_0008578_1125_2387 390
359 3300044694 Ga0466963_0015641 Ga0466963_0015641_1407_2654 390
360 3300044694 Ga0466963_0017524 Ga0466963_0017524_2792_4072 390
361 3300044694 Ga0466963_0017976 Ga0466963_0017976_3152_4393 390
362 3300044694 Ga0466963_0040185 Ga0466963_0040185_10_1368 390
363 3300044765 Ga0466970_0024812 Ga0466970_0024812_894_2132 390
364 3300044765 Ga0466970_0040102 Ga0466970_0040102_692_2050 390
365 3300044842 Ga0466957_0060757 Ga0466957_0060757_981_2261 390
366 3300044842 Ga0466957_0079669 Ga0466957_0079669_303_1565 390
367 3300045049 Ga0466959_0001464 Ga0466959_0001464_9224_10468 390
368 3300045049 Ga0466959_0006901 Ga0466959_0006901_2366_3724 390
369 3300045049 Ga0466959_0014631 Ga0466959_0014631_1856_3118 390
370 3300045049 Ga0466959_0202441 Ga0466959_0202441_55_1329 390
371 3300045836 Ga0466958_0001617 Ga0466958_0001617_5047_6309 390
372 3300045836 Ga0466958_0005363 Ga0466958_0005363_5208_6449 390
373 3300045836 Ga0466958_0015156 Ga0466958_0015156_1403_2761 390
374 3300045836 Ga0466958_0021420 Ga0466958_0021420_354_1589 390
375 3300045836 Ga0466958_0081711 Ga0466958_0081711_606_1847 390
376 3300045836 Ga0466958_0084658 Ga0466958_0084658_205_1476 390
377 3300045836 Ga0466958_0112636 Ga0466958_0112636_265_1512 390
378 3300045976 Ga0466967_0004740 Ga0466967_0004740_6764_8026 390
379 3300045976 Ga0466967_0144983 Ga0466967_0144983_712_1992 390
380 3300045976 Ga0466967_0325591 Ga0466967_0325591_160_1401 390
381 3300046461 Ga0495641_0026307 Ga0495641_0026307_127_1416 390
382 3300046462 Ga0495651_0010955 Ga0495651_0010955_2036_3310 390
383 3300046463 Ga0495653_0000536 Ga0495653_0000536_25494_26759 390
384 3300046473 Ga0495582_0071752 Ga0495582_0071752_153_1427 390
385 3300046477 Ga0495664_0000073 Ga0495664_0000073_1569_2819 390
386 3300046514 Ga0495618_0000046 Ga0495618_0000046_42786_44063 390
387 3300046516 Ga0495628_0186278 Ga0495628_0186278_148_1422 390
388 3300046517 Ga0495630_0000241 Ga0495630_0000241_32417_33703 390
389 3300046517 Ga0495630_0147751 Ga0495630_0147751_196_1470 390
390 3300046529 Ga0495652_0055641 Ga0495652_0055641_1110_2384 390
391 3300046536 Ga0495587_0026741 Ga0495587_0026741_1184_2458 390
392 3300046543 Ga0495645_0000022 Ga0495645_0000022_23231_24496 390
393 3300046543 Ga0495645_0000119 Ga0495645_0000119_47120_48364 390
394 3300046663 Ga0495635_0011412 Ga0495635_0011412_547_1821 390
395 3300046675 Ga0495657_0000226 Ga0495657_0000226_32438_33724 390
396 3300046675 Ga0495657_0010844 Ga0495657_0010844_3508_4782 390
397 3300046680 Ga0495646_0040811 Ga0495646_0040811_736_2010 390
398 3300046809 Ga0495600_0058520 Ga0495600_0058520_361_1635 390
399 3300047317 Ga0495604_0000148 Ga0495604_0000148_25028_26284 390
400 3300047317 Ga0495604_0020614 Ga0495604_0020614_338_1612 390
401 3300047319 Ga0495674_0015458 Ga0495674_0015458_2127_3401 390
402 3300047321 Ga0495676_0071845 Ga0495676_0071845_577_1866 390
403 3300047322 Ga0495680_0003599 Ga0495680_0003599_6653_7927 390
404 3300047444 Ga0495675_0027217 Ga0495675_0027217_717_1991 390
405 3300047444 Ga0495675_0078228 Ga0495675_0078228_741_2018 390
406 3300047471 Ga0495684_0004277 Ga0495684_0004277_4385_5662 390
407 3300047471 Ga0495684_0011380 Ga0495684_0011380_5523_6797 390
408 3300048088 Ga0495602_0027711 Ga0495602_0027711_3499_4773 390
409 3300048903 Ga0496100_0000450 Ga0496100_0000450_11313_12569 390
410 3300048903 Ga0496100_0015709 Ga0496100_0015709_982_2271 390
411 3300048904 Ga0496101_0001032 Ga0496101_0001032_13710_14966 390
412 3300048905 Ga0496102_0000040 Ga0496102_0000040_46186_47424 390
413 3300048905 Ga0496102_0008080 Ga0496102_0008080_6625_7914 390
414 3300048905 Ga0496102_0012915 Ga0496102_0012915_243_1547 390
415 3300048906 Ga0496103_0000067 Ga0496103_0000067_76_1314 390
416 3300048906 Ga0496103_0001681 Ga0496103_0001681_7362_8651 390
417 3300048907 Ga0496104_0000006 Ga0496104_0000006_425731_426978 390
418 3300048907 Ga0496104_0033875 Ga0496104_0033875_2388_3677 390
419 3300048907 Ga0496104_0066277 Ga0496104_0066277_1542_2816 390
420 3300048907 Ga0496104_0066408 Ga0496104_0066408_1288_2562 390
421 3300048908 Ga0496105_0005449 Ga0496105_0005449_8138_9427 390
422 3300048909 Ga0496106_0009964 Ga0496106_0009964_5373_6662 390
423 3300048909 Ga0496106_0111245 Ga0496106_0111245_80_1363 390
424 3300048909 Ga0496106_0128685 Ga0496106_0128685_222_1526 390
425 3300048910 Ga0496107_0012518 Ga0496107_0012518_355_1644 390
426 3300048910 Ga0496107_0038123 Ga0496107_0038123_1515_2819 390
427 3300048910 Ga0496107_0124848 Ga0496107_0124848_220_1503 390
428 3300048911 Ga0496108_0004671 Ga0496108_0004671_3822_5111 390
429 3300048911 Ga0496108_0013342 Ga0496108_0013342_4765_6069 390
430 3300048912 Ga0496109_0019443 Ga0496109_0019443_327_1616 390
431 3300048912 Ga0496109_0028889 Ga0496109_0028889_1678_2931 390
432 3300048912 Ga0496109_0133062 Ga0496109_0133062_684_1988 390
433 3300048913 Ga0496110_0000064 Ga0496110_0000064_5904_7151 390
434 3300048913 Ga0496110_0006623 Ga0496110_0006623_5572_6861 390
435 3300048913 Ga0496110_0022612 Ga0496110_0022612_3107_4411 390
436 3300048913 Ga0496110_0086550 Ga0496110_0086550_70_1341 390
437 3300048914 Ga0496111_0002025 Ga0496111_0002025_6966_8255 390
438 3300048915 Ga0496112_0000095 Ga0496112_0000095_18331_19578 390
439 3300048915 Ga0496112_0005797 Ga0496112_0005797_8597_9871 390
440 3300048915 Ga0496112_0089669 Ga0496112_0089669_1251_2540 390
441 3300048916 Ga0496113_0066251 Ga0496113_0066251_129_1433 390
442 3300048917 Ga0496114_0010676 Ga0496114_0010676_456_1745 390
443 3300048918 Ga0496115_0000059 Ga0496115_0000059_73008_74288 390
444 3300048918 Ga0496115_0000087 Ga0496115_0000087_22082_23362 390
445 3300048918 Ga0496115_0010330 Ga0496115_0010330_351_1640 390
446 3300048918 Ga0496115_0074997 Ga0496115_0074997_1396_2667 390
447 3300048927 Ga0496124_0115740 Ga0496124_0115740_576_1817 390
448 3300049568 Ga0501031_0008936 Ga0501031_0008936_2105_3364 390
449 3300049569 Ga0501032_0004500 Ga0501032_0004500_8592_9851 390
450 3300049570 Ga0501033_0121690 Ga0501033_0121690_261_1520 390
451 3300049572 Ga0501036_0052553 Ga0501036_0052553_440_1699 390
452 3300049573 Ga0501037_0118634 Ga0501037_0118634_248_1507 390
453 3300049574 Ga0501038_0005589 Ga0501038_0005589_8488_9747 390
454 3300049575 Ga0501039_0078652 Ga0501039_0078652_603_1862 390
455 3300049578 Ga0501042_0025820 Ga0501042_0025820_749_2008 390
456 3300049578 Ga0501042_0160550 Ga0501042_0160550_349_1593 390
457 3300049580 Ga0501046_0002368 Ga0501046_0002368_11770_13029 390
458 3300049582 Ga0501048_0015968 Ga0501048_0015968_3512_4771 390
459 3300049584 Ga0501068_0022156 Ga0501068_0022156_2213_3472 390
460 3300049585 Ga0501069_0001600 Ga0501069_0001600_1441_2700 390
461 3300049585 Ga0501069_0057514 Ga0501069_0057514_351_1634 390
462 3300049586 Ga0501070_0041608 Ga0501070_0041608_1501_2784 390
463 3300049586 Ga0501070_0072465 Ga0501070_0072465_1179_2438 390
464 3300049587 Ga0501071_0177665 Ga0501071_0177665_218_1501 390
465 3300049588 Ga0501072_0016803 Ga0501072_0016803_525_1808 390
466 3300049589 Ga0501073_0007298 Ga0501073_0007298_728_1987 390
467 3300049589 Ga0501073_0179281 Ga0501073_0179281_31_1314 390
468 3300049590 Ga0501074_0156252 Ga0501074_0156252_74_1357 390
469 3300049742 Ga0501080_0012732 Ga0501080_0012732_2662_3921 390
470 3300049744 Ga0501083_0021160 Ga0501083_0021160_1481_2740 390
471 3300049822 Ga0501035_0023094 Ga0501035_0023094_1790_3049 390
472 3300050491 nmdc:mga00v17_14935_c1 nmdc:mga00v17_14935_c1_354_1658 390
473 3300050491 nmdc:mga00v17_24681_c1 nmdc:mga00v17_24681_c1_1453_2745 390
474 3300050492 nmdc:mga0yw44_212097_c1 nmdc:mga0yw44_212097_c1_23_1267 390
475 3300050492 nmdc:mga0yw44_92281_c1 nmdc:mga0yw44_92281_c1_594_1877 390
476 3300050494 nmdc:mga06z11_25263_c1 nmdc:mga06z11_25263_c1_539_1843 390
477 3300050508 nmdc:mga09592_128396_c1 nmdc:mga09592_128396_c1_709_2013 390
478 3300050508 nmdc:mga09592_14752_c1 nmdc:mga09592_14752_c1_343_1593 390
479 3300050509 nmdc:mga0qj67_241736_c1 nmdc:mga0qj67_241736_c1_78_1382 390
480 3300050509 nmdc:mga0qj67_77597_c1 nmdc:mga0qj67_77597_c1_561_1811 390
481 3300050510 nmdc:mga06r32_1211_c1 nmdc:mga06r32_1211_c1_12216_13487 390
482 3300050511 nmdc:mga08y16_22098_c1 nmdc:mga08y16_22098_c1_4437_5708 390
483 3300050512 nmdc:mga0n895_149931_c1 nmdc:mga0n895_149931_c1_371_1642 390
484 3300050516 nmdc:mga0sz30_41416_c1 nmdc:mga0sz30_41416_c1_575_1885 390
485 3300053077 Ga0495601_0001152 Ga0495601_0001152_6983_8269 390
486 3300053077 Ga0495601_0013587 Ga0495601_0013587_1492_2742 390
487 3300053078 Ga0495612_0000032 Ga0495612_0000032_28877_30163 390
488 3300053084 Ga0495595_0048126 Ga0495595_0048126_678_1952 390
489 3300053085 Ga0495619_0018953 Ga0495619_0018953_1172_2446 390
490 3300053104 Ga0500556_0000262 Ga0500556_0000262_28466_29719 390
491 3300053153 Ga0500616_0006584 Ga0500616_0006584_4962_6215 390
492 3300060353 Ga0501082_0022434 Ga0501082_0022434_244_1503 390
493 3300061719 Ga0466962_0039153 Ga0466962_0039153_701_2059 390
494 3300039453 Ga0436362_0352471 Ga0436362_0352471_363_1655 391
495 3300003203 JGI25406J46586_10003565 JGI25406J46586_100035654 392
496 3300005337 Ga0070682_100145669 Ga0070682_1001456691 392
497 3300005347 Ga0070668_100154304 Ga0070668_1001543042 392
498 3300005546 Ga0070696_100073730 Ga0070696_1000737302 392
499 3300005719 Ga0068861_100060118 Ga0068861_1000601182 392
500 3300005985 Ga0081539_10001045 Ga0081539_1000104513 392
501 3300006058 Ga0075432_10004541 Ga0075432_100045417 392
502 3300006847 Ga0075431_100150378 Ga0075431_1001503782 392
503 3300006880 Ga0075429_100076483 Ga0075429_1000764833 392
504 3300014325 Ga0163163_10185551 Ga0163163_101855512 392
505 3300026075 Ga0207708_10028439 Ga0207708_100284393 392
506 3300031852 Ga0307410_10253978 Ga0307410_102539782 392
507 3300031995 Ga0307409_100186388 Ga0307409_1001863882 392
508 3300037466 Ga0395898_0122044 Ga0395898_0122044_514_1746 392
509 3300037471 Ga0395905_0146681 Ga0395905_0146681_470_1729 392
510 3300042016 Ga0439463_029393 Ga0439463_029393_18_1250 392
511 3300050512 nmdc:mga0n895_322636_c1 nmdc:mga0n895_322636_c1_164_1399 392
512 3300005937 Ga0081455_10100827 Ga0081455_101008272 393
513 3300039437 Ga0436365_0808769 Ga0436365_0808769_178_1470 393
514 3300045976 Ga0466967_0081421 Ga0466967_0081421_1493_2737 393
515 3300048912 Ga0496109_0008856 Ga0496109_0008856_3639_4910 393
516 3300003373 JGI25407J50210_10001845 JGI25407J50210_100018454 394
517 3300005937 Ga0081455_10059760 Ga0081455_100597602 394
518 3300005981 Ga0081538_10000839 Ga0081538_1000083927 394
519 3300005981 Ga0081538_10010085 Ga0081538_1001008512 394
520 3300005981 Ga0081538_10013079 Ga0081538_100130794 394
521 3300005981 Ga0081538_10063332 Ga0081538_100633322 394
522 3300031731 Ga0307405_10054391 Ga0307405_100543913 394
523 3300031901 Ga0307406_10029133 Ga0307406_100291331 394
524 3300031901 Ga0307406_10078807 Ga0307406_100788072 394
525 3300031995 Ga0307409_100101435 Ga0307409_1001014352 394
526 3300032126 Ga0307415_100000210 Ga0307415_10000021020 394
527 3300032126 Ga0307415_100065587 Ga0307415_1000655872 394
528 3300047320 Ga0495672_0027013 Ga0495672_0027013_1040_2302 394
529 3300003373 JGI25407J50210_10000444 JGI25407J50210_100004449 395
530 3300003373 JGI25407J50210_10000682 JGI25407J50210_100006823 395
531 3300005336 Ga0070680_100254925 Ga0070680_1002549252 395
532 3300005530 Ga0070679_100224598 Ga0070679_1002245982 395
533 3300005981 Ga0081538_10002004 Ga0081538_1000200425 395
534 3300005981 Ga0081538_10007804 Ga0081538_1000780412 395
535 3300005981 Ga0081538_10010720 Ga0081538_100107203 395
536 3300005981 Ga0081538_10016364 Ga0081538_100163643 395
537 3300006844 Ga0075428_100067439 Ga0075428_1000674393 395
538 3300009147 Ga0114129_10313755 Ga0114129_103137553 395
539 3300027907 Ga0207428_10167941 Ga0207428_101679411 395
540 3300031548 Ga0307408_100140076 Ga0307408_1001400761 395
541 3300031852 Ga0307410_10014490 Ga0307410_100144902 395
542 3300031901 Ga0307406_10017241 Ga0307406_100172414 395
543 3300031901 Ga0307406_10104437 Ga0307406_101044372 395
544 3300031903 Ga0307407_10004725 Ga0307407_100047254 395
545 3300031911 Ga0307412_10114521 Ga0307412_101145212 395
546 3300031995 Ga0307409_100011600 Ga0307409_1000116004 395
547 3300031995 Ga0307409_100063756 Ga0307409_1000637563 395
548 3300032004 Ga0307414_10123422 Ga0307414_101234222 395
549 3300032126 Ga0307415_100044436 Ga0307415_1000444363 395
550 3300049578 Ga0501042_0104931 Ga0501042_0104931_184_1440 395
551 3300049591 Ga0501075_0022561 Ga0501075_0022561_2604_3854 395
552 3300050507 nmdc:mga05p37_145196_c1 nmdc:mga05p37_145196_c1_1288_2565 395
553 3300050511 nmdc:mga08y16_161822_c1 nmdc:mga08y16_161822_c1_811_2088 395
554 3300061734 Ga0530510_0008178 Ga0530510_0008178_4709_5959 395
555 3300005937 Ga0081455_10021892 Ga0081455_100218922 396
556 3300005981 Ga0081538_10009518 Ga0081538_100095185 396
557 3300005981 Ga0081538_10025487 Ga0081538_100254875 396
558 3300006846 Ga0075430_100005551 Ga0075430_1000055514 396
559 3300009147 Ga0114129_10082076 Ga0114129_100820762 396
560 3300046675 Ga0495657_0116251 Ga0495657_0116251_142_1500 396
561 3300047472 Ga0495686_0000011 Ga0495686_0000011_360401_361789 396
562 3300047472 Ga0495686_0002303 Ga0495686_0002303_10400_11782 396
563 3300049588 Ga0501072_0037754 Ga0501072_0037754_1197_2456 396
564 3300049591 Ga0501075_0136751 Ga0501075_0136751_236_1495 396
565 3300049824 Ga0501045_0162393 Ga0501045_0162393_356_1615 396
566 3300050507 nmdc:mga05p37_820_c1 nmdc:mga05p37_820_c1_30613_31872 396
567 3300050509 nmdc:mga0qj67_1947_c1 nmdc:mga0qj67_1947_c1_6316_7575 396
568 3300000549 LJQas_1000809 LJQas_10008099 397
569 3300044694 Ga0466963_0009122 Ga0466963_0009122_932_2182 397
570 3300046461 Ga0495641_0006906 Ga0495641_0006906_2444_3859 397
571 3300046615 Ga0495656_0008515 Ga0495656_0008515_818_2224 397
572 3300047469 Ga0495673_0012407 Ga0495673_0012407_1145_2551 397
573 3300047472 Ga0495686_0025906 Ga0495686_0025906_2387_3784 397
574 3300048090 Ga0495615_0015247 Ga0495615_0015247_147_1553 397
575 3300005458 Ga0070681_10126193 Ga0070681_101261932 398
576 3300005530 Ga0070679_100074391 Ga0070679_1000743912 398
577 3300005577 Ga0068857_100118365 Ga0068857_1001183652 398
578 3300005981 Ga0081538_10027440 Ga0081538_100274401 398
579 3300005981 Ga0081538_10035784 Ga0081538_100357843 398
580 3300006844 Ga0075428_100079393 Ga0075428_1000793932 398
581 3300009545 Ga0105237_10049423 Ga0105237_100494235 398
582 3300013104 Ga0157370_10017109 Ga0157370_100171096 398
583 3300013105 Ga0157369_10299946 Ga0157369_102999462 398
584 3300013307 Ga0157372_10084129 Ga0157372_100841292 398
585 3300025919 Ga0207657_10032101 Ga0207657_100321014 398
586 3300025920 Ga0207649_10069644 Ga0207649_100696441 398
587 3300025921 Ga0207652_10010267 Ga0207652_100102677 398
588 3300025944 Ga0207661_10003968 Ga0207661_100039684 398
589 3300026116 Ga0207674_10023744 Ga0207674_100237445 398
590 3300031548 Ga0307408_100052371 Ga0307408_1000523714 398
591 3300037466 Ga0395898_0091022 Ga0395898_0091022_65_1330 398
592 3300038443 Ga0395901_0212932 Ga0395901_0212932_310_1578 398
593 3300045976 Ga0466967_0066665 Ga0466967_0066665_1075_2328 398
594 3300048913 Ga0496110_0168470 Ga0496110_0168470_88_1356 398
595 3300005983 Ga0081540_1026074 Ga0081540_10260742 399
596 3300005985 Ga0081539_10081547 Ga0081539_100815471 399
597 3300026142 Ga0207698_10200730 Ga0207698_102007302 399
598 3300032126 Ga0307415_100076431 Ga0307415_1000764313 399
599 3300000546 LJNas_1004847 LJNas_10048472 400
600 3300005338 Ga0068868_100085151 Ga0068868_1000851512 400
601 3300005341 Ga0070691_10065235 Ga0070691_100652352 400
602 3300005347 Ga0070668_100124869 Ga0070668_1001248692 400
603 3300005353 Ga0070669_100079863 Ga0070669_1000798633 400
604 3300005356 Ga0070674_100189935 Ga0070674_1001899351 400
605 3300005441 Ga0070700_100007717 Ga0070700_1000077172 400
606 3300005535 Ga0070684_100088088 Ga0070684_1000880882 400
607 3300005578 Ga0068854_100173471 Ga0068854_1001734712 400
608 3300005615 Ga0070702_100005646 Ga0070702_1000056465 400
609 3300005615 Ga0070702_100152582 Ga0070702_1001525821 400
610 3300005937 Ga0081455_10019184 Ga0081455_100191846 400
611 3300005981 Ga0081538_10001191 Ga0081538_1000119137 400
612 3300005981 Ga0081538_10019801 Ga0081538_100198012 400
613 3300006846 Ga0075430_100012676 Ga0075430_1000126764 400
614 3300006881 Ga0068865_100147021 Ga0068865_1001470212 400
615 3300009098 Ga0105245_10037717 Ga0105245_100377172 400
616 3300025302 Ga0207426_1011793 Ga0207426_10117933 400
617 3300025901 Ga0207688_10047303 Ga0207688_100473032 400
618 3300025907 Ga0207645_10065100 Ga0207645_100651003 400
619 3300025933 Ga0207706_10068422 Ga0207706_100684222 400
620 3300025938 Ga0207704_10051106 Ga0207704_100511062 400
621 3300025938 Ga0207704_10137842 Ga0207704_101378422 400
622 3300025944 Ga0207661_10060212 Ga0207661_100602123 400
623 3300025945 Ga0207679_10072688 Ga0207679_100726882 400
624 3300025981 Ga0207640_10096750 Ga0207640_100967502 400
625 3300026075 Ga0207708_10006410 Ga0207708_1000641012 400
626 3300026089 Ga0207648_10148068 Ga0207648_101480682 400
627 3300026118 Ga0207675_100101254 Ga0207675_1001012542 400
628 3300031824 Ga0307413_10111285 Ga0307413_101112852 400
629 3300031824 Ga0307413_10139087 Ga0307413_101390872 400
630 3300031911 Ga0307412_10160447 Ga0307412_101604472 400
631 3300032002 Ga0307416_100006134 Ga0307416_1000061348 400
632 3300032002 Ga0307416_100040991 Ga0307416_1000409912 400
633 3300044694 Ga0466963_0124490 Ga0466963_0124490_360_1619 400
634 3300045976 Ga0466967_0001002 Ga0466967_0001002_13156_14436 400
635 3300045976 Ga0466967_0040152 Ga0466967_0040152_1565_2824 400
636 3300045976 Ga0466967_0086414 Ga0466967_0086414_1160_2431 400
637 3300048905 Ga0496102_0095397 Ga0496102_0095397_902_2167 400
638 3300048909 Ga0496106_0027332 Ga0496106_0027332_1940_3205 400
639 3300048924 Ga0496121_0002770 Ga0496121_0002770_18672_19973 400
640 3300049569 Ga0501032_0068591 Ga0501032_0068591_720_1979 400
641 3300049572 Ga0501036_0058695 Ga0501036_0058695_1010_2269 400
642 3300049575 Ga0501039_0068499 Ga0501039_0068499_1046_2305 400
643 3300049588 Ga0501072_0156522 Ga0501072_0156522_497_1765 400
644 3300049590 Ga0501074_0108291 Ga0501074_0108291_641_1870 400
645 3300049824 Ga0501045_0067104 Ga0501045_0067104_733_1992 400
646 3300050509 nmdc:mga0qj67_47848_c1 nmdc:mga0qj67_47848_c1_603_1922 400
647 3300061734 Ga0530510_0029873 Ga0530510_0029873_945_2204 400

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00346

Complex1_49kDa

Respiratory-chain NADH dehydrogenase, 49 Kd subunit

144

414

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qsn-assembly1.cif.gz_D bovine complex i in lipid nanodisc, deactive-apo 0.9676 40 400
7vwj-assembly1.cif.gz_Q matrix arm of deactive state ci from rotenone-nadh dataset 0.962 17 400
6zk9-assembly1.cif.gz_4 peripheral domain of open complex i during turnover 0.9618 15 400
6g72-assembly1.cif.gz_D mouse mitochondrial complex i in the deactive state 0.9603 17 400
7r4c-assembly1.cif.gz_D bovine complex i in the presence of im1761092, deactive class v (composite map) 0.9599 15 400
ID Description Score Start End Superfamily
af_Q23883_16_406_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9466 17 400 1.10.645.10
af_P33599_211_596_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9438 17 400 1.10.645.10
af_P9WJH5_38_440_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9389 17 400 1.10.645.10
af_P16431_180_537_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.937 17 393 1.10.645.10
af_P33599_211_596_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9367 17 400 1.10.645.10
ID Description Score Start End GO Terms
AF-A0A5Q0UUT2-F1-model_v4 NADH-plastoquinone oxidoreductase subunit 7 0.9879 82 296 GO:0009535
GO:0016651
GO:0048038
GO:0051287
AF-A0A7M3XQJ2-F1-model_v4 NADH-quinone oxidoreductase subunit NuoD 0.9802 104 271 GO:0016651
GO:0048038
GO:0051287
AF-A0A5K1HTL9-F1-model_v4 NADH-quinone oxidoreductase subunit D domain-containing protein 0.9772 55 255 GO:0009535
GO:0016651
GO:0048038
GO:0051287
AF-A0A5J4NH96-F1-model_v4 Complex I-49kD (NADH-ubiquinone oxidoreductase 49 kDa subunit) 0.9771 82 390 GO:0005739
GO:0006120
GO:0016020
GO:0016651
GO:0048038
GO:0051287
AF-X1TSP0-F1-model_v4 NADH-quinone oxidoreductase subunit D domain-containing protein 0.977 86 241 GO:0016651
GO:0048038
GO:0051287

Feature Viewer

pLDDT pTM Quality
89.77 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map