F471799

General Info

Members Datasets Scaffolds Average Seq Length
641 354 641 156

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0136418|Ga0373937_0136418_590_1123
Length 177
Sequence MQFDFFHYVYSSMAHNKSVNRLREGFMASLEINGKTQEVNADPSTPLLWVIRDTLNMTGTKFGCGAQLCGACTVHLDGKPVRSCGTPLSAAIGKKITTIEGVSASAAXKKVQAAWAAIDVPQCGYCQSGQIMSATALLAENPKPTDADIDKAMAGNICRCGTYPRIRAAIHKAAKGA

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
123 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
124 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
125 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
182 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
183 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
187 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
190 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
191 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
192 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
193 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
194 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
195 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
196 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
210 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
211 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
220 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
231 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
232 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
241 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
259 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
260 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
261 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
262 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
263 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
264 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
265 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
266 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
267 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
268 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
269 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
270 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
275 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
276 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
277 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
278 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
279 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
282 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
283 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
286 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
287 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
288 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
289 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
294 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
295 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
296 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
297 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
298 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
299 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
300 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
301 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
302 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
303 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
304 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
305 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
306 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
307 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
308 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
313 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
314 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
315 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
316 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
322 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
323 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
324 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
325 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
329 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
330 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
331 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
332 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
333 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
334 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
339 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
340 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
341 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
344 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
345 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
346 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
349 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
350 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
351 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
352 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 2.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 0.94
Rhizosphere 96.26
Stem 0
Stem Tuber 0
Unclassified 2.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1338701 2162886006 Bacteria 1120
2 JGI24735J21928_10049085 3300002067 Bacteria 1220
3 JGI24749J21850_1025208 3300002076 Bacteria 847
4 rootH2_10136714 3300003320 Bacteria 2878
5 Ga0058859_10793595 3300004798 Bacteria 1221
6 Ga0058859_11381433 3300004798 Bacteria 650
7 Ga0058862_12713619 3300004803 Bacteria 2965
8 Ga0065704_10070436 3300005289 Bacteria 24901
9 Ga0065707_10001282 3300005295 Bacteria 10735
10 Ga0065707_10081813 3300005295 Bacteria 36984
11 Ga0065707_10084037 3300005295 Bacteria 7727
12 Ga0065707_10256063 3300005295 Bacteria 1111
13 Ga0065707_10441765 3300005295 Bacteria 809
14 Ga0065707_10673030 3300005295 Unclassified 652
15 Ga0070658_10012627 3300005327 Bacteria 6775
16 Ga0070658_10354227 3300005327 Bacteria 1257
17 Ga0070676_10039164 3300005328 Bacteria 2740
18 Ga0070676_10060206 3300005328 Bacteria 2254
19 Ga0070690_100000075 3300005330 Bacteria 48451
20 Ga0070690_100090386 3300005330 Bacteria 2016
21 Ga0068869_100000841 3300005334 Bacteria 17573
22 Ga0068869_100001166 3300005334 Bacteria 15390
23 Ga0070680_100001183 3300005336 Bacteria 18770
24 Ga0070682_100034498 3300005337 Bacteria 3082
25 Ga0070682_100975293 3300005337 Bacteria 702
26 Ga0068868_100000329 3300005338 Bacteria 31993
27 Ga0070660_100001672 3300005339 Bacteria 15227
28 Ga0070660_100119900 3300005339 Bacteria 2099
29 Ga0070689_100000481 3300005340 Bacteria 23552
30 Ga0070691_10000399 3300005341 Bacteria 15765
31 Ga0070687_100000014 3300005343 Bacteria 57432
32 Ga0070661_101038233 3300005344 Bacteria 681
33 Ga0070692_10000041 3300005345 Bacteria 24940
34 Ga0070675_100001440 3300005354 Bacteria 17483
35 Ga0070675_100565877 3300005354 Bacteria 1029
36 Ga0070675_100815892 3300005354 Bacteria 853
37 Ga0070688_100048098 3300005365 Bacteria 2649
38 Ga0070709_10023177 3300005434 Bacteria 3642
39 Ga0070709_10815766 3300005434 Bacteria 733
40 Ga0070714_100234140 3300005435 Bacteria 1693
41 Ga0070713_100001485 3300005436 Bacteria 14948
42 Ga0070713_100036776 3300005436 Bacteria 3954
43 Ga0070713_100066237 3300005436 Bacteria 3037
44 Ga0070701_10000641 3300005438 Bacteria 12213
45 Ga0070711_100418087 3300005439 Bacteria 1092
46 Ga0070705_100008701 3300005440 Bacteria 5027
47 Ga0070705_100165941 3300005440 Unclassified 1481
48 Ga0070705_100596163 3300005440 Bacteria 854
49 Ga0070705_100631222 3300005440 Bacteria 833
50 Ga0070700_100001345 3300005441 Bacteria 12219
51 Ga0070694_100000099 3300005444 Bacteria 41966
52 Ga0070694_100089852 3300005444 Bacteria 2153
53 Ga0070708_100012421 3300005445 Bacteria 6953
54 Ga0070708_100046280 3300005445 Bacteria 3839
55 Ga0070708_100634375 3300005445 Bacteria 1007
56 Ga0070681_10027710 3300005458 Bacteria 5696
57 Ga0068867_100000174 3300005459 Bacteria 41996
58 Ga0070706_100103560 3300005467 Bacteria 2646
59 Ga0070706_100129737 3300005467 Bacteria 2352
60 Ga0070707_100014756 3300005468 Bacteria 7323
61 Ga0070707_100086838 3300005468 Bacteria 3025
62 Ga0070707_100152189 3300005468 Bacteria 2253
63 Ga0070707_100326803 3300005468 Unclassified 1490
64 Ga0070707_100596650 3300005468 Bacteria 1067
65 Ga0070698_100017576 3300005471 Bacteria 7537
66 Ga0070698_100048113 3300005471 Bacteria 4357
67 Ga0070698_100160949 3300005471 Bacteria 2188
68 Ga0070698_100349329 3300005471 Bacteria 1410
69 Ga0070699_100021230 3300005518 Bacteria 5600
70 Ga0070699_100026645 3300005518 Bacteria 4985
71 Ga0070699_100044553 3300005518 Bacteria 3840
72 Ga0070699_100255187 3300005518 Bacteria 1567
73 Ga0070699_100436277 3300005518 Bacteria 1187
74 Ga0070699_100488850 3300005518 Bacteria 1117
75 Ga0070699_100689624 3300005518 Bacteria 933
76 Ga0070679_100031801 3300005530 Bacteria 5218
77 Ga0070697_100070216 3300005536 Bacteria 2871
78 Ga0070697_100082474 3300005536 Bacteria 2650
79 Ga0070697_100432368 3300005536 Bacteria 1145
80 Ga0068853_100057696 3300005539 Bacteria 3351
81 Ga0068853_101776598 3300005539 Bacteria 598
82 Ga0070686_100000134 3300005544 Bacteria 51357
83 Ga0070695_100000018 3300005545 Bacteria 63499
84 Ga0070695_100012719 3300005545 Bacteria 5051
85 Ga0070695_100066267 3300005545 Bacteria 2353
86 Ga0070696_100027846 3300005546 Bacteria 3854
87 Ga0070693_100000021 3300005547 Bacteria 59618
88 Ga0070665_100001226 3300005548 Bacteria 31203
89 Ga0070704_100000043 3300005549 Bacteria 42411
90 Ga0070704_100003271 3300005549 Bacteria 9259
91 Ga0070704_100305828 3300005549 Unclassified 1326
92 Ga0068855_100001327 3300005563 Bacteria 30611
93 Ga0068855_100699465 3300005563 Bacteria 1085
94 Ga0068857_100111024 3300005577 Bacteria 2464
95 Ga0068854_100002225 3300005578 Bacteria 11931
96 Ga0068854_101177074 3300005578 Bacteria 686
97 Ga0068856_100041413 3300005614 Bacteria 4527
98 Ga0068856_100263037 3300005614 Bacteria 1741
99 Ga0068856_100606005 3300005614 Bacteria 1116
100 Ga0070702_100000007 3300005615 Bacteria 65238
101 Ga0068852_100042244 3300005616 Bacteria 3859
102 Ga0068852_101147056 3300005616 Bacteria 798
103 Ga0068859_100001320 3300005617 Bacteria 25307
104 Ga0068859_100252866 3300005617 Bacteria 1853
105 Ga0068866_10000561 3300005718 Bacteria 16983
106 Ga0068861_100000617 3300005719 Bacteria 21065
107 Ga0068861_102037473 3300005719 Bacteria 573
108 Ga0068870_10004187 3300005840 Bacteria 6194
109 Ga0068863_100254518 3300005841 Bacteria 1697
110 Ga0068863_100435927 3300005841 Bacteria 1285
111 Ga0068858_100000334 3300005842 Bacteria 49778
112 Ga0068860_100001410 3300005843 Bacteria 26069
113 Ga0068860_100125796 3300005843 Bacteria 2457
114 Ga0068862_100000688 3300005844 Bacteria 34533
115 Ga0068862_100082797 3300005844 Bacteria 2785
116 Ga0068862_100106650 3300005844 Bacteria 2456
117 Ga0081455_10086864 3300005937 Bacteria 2547
118 Ga0081538_10003141 3300005981 Bacteria 15695
119 Ga0070717_10283452 3300006028 Bacteria 1470
120 Ga0070715_10470048 3300006163 Bacteria 714
121 Ga0070716_100001913 3300006173 Bacteria 9466
122 Ga0070716_100007818 3300006173 Bacteria 5285
123 Ga0070712_100671118 3300006175 Bacteria 882
124 Ga0075427_10000052 3300006194 Bacteria 8724
125 Ga0097621_100000593 3300006237 Bacteria 25510
126 Ga0097621_100072191 3300006237 Bacteria 2855
127 Ga0068871_100000157 3300006358 Bacteria 44850
128 Ga0075428_100001267 3300006844 Bacteria 26940
129 Ga0075428_100004810 3300006844 Bacteria 14974
130 Ga0075428_100022421 3300006844 Bacteria 6992
131 Ga0075428_100057169 3300006844 Bacteria 4271
132 Ga0075428_100181592 3300006844 Bacteria 2277
133 Ga0075428_100198604 3300006844 Bacteria 2169
134 Ga0075430_100002352 3300006846 Bacteria 15715
135 Ga0075430_100049700 3300006846 Unclassified 3539
136 Ga0075430_100233003 3300006846 Bacteria 1527
137 Ga0075430_100845485 3300006846 Bacteria 754
138 Ga0075431_100021112 3300006847 Bacteria 6655
139 Ga0075431_100070939 3300006847 Bacteria 3594
140 Ga0075431_100161631 3300006847 Bacteria 2303
141 Ga0075431_100420933 3300006847 Bacteria 1335
142 Ga0075431_101141333 3300006847 Bacteria 743
143 Ga0075433_10001495 3300006852 Bacteria 17266
144 Ga0075433_10341005 3300006852 Bacteria 1325
145 Ga0075433_10670647 3300006852 Bacteria 909
146 Ga0075433_11663316 3300006852 Bacteria 550
147 Ga0075434_100000989 3300006871 Bacteria 23001
148 Ga0075434_100047202 3300006871 Bacteria 4274
149 Ga0075434_100337235 3300006871 Bacteria 1528
150 Ga0075429_100000046 3300006880 Bacteria 56781
151 Ga0075429_100001186 3300006880 Bacteria 21066
152 Ga0075429_100013305 3300006880 Bacteria 7136
153 Ga0075429_100024544 3300006880 Bacteria 5231
154 Ga0075429_100048367 3300006880 Bacteria 3698
155 Ga0075429_100317707 3300006880 Bacteria 1363
156 Ga0068865_100000296 3300006881 Bacteria 27405
157 Ga0075436_100000190 3300006914 Bacteria 37988
158 Ga0097620_100001320 3300006931 Bacteria 25307
159 Ga0097620_100252866 3300006931 Bacteria 1853
160 Ga0075435_100000058 3300007076 Bacteria 56883
161 Ga0075435_100346660 3300007076 Bacteria 1273
162 Ga0075435_101227682 3300007076 Bacteria 656
163 Ga0099794_10010059 3300007265 Bacteria 4005
164 Ga0099794_10099383 3300007265 Bacteria 1451
165 Ga0099794_10145106 3300007265 Bacteria 1203
166 Ga0099794_10272541 3300007265 Bacteria 874
167 Ga0099795_10123063 3300007788 Bacteria 1039
168 Ga0105251_10003168 3300009011 Bacteria 12177
169 Ga0105240_10004592 3300009093 Bacteria 20929
170 Ga0105240_10249969 3300009093 Bacteria 2051
171 Ga0105240_10779433 3300009093 Bacteria 1037
172 Ga0111539_10010601 3300009094 Bacteria 11606
173 Ga0111539_10816109 3300009094 Bacteria 1085
174 Ga0111539_11154220 3300009094 Bacteria 900
175 Ga0111539_11194109 3300009094 Bacteria 884
176 Ga0111539_11379558 3300009094 Bacteria 818
177 Ga0111539_12658459 3300009094 Bacteria 580
178 Ga0105245_10000405 3300009098 Bacteria 40004
179 Ga0105245_10925557 3300009098 Bacteria 914
180 Ga0105245_11526127 3300009098 Bacteria 719
181 Ga0114129_10000177 3300009147 Bacteria 70549
182 Ga0114129_10000974 3300009147 Bacteria 37478
183 Ga0114129_10004218 3300009147 Bacteria 20308
184 Ga0114129_10014581 3300009147 Bacteria 11197
185 Ga0114129_10170625 3300009147 Bacteria 2966
186 Ga0114129_10794708 3300009147 Bacteria 1208
187 Ga0105243_10000466 3300009148 Bacteria 41868
188 Ga0105243_10022088 3300009148 Bacteria 4835
189 Ga0105243_10124485 3300009148 Bacteria 2178
190 Ga0105241_10132627 3300009174 Bacteria 2019
191 Ga0105242_10000191 3300009176 Bacteria 47337
192 Ga0105242_10127947 3300009176 Bacteria 2188
193 Ga0105248_10131250 3300009177 Bacteria 2827
194 Ga0105237_10023256 3300009545 Bacteria 6352
195 Ga0105237_10215933 3300009545 Bacteria 1918
196 Ga0105237_10466983 3300009545 Bacteria 1268
197 Ga0105238_11584057 3300009551 Bacteria 685
198 Ga0105249_10000555 3300009553 Bacteria 34420
199 Ga0105249_10035348 3300009553 Bacteria 4532
200 Ga0105249_10139393 3300009553 Unclassified 2324
201 Ga0105249_10870152 3300009553 Unclassified 967
202 Ga0099796_10129973 3300010159 Bacteria 976
203 Ga0105239_10082228 3300010375 Bacteria 3546
204 Ga0105246_10081161 3300011119 Bacteria 2310
205 Ga0105246_10296247 3300011119 Bacteria 1304
206 Ga0105246_11301184 3300011119 Bacteria 674
207 Ga0157324_1037396 3300012506 Bacteria 579
208 Ga0157373_10021893 3300013100 Bacteria 4638
209 Ga0157371_10047383 3300013102 Bacteria 3056
210 Ga0157371_10113482 3300013102 Bacteria 1924
211 Ga0157371_10269411 3300013102 Bacteria 1229
212 Ga0157370_10004911 3300013104 Bacteria 15149
213 Ga0157369_10003711 3300013105 Bacteria 18153
214 Ga0157369_10011071 3300013105 Bacteria 10262
215 Ga0157374_10000221 3300013296 Bacteria 52587
216 Ga0157374_10007785 3300013296 Bacteria 9145
217 Ga0157374_10651266 3300013296 Bacteria 1065
218 Ga0157378_10000196 3300013297 Bacteria 58849
219 Ga0163162_10057810 3300013306 Bacteria 3906
220 Ga0163162_10116338 3300013306 Bacteria 2774
221 Ga0157372_10009644 3300013307 Bacteria 10261
222 Ga0157372_10016041 3300013307 Bacteria 8035
223 Ga0157372_10114553 3300013307 Bacteria 3091
224 Ga0157372_10412772 3300013307 Bacteria 1573
225 Ga0157372_11425375 3300013307 Bacteria 798
226 Ga0157372_12042109 3300013307 Bacteria 659
227 Ga0163163_10028218 3300014325 Bacteria 5387
228 Ga0157380_10028322 3300014326 Bacteria 4270
229 Ga0157380_10030394 3300014326 Bacteria 4136
230 Ga0157380_10121650 3300014326 Bacteria 2212
231 Ga0157380_10198695 3300014326 Bacteria 1777
232 Ga0157377_10001401 3300014745 Bacteria 10405
233 Ga0157377_10167411 3300014745 Bacteria 1371
234 Ga0157379_10045543 3300014968 Bacteria 3914
235 Ga0157376_10000314 3300014969 Bacteria 32447
236 Ga0157376_10037538 3300014969 Bacteria 3934
237 Ga0182006_1129887 3300015261 Bacteria 867
238 Ga0163161_10006381 3300017792 Bacteria 8163
239 Ga0197907_10572943 3300020069 Bacteria 1577
240 Ga0206349_1444139 3300020075 Bacteria 4662
241 Ga0206351_10662555 3300020077 Bacteria 577
242 Ga0206350_10957556 3300020080 Bacteria 1528
243 Ga0206354_11344381 3300020081 Bacteria 2011
244 Ga0206353_11249298 3300020082 Bacteria 1280
245 Ga0206353_11376464 3300020082 Bacteria 2857
246 Ga0213872_10001160 3300021361 Bacteria 17917
247 Ga0213872_10040248 3300021361 Bacteria 2134
248 Ga0224712_10036737 3300022467 Bacteria 1818
249 Ga0224572_1057874 3300024225 Bacteria 719
250 Ga0209026_1003669 3300025250 Bacteria 4920
251 Ga0209759_1019331 3300025256 Bacteria 1618
252 Ga0207713_1061449 3300025735 Bacteria 1429
253 Ga0207642_10000935 3300025899 Bacteria 9141
254 Ga0207680_10089947 3300025903 Bacteria 1950
255 Ga0207647_10025600 3300025904 Bacteria 3873
256 Ga0207685_10257171 3300025905 Bacteria 847
257 Ga0207699_10047572 3300025906 Bacteria 2516
258 Ga0207643_10030147 3300025908 Bacteria 3019
259 Ga0207684_10086549 3300025910 Unclassified 2669
260 Ga0207684_10107704 3300025910 Bacteria 2384
261 Ga0207654_10091213 3300025911 Bacteria 1858
262 Ga0207707_10117754 3300025912 Bacteria 2322
263 Ga0207695_10071377 3300025913 Bacteria 3547
264 Ga0207695_10111167 3300025913 Bacteria 2719
265 Ga0207671_10090199 3300025914 Bacteria 2308
266 Ga0207671_10311526 3300025914 Bacteria 1244
267 Ga0207693_10154078 3300025915 Bacteria 1808
268 Ga0207663_10407627 3300025916 Bacteria 1041
269 Ga0207660_10000284 3300025917 Bacteria 33488
270 Ga0207660_10027982 3300025917 Bacteria 3853
271 Ga0207660_10342732 3300025917 Bacteria 1196
272 Ga0207662_10000063 3300025918 Bacteria 46662
273 Ga0207657_10018440 3300025919 Bacteria 6661
274 Ga0207657_10081948 3300025919 Bacteria 2709
275 Ga0207652_10016598 3300025921 Bacteria 6015
276 Ga0207652_11205550 3300025921 Bacteria 659
277 Ga0207646_10001174 3300025922 Bacteria 33188
278 Ga0207646_10052136 3300025922 Bacteria 3661
279 Ga0207646_10289103 3300025922 Bacteria 1481
280 Ga0207681_10361666 3300025923 Bacteria 1164
281 Ga0207659_10021091 3300025926 Bacteria 4318
282 Ga0207687_10000976 3300025927 Bacteria 19455
283 Ga0207687_10207992 3300025927 Bacteria 1533
284 Ga0207700_10004396 3300025928 Bacteria 8302
285 Ga0207700_10028783 3300025928 Bacteria 3913
286 Ga0207700_10076167 3300025928 Bacteria 2602
287 Ga0207664_10565261 3300025929 Bacteria 1021
288 Ga0207686_11069086 3300025934 Bacteria 657
289 Ga0207709_10002870 3300025935 Bacteria 10556
290 Ga0207709_11013107 3300025935 Bacteria 679
291 Ga0207670_10001140 3300025936 Bacteria 14016
292 Ga0207670_10021108 3300025936 Bacteria 4013
293 Ga0207704_10001148 3300025938 Bacteria 11772
294 Ga0207665_10000589 3300025939 Bacteria 24479
295 Ga0207665_10110252 3300025939 Bacteria 1933
296 Ga0207665_11030817 3300025939 Bacteria 655
297 Ga0207691_10292695 3300025940 Bacteria 1400
298 Ga0207711_10174590 3300025941 Bacteria 1952
299 Ga0207711_10900137 3300025941 Bacteria 823
300 Ga0207689_10000214 3300025942 Bacteria 51325
301 Ga0207667_10027649 3300025949 Bacteria 6170
302 Ga0207667_10031255 3300025949 Bacteria 5749
303 Ga0207667_10408109 3300025949 Bacteria 1383
304 Ga0207667_11127318 3300025949 Bacteria 767
305 Ga0207712_10161688 3300025961 Bacteria 1741
306 Ga0207712_10191520 3300025961 Bacteria 1615
307 Ga0207712_10238810 3300025961 Bacteria 1463
308 Ga0207640_10000972 3300025981 Bacteria 15897
309 Ga0207640_10942835 3300025981 Bacteria 756
310 Ga0207677_10000714 3300026023 Bacteria 19610
311 Ga0207703_10012996 3300026035 Bacteria 6487
312 Ga0207639_10012477 3300026041 Bacteria 5919
313 Ga0207639_11509449 3300026041 Bacteria 631
314 Ga0207708_10000117 3300026075 Bacteria 60989
315 Ga0207702_10028320 3300026078 Bacteria 4656
316 Ga0207702_10103138 3300026078 Bacteria 2522
317 Ga0207702_10288441 3300026078 Bacteria 1554
318 Ga0207702_10765074 3300026078 Bacteria 954
319 Ga0207641_10234745 3300026088 Bacteria 1706
320 Ga0207641_11489522 3300026088 Bacteria 678
321 Ga0207648_10000293 3300026089 Bacteria 54504
322 Ga0207676_10411431 3300026095 Bacteria 1266
323 Ga0207674_10118964 3300026116 Bacteria 2611
324 Ga0207674_10144868 3300026116 Bacteria 2334
325 Ga0207674_10702827 3300026116 Bacteria 976
326 Ga0207675_100000218 3300026118 Bacteria 53850
327 Ga0207675_100411018 3300026118 Bacteria 1335
328 Ga0207675_100476898 3300026118 Bacteria 1239
329 Ga0207698_10042850 3300026142 Bacteria 3386
330 Ga0209588_1007989 3300027671 Bacteria 3130
331 Ga0209588_1148749 3300027671 Bacteria 743
332 Ga0209971_1095120 3300027682 Bacteria 728
333 Ga0207428_10000517 3300027907 Bacteria 46100
334 Ga0207428_10027604 3300027907 Bacteria 4725
335 Ga0207428_10833560 3300027907 Bacteria 654
336 Ga0268266_10001924 3300028379 Bacteria 23359
337 Ga0268265_10005718 3300028380 Bacteria 8491
338 Ga0268265_10359232 3300028380 Bacteria 1333
339 Ga0268265_11076027 3300028380 Bacteria 797
340 Ga0268264_10000609 3300028381 Bacteria 42936
341 Ga0268264_10084407 3300028381 Bacteria 2723
342 Ga0268264_10266123 3300028381 Bacteria 1600
343 Ga0265769_107039 3300030888 Bacteria 718
344 Ga0265328_10005792 3300031239 Bacteria 5275
345 Ga0265331_10002817 3300031250 Bacteria 11527
346 Ga0265327_10000043 3300031251 Bacteria 285108
347 Ga0265327_10008406 3300031251 Bacteria 7695
348 Ga0316576_10468192 3300031727 Bacteria 929
349 Ga0316578_10093402 3300031728 Bacteria 1799
350 Ga0316577_10005591 3300031733 Bacteria 6601
351 Ga0307416_100140329 3300032002 Bacteria 2195
352 Ga0307411_10509219 3300032005 Bacteria 1019
353 Ga0316585_10017644 3300032137 Bacteria 2160
354 Ga0307507_10088742 3300033179 Bacteria 2665
355 Ga0307510_10059359 3300033180 Bacteria 3951
356 Ga0373930_0022050 3300034816 Bacteria 1256
357 Ga0373959_0045623 3300034820 Bacteria 932
358 Ga0373938_0045456 3300034957 Bacteria 988
359 Ga0373928_0036099 3300035084 Bacteria 1116
360 Ga0373940_0003758 3300035088 Bacteria 3135
361 Ga0373944_0232308 3300035089 Bacteria 676
362 Ga0373949_0050928 3300035090 Bacteria 1043
363 Ga0373951_0008041 3300035091 Bacteria 2391
364 Ga0373952_0012870 3300035092 Bacteria 1652
365 Ga0373923_0078772 3300035111 Bacteria 1426
366 Ga0373923_0276048 3300035111 Bacteria 791
367 Ga0373932_0001050 3300035112 Bacteria 7951
368 Ga0373936_0032465 3300035113 Bacteria 2065
369 Ga0373936_0064179 3300035113 Bacteria 1504
370 Ga0373936_0244925 3300035113 Bacteria 799
371 Ga0373939_0002059 3300035114 Bacteria 4799
372 Ga0373941_0024743 3300035115 Bacteria 1727
373 Ga0373941_0044988 3300035115 Bacteria 1380
374 Ga0373941_0277275 3300035115 Bacteria 662
375 Ga0373945_0045063 3300035116 Bacteria 1605
376 Ga0373954_0051752 3300035118 Bacteria 1929
377 Ga0373954_0399335 3300035118 Bacteria 680
378 Ga0373956_0036320 3300035119 Bacteria 2174
379 Ga0373943_0002249 3300035170 Bacteria 8772
380 Ga0373943_0285902 3300035170 Bacteria 933
381 Ga0373943_0588671 3300035170 Bacteria 655
382 Ga0373946_0002900 3300035171 Bacteria 6083
383 Ga0373955_0011452 3300035172 Bacteria 4228
384 Ga0373942_0010568 3300035207 Bacteria 2173
385 Ga0373942_0131079 3300035207 Bacteria 791
386 Ga0373962_0120752 3300035242 Bacteria 835
387 Ga0316574_0008996 3300035398 Bacteria 5578
388 Ga0316574_0324815 3300035398 Bacteria 976
389 Ga0373924_0013784 3300035410 Bacteria 3042
390 Ga0373924_0420712 3300035410 Bacteria 598
391 Ga0373931_0001310 3300035691 Bacteria 10655
392 Ga0373931_0001708 3300035691 Bacteria 9519
393 Ga0373935_0002524 3300035692 Bacteria 10489
394 Ga0373935_0099425 3300035692 Bacteria 1915
395 Ga0373935_0446814 3300035692 Bacteria 933
396 Ga0373935_0836404 3300035692 Bacteria 680
397 Ga0373927_0010809 3300035695 Bacteria 6082
398 Ga0373927_0019500 3300035695 Bacteria 4446
399 Ga0373933_0006340 3300035724 Bacteria 6436
400 Ga0373947_0009586 3300035725 Bacteria 5557
401 Ga0373947_0046137 3300035725 Bacteria 2609
402 Ga0373947_0589389 3300035725 Bacteria 757
403 Ga0373937_0039197 3300036401 Bacteria 4318
404 Ga0373937_0136418 3300036401 Bacteria 2294
405 Ga0373937_0209461 3300036401 Bacteria 1834
406 Ga0373937_0225552 3300036401 Bacteria 1764
407 Ga0316582_0265275 3300036647 Bacteria 1178
408 Ga0316584_0002429 3300036712 Bacteria 11787
409 Ga0316584_0113994 3300036712 Bacteria 2022
410 Ga0316584_0201669 3300036712 Bacteria 1468
411 Ga0373925_0010575 3300037068 Bacteria 6692
412 Ga0373925_0029085 3300037068 Bacteria 4054
413 Ga0395899_0002318 3300037312 Bacteria 15511
414 Ga0395900_0072495 3300037418 Bacteria 3540
415 Ga0395900_0206367 3300037418 Bacteria 1986
416 Ga0395900_0239580 3300037418 Bacteria 1820
417 Ga0395898_0255974 3300037466 Bacteria 1669
418 Ga0436364_0823753 3300037853 Bacteria 1272
419 Ga0436364_1416277 3300037853 Bacteria 510
420 Ga0395901_0099359 3300038443 Bacteria 3051
421 Ga0395901_0132273 3300038443 Bacteria 2621
422 Ga0395901_0311919 3300038443 Bacteria 1629
423 Ga0436365_0025793 3300039437 Bacteria 658
424 Ga0436361_0056557 3300039447 Bacteria 1002
425 Ga0436361_0242643 3300039447 Bacteria 529
426 Ga0436361_0294265 3300039447 Bacteria 539
427 Ga0436361_0483849 3300039447 Bacteria 2524
428 Ga0436361_1208495 3300039447 Bacteria 38358
429 Ga0436363_0564814 3300039450 Bacteria 544
430 Ga0436363_1259361 3300039450 Bacteria 719
431 Ga0439441_026140 3300042001 Bacteria 1106
432 Ga0439448_0000024 3300042005 Bacteria 24656
433 Ga0439446_0103567 3300042156 Bacteria 902
434 Ga0451577_0000181 3300042876 Bacteria 134503
435 Ga0451577_0025715 3300042876 Bacteria 5340
436 Ga0451577_0030853 3300042876 Bacteria 4840
437 Ga0451577_0175893 3300042876 Bacteria 1929
438 Ga0451577_0533724 3300042876 Unclassified 1065
439 Ga0451577_1118145 3300042876 Bacteria 705
440 Ga0453683_0144803 3300044673 Bacteria 1500
441 Ga0453683_0269553 3300044673 Unclassified 1086
442 Ga0453683_0901962 3300044673 Bacteria 584
443 Ga0453683_1043029 3300044673 Bacteria 544
444 Ga0453684_0000592 3300044712 Bacteria 134503
445 Ga0453684_0020611 3300044712 Bacteria 9927
446 Ga0453684_0044528 3300044712 Bacteria 5935
447 Ga0453684_0045961 3300044712 Bacteria 5816
448 Ga0453684_0135543 3300044712 Bacteria 2948
449 Ga0453684_0187410 3300044712 Unclassified 2423
450 Ga0453684_0626313 3300044712 Bacteria 1176
451 Ga0451576_0001387 3300045051 Bacteria 41619
452 Ga0451576_0006418 3300045051 Bacteria 14425
453 Ga0451576_0026411 3300045051 Bacteria 6246
454 Ga0451576_0078953 3300045051 Unclassified 3424
455 Ga0451576_0344377 3300045051 Bacteria 1560
456 Ga0451576_0390474 3300045051 Bacteria 1459
457 Ga0451576_0656078 3300045051 Bacteria 1102
458 Ga0451576_1012494 3300045051 Bacteria 871
459 Ga0495627_015812 3300046453 Bacteria 2598
460 Ga0495627_139589 3300046453 Bacteria 679
461 Ga0495592_0121651 3300046454 Bacteria 1835
462 Ga0495603_0008792 3300046455 Bacteria 6105
463 Ga0495590_0094512 3300046457 Bacteria 1059
464 Ga0495591_008252 3300046458 Bacteria 4290
465 Ga0495629_0021221 3300046459 Bacteria 4635
466 Ga0495650_0002488 3300046471 Bacteria 14818
467 Ga0495650_0004830 3300046471 Bacteria 9024
468 Ga0495580_0009565 3300046472 Bacteria 7615
469 Ga0495580_0025415 3300046472 Bacteria 4328
470 Ga0495580_0104971 3300046472 Bacteria 1963
471 Ga0495582_0026272 3300046473 Bacteria 3191
472 Ga0495605_0000002 3300046474 Bacteria 522417
473 Ga0495605_0022400 3300046474 Bacteria 3336
474 Ga0495605_0383140 3300046474 Bacteria 586
475 Ga0495639_0004313 3300046475 Bacteria 6099
476 Ga0495639_0037952 3300046475 Bacteria 2162
477 Ga0495664_0363157 3300046477 Bacteria 871
478 Ga0495664_0538212 3300046477 Bacteria 696
479 Ga0495584_0039781 3300046491 Bacteria 2375
480 Ga0495585_0004721 3300046492 Bacteria 8773
481 Ga0495594_0009897 3300046499 Bacteria 4940
482 Ga0495594_0052252 3300046499 Bacteria 2250
483 Ga0495594_0091449 3300046499 Bacteria 1705
484 Ga0495596_0012913 3300046500 Bacteria 3559
485 Ga0495607_0087477 3300046501 Bacteria 1695
486 Ga0495583_0000012 3300046506 Bacteria 324839
487 Ga0495583_0001950 3300046506 Bacteria 19001
488 Ga0495606_0001289 3300046507 Bacteria 34720
489 Ga0495608_0014684 3300046511 Bacteria 5433
490 Ga0495610_0029055 3300046512 Bacteria 2916
491 Ga0495610_0047779 3300046512 Bacteria 2104
492 Ga0495616_0047136 3300046513 Bacteria 2171
493 Ga0495620_0000026 3300046515 Bacteria 124427
494 Ga0495628_0011070 3300046516 Bacteria 7633
495 Ga0495630_0129081 3300046517 Bacteria 1919
496 Ga0495631_0025273 3300046518 Bacteria 2737
497 Ga0495631_0029429 3300046518 Bacteria 2497
498 Ga0495632_0012687 3300046519 Bacteria 4845
499 Ga0495637_0000021 3300046520 Bacteria 179141
500 Ga0495637_0034092 3300046520 Bacteria 2231
501 Ga0495643_0025155 3300046522 Bacteria 3371
502 Ga0495644_0002658 3300046523 Bacteria 7099
503 Ga0495648_0026343 3300046524 Bacteria 3916
504 Ga0495666_0012173 3300046526 Bacteria 4294
505 Ga0495666_0066130 3300046526 Bacteria 1724
506 Ga0495652_0043254 3300046529 Bacteria 3881
507 Ga0495654_0000617 3300046530 Bacteria 28316
508 Ga0495654_0138098 3300046530 Bacteria 1088
509 Ga0495665_0016706 3300046531 Bacteria 3953
510 Ga0495665_0028043 3300046531 Bacteria 3021
511 Ga0495640_0017250 3300046533 Bacteria 5384
512 Ga0495640_0022809 3300046533 Bacteria 4571
513 Ga0495586_0013912 3300046535 Bacteria 4271
514 Ga0495586_0033144 3300046535 Bacteria 2771
515 Ga0495586_0034781 3300046535 Bacteria 2707
516 Ga0495586_0042485 3300046535 Bacteria 2448
517 Ga0495609_0000008 3300046538 Bacteria 383025
518 Ga0495609_0000920 3300046538 Bacteria 21325
519 Ga0495621_0408362 3300046539 Bacteria 577
520 Ga0495597_0002842 3300046542 Bacteria 10597
521 Ga0495597_0219643 3300046542 Bacteria 755
522 Ga0495622_0002553 3300046557 Bacteria 8799
523 Ga0495633_0000216 3300046558 Bacteria 72025
524 Ga0495667_0016919 3300046559 Bacteria 4924
525 Ga0495668_0120603 3300046616 Bacteria 1434
526 Ga0495634_0011889 3300046642 Bacteria 6324
527 Ga0495611_0000175 3300046648 Bacteria 46491
528 Ga0495611_0009399 3300046648 Bacteria 4132
529 Ga0495625_0000028 3300046660 Bacteria 256946
530 Ga0495635_0057937 3300046663 Bacteria 2665
531 Ga0495661_0000096 3300046665 Bacteria 109096
532 Ga0495661_0003182 3300046665 Bacteria 12277
533 Ga0495657_0062429 3300046675 Bacteria 2462
534 Ga0495599_0015790 3300046678 Bacteria 4687
535 Ga0495647_0189277 3300046681 Bacteria 898
536 Ga0495658_0034873 3300046683 Bacteria 2763
537 Ga0495613_0109325 3300046689 Bacteria 1993
538 Ga0495624_0229024 3300046690 Bacteria 1126
539 Ga0495670_0032173 3300046691 Bacteria 2608
540 Ga0495670_0033868 3300046691 Bacteria 2542
541 Ga0495671_0024052 3300046692 Bacteria 3177
542 Ga0495671_0039485 3300046692 Bacteria 2382
543 Ga0495649_0017948 3300046694 Bacteria 3987
544 Ga0495589_0000492 3300046794 Bacteria 28250
545 Ga0495600_0859454 3300046809 Bacteria 537
546 Ga0495660_0006771 3300046810 Bacteria 6757
547 Ga0495581_0014771 3300047315 Bacteria 4530
548 Ga0495604_0104774 3300047317 Bacteria 2071
549 Ga0495674_0044843 3300047319 Bacteria 3929
550 Ga0495672_0051058 3300047320 Bacteria 2437
551 Ga0495676_0000006 3300047321 Bacteria 280508
552 Ga0495676_0006782 3300047321 Bacteria 10527
553 Ga0495680_0021285 3300047322 Bacteria 5431
554 Ga0495680_0405954 3300047322 Bacteria 940
555 Ga0495683_0000169 3300047323 Bacteria 63606
556 Ga0495683_0014816 3300047323 Bacteria 4060
557 Ga0495675_0202442 3300047444 Bacteria 1208
558 Ga0495679_000200 3300047446 Bacteria 52539
559 Ga0495679_001247 3300047446 Bacteria 15082
560 Ga0495673_0014435 3300047469 Bacteria 4108
561 Ga0495681_0000789 3300047470 Bacteria 24391
562 Ga0495681_0006948 3300047470 Bacteria 7334
563 Ga0495684_0011742 3300047471 Bacteria 6761
564 Ga0495686_0003039 3300047472 Bacteria 14874
565 Ga0495686_0173329 3300047472 Bacteria 1253
566 Ga0495593_0177472 3300047673 Bacteria 1073
567 Ga0495614_0100599 3300048089 Bacteria 1263
568 Ga0495626_0000019 3300048091 Bacteria 225494
569 Ga0496100_0024814 3300048903 Bacteria 3662
570 Ga0496101_0084496 3300048904 Bacteria 2351
571 Ga0496102_0666558 3300048905 Bacteria 963
572 Ga0496106_0360215 3300048909 Bacteria 1168
573 Ga0496114_0124556 3300048917 Bacteria 2220
574 Ga0496115_0004843 3300048918 Bacteria 9770
575 Ga0496116_0000550 3300048919 Bacteria 50193
576 Ga0496122_0025334 3300048925 Bacteria 5154
577 Ga0496123_0014205 3300048926 Bacteria 6619
578 Ga0496126_0551945 3300048929 Bacteria 914
579 Ga0495678_000242 3300049459 Bacteria 61395
580 Ga0501036_0494216 3300049572 Bacteria 1018
581 Ga0501036_1230823 3300049572 Bacteria 610
582 Ga0501040_0012787 3300049576 Bacteria 5510
583 Ga0501040_0245516 3300049576 Bacteria 1277
584 Ga0501040_0458254 3300049576 Bacteria 918
585 Ga0501048_0221294 3300049582 Bacteria 1343
586 Ga0501067_0529663 3300049583 Bacteria 659
587 Ga0501071_0084511 3300049587 Bacteria 2326
588 Ga0501071_0371542 3300049587 Bacteria 1090
589 Ga0501073_0011837 3300049589 Bacteria 6368
590 Ga0501074_0175412 3300049590 Bacteria 1529
591 Ga0501074_0801133 3300049590 Bacteria 664
592 Ga0501075_0003860 3300049591 Bacteria 10095
593 Ga0501075_0113568 3300049591 Bacteria 2060
594 Ga0501076_0803540 3300049592 Bacteria 776
595 Ga0501202_226393 3300049652 Bacteria 519
596 Ga0501079_0033042 3300049741 Bacteria 3979
597 Ga0501080_0119439 3300049742 Bacteria 2444
598 Ga0501080_0589882 3300049742 Bacteria 987
599 Ga0501045_0148668 3300049824 Bacteria 1743
600 nmdc:mga05p37_20293_c1 3300050507 Bacteria 8041
601 nmdc:mga05p37_344_c1 3300050507 Bacteria 49898
602 nmdc:mga05p37_51069_c1 3300050507 Bacteria 5086
603 nmdc:mga05p37_66679_c1 3300050507 Bacteria 4427
604 nmdc:mga05p37_81432_c1 3300050507 Unclassified 3988
605 nmdc:mga05p37_847720_c1 3300050507 Bacteria 993
606 nmdc:mga05p37_972481_c1 3300050507 Bacteria 906
607 nmdc:mga09592_144945_c1 3300050508 Bacteria 2048
608 nmdc:mga09592_236889_c1 3300050508 Unclassified 1581
609 nmdc:mga09592_3484_c1 3300050508 Bacteria 12706
610 nmdc:mga09592_407852_c1 3300050508 Bacteria 1174
611 nmdc:mga09592_7945_c1 3300050508 Bacteria 8619
612 nmdc:mga0qj67_11724_c1 3300050509 Bacteria 6578
613 nmdc:mga06r32_125963_c1 3300050510 Bacteria 2530
614 nmdc:mga06r32_1408895_c1 3300050510 Bacteria 639
615 nmdc:mga06r32_290142_c1 3300050510 Bacteria 1623
616 nmdc:mga06r32_31908_c1 3300050510 Unclassified 4951
617 nmdc:mga08y16_11098_c1 3300050511 Bacteria 9459
618 nmdc:mga08y16_2094426_c1 3300050511 Bacteria 514
619 nmdc:mga08y16_4553_c1 3300050511 Bacteria 14453
620 nmdc:mga08y16_7973_c1 3300050511 Bacteria 11084
621 nmdc:mga0n895_370_c1 3300050512 Bacteria 30361
622 nmdc:mga0n895_413119_c1 3300050512 Bacteria 1364
623 nmdc:mga0n895_6296_c1 3300050512 Bacteria 10064
624 nmdc:mga0n895_991301_c1 3300050512 Bacteria 822
625 nmdc:mga0rr50_11142_c1 3300050513 Bacteria 5738
626 nmdc:mga0rr50_463_c1 3300050513 Bacteria 21610
627 nmdc:mga08x19_4276_c1 3300050514 Bacteria 8465
628 nmdc:mga0a205_1307737_c1 3300050515 Bacteria 573
629 nmdc:mga0a205_134_c1 3300050515 Bacteria 46209
630 nmdc:mga0a205_3271_c1 3300050515 Bacteria 14414
631 nmdc:mga0a205_465582_c1 3300050515 Bacteria 1123
632 Ga0495601_0014585 3300053077 Bacteria 4736
633 Ga0495619_0055928 3300053085 Bacteria 2615
634 Ga0495619_0244703 3300053085 Bacteria 1243
635 Ga0500618_114266 3300053125 Bacteria 610
636 Ga0500586_131593 3300053145 Bacteria 865
637 Ga0501084_0017223 3300054114 Bacteria 6002
638 Ga0587075_010098 3300059644 Bacteria 1242
639 Ga0501082_0189052 3300060353 Bacteria 1792
640 Ga0501082_0373633 3300060353 Bacteria 1244
641 Ga0530510_0373686 3300061734 Bacteria 1072

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0209461 Ga0373937_0209461_380_802 136
2 3300025921 Ga0207652_11205550 Ga0207652_112055502 148
3 3300025936 Ga0207670_10021108 Ga0207670_100211082 148
4 3300025949 Ga0207667_11127318 Ga0207667_111273181 148
5 3300026095 Ga0207676_10411431 Ga0207676_104114312 148
6 3300050511 nmdc:mga08y16_11098_c1 nmdc:mga08y16_11098_c1_1379_1834 148
7 3300050512 nmdc:mga0n895_6296_c1 nmdc:mga0n895_6296_c1_1170_1625 148
8 3300050513 nmdc:mga0rr50_11142_c1 nmdc:mga0rr50_11142_c1_1820_2275 148
9 3300050515 nmdc:mga0a205_3271_c1 nmdc:mga0a205_3271_c1_8440_8895 148
10 3300025905 Ga0207685_10257171 Ga0207685_102571712 149
11 3300042876 Ga0451577_0000181 Ga0451577_0000181_40185_40649 150
12 3300044712 Ga0453684_0000592 Ga0453684_0000592_93855_94319 150
13 3300002067 JGI24735J21928_10049085 JGI24735J21928_100490852 151
14 3300002076 JGI24749J21850_1025208 JGI24749J21850_10252082 151
15 3300004798 Ga0058859_11381433 Ga0058859_113814331 151
16 3300005327 Ga0070658_10012627 Ga0070658_100126275 151
17 3300005328 Ga0070676_10039164 Ga0070676_100391642 151
18 3300005330 Ga0070690_100000075 Ga0070690_10000007514 151
19 3300005330 Ga0070690_100090386 Ga0070690_1000903862 151
20 3300005334 Ga0068869_100000841 Ga0068869_1000008419 151
21 3300005336 Ga0070680_100001183 Ga0070680_10000118310 151
22 3300005337 Ga0070682_100034498 Ga0070682_1000344982 151
23 3300005338 Ga0068868_100000329 Ga0068868_1000003298 151
24 3300005339 Ga0070660_100001672 Ga0070660_1000016728 151
25 3300005340 Ga0070689_100000481 Ga0070689_10000048110 151
26 3300005341 Ga0070691_10000399 Ga0070691_100003996 151
27 3300005343 Ga0070687_100000014 Ga0070687_10000001422 151
28 3300005345 Ga0070692_10000041 Ga0070692_1000004114 151
29 3300005354 Ga0070675_100815892 Ga0070675_1008158922 151
30 3300005365 Ga0070688_100048098 Ga0070688_1000480982 151
31 3300005438 Ga0070701_10000641 Ga0070701_100006419 151
32 3300005440 Ga0070705_100008701 Ga0070705_1000087014 151
33 3300005441 Ga0070700_100001345 Ga0070700_1000013458 151
34 3300005444 Ga0070694_100000099 Ga0070694_1000000999 151
35 3300005458 Ga0070681_10027710 Ga0070681_100277105 151
36 3300005459 Ga0068867_100000174 Ga0068867_10000017432 151
37 3300005530 Ga0070679_100031801 Ga0070679_1000318015 151
38 3300005536 Ga0070697_100432368 Ga0070697_1004323682 151
39 3300005539 Ga0068853_100057696 Ga0068853_1000576963 151
40 3300005544 Ga0070686_100000134 Ga0070686_10000013425 151
41 3300005545 Ga0070695_100000018 Ga0070695_10000001832 151
42 3300005546 Ga0070696_100027846 Ga0070696_1000278462 151
43 3300005547 Ga0070693_100000021 Ga0070693_10000002125 151
44 3300005549 Ga0070704_100000043 Ga0070704_10000004316 151
45 3300005563 Ga0068855_100001327 Ga0068855_10000132722 151
46 3300005578 Ga0068854_100002225 Ga0068854_1000022255 151
47 3300005614 Ga0068856_100041413 Ga0068856_1000414132 151
48 3300005614 Ga0068856_100263037 Ga0068856_1002630373 151
49 3300005614 Ga0068856_100606005 Ga0068856_1006060052 151
50 3300005615 Ga0070702_100000007 Ga0070702_10000000729 151
51 3300005616 Ga0068852_100042244 Ga0068852_1000422444 151
52 3300005617 Ga0068859_100001320 Ga0068859_10000132024 151
53 3300005718 Ga0068866_10000561 Ga0068866_100005619 151
54 3300005719 Ga0068861_100000617 Ga0068861_10000061719 151
55 3300005719 Ga0068861_102037473 Ga0068861_1020374731 151
56 3300005840 Ga0068870_10004187 Ga0068870_100041874 151
57 3300005841 Ga0068863_100254518 Ga0068863_1002545183 151
58 3300005841 Ga0068863_100435927 Ga0068863_1004359272 151
59 3300005842 Ga0068858_100000334 Ga0068858_10000033422 151
60 3300005843 Ga0068860_100001410 Ga0068860_10000141016 151
61 3300005843 Ga0068860_100125796 Ga0068860_1001257963 151
62 3300005844 Ga0068862_100000688 Ga0068862_10000068824 151
63 3300006237 Ga0097621_100000593 Ga0097621_10000059316 151
64 3300006358 Ga0068871_100000157 Ga0068871_10000015733 151
65 3300006844 Ga0075428_100001267 Ga0075428_1000012676 151
66 3300006852 Ga0075433_10001495 Ga0075433_1000149514 151
67 3300006871 Ga0075434_100000989 Ga0075434_1000009896 151
68 3300006880 Ga0075429_100000046 Ga0075429_10000004633 151
69 3300006881 Ga0068865_100000296 Ga0068865_10000029618 151
70 3300006914 Ga0075436_100000190 Ga0075436_10000019025 151
71 3300006931 Ga0097620_100001320 Ga0097620_10000132024 151
72 3300007076 Ga0075435_100000058 Ga0075435_10000005820 151
73 3300007076 Ga0075435_100346660 Ga0075435_1003466602 151
74 3300009093 Ga0105240_10004592 Ga0105240_1000459211 151
75 3300009093 Ga0105240_10779433 Ga0105240_107794332 151
76 3300009094 Ga0111539_11154220 Ga0111539_111542202 151
77 3300009094 Ga0111539_11194109 Ga0111539_111941092 151
78 3300009098 Ga0105245_10000405 Ga0105245_100004057 151
79 3300009147 Ga0114129_10000177 Ga0114129_1000017749 151
80 3300009148 Ga0105243_10000466 Ga0105243_100004669 151
81 3300009174 Ga0105241_10132627 Ga0105241_101326272 151
82 3300009176 Ga0105242_10000191 Ga0105242_1000019124 151
83 3300009177 Ga0105248_10131250 Ga0105248_101312503 151
84 3300009545 Ga0105237_10023256 Ga0105237_100232565 151
85 3300009545 Ga0105237_10466983 Ga0105237_104669832 151
86 3300009553 Ga0105249_10000555 Ga0105249_1000055523 151
87 3300010375 Ga0105239_10082228 Ga0105239_100822282 151
88 3300011119 Ga0105246_10081161 Ga0105246_100811612 151
89 3300013100 Ga0157373_10021893 Ga0157373_100218935 151
90 3300013102 Ga0157371_10113482 Ga0157371_101134823 151
91 3300013104 Ga0157370_10004911 Ga0157370_100049116 151
92 3300013105 Ga0157369_10003711 Ga0157369_100037115 151
93 3300013296 Ga0157374_10000221 Ga0157374_100002218 151
94 3300013296 Ga0157374_10651266 Ga0157374_106512662 151
95 3300013297 Ga0157378_10000196 Ga0157378_1000019630 151
96 3300013306 Ga0163162_10057810 Ga0163162_100578104 151
97 3300013307 Ga0157372_10016041 Ga0157372_100160415 151
98 3300013307 Ga0157372_10412772 Ga0157372_104127722 151
99 3300013307 Ga0157372_11425375 Ga0157372_114253752 151
100 3300014326 Ga0157380_10028322 Ga0157380_100283222 151
101 3300014745 Ga0157377_10167411 Ga0157377_101674112 151
102 3300014968 Ga0157379_10045543 Ga0157379_100455432 151
103 3300014969 Ga0157376_10000314 Ga0157376_100003143 151
104 3300015261 Ga0182006_1129887 Ga0182006_11298872 151
105 3300025256 Ga0209759_1019331 Ga0209759_10193312 151
106 3300025899 Ga0207642_10000935 Ga0207642_100009353 151
107 3300025903 Ga0207680_10089947 Ga0207680_100899472 151
108 3300025904 Ga0207647_10025600 Ga0207647_100256002 151
109 3300025908 Ga0207643_10030147 Ga0207643_100301472 151
110 3300025911 Ga0207654_10091213 Ga0207654_100912132 151
111 3300025912 Ga0207707_10117754 Ga0207707_101177542 151
112 3300025913 Ga0207695_10071377 Ga0207695_100713772 151
113 3300025914 Ga0207671_10090199 Ga0207671_100901992 151
114 3300025914 Ga0207671_10311526 Ga0207671_103115262 151
115 3300025917 Ga0207660_10000284 Ga0207660_1000028419 151
116 3300025918 Ga0207662_10000063 Ga0207662_1000006320 151
117 3300025919 Ga0207657_10018440 Ga0207657_100184405 151
118 3300025921 Ga0207652_10016598 Ga0207652_100165982 151
119 3300025923 Ga0207681_10361666 Ga0207681_103616662 151
120 3300025926 Ga0207659_10021091 Ga0207659_100210915 151
121 3300025927 Ga0207687_10000976 Ga0207687_1000097616 151
122 3300025935 Ga0207709_10002870 Ga0207709_1000287012 151
123 3300025936 Ga0207670_10001140 Ga0207670_1000114011 151
124 3300025938 Ga0207704_10001148 Ga0207704_100011489 151
125 3300025939 Ga0207665_11030817 Ga0207665_110308172 151
126 3300025940 Ga0207691_10292695 Ga0207691_102926952 151
127 3300025941 Ga0207711_10174590 Ga0207711_101745902 151
128 3300025941 Ga0207711_10900137 Ga0207711_109001371 151
129 3300025942 Ga0207689_10000214 Ga0207689_1000021423 151
130 3300025949 Ga0207667_10027649 Ga0207667_100276494 151
131 3300025949 Ga0207667_10031255 Ga0207667_100312555 151
132 3300025961 Ga0207712_10191520 Ga0207712_101915202 151
133 3300025981 Ga0207640_10000972 Ga0207640_100009729 151
134 3300026023 Ga0207677_10000714 Ga0207677_1000071416 151
135 3300026035 Ga0207703_10012996 Ga0207703_100129964 151
136 3300026041 Ga0207639_10012477 Ga0207639_100124774 151
137 3300026075 Ga0207708_10000117 Ga0207708_1000011732 151
138 3300026078 Ga0207702_10028320 Ga0207702_100283206 151
139 3300026078 Ga0207702_10103138 Ga0207702_101031382 151
140 3300026078 Ga0207702_10288441 Ga0207702_102884411 151
141 3300026078 Ga0207702_10765074 Ga0207702_107650742 151
142 3300026088 Ga0207641_10234745 Ga0207641_102347452 151
143 3300026088 Ga0207641_11489522 Ga0207641_114895222 151
144 3300026089 Ga0207648_10000293 Ga0207648_1000029323 151
145 3300026116 Ga0207674_10118964 Ga0207674_101189642 151
146 3300026118 Ga0207675_100000218 Ga0207675_10000021827 151
147 3300026118 Ga0207675_100476898 Ga0207675_1004768982 151
148 3300026142 Ga0207698_10042850 Ga0207698_100428503 151
149 3300027907 Ga0207428_10000517 Ga0207428_100005179 151
150 3300027907 Ga0207428_10027604 Ga0207428_100276042 151
151 3300028380 Ga0268265_10005718 Ga0268265_100057186 151
152 3300028381 Ga0268264_10000609 Ga0268264_1000060926 151
153 3300028381 Ga0268264_10084407 Ga0268264_100844073 151
154 3300031239 Ga0265328_10005792 Ga0265328_100057926 151
155 3300031250 Ga0265331_10002817 Ga0265331_100028173 151
156 3300031251 Ga0265327_10000043 Ga0265327_10000043177 151
157 3300034816 Ga0373930_0022050 Ga0373930_0022050_729_1184 151
158 3300034820 Ga0373959_0045623 Ga0373959_0045623_49_504 151
159 3300034957 Ga0373938_0045456 Ga0373938_0045456_465_920 151
160 3300035084 Ga0373928_0036099 Ga0373928_0036099_636_1091 151
161 3300035088 Ga0373940_0003758 Ga0373940_0003758_1832_2287 151
162 3300035089 Ga0373944_0232308 Ga0373944_0232308_21_476 151
163 3300035091 Ga0373951_0008041 Ga0373951_0008041_1783_2238 151
164 3300035092 Ga0373952_0012870 Ga0373952_0012870_435_890 151
165 3300035111 Ga0373923_0078772 Ga0373923_0078772_652_1107 151
166 3300035111 Ga0373923_0276048 Ga0373923_0276048_145_600 151
167 3300035112 Ga0373932_0001050 Ga0373932_0001050_5209_5664 151
168 3300035113 Ga0373936_0032465 Ga0373936_0032465_624_1079 151
169 3300035113 Ga0373936_0244925 Ga0373936_0244925_144_599 151
170 3300035114 Ga0373939_0002059 Ga0373939_0002059_1930_2385 151
171 3300035115 Ga0373941_0024743 Ga0373941_0024743_1130_1585 151
172 3300035115 Ga0373941_0277275 Ga0373941_0277275_43_498 151
173 3300035116 Ga0373945_0045063 Ga0373945_0045063_1120_1575 151
174 3300035118 Ga0373954_0399335 Ga0373954_0399335_18_473 151
175 3300035170 Ga0373943_0002249 Ga0373943_0002249_6062_6517 151
176 3300035170 Ga0373943_0285902 Ga0373943_0285902_439_894 151
177 3300035171 Ga0373946_0002900 Ga0373946_0002900_4602_5057 151
178 3300035207 Ga0373942_0131079 Ga0373942_0131079_203_658 151
179 3300035242 Ga0373962_0120752 Ga0373962_0120752_361_816 151
180 3300035410 Ga0373924_0420712 Ga0373924_0420712_116_571 151
181 3300035691 Ga0373931_0001310 Ga0373931_0001310_7787_8242 151
182 3300035691 Ga0373931_0001708 Ga0373931_0001708_4534_4989 151
183 3300035692 Ga0373935_0002524 Ga0373935_0002524_2961_3416 151
184 3300035692 Ga0373935_0446814 Ga0373935_0446814_455_910 151
185 3300035695 Ga0373927_0010809 Ga0373927_0010809_2319_2774 151
186 3300035695 Ga0373927_0019500 Ga0373927_0019500_3496_3951 151
187 3300035725 Ga0373947_0009586 Ga0373947_0009586_949_1404 151
188 3300035725 Ga0373947_0589389 Ga0373947_0589389_160_615 151
189 3300036401 Ga0373937_0225552 Ga0373937_0225552_1190_1645 151
190 3300037068 Ga0373925_0010575 Ga0373925_0010575_2084_2539 151
191 3300037068 Ga0373925_0029085 Ga0373925_0029085_893_1348 151
192 3300037418 Ga0395900_0206367 Ga0395900_0206367_1094_1549 151
193 3300038443 Ga0395901_0311919 Ga0395901_0311919_504_959 151
194 3300042001 Ga0439441_026140 Ga0439441_026140_389_844 151
195 3300042005 Ga0439448_0000024 Ga0439448_0000024_15601_16056 151
196 3300042876 Ga0451577_0175893 Ga0451577_0175893_742_1197 151
197 3300045051 Ga0451576_0001387 Ga0451576_0001387_39501_39956 151
198 3300045051 Ga0451576_0006418 Ga0451576_0006418_11768_12268 151
199 3300045051 Ga0451576_0656078 Ga0451576_0656078_588_1043 151
200 3300046455 Ga0495603_0008792 Ga0495603_0008792_2274_2729 151
201 3300046472 Ga0495580_0009565 Ga0495580_0009565_1142_1597 151
202 3300046475 Ga0495639_0037952 Ga0495639_0037952_1353_1808 151
203 3300046499 Ga0495594_0052252 Ga0495594_0052252_1662_2117 151
204 3300046526 Ga0495666_0066130 Ga0495666_0066130_251_706 151
205 3300046531 Ga0495665_0016706 Ga0495665_0016706_298_753 151
206 3300046535 Ga0495586_0034781 Ga0495586_0034781_1884_2339 151
207 3300048905 Ga0496102_0666558 Ga0496102_0666558_19_474 151
208 3300048909 Ga0496106_0360215 Ga0496106_0360215_259_714 151
209 3300050507 nmdc:mga05p37_344_c1 nmdc:mga05p37_344_c1_16466_16921 151
210 3300050508 nmdc:mga09592_144945_c1 nmdc:mga09592_144945_c1_121_576 151
211 3300050511 nmdc:mga08y16_2094426_c1 nmdc:mga08y16_2094426_c1_37_492 151
212 3300050511 nmdc:mga08y16_7973_c1 nmdc:mga08y16_7973_c1_8583_9038 151
213 3300050512 nmdc:mga0n895_991301_c1 nmdc:mga0n895_991301_c1_330_785 151
214 3300005354 Ga0070675_100565877 Ga0070675_1005658771 152
215 3300005436 Ga0070713_100001485 Ga0070713_1000014851 152
216 3300005440 Ga0070705_100596163 Ga0070705_1005961631 152
217 3300014326 Ga0157380_10030394 Ga0157380_100303942 152
218 3300014326 Ga0157380_10198695 Ga0157380_101986951 152
219 3300025928 Ga0207700_10028783 Ga0207700_100287832 152
220 3300033179 Ga0307507_10088742 Ga0307507_100887422 152
221 3300033180 Ga0307510_10059359 Ga0307510_100593592 152
222 3300046453 Ga0495627_015812 Ga0495627_015812_830_1294 152
223 3300046453 Ga0495627_139589 Ga0495627_139589_139_603 152
224 3300046457 Ga0495590_0094512 Ga0495590_0094512_29_493 152
225 3300046458 Ga0495591_008252 Ga0495591_008252_321_785 152
226 3300046471 Ga0495650_0002488 Ga0495650_0002488_6046_6510 152
227 3300046471 Ga0495650_0004830 Ga0495650_0004830_4515_4979 152
228 3300046474 Ga0495605_0000002 Ga0495605_0000002_388725_389189 152
229 3300046474 Ga0495605_0022400 Ga0495605_0022400_18_482 152
230 3300046474 Ga0495605_0383140 Ga0495605_0383140_37_501 152
231 3300046491 Ga0495584_0039781 Ga0495584_0039781_1420_1884 152
232 3300046492 Ga0495585_0004721 Ga0495585_0004721_7497_7961 152
233 3300046499 Ga0495594_0009897 Ga0495594_0009897_2279_2743 152
234 3300046500 Ga0495596_0012913 Ga0495596_0012913_943_1407 152
235 3300046501 Ga0495607_0087477 Ga0495607_0087477_609_1073 152
236 3300046506 Ga0495583_0000012 Ga0495583_0000012_32950_33414 152
237 3300046506 Ga0495583_0001950 Ga0495583_0001950_10403_10867 152
238 3300046507 Ga0495606_0001289 Ga0495606_0001289_22701_23165 152
239 3300046512 Ga0495610_0029055 Ga0495610_0029055_1562_2026 152
240 3300046512 Ga0495610_0047779 Ga0495610_0047779_1486_1950 152
241 3300046513 Ga0495616_0047136 Ga0495616_0047136_948_1412 152
242 3300046515 Ga0495620_0000026 Ga0495620_0000026_33191_33655 152
243 3300046518 Ga0495631_0025273 Ga0495631_0025273_1032_1496 152
244 3300046518 Ga0495631_0029429 Ga0495631_0029429_1071_1535 152
245 3300046519 Ga0495632_0012687 Ga0495632_0012687_4169_4633 152
246 3300046520 Ga0495637_0000021 Ga0495637_0000021_167232_167696 152
247 3300046520 Ga0495637_0034092 Ga0495637_0034092_253_717 152
248 3300046522 Ga0495643_0025155 Ga0495643_0025155_1744_2208 152
249 3300046523 Ga0495644_0002658 Ga0495644_0002658_5206_5670 152
250 3300046524 Ga0495648_0026343 Ga0495648_0026343_1015_1479 152
251 3300046530 Ga0495654_0000617 Ga0495654_0000617_27745_28209 152
252 3300046530 Ga0495654_0138098 Ga0495654_0138098_120_584 152
253 3300046538 Ga0495609_0000008 Ga0495609_0000008_349463_349927 152
254 3300046538 Ga0495609_0000920 Ga0495609_0000920_11419_11883 152
255 3300046542 Ga0495597_0002842 Ga0495597_0002842_302_766 152
256 3300046542 Ga0495597_0219643 Ga0495597_0219643_223_687 152
257 3300046557 Ga0495622_0002553 Ga0495622_0002553_2314_2778 152
258 3300046558 Ga0495633_0000216 Ga0495633_0000216_27955_28419 152
259 3300046616 Ga0495668_0120603 Ga0495668_0120603_933_1397 152
260 3300046648 Ga0495611_0000175 Ga0495611_0000175_22270_22734 152
261 3300046648 Ga0495611_0009399 Ga0495611_0009399_1865_2329 152
262 3300046660 Ga0495625_0000028 Ga0495625_0000028_95857_96321 152
263 3300046665 Ga0495661_0000096 Ga0495661_0000096_30736_31200 152
264 3300046665 Ga0495661_0003182 Ga0495661_0003182_2126_2590 152
265 3300046691 Ga0495670_0032173 Ga0495670_0032173_1433_1897 152
266 3300046691 Ga0495670_0033868 Ga0495670_0033868_412_876 152
267 3300046692 Ga0495671_0024052 Ga0495671_0024052_2342_2806 152
268 3300046692 Ga0495671_0039485 Ga0495671_0039485_155_619 152
269 3300046694 Ga0495649_0017948 Ga0495649_0017948_1536_2000 152
270 3300046794 Ga0495589_0000492 Ga0495589_0000492_10324_10788 152
271 3300046810 Ga0495660_0006771 Ga0495660_0006771_4602_5066 152
272 3300047320 Ga0495672_0051058 Ga0495672_0051058_948_1412 152
273 3300047321 Ga0495676_0000006 Ga0495676_0000006_96275_96739 152
274 3300047323 Ga0495683_0000169 Ga0495683_0000169_29951_30415 152
275 3300047323 Ga0495683_0014816 Ga0495683_0014816_2274_2738 152
276 3300047446 Ga0495679_000200 Ga0495679_000200_21282_21746 152
277 3300047446 Ga0495679_001247 Ga0495679_001247_8390_8854 152
278 3300047469 Ga0495673_0014435 Ga0495673_0014435_3155_3619 152
279 3300047470 Ga0495681_0000789 Ga0495681_0000789_23463_23927 152
280 3300047470 Ga0495681_0006948 Ga0495681_0006948_4289_4753 152
281 3300047472 Ga0495686_0173329 Ga0495686_0173329_174_638 152
282 3300048091 Ga0495626_0000019 Ga0495626_0000019_60732_61196 152
283 3300048925 Ga0496122_0025334 Ga0496122_0025334_708_1172 152
284 3300048926 Ga0496123_0014205 Ga0496123_0014205_3447_3911 152
285 3300049459 Ga0495678_000242 Ga0495678_000242_27855_28319 152
286 3300053125 Ga0500618_114266 Ga0500618_114266_125_589 152
287 3300053145 Ga0500586_131593 Ga0500586_131593_333_797 152
288 3300005295 Ga0065707_10256063 Ga0065707_102560632 153
289 3300005328 Ga0070676_10060206 Ga0070676_100602062 153
290 3300005334 Ga0068869_100001166 Ga0068869_1000011669 153
291 3300005337 Ga0070682_100975293 Ga0070682_1009752932 153
292 3300005354 Ga0070675_100001440 Ga0070675_1000014406 153
293 3300005468 Ga0070707_100014756 Ga0070707_1000147569 153
294 3300005471 Ga0070698_100048113 Ga0070698_1000481134 153
295 3300005545 Ga0070695_100066267 Ga0070695_1000662672 153
296 3300005549 Ga0070704_100003271 Ga0070704_1000032712 153
297 3300006237 Ga0097621_100072191 Ga0097621_1000721912 153
298 3300006844 Ga0075428_100181592 Ga0075428_1001815921 153
299 3300006846 Ga0075430_100002352 Ga0075430_1000023523 153
300 3300006847 Ga0075431_100021112 Ga0075431_1000211121 153
301 3300006847 Ga0075431_100070939 Ga0075431_1000709392 153
302 3300006871 Ga0075434_100337235 Ga0075434_1003372353 153
303 3300009093 Ga0105240_10249969 Ga0105240_102499692 153
304 3300009094 Ga0111539_10816109 Ga0111539_108161091 153
305 3300009094 Ga0111539_12658459 Ga0111539_126584591 153
306 3300009098 Ga0105245_10925557 Ga0105245_109255572 153
307 3300009147 Ga0114129_10000974 Ga0114129_1000097446 153
308 3300009147 Ga0114129_10794708 Ga0114129_107947082 153
309 3300009545 Ga0105237_10215933 Ga0105237_102159332 153
310 3300013102 Ga0157371_10047383 Ga0157371_100473832 153
311 3300013296 Ga0157374_10007785 Ga0157374_100077852 153
312 3300013306 Ga0163162_10116338 Ga0163162_101163382 153
313 3300013307 Ga0157372_10009644 Ga0157372_100096442 153
314 3300014745 Ga0157377_10001401 Ga0157377_100014014 153
315 3300017792 Ga0163161_10006381 Ga0163161_100063812 153
316 3300021361 Ga0213872_10040248 Ga0213872_100402482 153
317 3300025922 Ga0207646_10052136 Ga0207646_100521362 153
318 3300027671 Ga0209588_1148749 Ga0209588_11487491 153
319 3300027682 Ga0209971_1095120 Ga0209971_10951202 153
320 3300027907 Ga0207428_10833560 Ga0207428_108335601 153
321 3300035207 Ga0373942_0010568 Ga0373942_0010568_946_1407 153
322 3300044673 Ga0453683_0901962 Ga0453683_0901962_25_510 153
323 3300045051 Ga0451576_0390474 Ga0451576_0390474_75_536 153
324 3300046472 Ga0495580_0104971 Ga0495580_0104971_984_1448 153
325 3300047472 Ga0495686_0003039 Ga0495686_0003039_8857_9324 153
326 3300049583 Ga0501067_0529663 Ga0501067_0529663_86_550 153
327 3300049589 Ga0501073_0011837 Ga0501073_0011837_4029_4493 153
328 3300049590 Ga0501074_0175412 Ga0501074_0175412_980_1444 153
329 3300050507 nmdc:mga05p37_847720_c1 nmdc:mga05p37_847720_c1_280_741 153
330 3300050508 nmdc:mga09592_407852_c1 nmdc:mga09592_407852_c1_209_679 153
331 3300050509 nmdc:mga0qj67_11724_c1 nmdc:mga0qj67_11724_c1_3203_3664 153
332 3300050510 nmdc:mga06r32_125963_c1 nmdc:mga06r32_125963_c1_1565_2026 153
333 3300050512 nmdc:mga0n895_413119_c1 nmdc:mga0n895_413119_c1_96_566 153
334 3300003320 rootH2_10136714 rootH2_101367142 154
335 3300005434 Ga0070709_10023177 Ga0070709_100231775 154
336 3300005434 Ga0070709_10815766 Ga0070709_108157662 154
337 3300005436 Ga0070713_100036776 Ga0070713_1000367763 154
338 3300005439 Ga0070711_100418087 Ga0070711_1004180872 154
339 3300005440 Ga0070705_100165941 Ga0070705_1001659412 154
340 3300005445 Ga0070708_100012421 Ga0070708_1000124216 154
341 3300005445 Ga0070708_100046280 Ga0070708_1000462805 154
342 3300005445 Ga0070708_100634375 Ga0070708_1006343752 154
343 3300005467 Ga0070706_100103560 Ga0070706_1001035602 154
344 3300005467 Ga0070706_100129737 Ga0070706_1001297371 154
345 3300005468 Ga0070707_100086838 Ga0070707_1000868382 154
346 3300005468 Ga0070707_100596650 Ga0070707_1005966501 154
347 3300005471 Ga0070698_100160949 Ga0070698_1001609493 154
348 3300005518 Ga0070699_100044553 Ga0070699_1000445532 154
349 3300005536 Ga0070697_100070216 Ga0070697_1000702162 154
350 3300005536 Ga0070697_100082474 Ga0070697_1000824742 154
351 3300006163 Ga0070715_10470048 Ga0070715_104700482 154
352 3300006173 Ga0070716_100001913 Ga0070716_1000019133 154
353 3300006173 Ga0070716_100007818 Ga0070716_1000078184 154
354 3300006175 Ga0070712_100671118 Ga0070712_1006711181 154
355 3300006852 Ga0075433_11663316 Ga0075433_116633161 154
356 3300006871 Ga0075434_100047202 Ga0075434_1000472022 154
357 3300007076 Ga0075435_101227682 Ga0075435_1012276822 154
358 3300007265 Ga0099794_10010059 Ga0099794_100100594 154
359 3300007265 Ga0099794_10099383 Ga0099794_100993832 154
360 3300007265 Ga0099794_10145106 Ga0099794_101451062 154
361 3300007265 Ga0099794_10272541 Ga0099794_102725411 154
362 3300007788 Ga0099795_10123063 Ga0099795_101230632 154
363 3300009011 Ga0105251_10003168 Ga0105251_1000316810 154
364 3300010159 Ga0099796_10129973 Ga0099796_101299731 154
365 3300014969 Ga0157376_10037538 Ga0157376_100375383 154
366 3300021361 Ga0213872_10001160 Ga0213872_100011605 154
367 3300025250 Ga0209026_1003669 Ga0209026_10036692 154
368 3300025735 Ga0207713_1061449 Ga0207713_10614492 154
369 3300025906 Ga0207699_10047572 Ga0207699_100475722 154
370 3300025910 Ga0207684_10107704 Ga0207684_101077042 154
371 3300025915 Ga0207693_10154078 Ga0207693_101540782 154
372 3300025916 Ga0207663_10407627 Ga0207663_104076272 154
373 3300025922 Ga0207646_10001174 Ga0207646_1000117422 154
374 3300025928 Ga0207700_10004396 Ga0207700_100043967 154
375 3300025939 Ga0207665_10000589 Ga0207665_100005895 154
376 3300025939 Ga0207665_10110252 Ga0207665_101102521 154
377 3300027671 Ga0209588_1007989 Ga0209588_10079895 154
378 3300035113 Ga0373936_0064179 Ga0373936_0064179_628_1092 154
379 3300035118 Ga0373954_0051752 Ga0373954_0051752_136_600 154
380 3300035119 Ga0373956_0036320 Ga0373956_0036320_10_474 154
381 3300035170 Ga0373943_0588671 Ga0373943_0588671_48_512 154
382 3300035172 Ga0373955_0011452 Ga0373955_0011452_3223_3687 154
383 3300035410 Ga0373924_0013784 Ga0373924_0013784_1315_1779 154
384 3300035692 Ga0373935_0099425 Ga0373935_0099425_1096_1560 154
385 3300035724 Ga0373933_0006340 Ga0373933_0006340_4512_4976 154
386 3300035725 Ga0373947_0046137 Ga0373947_0046137_1273_1737 154
387 3300036401 Ga0373937_0039197 Ga0373937_0039197_542_1006 154
388 3300037312 Ga0395899_0002318 Ga0395899_0002318_2693_3160 154
389 3300037418 Ga0395900_0072495 Ga0395900_0072495_68_535 154
390 3300037418 Ga0395900_0239580 Ga0395900_0239580_174_641 154
391 3300037466 Ga0395898_0255974 Ga0395898_0255974_174_641 154
392 3300038443 Ga0395901_0099359 Ga0395901_0099359_1801_2268 154
393 3300038443 Ga0395901_0132273 Ga0395901_0132273_1430_1897 154
394 3300039447 Ga0436361_1208495 Ga0436361_1208495_7139_7606 154
395 3300046459 Ga0495629_0021221 Ga0495629_0021221_3873_4340 154
396 3300046472 Ga0495580_0025415 Ga0495580_0025415_1499_1966 154
397 3300046473 Ga0495582_0026272 Ga0495582_0026272_958_1425 154
398 3300046475 Ga0495639_0004313 Ga0495639_0004313_3255_3722 154
399 3300046477 Ga0495664_0538212 Ga0495664_0538212_76_543 154
400 3300046499 Ga0495594_0091449 Ga0495594_0091449_422_889 154
401 3300046511 Ga0495608_0014684 Ga0495608_0014684_542_1006 154
402 3300046517 Ga0495630_0129081 Ga0495630_0129081_1030_1497 154
403 3300046526 Ga0495666_0012173 Ga0495666_0012173_3755_4222 154
404 3300046531 Ga0495665_0028043 Ga0495665_0028043_2458_2925 154
405 3300046533 Ga0495640_0017250 Ga0495640_0017250_1827_2294 154
406 3300046533 Ga0495640_0022809 Ga0495640_0022809_399_863 154
407 3300046535 Ga0495586_0013912 Ga0495586_0013912_3636_4103 154
408 3300046535 Ga0495586_0033144 Ga0495586_0033144_197_661 154
409 3300046539 Ga0495621_0408362 Ga0495621_0408362_72_554 154
410 3300046559 Ga0495667_0016919 Ga0495667_0016919_3919_4383 154
411 3300046642 Ga0495634_0011889 Ga0495634_0011889_5293_5760 154
412 3300046663 Ga0495635_0057937 Ga0495635_0057937_2103_2570 154
413 3300046675 Ga0495657_0062429 Ga0495657_0062429_701_1165 154
414 3300046681 Ga0495647_0189277 Ga0495647_0189277_346_813 154
415 3300046683 Ga0495658_0034873 Ga0495658_0034873_798_1265 154
416 3300046689 Ga0495613_0109325 Ga0495613_0109325_638_1105 154
417 3300046690 Ga0495624_0229024 Ga0495624_0229024_11_478 154
418 3300047315 Ga0495581_0014771 Ga0495581_0014771_554_1021 154
419 3300047317 Ga0495604_0104774 Ga0495604_0104774_514_978 154
420 3300047319 Ga0495674_0044843 Ga0495674_0044843_1280_1747 154
421 3300047321 Ga0495676_0006782 Ga0495676_0006782_4041_4508 154
422 3300047322 Ga0495680_0021285 Ga0495680_0021285_1033_1500 154
423 3300047471 Ga0495684_0011742 Ga0495684_0011742_1821_2285 154
424 3300047673 Ga0495593_0177472 Ga0495593_0177472_309_773 154
425 3300048089 Ga0495614_0100599 Ga0495614_0100599_649_1116 154
426 3300048903 Ga0496100_0024814 Ga0496100_0024814_1009_1476 154
427 3300048904 Ga0496101_0084496 Ga0496101_0084496_889_1356 154
428 3300048917 Ga0496114_0124556 Ga0496114_0124556_740_1207 154
429 3300048918 Ga0496115_0004843 Ga0496115_0004843_8725_9192 154
430 3300048919 Ga0496116_0000550 Ga0496116_0000550_35700_36173 154
431 3300048929 Ga0496126_0551945 Ga0496126_0551945_360_827 154
432 3300050515 nmdc:mga0a205_1307737_c1 nmdc:mga0a205_1307737_c1_27_497 154
433 3300053085 Ga0495619_0244703 Ga0495619_0244703_190_657 154
434 3300005295 Ga0065707_10084037 Ga0065707_100840377 155
435 3300005295 Ga0065707_10673030 Ga0065707_106730301 155
436 3300005327 Ga0070658_10354227 Ga0070658_103542272 155
437 3300005339 Ga0070660_100119900 Ga0070660_1001199001 155
438 3300005344 Ga0070661_101038233 Ga0070661_1010382332 155
439 3300005440 Ga0070705_100631222 Ga0070705_1006312222 155
440 3300005468 Ga0070707_100326803 Ga0070707_1003268032 155
441 3300005471 Ga0070698_100349329 Ga0070698_1003493292 155
442 3300005518 Ga0070699_100021230 Ga0070699_1000212305 155
443 3300005518 Ga0070699_100255187 Ga0070699_1002551872 155
444 3300005518 Ga0070699_100488850 Ga0070699_1004888502 155
445 3300005518 Ga0070699_100689624 Ga0070699_1006896242 155
446 3300005539 Ga0068853_101776598 Ga0068853_1017765981 155
447 3300005549 Ga0070704_100305828 Ga0070704_1003058282 155
448 3300005563 Ga0068855_100699465 Ga0068855_1006994652 155
449 3300005578 Ga0068854_101177074 Ga0068854_1011770741 155
450 3300005616 Ga0068852_101147056 Ga0068852_1011470562 155
451 3300005844 Ga0068862_100106650 Ga0068862_1001066503 155
452 3300006844 Ga0075428_100004810 Ga0075428_1000048107 155
453 3300006846 Ga0075430_100845485 Ga0075430_1008454852 155
454 3300006880 Ga0075429_100013305 Ga0075429_1000133054 155
455 3300009147 Ga0114129_10014581 Ga0114129_100145815 155
456 3300009148 Ga0105243_10124485 Ga0105243_101244852 155
457 3300009553 Ga0105249_10035348 Ga0105249_100353483 155
458 3300009553 Ga0105249_10870152 Ga0105249_108701521 155
459 3300013102 Ga0157371_10269411 Ga0157371_102694112 155
460 3300013105 Ga0157369_10011071 Ga0157369_100110715 155
461 3300013307 Ga0157372_10114553 Ga0157372_101145533 155
462 3300014326 Ga0157380_10121650 Ga0157380_101216502 155
463 3300020082 Ga0206353_11376464 Ga0206353_113764642 155
464 3300025917 Ga0207660_10027982 Ga0207660_100279821 155
465 3300025917 Ga0207660_10342732 Ga0207660_103427321 155
466 3300025919 Ga0207657_10081948 Ga0207657_100819483 155
467 3300025935 Ga0207709_11013107 Ga0207709_110131071 155
468 3300025949 Ga0207667_10408109 Ga0207667_104081092 155
469 3300025961 Ga0207712_10161688 Ga0207712_101616882 155
470 3300025981 Ga0207640_10942835 Ga0207640_109428352 155
471 3300026041 Ga0207639_11509449 Ga0207639_115094491 155
472 3300026116 Ga0207674_10702827 Ga0207674_107028272 155
473 3300026118 Ga0207675_100411018 Ga0207675_1004110182 155
474 3300028380 Ga0268265_10359232 Ga0268265_103592322 155
475 3300037853 Ga0436364_0823753 Ga0436364_0823753_24_521 155
476 3300039437 Ga0436365_0025793 Ga0436365_0025793_46_543 155
477 3300039447 Ga0436361_0056557 Ga0436361_0056557_316_795 155
478 3300039447 Ga0436361_0483849 Ga0436361_0483849_1370_1849 155
479 3300042876 Ga0451577_0025715 Ga0451577_0025715_2699_3166 155
480 3300042876 Ga0451577_0030853 Ga0451577_0030853_3813_4280 155
481 3300044712 Ga0453684_0044528 Ga0453684_0044528_1429_1896 155
482 3300044712 Ga0453684_0187410 Ga0453684_0187410_689_1156 155
483 3300046809 Ga0495600_0859454 Ga0495600_0859454_19_492 155
484 3300050507 nmdc:mga05p37_51069_c1 nmdc:mga05p37_51069_c1_3156_3623 155
485 3300050508 nmdc:mga09592_7945_c1 nmdc:mga09592_7945_c1_5374_5841 155
486 3300005577 Ga0068857_100111024 Ga0068857_1001110242 156
487 3300009094 Ga0111539_10010601 Ga0111539_1001060112 156
488 3300009098 Ga0105245_11526127 Ga0105245_115261272 156
489 3300011119 Ga0105246_10296247 Ga0105246_102962472 156
490 3300011119 Ga0105246_11301184 Ga0105246_113011842 156
491 3300013307 Ga0157372_12042109 Ga0157372_120421092 156
492 3300014325 Ga0163163_10028218 Ga0163163_100282187 156
493 3300025927 Ga0207687_10207992 Ga0207687_102079922 156
494 3300035398 Ga0316574_0008996 Ga0316574_0008996_2246_2722 156
495 3300036401 Ga0373937_0136418 Ga0373937_0136418_590_1123 156
496 3300036647 Ga0316582_0265275 Ga0316582_0265275_295_771 156
497 3300036712 Ga0316584_0113994 Ga0316584_0113994_798_1274 156
498 3300037853 Ga0436364_1416277 Ga0436364_1416277_26_499 156
499 3300039447 Ga0436361_0242643 Ga0436361_0242643_14_487 156
500 3300039447 Ga0436361_0294265 Ga0436361_0294265_15_488 156
501 3300039450 Ga0436363_0564814 Ga0436363_0564814_54_527 156
502 3300046454 Ga0495592_0121651 Ga0495592_0121651_767_1237 156
503 3300046477 Ga0495664_0363157 Ga0495664_0363157_300_770 156
504 3300046516 Ga0495628_0011070 Ga0495628_0011070_2420_2890 156
505 3300046529 Ga0495652_0043254 Ga0495652_0043254_2352_2822 156
506 3300046535 Ga0495586_0042485 Ga0495586_0042485_1545_2015 156
507 3300046678 Ga0495599_0015790 Ga0495599_0015790_3688_4158 156
508 3300047322 Ga0495680_0405954 Ga0495680_0405954_140_610 156
509 3300047444 Ga0495675_0202442 Ga0495675_0202442_266_736 156
510 3300050511 nmdc:mga08y16_4553_c1 nmdc:mga08y16_4553_c1_745_1233 156
511 3300050512 nmdc:mga0n895_370_c1 nmdc:mga0n895_370_c1_29541_30029 156
512 3300050513 nmdc:mga0rr50_463_c1 nmdc:mga0rr50_463_c1_8265_8753 156
513 3300050514 nmdc:mga08x19_4276_c1 nmdc:mga08x19_4276_c1_3751_4239 156
514 3300050515 nmdc:mga0a205_134_c1 nmdc:mga0a205_134_c1_15684_16172 156
515 3300053077 Ga0495601_0014585 Ga0495601_0014585_2621_3091 156
516 3300009551 Ga0105238_11584057 Ga0105238_115840571 157
517 3300006844 Ga0075428_100198604 Ga0075428_1001986043 158
518 3300012506 Ga0157324_1037396 Ga0157324_10373961 158
519 3300020069 Ga0197907_10572943 Ga0197907_105729432 158
520 3300020077 Ga0206351_10662555 Ga0206351_106625551 158
521 3300020080 Ga0206350_10957556 Ga0206350_109575562 158
522 3300020082 Ga0206353_11249298 Ga0206353_112492982 158
523 3300022467 Ga0224712_10036737 Ga0224712_100367372 158
524 3300025913 Ga0207695_10111167 Ga0207695_101111671 158
525 3300025961 Ga0207712_10238810 Ga0207712_102388102 158
526 3300032002 Ga0307416_100140329 Ga0307416_1001403292 158
527 3300032005 Ga0307411_10509219 Ga0307411_105092192 158
528 3300036712 Ga0316584_0201669 Ga0316584_0201669_460_939 158
529 3300042156 Ga0439446_0103567 Ga0439446_0103567_397_885 158
530 3300049572 Ga0501036_1230823 Ga0501036_1230823_100_585 158
531 3300049576 Ga0501040_0245516 Ga0501040_0245516_229_714 158
532 3300049582 Ga0501048_0221294 Ga0501048_0221294_432_917 158
533 3300049587 Ga0501071_0371542 Ga0501071_0371542_402_887 158
534 3300049591 Ga0501075_0113568 Ga0501075_0113568_316_801 158
535 3300049592 Ga0501076_0803540 Ga0501076_0803540_157_642 158
536 3300049652 Ga0501202_226393 Ga0501202_226393_16_504 158
537 3300005617 Ga0068859_100252866 Ga0068859_1002528662 159
538 3300005844 Ga0068862_100082797 Ga0068862_1000827972 159
539 3300005937 Ga0081455_10086864 Ga0081455_100868642 159
540 3300005981 Ga0081538_10003141 Ga0081538_1000314111 159
541 3300006931 Ga0097620_100252866 Ga0097620_1002528662 159
542 3300009553 Ga0105249_10139393 Ga0105249_101393932 159
543 3300024225 Ga0224572_1057874 Ga0224572_10578742 159
544 3300028380 Ga0268265_11076027 Ga0268265_110760272 159
545 3300028381 Ga0268264_10266123 Ga0268264_102661232 159
546 3300030888 Ga0265769_107039 Ga0265769_1070391 159
547 3300039450 Ga0436363_1259361 Ga0436363_1259361_129_614 159
548 3300049572 Ga0501036_0494216 Ga0501036_0494216_366_875 159
549 3300049587 Ga0501071_0084511 Ga0501071_0084511_386_895 159
550 3300049590 Ga0501074_0801133 Ga0501074_0801133_25_513 159
551 3300049742 Ga0501080_0119439 Ga0501080_0119439_1744_2253 159
552 3300061734 Ga0530510_0373686 Ga0530510_0373686_356_865 159
553 2162886006 SwRhRL3b_contig_1338701 SwRhRL3b_0647.00001710 160
554 3300004798 Ga0058859_10793595 Ga0058859_107935952 160
555 3300004803 Ga0058862_12713619 Ga0058862_127136192 160
556 3300005289 Ga0065704_10070436 Ga0065704_100704369 160
557 3300005295 Ga0065707_10001282 Ga0065707_100012827 160
558 3300005295 Ga0065707_10081813 Ga0065707_1008181326 160
559 3300005295 Ga0065707_10441765 Ga0065707_104417652 160
560 3300005435 Ga0070714_100234140 Ga0070714_1002341402 160
561 3300005436 Ga0070713_100066237 Ga0070713_1000662373 160
562 3300005444 Ga0070694_100089852 Ga0070694_1000898522 160
563 3300005468 Ga0070707_100152189 Ga0070707_1001521892 160
564 3300005471 Ga0070698_100017576 Ga0070698_1000175763 160
565 3300005518 Ga0070699_100026645 Ga0070699_1000266452 160
566 3300005518 Ga0070699_100436277 Ga0070699_1004362772 160
567 3300005545 Ga0070695_100012719 Ga0070695_1000127193 160
568 3300005548 Ga0070665_100001226 Ga0070665_10000122630 160
569 3300006028 Ga0070717_10283452 Ga0070717_102834522 160
570 3300006194 Ga0075427_10000052 Ga0075427_100000524 160
571 3300006844 Ga0075428_100022421 Ga0075428_1000224214 160
572 3300006844 Ga0075428_100057169 Ga0075428_1000571692 160
573 3300006846 Ga0075430_100049700 Ga0075430_1000497002 160
574 3300006846 Ga0075430_100233003 Ga0075430_1002330032 160
575 3300006847 Ga0075431_100161631 Ga0075431_1001616312 160
576 3300006847 Ga0075431_100420933 Ga0075431_1004209332 160
577 3300006847 Ga0075431_101141333 Ga0075431_1011413332 160
578 3300006852 Ga0075433_10341005 Ga0075433_103410052 160
579 3300006852 Ga0075433_10670647 Ga0075433_106706471 160
580 3300006880 Ga0075429_100001186 Ga0075429_10000118612 160
581 3300006880 Ga0075429_100024544 Ga0075429_1000245444 160
582 3300006880 Ga0075429_100048367 Ga0075429_1000483672 160
583 3300006880 Ga0075429_100317707 Ga0075429_1003177072 160
584 3300009094 Ga0111539_11379558 Ga0111539_113795582 160
585 3300009147 Ga0114129_10004218 Ga0114129_1000421821 160
586 3300009147 Ga0114129_10170625 Ga0114129_101706252 160
587 3300009148 Ga0105243_10022088 Ga0105243_100220884 160
588 3300009176 Ga0105242_10127947 Ga0105242_101279471 160
589 3300020075 Ga0206349_1444139 Ga0206349_14441393 160
590 3300020081 Ga0206354_11344381 Ga0206354_113443812 160
591 3300025910 Ga0207684_10086549 Ga0207684_100865492 160
592 3300025922 Ga0207646_10289103 Ga0207646_102891032 160
593 3300025928 Ga0207700_10076167 Ga0207700_100761672 160
594 3300025929 Ga0207664_10565261 Ga0207664_105652612 160
595 3300025934 Ga0207686_11069086 Ga0207686_110690861 160
596 3300026116 Ga0207674_10144868 Ga0207674_101448682 160
597 3300028379 Ga0268266_10001924 Ga0268266_100019245 160
598 3300031251 Ga0265327_10008406 Ga0265327_100084067 160
599 3300031727 Ga0316576_10468192 Ga0316576_104681921 160
600 3300031728 Ga0316578_10093402 Ga0316578_100934022 160
601 3300031733 Ga0316577_10005591 Ga0316577_100055913 160
602 3300032137 Ga0316585_10017644 Ga0316585_100176442 160
603 3300035090 Ga0373949_0050928 Ga0373949_0050928_472_954 160
604 3300035115 Ga0373941_0044988 Ga0373941_0044988_160_642 160
605 3300035398 Ga0316574_0324815 Ga0316574_0324815_93_578 160
606 3300035692 Ga0373935_0836404 Ga0373935_0836404_72_569 160
607 3300036712 Ga0316584_0002429 Ga0316584_0002429_268_762 160
608 3300042876 Ga0451577_0533724 Ga0451577_0533724_306_788 160
609 3300042876 Ga0451577_1118145 Ga0451577_1118145_122_637 160
610 3300044673 Ga0453683_0144803 Ga0453683_0144803_887_1369 160
611 3300044673 Ga0453683_0269553 Ga0453683_0269553_56_538 160
612 3300044673 Ga0453683_1043029 Ga0453683_1043029_14_496 160
613 3300044712 Ga0453684_0020611 Ga0453684_0020611_2538_3035 160
614 3300044712 Ga0453684_0045961 Ga0453684_0045961_43_609 160
615 3300044712 Ga0453684_0135543 Ga0453684_0135543_61_546 160
616 3300044712 Ga0453684_0626313 Ga0453684_0626313_505_987 160
617 3300045051 Ga0451576_0026411 Ga0451576_0026411_275_757 160
618 3300045051 Ga0451576_0078953 Ga0451576_0078953_847_1329 160
619 3300045051 Ga0451576_0344377 Ga0451576_0344377_254_736 160
620 3300045051 Ga0451576_1012494 Ga0451576_1012494_168_680 160
621 3300049576 Ga0501040_0012787 Ga0501040_0012787_3897_4379 160
622 3300049576 Ga0501040_0458254 Ga0501040_0458254_85_576 160
623 3300049591 Ga0501075_0003860 Ga0501075_0003860_4576_5058 160
624 3300049741 Ga0501079_0033042 Ga0501079_0033042_3235_3717 160
625 3300049742 Ga0501080_0589882 Ga0501080_0589882_175_657 160
626 3300049824 Ga0501045_0148668 Ga0501045_0148668_463_945 160
627 3300050507 nmdc:mga05p37_20293_c1 nmdc:mga05p37_20293_c1_2109_2594 160
628 3300050507 nmdc:mga05p37_66679_c1 nmdc:mga05p37_66679_c1_3150_3635 160
629 3300050507 nmdc:mga05p37_81432_c1 nmdc:mga05p37_81432_c1_316_798 160
630 3300050507 nmdc:mga05p37_972481_c1 nmdc:mga05p37_972481_c1_264_746 160
631 3300050508 nmdc:mga09592_236889_c1 nmdc:mga09592_236889_c1_735_1220 160
632 3300050508 nmdc:mga09592_3484_c1 nmdc:mga09592_3484_c1_582_1067 160
633 3300050510 nmdc:mga06r32_1408895_c1 nmdc:mga06r32_1408895_c1_46_531 160
634 3300050510 nmdc:mga06r32_290142_c1 nmdc:mga06r32_290142_c1_552_1037 160
635 3300050510 nmdc:mga06r32_31908_c1 nmdc:mga06r32_31908_c1_1671_2156 160
636 3300050515 nmdc:mga0a205_465582_c1 nmdc:mga0a205_465582_c1_480_965 160
637 3300053085 Ga0495619_0055928 Ga0495619_0055928_1737_2255 160
638 3300054114 Ga0501084_0017223 Ga0501084_0017223_1319_1801 160
639 3300059644 Ga0587075_010098 Ga0587075_010098_374_865 160
640 3300060353 Ga0501082_0189052 Ga0501082_0189052_12_494 160
641 3300060353 Ga0501082_0373633 Ga0501082_0373633_289_780 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

98

171

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

30

95

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9744 5 160
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9723 4 156
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9712 5 157
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.9653 6 158
3hrd-assembly1.cif.gz_H crystal structure of nicotinate dehydrogenase 0.9647 4 155
ID Description Score Start End Superfamily
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9922 2 77 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9778 5 79 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.975 3 79 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9705 4 79 3.10.20.30
3hrdH01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9607 4 79 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A6L7WE32-F1-model_v4 (2Fe-2S)-binding protein 0.9899 4 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A2E3V100-F1-model_v4 Ferredoxin 0.9899 4 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A1K2HT67-F1-model_v4 Nicotinate dehydrogenase subunit A 0.9883 2 155 GO:0016491
GO:0046872
GO:0051537
AF-A0A536CNY8-F1-model_v4 (2Fe-2S)-binding protein 0.9878 3 155 GO:0016491
GO:0046872
GO:0051537
AF-A0A177QCX2-F1-model_v4 Ferredoxin 0.9876 4 156 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
94.05 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map