F471799
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 641 | 354 | 641 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0136418|Ga0373937_0136418_590_1123 |
| Length | 177 |
| Sequence | MQFDFFHYVYSSMAHNKSVNRLREGFMASLEINGKTQEVNADPSTPLLWVIRDTLNMTGTKFGCGAQLCGACTVHLDGKPVRSCGTPLSAAIGKKITTIEGVSASAAXKKVQAAWAAIDVPQCGYCQSGQIMSATALLAENPKPTDADIDKAMAGNICRCGTYPRIRAAIHKAAKGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 123 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 179 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 181 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 182 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 183 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 187 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 188 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 189 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 190 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 191 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 192 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 198 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 202 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 211 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 212 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 220 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 229 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 230 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 231 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 232 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 235 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 317 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 318 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 319 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 320 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 321 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 322 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 323 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 324 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 335 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 351 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.97 |
| Metatranscriptomes | 2.03 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.31 |
| Nodule | 0 |
| Rhizoplane | 0.94 |
| Rhizosphere | 96.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_1338701 | 2162886006 | Bacteria | 1120 |
| 2 | JGI24735J21928_10049085 | 3300002067 | Bacteria | 1220 |
| 3 | JGI24749J21850_1025208 | 3300002076 | Bacteria | 847 |
| 4 | rootH2_10136714 | 3300003320 | Bacteria | 2878 |
| 5 | Ga0058859_10793595 | 3300004798 | Bacteria | 1221 |
| 6 | Ga0058859_11381433 | 3300004798 | Bacteria | 650 |
| 7 | Ga0058862_12713619 | 3300004803 | Bacteria | 2965 |
| 8 | Ga0065704_10070436 | 3300005289 | Bacteria | 24901 |
| 9 | Ga0065707_10001282 | 3300005295 | Bacteria | 10735 |
| 10 | Ga0065707_10081813 | 3300005295 | Bacteria | 36984 |
| 11 | Ga0065707_10084037 | 3300005295 | Bacteria | 7727 |
| 12 | Ga0065707_10256063 | 3300005295 | Bacteria | 1111 |
| 13 | Ga0065707_10441765 | 3300005295 | Bacteria | 809 |
| 14 | Ga0065707_10673030 | 3300005295 | Unclassified | 652 |
| 15 | Ga0070658_10012627 | 3300005327 | Bacteria | 6775 |
| 16 | Ga0070658_10354227 | 3300005327 | Bacteria | 1257 |
| 17 | Ga0070676_10039164 | 3300005328 | Bacteria | 2740 |
| 18 | Ga0070676_10060206 | 3300005328 | Bacteria | 2254 |
| 19 | Ga0070690_100000075 | 3300005330 | Bacteria | 48451 |
| 20 | Ga0070690_100090386 | 3300005330 | Bacteria | 2016 |
| 21 | Ga0068869_100000841 | 3300005334 | Bacteria | 17573 |
| 22 | Ga0068869_100001166 | 3300005334 | Bacteria | 15390 |
| 23 | Ga0070680_100001183 | 3300005336 | Bacteria | 18770 |
| 24 | Ga0070682_100034498 | 3300005337 | Bacteria | 3082 |
| 25 | Ga0070682_100975293 | 3300005337 | Bacteria | 702 |
| 26 | Ga0068868_100000329 | 3300005338 | Bacteria | 31993 |
| 27 | Ga0070660_100001672 | 3300005339 | Bacteria | 15227 |
| 28 | Ga0070660_100119900 | 3300005339 | Bacteria | 2099 |
| 29 | Ga0070689_100000481 | 3300005340 | Bacteria | 23552 |
| 30 | Ga0070691_10000399 | 3300005341 | Bacteria | 15765 |
| 31 | Ga0070687_100000014 | 3300005343 | Bacteria | 57432 |
| 32 | Ga0070661_101038233 | 3300005344 | Bacteria | 681 |
| 33 | Ga0070692_10000041 | 3300005345 | Bacteria | 24940 |
| 34 | Ga0070675_100001440 | 3300005354 | Bacteria | 17483 |
| 35 | Ga0070675_100565877 | 3300005354 | Bacteria | 1029 |
| 36 | Ga0070675_100815892 | 3300005354 | Bacteria | 853 |
| 37 | Ga0070688_100048098 | 3300005365 | Bacteria | 2649 |
| 38 | Ga0070709_10023177 | 3300005434 | Bacteria | 3642 |
| 39 | Ga0070709_10815766 | 3300005434 | Bacteria | 733 |
| 40 | Ga0070714_100234140 | 3300005435 | Bacteria | 1693 |
| 41 | Ga0070713_100001485 | 3300005436 | Bacteria | 14948 |
| 42 | Ga0070713_100036776 | 3300005436 | Bacteria | 3954 |
| 43 | Ga0070713_100066237 | 3300005436 | Bacteria | 3037 |
| 44 | Ga0070701_10000641 | 3300005438 | Bacteria | 12213 |
| 45 | Ga0070711_100418087 | 3300005439 | Bacteria | 1092 |
| 46 | Ga0070705_100008701 | 3300005440 | Bacteria | 5027 |
| 47 | Ga0070705_100165941 | 3300005440 | Unclassified | 1481 |
| 48 | Ga0070705_100596163 | 3300005440 | Bacteria | 854 |
| 49 | Ga0070705_100631222 | 3300005440 | Bacteria | 833 |
| 50 | Ga0070700_100001345 | 3300005441 | Bacteria | 12219 |
| 51 | Ga0070694_100000099 | 3300005444 | Bacteria | 41966 |
| 52 | Ga0070694_100089852 | 3300005444 | Bacteria | 2153 |
| 53 | Ga0070708_100012421 | 3300005445 | Bacteria | 6953 |
| 54 | Ga0070708_100046280 | 3300005445 | Bacteria | 3839 |
| 55 | Ga0070708_100634375 | 3300005445 | Bacteria | 1007 |
| 56 | Ga0070681_10027710 | 3300005458 | Bacteria | 5696 |
| 57 | Ga0068867_100000174 | 3300005459 | Bacteria | 41996 |
| 58 | Ga0070706_100103560 | 3300005467 | Bacteria | 2646 |
| 59 | Ga0070706_100129737 | 3300005467 | Bacteria | 2352 |
| 60 | Ga0070707_100014756 | 3300005468 | Bacteria | 7323 |
| 61 | Ga0070707_100086838 | 3300005468 | Bacteria | 3025 |
| 62 | Ga0070707_100152189 | 3300005468 | Bacteria | 2253 |
| 63 | Ga0070707_100326803 | 3300005468 | Unclassified | 1490 |
| 64 | Ga0070707_100596650 | 3300005468 | Bacteria | 1067 |
| 65 | Ga0070698_100017576 | 3300005471 | Bacteria | 7537 |
| 66 | Ga0070698_100048113 | 3300005471 | Bacteria | 4357 |
| 67 | Ga0070698_100160949 | 3300005471 | Bacteria | 2188 |
| 68 | Ga0070698_100349329 | 3300005471 | Bacteria | 1410 |
| 69 | Ga0070699_100021230 | 3300005518 | Bacteria | 5600 |
| 70 | Ga0070699_100026645 | 3300005518 | Bacteria | 4985 |
| 71 | Ga0070699_100044553 | 3300005518 | Bacteria | 3840 |
| 72 | Ga0070699_100255187 | 3300005518 | Bacteria | 1567 |
| 73 | Ga0070699_100436277 | 3300005518 | Bacteria | 1187 |
| 74 | Ga0070699_100488850 | 3300005518 | Bacteria | 1117 |
| 75 | Ga0070699_100689624 | 3300005518 | Bacteria | 933 |
| 76 | Ga0070679_100031801 | 3300005530 | Bacteria | 5218 |
| 77 | Ga0070697_100070216 | 3300005536 | Bacteria | 2871 |
| 78 | Ga0070697_100082474 | 3300005536 | Bacteria | 2650 |
| 79 | Ga0070697_100432368 | 3300005536 | Bacteria | 1145 |
| 80 | Ga0068853_100057696 | 3300005539 | Bacteria | 3351 |
| 81 | Ga0068853_101776598 | 3300005539 | Bacteria | 598 |
| 82 | Ga0070686_100000134 | 3300005544 | Bacteria | 51357 |
| 83 | Ga0070695_100000018 | 3300005545 | Bacteria | 63499 |
| 84 | Ga0070695_100012719 | 3300005545 | Bacteria | 5051 |
| 85 | Ga0070695_100066267 | 3300005545 | Bacteria | 2353 |
| 86 | Ga0070696_100027846 | 3300005546 | Bacteria | 3854 |
| 87 | Ga0070693_100000021 | 3300005547 | Bacteria | 59618 |
| 88 | Ga0070665_100001226 | 3300005548 | Bacteria | 31203 |
| 89 | Ga0070704_100000043 | 3300005549 | Bacteria | 42411 |
| 90 | Ga0070704_100003271 | 3300005549 | Bacteria | 9259 |
| 91 | Ga0070704_100305828 | 3300005549 | Unclassified | 1326 |
| 92 | Ga0068855_100001327 | 3300005563 | Bacteria | 30611 |
| 93 | Ga0068855_100699465 | 3300005563 | Bacteria | 1085 |
| 94 | Ga0068857_100111024 | 3300005577 | Bacteria | 2464 |
| 95 | Ga0068854_100002225 | 3300005578 | Bacteria | 11931 |
| 96 | Ga0068854_101177074 | 3300005578 | Bacteria | 686 |
| 97 | Ga0068856_100041413 | 3300005614 | Bacteria | 4527 |
| 98 | Ga0068856_100263037 | 3300005614 | Bacteria | 1741 |
| 99 | Ga0068856_100606005 | 3300005614 | Bacteria | 1116 |
| 100 | Ga0070702_100000007 | 3300005615 | Bacteria | 65238 |
| 101 | Ga0068852_100042244 | 3300005616 | Bacteria | 3859 |
| 102 | Ga0068852_101147056 | 3300005616 | Bacteria | 798 |
| 103 | Ga0068859_100001320 | 3300005617 | Bacteria | 25307 |
| 104 | Ga0068859_100252866 | 3300005617 | Bacteria | 1853 |
| 105 | Ga0068866_10000561 | 3300005718 | Bacteria | 16983 |
| 106 | Ga0068861_100000617 | 3300005719 | Bacteria | 21065 |
| 107 | Ga0068861_102037473 | 3300005719 | Bacteria | 573 |
| 108 | Ga0068870_10004187 | 3300005840 | Bacteria | 6194 |
| 109 | Ga0068863_100254518 | 3300005841 | Bacteria | 1697 |
| 110 | Ga0068863_100435927 | 3300005841 | Bacteria | 1285 |
| 111 | Ga0068858_100000334 | 3300005842 | Bacteria | 49778 |
| 112 | Ga0068860_100001410 | 3300005843 | Bacteria | 26069 |
| 113 | Ga0068860_100125796 | 3300005843 | Bacteria | 2457 |
| 114 | Ga0068862_100000688 | 3300005844 | Bacteria | 34533 |
| 115 | Ga0068862_100082797 | 3300005844 | Bacteria | 2785 |
| 116 | Ga0068862_100106650 | 3300005844 | Bacteria | 2456 |
| 117 | Ga0081455_10086864 | 3300005937 | Bacteria | 2547 |
| 118 | Ga0081538_10003141 | 3300005981 | Bacteria | 15695 |
| 119 | Ga0070717_10283452 | 3300006028 | Bacteria | 1470 |
| 120 | Ga0070715_10470048 | 3300006163 | Bacteria | 714 |
| 121 | Ga0070716_100001913 | 3300006173 | Bacteria | 9466 |
| 122 | Ga0070716_100007818 | 3300006173 | Bacteria | 5285 |
| 123 | Ga0070712_100671118 | 3300006175 | Bacteria | 882 |
| 124 | Ga0075427_10000052 | 3300006194 | Bacteria | 8724 |
| 125 | Ga0097621_100000593 | 3300006237 | Bacteria | 25510 |
| 126 | Ga0097621_100072191 | 3300006237 | Bacteria | 2855 |
| 127 | Ga0068871_100000157 | 3300006358 | Bacteria | 44850 |
| 128 | Ga0075428_100001267 | 3300006844 | Bacteria | 26940 |
| 129 | Ga0075428_100004810 | 3300006844 | Bacteria | 14974 |
| 130 | Ga0075428_100022421 | 3300006844 | Bacteria | 6992 |
| 131 | Ga0075428_100057169 | 3300006844 | Bacteria | 4271 |
| 132 | Ga0075428_100181592 | 3300006844 | Bacteria | 2277 |
| 133 | Ga0075428_100198604 | 3300006844 | Bacteria | 2169 |
| 134 | Ga0075430_100002352 | 3300006846 | Bacteria | 15715 |
| 135 | Ga0075430_100049700 | 3300006846 | Unclassified | 3539 |
| 136 | Ga0075430_100233003 | 3300006846 | Bacteria | 1527 |
| 137 | Ga0075430_100845485 | 3300006846 | Bacteria | 754 |
| 138 | Ga0075431_100021112 | 3300006847 | Bacteria | 6655 |
| 139 | Ga0075431_100070939 | 3300006847 | Bacteria | 3594 |
| 140 | Ga0075431_100161631 | 3300006847 | Bacteria | 2303 |
| 141 | Ga0075431_100420933 | 3300006847 | Bacteria | 1335 |
| 142 | Ga0075431_101141333 | 3300006847 | Bacteria | 743 |
| 143 | Ga0075433_10001495 | 3300006852 | Bacteria | 17266 |
| 144 | Ga0075433_10341005 | 3300006852 | Bacteria | 1325 |
| 145 | Ga0075433_10670647 | 3300006852 | Bacteria | 909 |
| 146 | Ga0075433_11663316 | 3300006852 | Bacteria | 550 |
| 147 | Ga0075434_100000989 | 3300006871 | Bacteria | 23001 |
| 148 | Ga0075434_100047202 | 3300006871 | Bacteria | 4274 |
| 149 | Ga0075434_100337235 | 3300006871 | Bacteria | 1528 |
| 150 | Ga0075429_100000046 | 3300006880 | Bacteria | 56781 |
| 151 | Ga0075429_100001186 | 3300006880 | Bacteria | 21066 |
| 152 | Ga0075429_100013305 | 3300006880 | Bacteria | 7136 |
| 153 | Ga0075429_100024544 | 3300006880 | Bacteria | 5231 |
| 154 | Ga0075429_100048367 | 3300006880 | Bacteria | 3698 |
| 155 | Ga0075429_100317707 | 3300006880 | Bacteria | 1363 |
| 156 | Ga0068865_100000296 | 3300006881 | Bacteria | 27405 |
| 157 | Ga0075436_100000190 | 3300006914 | Bacteria | 37988 |
| 158 | Ga0097620_100001320 | 3300006931 | Bacteria | 25307 |
| 159 | Ga0097620_100252866 | 3300006931 | Bacteria | 1853 |
| 160 | Ga0075435_100000058 | 3300007076 | Bacteria | 56883 |
| 161 | Ga0075435_100346660 | 3300007076 | Bacteria | 1273 |
| 162 | Ga0075435_101227682 | 3300007076 | Bacteria | 656 |
| 163 | Ga0099794_10010059 | 3300007265 | Bacteria | 4005 |
| 164 | Ga0099794_10099383 | 3300007265 | Bacteria | 1451 |
| 165 | Ga0099794_10145106 | 3300007265 | Bacteria | 1203 |
| 166 | Ga0099794_10272541 | 3300007265 | Bacteria | 874 |
| 167 | Ga0099795_10123063 | 3300007788 | Bacteria | 1039 |
| 168 | Ga0105251_10003168 | 3300009011 | Bacteria | 12177 |
| 169 | Ga0105240_10004592 | 3300009093 | Bacteria | 20929 |
| 170 | Ga0105240_10249969 | 3300009093 | Bacteria | 2051 |
| 171 | Ga0105240_10779433 | 3300009093 | Bacteria | 1037 |
| 172 | Ga0111539_10010601 | 3300009094 | Bacteria | 11606 |
| 173 | Ga0111539_10816109 | 3300009094 | Bacteria | 1085 |
| 174 | Ga0111539_11154220 | 3300009094 | Bacteria | 900 |
| 175 | Ga0111539_11194109 | 3300009094 | Bacteria | 884 |
| 176 | Ga0111539_11379558 | 3300009094 | Bacteria | 818 |
| 177 | Ga0111539_12658459 | 3300009094 | Bacteria | 580 |
| 178 | Ga0105245_10000405 | 3300009098 | Bacteria | 40004 |
| 179 | Ga0105245_10925557 | 3300009098 | Bacteria | 914 |
| 180 | Ga0105245_11526127 | 3300009098 | Bacteria | 719 |
| 181 | Ga0114129_10000177 | 3300009147 | Bacteria | 70549 |
| 182 | Ga0114129_10000974 | 3300009147 | Bacteria | 37478 |
| 183 | Ga0114129_10004218 | 3300009147 | Bacteria | 20308 |
| 184 | Ga0114129_10014581 | 3300009147 | Bacteria | 11197 |
| 185 | Ga0114129_10170625 | 3300009147 | Bacteria | 2966 |
| 186 | Ga0114129_10794708 | 3300009147 | Bacteria | 1208 |
| 187 | Ga0105243_10000466 | 3300009148 | Bacteria | 41868 |
| 188 | Ga0105243_10022088 | 3300009148 | Bacteria | 4835 |
| 189 | Ga0105243_10124485 | 3300009148 | Bacteria | 2178 |
| 190 | Ga0105241_10132627 | 3300009174 | Bacteria | 2019 |
| 191 | Ga0105242_10000191 | 3300009176 | Bacteria | 47337 |
| 192 | Ga0105242_10127947 | 3300009176 | Bacteria | 2188 |
| 193 | Ga0105248_10131250 | 3300009177 | Bacteria | 2827 |
| 194 | Ga0105237_10023256 | 3300009545 | Bacteria | 6352 |
| 195 | Ga0105237_10215933 | 3300009545 | Bacteria | 1918 |
| 196 | Ga0105237_10466983 | 3300009545 | Bacteria | 1268 |
| 197 | Ga0105238_11584057 | 3300009551 | Bacteria | 685 |
| 198 | Ga0105249_10000555 | 3300009553 | Bacteria | 34420 |
| 199 | Ga0105249_10035348 | 3300009553 | Bacteria | 4532 |
| 200 | Ga0105249_10139393 | 3300009553 | Unclassified | 2324 |
| 201 | Ga0105249_10870152 | 3300009553 | Unclassified | 967 |
| 202 | Ga0099796_10129973 | 3300010159 | Bacteria | 976 |
| 203 | Ga0105239_10082228 | 3300010375 | Bacteria | 3546 |
| 204 | Ga0105246_10081161 | 3300011119 | Bacteria | 2310 |
| 205 | Ga0105246_10296247 | 3300011119 | Bacteria | 1304 |
| 206 | Ga0105246_11301184 | 3300011119 | Bacteria | 674 |
| 207 | Ga0157324_1037396 | 3300012506 | Bacteria | 579 |
| 208 | Ga0157373_10021893 | 3300013100 | Bacteria | 4638 |
| 209 | Ga0157371_10047383 | 3300013102 | Bacteria | 3056 |
| 210 | Ga0157371_10113482 | 3300013102 | Bacteria | 1924 |
| 211 | Ga0157371_10269411 | 3300013102 | Bacteria | 1229 |
| 212 | Ga0157370_10004911 | 3300013104 | Bacteria | 15149 |
| 213 | Ga0157369_10003711 | 3300013105 | Bacteria | 18153 |
| 214 | Ga0157369_10011071 | 3300013105 | Bacteria | 10262 |
| 215 | Ga0157374_10000221 | 3300013296 | Bacteria | 52587 |
| 216 | Ga0157374_10007785 | 3300013296 | Bacteria | 9145 |
| 217 | Ga0157374_10651266 | 3300013296 | Bacteria | 1065 |
| 218 | Ga0157378_10000196 | 3300013297 | Bacteria | 58849 |
| 219 | Ga0163162_10057810 | 3300013306 | Bacteria | 3906 |
| 220 | Ga0163162_10116338 | 3300013306 | Bacteria | 2774 |
| 221 | Ga0157372_10009644 | 3300013307 | Bacteria | 10261 |
| 222 | Ga0157372_10016041 | 3300013307 | Bacteria | 8035 |
| 223 | Ga0157372_10114553 | 3300013307 | Bacteria | 3091 |
| 224 | Ga0157372_10412772 | 3300013307 | Bacteria | 1573 |
| 225 | Ga0157372_11425375 | 3300013307 | Bacteria | 798 |
| 226 | Ga0157372_12042109 | 3300013307 | Bacteria | 659 |
| 227 | Ga0163163_10028218 | 3300014325 | Bacteria | 5387 |
| 228 | Ga0157380_10028322 | 3300014326 | Bacteria | 4270 |
| 229 | Ga0157380_10030394 | 3300014326 | Bacteria | 4136 |
| 230 | Ga0157380_10121650 | 3300014326 | Bacteria | 2212 |
| 231 | Ga0157380_10198695 | 3300014326 | Bacteria | 1777 |
| 232 | Ga0157377_10001401 | 3300014745 | Bacteria | 10405 |
| 233 | Ga0157377_10167411 | 3300014745 | Bacteria | 1371 |
| 234 | Ga0157379_10045543 | 3300014968 | Bacteria | 3914 |
| 235 | Ga0157376_10000314 | 3300014969 | Bacteria | 32447 |
| 236 | Ga0157376_10037538 | 3300014969 | Bacteria | 3934 |
| 237 | Ga0182006_1129887 | 3300015261 | Bacteria | 867 |
| 238 | Ga0163161_10006381 | 3300017792 | Bacteria | 8163 |
| 239 | Ga0197907_10572943 | 3300020069 | Bacteria | 1577 |
| 240 | Ga0206349_1444139 | 3300020075 | Bacteria | 4662 |
| 241 | Ga0206351_10662555 | 3300020077 | Bacteria | 577 |
| 242 | Ga0206350_10957556 | 3300020080 | Bacteria | 1528 |
| 243 | Ga0206354_11344381 | 3300020081 | Bacteria | 2011 |
| 244 | Ga0206353_11249298 | 3300020082 | Bacteria | 1280 |
| 245 | Ga0206353_11376464 | 3300020082 | Bacteria | 2857 |
| 246 | Ga0213872_10001160 | 3300021361 | Bacteria | 17917 |
| 247 | Ga0213872_10040248 | 3300021361 | Bacteria | 2134 |
| 248 | Ga0224712_10036737 | 3300022467 | Bacteria | 1818 |
| 249 | Ga0224572_1057874 | 3300024225 | Bacteria | 719 |
| 250 | Ga0209026_1003669 | 3300025250 | Bacteria | 4920 |
| 251 | Ga0209759_1019331 | 3300025256 | Bacteria | 1618 |
| 252 | Ga0207713_1061449 | 3300025735 | Bacteria | 1429 |
| 253 | Ga0207642_10000935 | 3300025899 | Bacteria | 9141 |
| 254 | Ga0207680_10089947 | 3300025903 | Bacteria | 1950 |
| 255 | Ga0207647_10025600 | 3300025904 | Bacteria | 3873 |
| 256 | Ga0207685_10257171 | 3300025905 | Bacteria | 847 |
| 257 | Ga0207699_10047572 | 3300025906 | Bacteria | 2516 |
| 258 | Ga0207643_10030147 | 3300025908 | Bacteria | 3019 |
| 259 | Ga0207684_10086549 | 3300025910 | Unclassified | 2669 |
| 260 | Ga0207684_10107704 | 3300025910 | Bacteria | 2384 |
| 261 | Ga0207654_10091213 | 3300025911 | Bacteria | 1858 |
| 262 | Ga0207707_10117754 | 3300025912 | Bacteria | 2322 |
| 263 | Ga0207695_10071377 | 3300025913 | Bacteria | 3547 |
| 264 | Ga0207695_10111167 | 3300025913 | Bacteria | 2719 |
| 265 | Ga0207671_10090199 | 3300025914 | Bacteria | 2308 |
| 266 | Ga0207671_10311526 | 3300025914 | Bacteria | 1244 |
| 267 | Ga0207693_10154078 | 3300025915 | Bacteria | 1808 |
| 268 | Ga0207663_10407627 | 3300025916 | Bacteria | 1041 |
| 269 | Ga0207660_10000284 | 3300025917 | Bacteria | 33488 |
| 270 | Ga0207660_10027982 | 3300025917 | Bacteria | 3853 |
| 271 | Ga0207660_10342732 | 3300025917 | Bacteria | 1196 |
| 272 | Ga0207662_10000063 | 3300025918 | Bacteria | 46662 |
| 273 | Ga0207657_10018440 | 3300025919 | Bacteria | 6661 |
| 274 | Ga0207657_10081948 | 3300025919 | Bacteria | 2709 |
| 275 | Ga0207652_10016598 | 3300025921 | Bacteria | 6015 |
| 276 | Ga0207652_11205550 | 3300025921 | Bacteria | 659 |
| 277 | Ga0207646_10001174 | 3300025922 | Bacteria | 33188 |
| 278 | Ga0207646_10052136 | 3300025922 | Bacteria | 3661 |
| 279 | Ga0207646_10289103 | 3300025922 | Bacteria | 1481 |
| 280 | Ga0207681_10361666 | 3300025923 | Bacteria | 1164 |
| 281 | Ga0207659_10021091 | 3300025926 | Bacteria | 4318 |
| 282 | Ga0207687_10000976 | 3300025927 | Bacteria | 19455 |
| 283 | Ga0207687_10207992 | 3300025927 | Bacteria | 1533 |
| 284 | Ga0207700_10004396 | 3300025928 | Bacteria | 8302 |
| 285 | Ga0207700_10028783 | 3300025928 | Bacteria | 3913 |
| 286 | Ga0207700_10076167 | 3300025928 | Bacteria | 2602 |
| 287 | Ga0207664_10565261 | 3300025929 | Bacteria | 1021 |
| 288 | Ga0207686_11069086 | 3300025934 | Bacteria | 657 |
| 289 | Ga0207709_10002870 | 3300025935 | Bacteria | 10556 |
| 290 | Ga0207709_11013107 | 3300025935 | Bacteria | 679 |
| 291 | Ga0207670_10001140 | 3300025936 | Bacteria | 14016 |
| 292 | Ga0207670_10021108 | 3300025936 | Bacteria | 4013 |
| 293 | Ga0207704_10001148 | 3300025938 | Bacteria | 11772 |
| 294 | Ga0207665_10000589 | 3300025939 | Bacteria | 24479 |
| 295 | Ga0207665_10110252 | 3300025939 | Bacteria | 1933 |
| 296 | Ga0207665_11030817 | 3300025939 | Bacteria | 655 |
| 297 | Ga0207691_10292695 | 3300025940 | Bacteria | 1400 |
| 298 | Ga0207711_10174590 | 3300025941 | Bacteria | 1952 |
| 299 | Ga0207711_10900137 | 3300025941 | Bacteria | 823 |
| 300 | Ga0207689_10000214 | 3300025942 | Bacteria | 51325 |
| 301 | Ga0207667_10027649 | 3300025949 | Bacteria | 6170 |
| 302 | Ga0207667_10031255 | 3300025949 | Bacteria | 5749 |
| 303 | Ga0207667_10408109 | 3300025949 | Bacteria | 1383 |
| 304 | Ga0207667_11127318 | 3300025949 | Bacteria | 767 |
| 305 | Ga0207712_10161688 | 3300025961 | Bacteria | 1741 |
| 306 | Ga0207712_10191520 | 3300025961 | Bacteria | 1615 |
| 307 | Ga0207712_10238810 | 3300025961 | Bacteria | 1463 |
| 308 | Ga0207640_10000972 | 3300025981 | Bacteria | 15897 |
| 309 | Ga0207640_10942835 | 3300025981 | Bacteria | 756 |
| 310 | Ga0207677_10000714 | 3300026023 | Bacteria | 19610 |
| 311 | Ga0207703_10012996 | 3300026035 | Bacteria | 6487 |
| 312 | Ga0207639_10012477 | 3300026041 | Bacteria | 5919 |
| 313 | Ga0207639_11509449 | 3300026041 | Bacteria | 631 |
| 314 | Ga0207708_10000117 | 3300026075 | Bacteria | 60989 |
| 315 | Ga0207702_10028320 | 3300026078 | Bacteria | 4656 |
| 316 | Ga0207702_10103138 | 3300026078 | Bacteria | 2522 |
| 317 | Ga0207702_10288441 | 3300026078 | Bacteria | 1554 |
| 318 | Ga0207702_10765074 | 3300026078 | Bacteria | 954 |
| 319 | Ga0207641_10234745 | 3300026088 | Bacteria | 1706 |
| 320 | Ga0207641_11489522 | 3300026088 | Bacteria | 678 |
| 321 | Ga0207648_10000293 | 3300026089 | Bacteria | 54504 |
| 322 | Ga0207676_10411431 | 3300026095 | Bacteria | 1266 |
| 323 | Ga0207674_10118964 | 3300026116 | Bacteria | 2611 |
| 324 | Ga0207674_10144868 | 3300026116 | Bacteria | 2334 |
| 325 | Ga0207674_10702827 | 3300026116 | Bacteria | 976 |
| 326 | Ga0207675_100000218 | 3300026118 | Bacteria | 53850 |
| 327 | Ga0207675_100411018 | 3300026118 | Bacteria | 1335 |
| 328 | Ga0207675_100476898 | 3300026118 | Bacteria | 1239 |
| 329 | Ga0207698_10042850 | 3300026142 | Bacteria | 3386 |
| 330 | Ga0209588_1007989 | 3300027671 | Bacteria | 3130 |
| 331 | Ga0209588_1148749 | 3300027671 | Bacteria | 743 |
| 332 | Ga0209971_1095120 | 3300027682 | Bacteria | 728 |
| 333 | Ga0207428_10000517 | 3300027907 | Bacteria | 46100 |
| 334 | Ga0207428_10027604 | 3300027907 | Bacteria | 4725 |
| 335 | Ga0207428_10833560 | 3300027907 | Bacteria | 654 |
| 336 | Ga0268266_10001924 | 3300028379 | Bacteria | 23359 |
| 337 | Ga0268265_10005718 | 3300028380 | Bacteria | 8491 |
| 338 | Ga0268265_10359232 | 3300028380 | Bacteria | 1333 |
| 339 | Ga0268265_11076027 | 3300028380 | Bacteria | 797 |
| 340 | Ga0268264_10000609 | 3300028381 | Bacteria | 42936 |
| 341 | Ga0268264_10084407 | 3300028381 | Bacteria | 2723 |
| 342 | Ga0268264_10266123 | 3300028381 | Bacteria | 1600 |
| 343 | Ga0265769_107039 | 3300030888 | Bacteria | 718 |
| 344 | Ga0265328_10005792 | 3300031239 | Bacteria | 5275 |
| 345 | Ga0265331_10002817 | 3300031250 | Bacteria | 11527 |
| 346 | Ga0265327_10000043 | 3300031251 | Bacteria | 285108 |
| 347 | Ga0265327_10008406 | 3300031251 | Bacteria | 7695 |
| 348 | Ga0316576_10468192 | 3300031727 | Bacteria | 929 |
| 349 | Ga0316578_10093402 | 3300031728 | Bacteria | 1799 |
| 350 | Ga0316577_10005591 | 3300031733 | Bacteria | 6601 |
| 351 | Ga0307416_100140329 | 3300032002 | Bacteria | 2195 |
| 352 | Ga0307411_10509219 | 3300032005 | Bacteria | 1019 |
| 353 | Ga0316585_10017644 | 3300032137 | Bacteria | 2160 |
| 354 | Ga0307507_10088742 | 3300033179 | Bacteria | 2665 |
| 355 | Ga0307510_10059359 | 3300033180 | Bacteria | 3951 |
| 356 | Ga0373930_0022050 | 3300034816 | Bacteria | 1256 |
| 357 | Ga0373959_0045623 | 3300034820 | Bacteria | 932 |
| 358 | Ga0373938_0045456 | 3300034957 | Bacteria | 988 |
| 359 | Ga0373928_0036099 | 3300035084 | Bacteria | 1116 |
| 360 | Ga0373940_0003758 | 3300035088 | Bacteria | 3135 |
| 361 | Ga0373944_0232308 | 3300035089 | Bacteria | 676 |
| 362 | Ga0373949_0050928 | 3300035090 | Bacteria | 1043 |
| 363 | Ga0373951_0008041 | 3300035091 | Bacteria | 2391 |
| 364 | Ga0373952_0012870 | 3300035092 | Bacteria | 1652 |
| 365 | Ga0373923_0078772 | 3300035111 | Bacteria | 1426 |
| 366 | Ga0373923_0276048 | 3300035111 | Bacteria | 791 |
| 367 | Ga0373932_0001050 | 3300035112 | Bacteria | 7951 |
| 368 | Ga0373936_0032465 | 3300035113 | Bacteria | 2065 |
| 369 | Ga0373936_0064179 | 3300035113 | Bacteria | 1504 |
| 370 | Ga0373936_0244925 | 3300035113 | Bacteria | 799 |
| 371 | Ga0373939_0002059 | 3300035114 | Bacteria | 4799 |
| 372 | Ga0373941_0024743 | 3300035115 | Bacteria | 1727 |
| 373 | Ga0373941_0044988 | 3300035115 | Bacteria | 1380 |
| 374 | Ga0373941_0277275 | 3300035115 | Bacteria | 662 |
| 375 | Ga0373945_0045063 | 3300035116 | Bacteria | 1605 |
| 376 | Ga0373954_0051752 | 3300035118 | Bacteria | 1929 |
| 377 | Ga0373954_0399335 | 3300035118 | Bacteria | 680 |
| 378 | Ga0373956_0036320 | 3300035119 | Bacteria | 2174 |
| 379 | Ga0373943_0002249 | 3300035170 | Bacteria | 8772 |
| 380 | Ga0373943_0285902 | 3300035170 | Bacteria | 933 |
| 381 | Ga0373943_0588671 | 3300035170 | Bacteria | 655 |
| 382 | Ga0373946_0002900 | 3300035171 | Bacteria | 6083 |
| 383 | Ga0373955_0011452 | 3300035172 | Bacteria | 4228 |
| 384 | Ga0373942_0010568 | 3300035207 | Bacteria | 2173 |
| 385 | Ga0373942_0131079 | 3300035207 | Bacteria | 791 |
| 386 | Ga0373962_0120752 | 3300035242 | Bacteria | 835 |
| 387 | Ga0316574_0008996 | 3300035398 | Bacteria | 5578 |
| 388 | Ga0316574_0324815 | 3300035398 | Bacteria | 976 |
| 389 | Ga0373924_0013784 | 3300035410 | Bacteria | 3042 |
| 390 | Ga0373924_0420712 | 3300035410 | Bacteria | 598 |
| 391 | Ga0373931_0001310 | 3300035691 | Bacteria | 10655 |
| 392 | Ga0373931_0001708 | 3300035691 | Bacteria | 9519 |
| 393 | Ga0373935_0002524 | 3300035692 | Bacteria | 10489 |
| 394 | Ga0373935_0099425 | 3300035692 | Bacteria | 1915 |
| 395 | Ga0373935_0446814 | 3300035692 | Bacteria | 933 |
| 396 | Ga0373935_0836404 | 3300035692 | Bacteria | 680 |
| 397 | Ga0373927_0010809 | 3300035695 | Bacteria | 6082 |
| 398 | Ga0373927_0019500 | 3300035695 | Bacteria | 4446 |
| 399 | Ga0373933_0006340 | 3300035724 | Bacteria | 6436 |
| 400 | Ga0373947_0009586 | 3300035725 | Bacteria | 5557 |
| 401 | Ga0373947_0046137 | 3300035725 | Bacteria | 2609 |
| 402 | Ga0373947_0589389 | 3300035725 | Bacteria | 757 |
| 403 | Ga0373937_0039197 | 3300036401 | Bacteria | 4318 |
| 404 | Ga0373937_0136418 | 3300036401 | Bacteria | 2294 |
| 405 | Ga0373937_0209461 | 3300036401 | Bacteria | 1834 |
| 406 | Ga0373937_0225552 | 3300036401 | Bacteria | 1764 |
| 407 | Ga0316582_0265275 | 3300036647 | Bacteria | 1178 |
| 408 | Ga0316584_0002429 | 3300036712 | Bacteria | 11787 |
| 409 | Ga0316584_0113994 | 3300036712 | Bacteria | 2022 |
| 410 | Ga0316584_0201669 | 3300036712 | Bacteria | 1468 |
| 411 | Ga0373925_0010575 | 3300037068 | Bacteria | 6692 |
| 412 | Ga0373925_0029085 | 3300037068 | Bacteria | 4054 |
| 413 | Ga0395899_0002318 | 3300037312 | Bacteria | 15511 |
| 414 | Ga0395900_0072495 | 3300037418 | Bacteria | 3540 |
| 415 | Ga0395900_0206367 | 3300037418 | Bacteria | 1986 |
| 416 | Ga0395900_0239580 | 3300037418 | Bacteria | 1820 |
| 417 | Ga0395898_0255974 | 3300037466 | Bacteria | 1669 |
| 418 | Ga0436364_0823753 | 3300037853 | Bacteria | 1272 |
| 419 | Ga0436364_1416277 | 3300037853 | Bacteria | 510 |
| 420 | Ga0395901_0099359 | 3300038443 | Bacteria | 3051 |
| 421 | Ga0395901_0132273 | 3300038443 | Bacteria | 2621 |
| 422 | Ga0395901_0311919 | 3300038443 | Bacteria | 1629 |
| 423 | Ga0436365_0025793 | 3300039437 | Bacteria | 658 |
| 424 | Ga0436361_0056557 | 3300039447 | Bacteria | 1002 |
| 425 | Ga0436361_0242643 | 3300039447 | Bacteria | 529 |
| 426 | Ga0436361_0294265 | 3300039447 | Bacteria | 539 |
| 427 | Ga0436361_0483849 | 3300039447 | Bacteria | 2524 |
| 428 | Ga0436361_1208495 | 3300039447 | Bacteria | 38358 |
| 429 | Ga0436363_0564814 | 3300039450 | Bacteria | 544 |
| 430 | Ga0436363_1259361 | 3300039450 | Bacteria | 719 |
| 431 | Ga0439441_026140 | 3300042001 | Bacteria | 1106 |
| 432 | Ga0439448_0000024 | 3300042005 | Bacteria | 24656 |
| 433 | Ga0439446_0103567 | 3300042156 | Bacteria | 902 |
| 434 | Ga0451577_0000181 | 3300042876 | Bacteria | 134503 |
| 435 | Ga0451577_0025715 | 3300042876 | Bacteria | 5340 |
| 436 | Ga0451577_0030853 | 3300042876 | Bacteria | 4840 |
| 437 | Ga0451577_0175893 | 3300042876 | Bacteria | 1929 |
| 438 | Ga0451577_0533724 | 3300042876 | Unclassified | 1065 |
| 439 | Ga0451577_1118145 | 3300042876 | Bacteria | 705 |
| 440 | Ga0453683_0144803 | 3300044673 | Bacteria | 1500 |
| 441 | Ga0453683_0269553 | 3300044673 | Unclassified | 1086 |
| 442 | Ga0453683_0901962 | 3300044673 | Bacteria | 584 |
| 443 | Ga0453683_1043029 | 3300044673 | Bacteria | 544 |
| 444 | Ga0453684_0000592 | 3300044712 | Bacteria | 134503 |
| 445 | Ga0453684_0020611 | 3300044712 | Bacteria | 9927 |
| 446 | Ga0453684_0044528 | 3300044712 | Bacteria | 5935 |
| 447 | Ga0453684_0045961 | 3300044712 | Bacteria | 5816 |
| 448 | Ga0453684_0135543 | 3300044712 | Bacteria | 2948 |
| 449 | Ga0453684_0187410 | 3300044712 | Unclassified | 2423 |
| 450 | Ga0453684_0626313 | 3300044712 | Bacteria | 1176 |
| 451 | Ga0451576_0001387 | 3300045051 | Bacteria | 41619 |
| 452 | Ga0451576_0006418 | 3300045051 | Bacteria | 14425 |
| 453 | Ga0451576_0026411 | 3300045051 | Bacteria | 6246 |
| 454 | Ga0451576_0078953 | 3300045051 | Unclassified | 3424 |
| 455 | Ga0451576_0344377 | 3300045051 | Bacteria | 1560 |
| 456 | Ga0451576_0390474 | 3300045051 | Bacteria | 1459 |
| 457 | Ga0451576_0656078 | 3300045051 | Bacteria | 1102 |
| 458 | Ga0451576_1012494 | 3300045051 | Bacteria | 871 |
| 459 | Ga0495627_015812 | 3300046453 | Bacteria | 2598 |
| 460 | Ga0495627_139589 | 3300046453 | Bacteria | 679 |
| 461 | Ga0495592_0121651 | 3300046454 | Bacteria | 1835 |
| 462 | Ga0495603_0008792 | 3300046455 | Bacteria | 6105 |
| 463 | Ga0495590_0094512 | 3300046457 | Bacteria | 1059 |
| 464 | Ga0495591_008252 | 3300046458 | Bacteria | 4290 |
| 465 | Ga0495629_0021221 | 3300046459 | Bacteria | 4635 |
| 466 | Ga0495650_0002488 | 3300046471 | Bacteria | 14818 |
| 467 | Ga0495650_0004830 | 3300046471 | Bacteria | 9024 |
| 468 | Ga0495580_0009565 | 3300046472 | Bacteria | 7615 |
| 469 | Ga0495580_0025415 | 3300046472 | Bacteria | 4328 |
| 470 | Ga0495580_0104971 | 3300046472 | Bacteria | 1963 |
| 471 | Ga0495582_0026272 | 3300046473 | Bacteria | 3191 |
| 472 | Ga0495605_0000002 | 3300046474 | Bacteria | 522417 |
| 473 | Ga0495605_0022400 | 3300046474 | Bacteria | 3336 |
| 474 | Ga0495605_0383140 | 3300046474 | Bacteria | 586 |
| 475 | Ga0495639_0004313 | 3300046475 | Bacteria | 6099 |
| 476 | Ga0495639_0037952 | 3300046475 | Bacteria | 2162 |
| 477 | Ga0495664_0363157 | 3300046477 | Bacteria | 871 |
| 478 | Ga0495664_0538212 | 3300046477 | Bacteria | 696 |
| 479 | Ga0495584_0039781 | 3300046491 | Bacteria | 2375 |
| 480 | Ga0495585_0004721 | 3300046492 | Bacteria | 8773 |
| 481 | Ga0495594_0009897 | 3300046499 | Bacteria | 4940 |
| 482 | Ga0495594_0052252 | 3300046499 | Bacteria | 2250 |
| 483 | Ga0495594_0091449 | 3300046499 | Bacteria | 1705 |
| 484 | Ga0495596_0012913 | 3300046500 | Bacteria | 3559 |
| 485 | Ga0495607_0087477 | 3300046501 | Bacteria | 1695 |
| 486 | Ga0495583_0000012 | 3300046506 | Bacteria | 324839 |
| 487 | Ga0495583_0001950 | 3300046506 | Bacteria | 19001 |
| 488 | Ga0495606_0001289 | 3300046507 | Bacteria | 34720 |
| 489 | Ga0495608_0014684 | 3300046511 | Bacteria | 5433 |
| 490 | Ga0495610_0029055 | 3300046512 | Bacteria | 2916 |
| 491 | Ga0495610_0047779 | 3300046512 | Bacteria | 2104 |
| 492 | Ga0495616_0047136 | 3300046513 | Bacteria | 2171 |
| 493 | Ga0495620_0000026 | 3300046515 | Bacteria | 124427 |
| 494 | Ga0495628_0011070 | 3300046516 | Bacteria | 7633 |
| 495 | Ga0495630_0129081 | 3300046517 | Bacteria | 1919 |
| 496 | Ga0495631_0025273 | 3300046518 | Bacteria | 2737 |
| 497 | Ga0495631_0029429 | 3300046518 | Bacteria | 2497 |
| 498 | Ga0495632_0012687 | 3300046519 | Bacteria | 4845 |
| 499 | Ga0495637_0000021 | 3300046520 | Bacteria | 179141 |
| 500 | Ga0495637_0034092 | 3300046520 | Bacteria | 2231 |
| 501 | Ga0495643_0025155 | 3300046522 | Bacteria | 3371 |
| 502 | Ga0495644_0002658 | 3300046523 | Bacteria | 7099 |
| 503 | Ga0495648_0026343 | 3300046524 | Bacteria | 3916 |
| 504 | Ga0495666_0012173 | 3300046526 | Bacteria | 4294 |
| 505 | Ga0495666_0066130 | 3300046526 | Bacteria | 1724 |
| 506 | Ga0495652_0043254 | 3300046529 | Bacteria | 3881 |
| 507 | Ga0495654_0000617 | 3300046530 | Bacteria | 28316 |
| 508 | Ga0495654_0138098 | 3300046530 | Bacteria | 1088 |
| 509 | Ga0495665_0016706 | 3300046531 | Bacteria | 3953 |
| 510 | Ga0495665_0028043 | 3300046531 | Bacteria | 3021 |
| 511 | Ga0495640_0017250 | 3300046533 | Bacteria | 5384 |
| 512 | Ga0495640_0022809 | 3300046533 | Bacteria | 4571 |
| 513 | Ga0495586_0013912 | 3300046535 | Bacteria | 4271 |
| 514 | Ga0495586_0033144 | 3300046535 | Bacteria | 2771 |
| 515 | Ga0495586_0034781 | 3300046535 | Bacteria | 2707 |
| 516 | Ga0495586_0042485 | 3300046535 | Bacteria | 2448 |
| 517 | Ga0495609_0000008 | 3300046538 | Bacteria | 383025 |
| 518 | Ga0495609_0000920 | 3300046538 | Bacteria | 21325 |
| 519 | Ga0495621_0408362 | 3300046539 | Bacteria | 577 |
| 520 | Ga0495597_0002842 | 3300046542 | Bacteria | 10597 |
| 521 | Ga0495597_0219643 | 3300046542 | Bacteria | 755 |
| 522 | Ga0495622_0002553 | 3300046557 | Bacteria | 8799 |
| 523 | Ga0495633_0000216 | 3300046558 | Bacteria | 72025 |
| 524 | Ga0495667_0016919 | 3300046559 | Bacteria | 4924 |
| 525 | Ga0495668_0120603 | 3300046616 | Bacteria | 1434 |
| 526 | Ga0495634_0011889 | 3300046642 | Bacteria | 6324 |
| 527 | Ga0495611_0000175 | 3300046648 | Bacteria | 46491 |
| 528 | Ga0495611_0009399 | 3300046648 | Bacteria | 4132 |
| 529 | Ga0495625_0000028 | 3300046660 | Bacteria | 256946 |
| 530 | Ga0495635_0057937 | 3300046663 | Bacteria | 2665 |
| 531 | Ga0495661_0000096 | 3300046665 | Bacteria | 109096 |
| 532 | Ga0495661_0003182 | 3300046665 | Bacteria | 12277 |
| 533 | Ga0495657_0062429 | 3300046675 | Bacteria | 2462 |
| 534 | Ga0495599_0015790 | 3300046678 | Bacteria | 4687 |
| 535 | Ga0495647_0189277 | 3300046681 | Bacteria | 898 |
| 536 | Ga0495658_0034873 | 3300046683 | Bacteria | 2763 |
| 537 | Ga0495613_0109325 | 3300046689 | Bacteria | 1993 |
| 538 | Ga0495624_0229024 | 3300046690 | Bacteria | 1126 |
| 539 | Ga0495670_0032173 | 3300046691 | Bacteria | 2608 |
| 540 | Ga0495670_0033868 | 3300046691 | Bacteria | 2542 |
| 541 | Ga0495671_0024052 | 3300046692 | Bacteria | 3177 |
| 542 | Ga0495671_0039485 | 3300046692 | Bacteria | 2382 |
| 543 | Ga0495649_0017948 | 3300046694 | Bacteria | 3987 |
| 544 | Ga0495589_0000492 | 3300046794 | Bacteria | 28250 |
| 545 | Ga0495600_0859454 | 3300046809 | Bacteria | 537 |
| 546 | Ga0495660_0006771 | 3300046810 | Bacteria | 6757 |
| 547 | Ga0495581_0014771 | 3300047315 | Bacteria | 4530 |
| 548 | Ga0495604_0104774 | 3300047317 | Bacteria | 2071 |
| 549 | Ga0495674_0044843 | 3300047319 | Bacteria | 3929 |
| 550 | Ga0495672_0051058 | 3300047320 | Bacteria | 2437 |
| 551 | Ga0495676_0000006 | 3300047321 | Bacteria | 280508 |
| 552 | Ga0495676_0006782 | 3300047321 | Bacteria | 10527 |
| 553 | Ga0495680_0021285 | 3300047322 | Bacteria | 5431 |
| 554 | Ga0495680_0405954 | 3300047322 | Bacteria | 940 |
| 555 | Ga0495683_0000169 | 3300047323 | Bacteria | 63606 |
| 556 | Ga0495683_0014816 | 3300047323 | Bacteria | 4060 |
| 557 | Ga0495675_0202442 | 3300047444 | Bacteria | 1208 |
| 558 | Ga0495679_000200 | 3300047446 | Bacteria | 52539 |
| 559 | Ga0495679_001247 | 3300047446 | Bacteria | 15082 |
| 560 | Ga0495673_0014435 | 3300047469 | Bacteria | 4108 |
| 561 | Ga0495681_0000789 | 3300047470 | Bacteria | 24391 |
| 562 | Ga0495681_0006948 | 3300047470 | Bacteria | 7334 |
| 563 | Ga0495684_0011742 | 3300047471 | Bacteria | 6761 |
| 564 | Ga0495686_0003039 | 3300047472 | Bacteria | 14874 |
| 565 | Ga0495686_0173329 | 3300047472 | Bacteria | 1253 |
| 566 | Ga0495593_0177472 | 3300047673 | Bacteria | 1073 |
| 567 | Ga0495614_0100599 | 3300048089 | Bacteria | 1263 |
| 568 | Ga0495626_0000019 | 3300048091 | Bacteria | 225494 |
| 569 | Ga0496100_0024814 | 3300048903 | Bacteria | 3662 |
| 570 | Ga0496101_0084496 | 3300048904 | Bacteria | 2351 |
| 571 | Ga0496102_0666558 | 3300048905 | Bacteria | 963 |
| 572 | Ga0496106_0360215 | 3300048909 | Bacteria | 1168 |
| 573 | Ga0496114_0124556 | 3300048917 | Bacteria | 2220 |
| 574 | Ga0496115_0004843 | 3300048918 | Bacteria | 9770 |
| 575 | Ga0496116_0000550 | 3300048919 | Bacteria | 50193 |
| 576 | Ga0496122_0025334 | 3300048925 | Bacteria | 5154 |
| 577 | Ga0496123_0014205 | 3300048926 | Bacteria | 6619 |
| 578 | Ga0496126_0551945 | 3300048929 | Bacteria | 914 |
| 579 | Ga0495678_000242 | 3300049459 | Bacteria | 61395 |
| 580 | Ga0501036_0494216 | 3300049572 | Bacteria | 1018 |
| 581 | Ga0501036_1230823 | 3300049572 | Bacteria | 610 |
| 582 | Ga0501040_0012787 | 3300049576 | Bacteria | 5510 |
| 583 | Ga0501040_0245516 | 3300049576 | Bacteria | 1277 |
| 584 | Ga0501040_0458254 | 3300049576 | Bacteria | 918 |
| 585 | Ga0501048_0221294 | 3300049582 | Bacteria | 1343 |
| 586 | Ga0501067_0529663 | 3300049583 | Bacteria | 659 |
| 587 | Ga0501071_0084511 | 3300049587 | Bacteria | 2326 |
| 588 | Ga0501071_0371542 | 3300049587 | Bacteria | 1090 |
| 589 | Ga0501073_0011837 | 3300049589 | Bacteria | 6368 |
| 590 | Ga0501074_0175412 | 3300049590 | Bacteria | 1529 |
| 591 | Ga0501074_0801133 | 3300049590 | Bacteria | 664 |
| 592 | Ga0501075_0003860 | 3300049591 | Bacteria | 10095 |
| 593 | Ga0501075_0113568 | 3300049591 | Bacteria | 2060 |
| 594 | Ga0501076_0803540 | 3300049592 | Bacteria | 776 |
| 595 | Ga0501202_226393 | 3300049652 | Bacteria | 519 |
| 596 | Ga0501079_0033042 | 3300049741 | Bacteria | 3979 |
| 597 | Ga0501080_0119439 | 3300049742 | Bacteria | 2444 |
| 598 | Ga0501080_0589882 | 3300049742 | Bacteria | 987 |
| 599 | Ga0501045_0148668 | 3300049824 | Bacteria | 1743 |
| 600 | nmdc:mga05p37_20293_c1 | 3300050507 | Bacteria | 8041 |
| 601 | nmdc:mga05p37_344_c1 | 3300050507 | Bacteria | 49898 |
| 602 | nmdc:mga05p37_51069_c1 | 3300050507 | Bacteria | 5086 |
| 603 | nmdc:mga05p37_66679_c1 | 3300050507 | Bacteria | 4427 |
| 604 | nmdc:mga05p37_81432_c1 | 3300050507 | Unclassified | 3988 |
| 605 | nmdc:mga05p37_847720_c1 | 3300050507 | Bacteria | 993 |
| 606 | nmdc:mga05p37_972481_c1 | 3300050507 | Bacteria | 906 |
| 607 | nmdc:mga09592_144945_c1 | 3300050508 | Bacteria | 2048 |
| 608 | nmdc:mga09592_236889_c1 | 3300050508 | Unclassified | 1581 |
| 609 | nmdc:mga09592_3484_c1 | 3300050508 | Bacteria | 12706 |
| 610 | nmdc:mga09592_407852_c1 | 3300050508 | Bacteria | 1174 |
| 611 | nmdc:mga09592_7945_c1 | 3300050508 | Bacteria | 8619 |
| 612 | nmdc:mga0qj67_11724_c1 | 3300050509 | Bacteria | 6578 |
| 613 | nmdc:mga06r32_125963_c1 | 3300050510 | Bacteria | 2530 |
| 614 | nmdc:mga06r32_1408895_c1 | 3300050510 | Bacteria | 639 |
| 615 | nmdc:mga06r32_290142_c1 | 3300050510 | Bacteria | 1623 |
| 616 | nmdc:mga06r32_31908_c1 | 3300050510 | Unclassified | 4951 |
| 617 | nmdc:mga08y16_11098_c1 | 3300050511 | Bacteria | 9459 |
| 618 | nmdc:mga08y16_2094426_c1 | 3300050511 | Bacteria | 514 |
| 619 | nmdc:mga08y16_4553_c1 | 3300050511 | Bacteria | 14453 |
| 620 | nmdc:mga08y16_7973_c1 | 3300050511 | Bacteria | 11084 |
| 621 | nmdc:mga0n895_370_c1 | 3300050512 | Bacteria | 30361 |
| 622 | nmdc:mga0n895_413119_c1 | 3300050512 | Bacteria | 1364 |
| 623 | nmdc:mga0n895_6296_c1 | 3300050512 | Bacteria | 10064 |
| 624 | nmdc:mga0n895_991301_c1 | 3300050512 | Bacteria | 822 |
| 625 | nmdc:mga0rr50_11142_c1 | 3300050513 | Bacteria | 5738 |
| 626 | nmdc:mga0rr50_463_c1 | 3300050513 | Bacteria | 21610 |
| 627 | nmdc:mga08x19_4276_c1 | 3300050514 | Bacteria | 8465 |
| 628 | nmdc:mga0a205_1307737_c1 | 3300050515 | Bacteria | 573 |
| 629 | nmdc:mga0a205_134_c1 | 3300050515 | Bacteria | 46209 |
| 630 | nmdc:mga0a205_3271_c1 | 3300050515 | Bacteria | 14414 |
| 631 | nmdc:mga0a205_465582_c1 | 3300050515 | Bacteria | 1123 |
| 632 | Ga0495601_0014585 | 3300053077 | Bacteria | 4736 |
| 633 | Ga0495619_0055928 | 3300053085 | Bacteria | 2615 |
| 634 | Ga0495619_0244703 | 3300053085 | Bacteria | 1243 |
| 635 | Ga0500618_114266 | 3300053125 | Bacteria | 610 |
| 636 | Ga0500586_131593 | 3300053145 | Bacteria | 865 |
| 637 | Ga0501084_0017223 | 3300054114 | Bacteria | 6002 |
| 638 | Ga0587075_010098 | 3300059644 | Bacteria | 1242 |
| 639 | Ga0501082_0189052 | 3300060353 | Bacteria | 1792 |
| 640 | Ga0501082_0373633 | 3300060353 | Bacteria | 1244 |
| 641 | Ga0530510_0373686 | 3300061734 | Bacteria | 1072 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036401 | Ga0373937_0209461 | Ga0373937_0209461_380_802 | 136 |
| 2 | 3300025921 | Ga0207652_11205550 | Ga0207652_112055502 | 148 |
| 3 | 3300025936 | Ga0207670_10021108 | Ga0207670_100211082 | 148 |
| 4 | 3300025949 | Ga0207667_11127318 | Ga0207667_111273181 | 148 |
| 5 | 3300026095 | Ga0207676_10411431 | Ga0207676_104114312 | 148 |
| 6 | 3300050511 | nmdc:mga08y16_11098_c1 | nmdc:mga08y16_11098_c1_1379_1834 | 148 |
| 7 | 3300050512 | nmdc:mga0n895_6296_c1 | nmdc:mga0n895_6296_c1_1170_1625 | 148 |
| 8 | 3300050513 | nmdc:mga0rr50_11142_c1 | nmdc:mga0rr50_11142_c1_1820_2275 | 148 |
| 9 | 3300050515 | nmdc:mga0a205_3271_c1 | nmdc:mga0a205_3271_c1_8440_8895 | 148 |
| 10 | 3300025905 | Ga0207685_10257171 | Ga0207685_102571712 | 149 |
| 11 | 3300042876 | Ga0451577_0000181 | Ga0451577_0000181_40185_40649 | 150 |
| 12 | 3300044712 | Ga0453684_0000592 | Ga0453684_0000592_93855_94319 | 150 |
| 13 | 3300002067 | JGI24735J21928_10049085 | JGI24735J21928_100490852 | 151 |
| 14 | 3300002076 | JGI24749J21850_1025208 | JGI24749J21850_10252082 | 151 |
| 15 | 3300004798 | Ga0058859_11381433 | Ga0058859_113814331 | 151 |
| 16 | 3300005327 | Ga0070658_10012627 | Ga0070658_100126275 | 151 |
| 17 | 3300005328 | Ga0070676_10039164 | Ga0070676_100391642 | 151 |
| 18 | 3300005330 | Ga0070690_100000075 | Ga0070690_10000007514 | 151 |
| 19 | 3300005330 | Ga0070690_100090386 | Ga0070690_1000903862 | 151 |
| 20 | 3300005334 | Ga0068869_100000841 | Ga0068869_1000008419 | 151 |
| 21 | 3300005336 | Ga0070680_100001183 | Ga0070680_10000118310 | 151 |
| 22 | 3300005337 | Ga0070682_100034498 | Ga0070682_1000344982 | 151 |
| 23 | 3300005338 | Ga0068868_100000329 | Ga0068868_1000003298 | 151 |
| 24 | 3300005339 | Ga0070660_100001672 | Ga0070660_1000016728 | 151 |
| 25 | 3300005340 | Ga0070689_100000481 | Ga0070689_10000048110 | 151 |
| 26 | 3300005341 | Ga0070691_10000399 | Ga0070691_100003996 | 151 |
| 27 | 3300005343 | Ga0070687_100000014 | Ga0070687_10000001422 | 151 |
| 28 | 3300005345 | Ga0070692_10000041 | Ga0070692_1000004114 | 151 |
| 29 | 3300005354 | Ga0070675_100815892 | Ga0070675_1008158922 | 151 |
| 30 | 3300005365 | Ga0070688_100048098 | Ga0070688_1000480982 | 151 |
| 31 | 3300005438 | Ga0070701_10000641 | Ga0070701_100006419 | 151 |
| 32 | 3300005440 | Ga0070705_100008701 | Ga0070705_1000087014 | 151 |
| 33 | 3300005441 | Ga0070700_100001345 | Ga0070700_1000013458 | 151 |
| 34 | 3300005444 | Ga0070694_100000099 | Ga0070694_1000000999 | 151 |
| 35 | 3300005458 | Ga0070681_10027710 | Ga0070681_100277105 | 151 |
| 36 | 3300005459 | Ga0068867_100000174 | Ga0068867_10000017432 | 151 |
| 37 | 3300005530 | Ga0070679_100031801 | Ga0070679_1000318015 | 151 |
| 38 | 3300005536 | Ga0070697_100432368 | Ga0070697_1004323682 | 151 |
| 39 | 3300005539 | Ga0068853_100057696 | Ga0068853_1000576963 | 151 |
| 40 | 3300005544 | Ga0070686_100000134 | Ga0070686_10000013425 | 151 |
| 41 | 3300005545 | Ga0070695_100000018 | Ga0070695_10000001832 | 151 |
| 42 | 3300005546 | Ga0070696_100027846 | Ga0070696_1000278462 | 151 |
| 43 | 3300005547 | Ga0070693_100000021 | Ga0070693_10000002125 | 151 |
| 44 | 3300005549 | Ga0070704_100000043 | Ga0070704_10000004316 | 151 |
| 45 | 3300005563 | Ga0068855_100001327 | Ga0068855_10000132722 | 151 |
| 46 | 3300005578 | Ga0068854_100002225 | Ga0068854_1000022255 | 151 |
| 47 | 3300005614 | Ga0068856_100041413 | Ga0068856_1000414132 | 151 |
| 48 | 3300005614 | Ga0068856_100263037 | Ga0068856_1002630373 | 151 |
| 49 | 3300005614 | Ga0068856_100606005 | Ga0068856_1006060052 | 151 |
| 50 | 3300005615 | Ga0070702_100000007 | Ga0070702_10000000729 | 151 |
| 51 | 3300005616 | Ga0068852_100042244 | Ga0068852_1000422444 | 151 |
| 52 | 3300005617 | Ga0068859_100001320 | Ga0068859_10000132024 | 151 |
| 53 | 3300005718 | Ga0068866_10000561 | Ga0068866_100005619 | 151 |
| 54 | 3300005719 | Ga0068861_100000617 | Ga0068861_10000061719 | 151 |
| 55 | 3300005719 | Ga0068861_102037473 | Ga0068861_1020374731 | 151 |
| 56 | 3300005840 | Ga0068870_10004187 | Ga0068870_100041874 | 151 |
| 57 | 3300005841 | Ga0068863_100254518 | Ga0068863_1002545183 | 151 |
| 58 | 3300005841 | Ga0068863_100435927 | Ga0068863_1004359272 | 151 |
| 59 | 3300005842 | Ga0068858_100000334 | Ga0068858_10000033422 | 151 |
| 60 | 3300005843 | Ga0068860_100001410 | Ga0068860_10000141016 | 151 |
| 61 | 3300005843 | Ga0068860_100125796 | Ga0068860_1001257963 | 151 |
| 62 | 3300005844 | Ga0068862_100000688 | Ga0068862_10000068824 | 151 |
| 63 | 3300006237 | Ga0097621_100000593 | Ga0097621_10000059316 | 151 |
| 64 | 3300006358 | Ga0068871_100000157 | Ga0068871_10000015733 | 151 |
| 65 | 3300006844 | Ga0075428_100001267 | Ga0075428_1000012676 | 151 |
| 66 | 3300006852 | Ga0075433_10001495 | Ga0075433_1000149514 | 151 |
| 67 | 3300006871 | Ga0075434_100000989 | Ga0075434_1000009896 | 151 |
| 68 | 3300006880 | Ga0075429_100000046 | Ga0075429_10000004633 | 151 |
| 69 | 3300006881 | Ga0068865_100000296 | Ga0068865_10000029618 | 151 |
| 70 | 3300006914 | Ga0075436_100000190 | Ga0075436_10000019025 | 151 |
| 71 | 3300006931 | Ga0097620_100001320 | Ga0097620_10000132024 | 151 |
| 72 | 3300007076 | Ga0075435_100000058 | Ga0075435_10000005820 | 151 |
| 73 | 3300007076 | Ga0075435_100346660 | Ga0075435_1003466602 | 151 |
| 74 | 3300009093 | Ga0105240_10004592 | Ga0105240_1000459211 | 151 |
| 75 | 3300009093 | Ga0105240_10779433 | Ga0105240_107794332 | 151 |
| 76 | 3300009094 | Ga0111539_11154220 | Ga0111539_111542202 | 151 |
| 77 | 3300009094 | Ga0111539_11194109 | Ga0111539_111941092 | 151 |
| 78 | 3300009098 | Ga0105245_10000405 | Ga0105245_100004057 | 151 |
| 79 | 3300009147 | Ga0114129_10000177 | Ga0114129_1000017749 | 151 |
| 80 | 3300009148 | Ga0105243_10000466 | Ga0105243_100004669 | 151 |
| 81 | 3300009174 | Ga0105241_10132627 | Ga0105241_101326272 | 151 |
| 82 | 3300009176 | Ga0105242_10000191 | Ga0105242_1000019124 | 151 |
| 83 | 3300009177 | Ga0105248_10131250 | Ga0105248_101312503 | 151 |
| 84 | 3300009545 | Ga0105237_10023256 | Ga0105237_100232565 | 151 |
| 85 | 3300009545 | Ga0105237_10466983 | Ga0105237_104669832 | 151 |
| 86 | 3300009553 | Ga0105249_10000555 | Ga0105249_1000055523 | 151 |
| 87 | 3300010375 | Ga0105239_10082228 | Ga0105239_100822282 | 151 |
| 88 | 3300011119 | Ga0105246_10081161 | Ga0105246_100811612 | 151 |
| 89 | 3300013100 | Ga0157373_10021893 | Ga0157373_100218935 | 151 |
| 90 | 3300013102 | Ga0157371_10113482 | Ga0157371_101134823 | 151 |
| 91 | 3300013104 | Ga0157370_10004911 | Ga0157370_100049116 | 151 |
| 92 | 3300013105 | Ga0157369_10003711 | Ga0157369_100037115 | 151 |
| 93 | 3300013296 | Ga0157374_10000221 | Ga0157374_100002218 | 151 |
| 94 | 3300013296 | Ga0157374_10651266 | Ga0157374_106512662 | 151 |
| 95 | 3300013297 | Ga0157378_10000196 | Ga0157378_1000019630 | 151 |
| 96 | 3300013306 | Ga0163162_10057810 | Ga0163162_100578104 | 151 |
| 97 | 3300013307 | Ga0157372_10016041 | Ga0157372_100160415 | 151 |
| 98 | 3300013307 | Ga0157372_10412772 | Ga0157372_104127722 | 151 |
| 99 | 3300013307 | Ga0157372_11425375 | Ga0157372_114253752 | 151 |
| 100 | 3300014326 | Ga0157380_10028322 | Ga0157380_100283222 | 151 |
| 101 | 3300014745 | Ga0157377_10167411 | Ga0157377_101674112 | 151 |
| 102 | 3300014968 | Ga0157379_10045543 | Ga0157379_100455432 | 151 |
| 103 | 3300014969 | Ga0157376_10000314 | Ga0157376_100003143 | 151 |
| 104 | 3300015261 | Ga0182006_1129887 | Ga0182006_11298872 | 151 |
| 105 | 3300025256 | Ga0209759_1019331 | Ga0209759_10193312 | 151 |
| 106 | 3300025899 | Ga0207642_10000935 | Ga0207642_100009353 | 151 |
| 107 | 3300025903 | Ga0207680_10089947 | Ga0207680_100899472 | 151 |
| 108 | 3300025904 | Ga0207647_10025600 | Ga0207647_100256002 | 151 |
| 109 | 3300025908 | Ga0207643_10030147 | Ga0207643_100301472 | 151 |
| 110 | 3300025911 | Ga0207654_10091213 | Ga0207654_100912132 | 151 |
| 111 | 3300025912 | Ga0207707_10117754 | Ga0207707_101177542 | 151 |
| 112 | 3300025913 | Ga0207695_10071377 | Ga0207695_100713772 | 151 |
| 113 | 3300025914 | Ga0207671_10090199 | Ga0207671_100901992 | 151 |
| 114 | 3300025914 | Ga0207671_10311526 | Ga0207671_103115262 | 151 |
| 115 | 3300025917 | Ga0207660_10000284 | Ga0207660_1000028419 | 151 |
| 116 | 3300025918 | Ga0207662_10000063 | Ga0207662_1000006320 | 151 |
| 117 | 3300025919 | Ga0207657_10018440 | Ga0207657_100184405 | 151 |
| 118 | 3300025921 | Ga0207652_10016598 | Ga0207652_100165982 | 151 |
| 119 | 3300025923 | Ga0207681_10361666 | Ga0207681_103616662 | 151 |
| 120 | 3300025926 | Ga0207659_10021091 | Ga0207659_100210915 | 151 |
| 121 | 3300025927 | Ga0207687_10000976 | Ga0207687_1000097616 | 151 |
| 122 | 3300025935 | Ga0207709_10002870 | Ga0207709_1000287012 | 151 |
| 123 | 3300025936 | Ga0207670_10001140 | Ga0207670_1000114011 | 151 |
| 124 | 3300025938 | Ga0207704_10001148 | Ga0207704_100011489 | 151 |
| 125 | 3300025939 | Ga0207665_11030817 | Ga0207665_110308172 | 151 |
| 126 | 3300025940 | Ga0207691_10292695 | Ga0207691_102926952 | 151 |
| 127 | 3300025941 | Ga0207711_10174590 | Ga0207711_101745902 | 151 |
| 128 | 3300025941 | Ga0207711_10900137 | Ga0207711_109001371 | 151 |
| 129 | 3300025942 | Ga0207689_10000214 | Ga0207689_1000021423 | 151 |
| 130 | 3300025949 | Ga0207667_10027649 | Ga0207667_100276494 | 151 |
| 131 | 3300025949 | Ga0207667_10031255 | Ga0207667_100312555 | 151 |
| 132 | 3300025961 | Ga0207712_10191520 | Ga0207712_101915202 | 151 |
| 133 | 3300025981 | Ga0207640_10000972 | Ga0207640_100009729 | 151 |
| 134 | 3300026023 | Ga0207677_10000714 | Ga0207677_1000071416 | 151 |
| 135 | 3300026035 | Ga0207703_10012996 | Ga0207703_100129964 | 151 |
| 136 | 3300026041 | Ga0207639_10012477 | Ga0207639_100124774 | 151 |
| 137 | 3300026075 | Ga0207708_10000117 | Ga0207708_1000011732 | 151 |
| 138 | 3300026078 | Ga0207702_10028320 | Ga0207702_100283206 | 151 |
| 139 | 3300026078 | Ga0207702_10103138 | Ga0207702_101031382 | 151 |
| 140 | 3300026078 | Ga0207702_10288441 | Ga0207702_102884411 | 151 |
| 141 | 3300026078 | Ga0207702_10765074 | Ga0207702_107650742 | 151 |
| 142 | 3300026088 | Ga0207641_10234745 | Ga0207641_102347452 | 151 |
| 143 | 3300026088 | Ga0207641_11489522 | Ga0207641_114895222 | 151 |
| 144 | 3300026089 | Ga0207648_10000293 | Ga0207648_1000029323 | 151 |
| 145 | 3300026116 | Ga0207674_10118964 | Ga0207674_101189642 | 151 |
| 146 | 3300026118 | Ga0207675_100000218 | Ga0207675_10000021827 | 151 |
| 147 | 3300026118 | Ga0207675_100476898 | Ga0207675_1004768982 | 151 |
| 148 | 3300026142 | Ga0207698_10042850 | Ga0207698_100428503 | 151 |
| 149 | 3300027907 | Ga0207428_10000517 | Ga0207428_100005179 | 151 |
| 150 | 3300027907 | Ga0207428_10027604 | Ga0207428_100276042 | 151 |
| 151 | 3300028380 | Ga0268265_10005718 | Ga0268265_100057186 | 151 |
| 152 | 3300028381 | Ga0268264_10000609 | Ga0268264_1000060926 | 151 |
| 153 | 3300028381 | Ga0268264_10084407 | Ga0268264_100844073 | 151 |
| 154 | 3300031239 | Ga0265328_10005792 | Ga0265328_100057926 | 151 |
| 155 | 3300031250 | Ga0265331_10002817 | Ga0265331_100028173 | 151 |
| 156 | 3300031251 | Ga0265327_10000043 | Ga0265327_10000043177 | 151 |
| 157 | 3300034816 | Ga0373930_0022050 | Ga0373930_0022050_729_1184 | 151 |
| 158 | 3300034820 | Ga0373959_0045623 | Ga0373959_0045623_49_504 | 151 |
| 159 | 3300034957 | Ga0373938_0045456 | Ga0373938_0045456_465_920 | 151 |
| 160 | 3300035084 | Ga0373928_0036099 | Ga0373928_0036099_636_1091 | 151 |
| 161 | 3300035088 | Ga0373940_0003758 | Ga0373940_0003758_1832_2287 | 151 |
| 162 | 3300035089 | Ga0373944_0232308 | Ga0373944_0232308_21_476 | 151 |
| 163 | 3300035091 | Ga0373951_0008041 | Ga0373951_0008041_1783_2238 | 151 |
| 164 | 3300035092 | Ga0373952_0012870 | Ga0373952_0012870_435_890 | 151 |
| 165 | 3300035111 | Ga0373923_0078772 | Ga0373923_0078772_652_1107 | 151 |
| 166 | 3300035111 | Ga0373923_0276048 | Ga0373923_0276048_145_600 | 151 |
| 167 | 3300035112 | Ga0373932_0001050 | Ga0373932_0001050_5209_5664 | 151 |
| 168 | 3300035113 | Ga0373936_0032465 | Ga0373936_0032465_624_1079 | 151 |
| 169 | 3300035113 | Ga0373936_0244925 | Ga0373936_0244925_144_599 | 151 |
| 170 | 3300035114 | Ga0373939_0002059 | Ga0373939_0002059_1930_2385 | 151 |
| 171 | 3300035115 | Ga0373941_0024743 | Ga0373941_0024743_1130_1585 | 151 |
| 172 | 3300035115 | Ga0373941_0277275 | Ga0373941_0277275_43_498 | 151 |
| 173 | 3300035116 | Ga0373945_0045063 | Ga0373945_0045063_1120_1575 | 151 |
| 174 | 3300035118 | Ga0373954_0399335 | Ga0373954_0399335_18_473 | 151 |
| 175 | 3300035170 | Ga0373943_0002249 | Ga0373943_0002249_6062_6517 | 151 |
| 176 | 3300035170 | Ga0373943_0285902 | Ga0373943_0285902_439_894 | 151 |
| 177 | 3300035171 | Ga0373946_0002900 | Ga0373946_0002900_4602_5057 | 151 |
| 178 | 3300035207 | Ga0373942_0131079 | Ga0373942_0131079_203_658 | 151 |
| 179 | 3300035242 | Ga0373962_0120752 | Ga0373962_0120752_361_816 | 151 |
| 180 | 3300035410 | Ga0373924_0420712 | Ga0373924_0420712_116_571 | 151 |
| 181 | 3300035691 | Ga0373931_0001310 | Ga0373931_0001310_7787_8242 | 151 |
| 182 | 3300035691 | Ga0373931_0001708 | Ga0373931_0001708_4534_4989 | 151 |
| 183 | 3300035692 | Ga0373935_0002524 | Ga0373935_0002524_2961_3416 | 151 |
| 184 | 3300035692 | Ga0373935_0446814 | Ga0373935_0446814_455_910 | 151 |
| 185 | 3300035695 | Ga0373927_0010809 | Ga0373927_0010809_2319_2774 | 151 |
| 186 | 3300035695 | Ga0373927_0019500 | Ga0373927_0019500_3496_3951 | 151 |
| 187 | 3300035725 | Ga0373947_0009586 | Ga0373947_0009586_949_1404 | 151 |
| 188 | 3300035725 | Ga0373947_0589389 | Ga0373947_0589389_160_615 | 151 |
| 189 | 3300036401 | Ga0373937_0225552 | Ga0373937_0225552_1190_1645 | 151 |
| 190 | 3300037068 | Ga0373925_0010575 | Ga0373925_0010575_2084_2539 | 151 |
| 191 | 3300037068 | Ga0373925_0029085 | Ga0373925_0029085_893_1348 | 151 |
| 192 | 3300037418 | Ga0395900_0206367 | Ga0395900_0206367_1094_1549 | 151 |
| 193 | 3300038443 | Ga0395901_0311919 | Ga0395901_0311919_504_959 | 151 |
| 194 | 3300042001 | Ga0439441_026140 | Ga0439441_026140_389_844 | 151 |
| 195 | 3300042005 | Ga0439448_0000024 | Ga0439448_0000024_15601_16056 | 151 |
| 196 | 3300042876 | Ga0451577_0175893 | Ga0451577_0175893_742_1197 | 151 |
| 197 | 3300045051 | Ga0451576_0001387 | Ga0451576_0001387_39501_39956 | 151 |
| 198 | 3300045051 | Ga0451576_0006418 | Ga0451576_0006418_11768_12268 | 151 |
| 199 | 3300045051 | Ga0451576_0656078 | Ga0451576_0656078_588_1043 | 151 |
| 200 | 3300046455 | Ga0495603_0008792 | Ga0495603_0008792_2274_2729 | 151 |
| 201 | 3300046472 | Ga0495580_0009565 | Ga0495580_0009565_1142_1597 | 151 |
| 202 | 3300046475 | Ga0495639_0037952 | Ga0495639_0037952_1353_1808 | 151 |
| 203 | 3300046499 | Ga0495594_0052252 | Ga0495594_0052252_1662_2117 | 151 |
| 204 | 3300046526 | Ga0495666_0066130 | Ga0495666_0066130_251_706 | 151 |
| 205 | 3300046531 | Ga0495665_0016706 | Ga0495665_0016706_298_753 | 151 |
| 206 | 3300046535 | Ga0495586_0034781 | Ga0495586_0034781_1884_2339 | 151 |
| 207 | 3300048905 | Ga0496102_0666558 | Ga0496102_0666558_19_474 | 151 |
| 208 | 3300048909 | Ga0496106_0360215 | Ga0496106_0360215_259_714 | 151 |
| 209 | 3300050507 | nmdc:mga05p37_344_c1 | nmdc:mga05p37_344_c1_16466_16921 | 151 |
| 210 | 3300050508 | nmdc:mga09592_144945_c1 | nmdc:mga09592_144945_c1_121_576 | 151 |
| 211 | 3300050511 | nmdc:mga08y16_2094426_c1 | nmdc:mga08y16_2094426_c1_37_492 | 151 |
| 212 | 3300050511 | nmdc:mga08y16_7973_c1 | nmdc:mga08y16_7973_c1_8583_9038 | 151 |
| 213 | 3300050512 | nmdc:mga0n895_991301_c1 | nmdc:mga0n895_991301_c1_330_785 | 151 |
| 214 | 3300005354 | Ga0070675_100565877 | Ga0070675_1005658771 | 152 |
| 215 | 3300005436 | Ga0070713_100001485 | Ga0070713_1000014851 | 152 |
| 216 | 3300005440 | Ga0070705_100596163 | Ga0070705_1005961631 | 152 |
| 217 | 3300014326 | Ga0157380_10030394 | Ga0157380_100303942 | 152 |
| 218 | 3300014326 | Ga0157380_10198695 | Ga0157380_101986951 | 152 |
| 219 | 3300025928 | Ga0207700_10028783 | Ga0207700_100287832 | 152 |
| 220 | 3300033179 | Ga0307507_10088742 | Ga0307507_100887422 | 152 |
| 221 | 3300033180 | Ga0307510_10059359 | Ga0307510_100593592 | 152 |
| 222 | 3300046453 | Ga0495627_015812 | Ga0495627_015812_830_1294 | 152 |
| 223 | 3300046453 | Ga0495627_139589 | Ga0495627_139589_139_603 | 152 |
| 224 | 3300046457 | Ga0495590_0094512 | Ga0495590_0094512_29_493 | 152 |
| 225 | 3300046458 | Ga0495591_008252 | Ga0495591_008252_321_785 | 152 |
| 226 | 3300046471 | Ga0495650_0002488 | Ga0495650_0002488_6046_6510 | 152 |
| 227 | 3300046471 | Ga0495650_0004830 | Ga0495650_0004830_4515_4979 | 152 |
| 228 | 3300046474 | Ga0495605_0000002 | Ga0495605_0000002_388725_389189 | 152 |
| 229 | 3300046474 | Ga0495605_0022400 | Ga0495605_0022400_18_482 | 152 |
| 230 | 3300046474 | Ga0495605_0383140 | Ga0495605_0383140_37_501 | 152 |
| 231 | 3300046491 | Ga0495584_0039781 | Ga0495584_0039781_1420_1884 | 152 |
| 232 | 3300046492 | Ga0495585_0004721 | Ga0495585_0004721_7497_7961 | 152 |
| 233 | 3300046499 | Ga0495594_0009897 | Ga0495594_0009897_2279_2743 | 152 |
| 234 | 3300046500 | Ga0495596_0012913 | Ga0495596_0012913_943_1407 | 152 |
| 235 | 3300046501 | Ga0495607_0087477 | Ga0495607_0087477_609_1073 | 152 |
| 236 | 3300046506 | Ga0495583_0000012 | Ga0495583_0000012_32950_33414 | 152 |
| 237 | 3300046506 | Ga0495583_0001950 | Ga0495583_0001950_10403_10867 | 152 |
| 238 | 3300046507 | Ga0495606_0001289 | Ga0495606_0001289_22701_23165 | 152 |
| 239 | 3300046512 | Ga0495610_0029055 | Ga0495610_0029055_1562_2026 | 152 |
| 240 | 3300046512 | Ga0495610_0047779 | Ga0495610_0047779_1486_1950 | 152 |
| 241 | 3300046513 | Ga0495616_0047136 | Ga0495616_0047136_948_1412 | 152 |
| 242 | 3300046515 | Ga0495620_0000026 | Ga0495620_0000026_33191_33655 | 152 |
| 243 | 3300046518 | Ga0495631_0025273 | Ga0495631_0025273_1032_1496 | 152 |
| 244 | 3300046518 | Ga0495631_0029429 | Ga0495631_0029429_1071_1535 | 152 |
| 245 | 3300046519 | Ga0495632_0012687 | Ga0495632_0012687_4169_4633 | 152 |
| 246 | 3300046520 | Ga0495637_0000021 | Ga0495637_0000021_167232_167696 | 152 |
| 247 | 3300046520 | Ga0495637_0034092 | Ga0495637_0034092_253_717 | 152 |
| 248 | 3300046522 | Ga0495643_0025155 | Ga0495643_0025155_1744_2208 | 152 |
| 249 | 3300046523 | Ga0495644_0002658 | Ga0495644_0002658_5206_5670 | 152 |
| 250 | 3300046524 | Ga0495648_0026343 | Ga0495648_0026343_1015_1479 | 152 |
| 251 | 3300046530 | Ga0495654_0000617 | Ga0495654_0000617_27745_28209 | 152 |
| 252 | 3300046530 | Ga0495654_0138098 | Ga0495654_0138098_120_584 | 152 |
| 253 | 3300046538 | Ga0495609_0000008 | Ga0495609_0000008_349463_349927 | 152 |
| 254 | 3300046538 | Ga0495609_0000920 | Ga0495609_0000920_11419_11883 | 152 |
| 255 | 3300046542 | Ga0495597_0002842 | Ga0495597_0002842_302_766 | 152 |
| 256 | 3300046542 | Ga0495597_0219643 | Ga0495597_0219643_223_687 | 152 |
| 257 | 3300046557 | Ga0495622_0002553 | Ga0495622_0002553_2314_2778 | 152 |
| 258 | 3300046558 | Ga0495633_0000216 | Ga0495633_0000216_27955_28419 | 152 |
| 259 | 3300046616 | Ga0495668_0120603 | Ga0495668_0120603_933_1397 | 152 |
| 260 | 3300046648 | Ga0495611_0000175 | Ga0495611_0000175_22270_22734 | 152 |
| 261 | 3300046648 | Ga0495611_0009399 | Ga0495611_0009399_1865_2329 | 152 |
| 262 | 3300046660 | Ga0495625_0000028 | Ga0495625_0000028_95857_96321 | 152 |
| 263 | 3300046665 | Ga0495661_0000096 | Ga0495661_0000096_30736_31200 | 152 |
| 264 | 3300046665 | Ga0495661_0003182 | Ga0495661_0003182_2126_2590 | 152 |
| 265 | 3300046691 | Ga0495670_0032173 | Ga0495670_0032173_1433_1897 | 152 |
| 266 | 3300046691 | Ga0495670_0033868 | Ga0495670_0033868_412_876 | 152 |
| 267 | 3300046692 | Ga0495671_0024052 | Ga0495671_0024052_2342_2806 | 152 |
| 268 | 3300046692 | Ga0495671_0039485 | Ga0495671_0039485_155_619 | 152 |
| 269 | 3300046694 | Ga0495649_0017948 | Ga0495649_0017948_1536_2000 | 152 |
| 270 | 3300046794 | Ga0495589_0000492 | Ga0495589_0000492_10324_10788 | 152 |
| 271 | 3300046810 | Ga0495660_0006771 | Ga0495660_0006771_4602_5066 | 152 |
| 272 | 3300047320 | Ga0495672_0051058 | Ga0495672_0051058_948_1412 | 152 |
| 273 | 3300047321 | Ga0495676_0000006 | Ga0495676_0000006_96275_96739 | 152 |
| 274 | 3300047323 | Ga0495683_0000169 | Ga0495683_0000169_29951_30415 | 152 |
| 275 | 3300047323 | Ga0495683_0014816 | Ga0495683_0014816_2274_2738 | 152 |
| 276 | 3300047446 | Ga0495679_000200 | Ga0495679_000200_21282_21746 | 152 |
| 277 | 3300047446 | Ga0495679_001247 | Ga0495679_001247_8390_8854 | 152 |
| 278 | 3300047469 | Ga0495673_0014435 | Ga0495673_0014435_3155_3619 | 152 |
| 279 | 3300047470 | Ga0495681_0000789 | Ga0495681_0000789_23463_23927 | 152 |
| 280 | 3300047470 | Ga0495681_0006948 | Ga0495681_0006948_4289_4753 | 152 |
| 281 | 3300047472 | Ga0495686_0173329 | Ga0495686_0173329_174_638 | 152 |
| 282 | 3300048091 | Ga0495626_0000019 | Ga0495626_0000019_60732_61196 | 152 |
| 283 | 3300048925 | Ga0496122_0025334 | Ga0496122_0025334_708_1172 | 152 |
| 284 | 3300048926 | Ga0496123_0014205 | Ga0496123_0014205_3447_3911 | 152 |
| 285 | 3300049459 | Ga0495678_000242 | Ga0495678_000242_27855_28319 | 152 |
| 286 | 3300053125 | Ga0500618_114266 | Ga0500618_114266_125_589 | 152 |
| 287 | 3300053145 | Ga0500586_131593 | Ga0500586_131593_333_797 | 152 |
| 288 | 3300005295 | Ga0065707_10256063 | Ga0065707_102560632 | 153 |
| 289 | 3300005328 | Ga0070676_10060206 | Ga0070676_100602062 | 153 |
| 290 | 3300005334 | Ga0068869_100001166 | Ga0068869_1000011669 | 153 |
| 291 | 3300005337 | Ga0070682_100975293 | Ga0070682_1009752932 | 153 |
| 292 | 3300005354 | Ga0070675_100001440 | Ga0070675_1000014406 | 153 |
| 293 | 3300005468 | Ga0070707_100014756 | Ga0070707_1000147569 | 153 |
| 294 | 3300005471 | Ga0070698_100048113 | Ga0070698_1000481134 | 153 |
| 295 | 3300005545 | Ga0070695_100066267 | Ga0070695_1000662672 | 153 |
| 296 | 3300005549 | Ga0070704_100003271 | Ga0070704_1000032712 | 153 |
| 297 | 3300006237 | Ga0097621_100072191 | Ga0097621_1000721912 | 153 |
| 298 | 3300006844 | Ga0075428_100181592 | Ga0075428_1001815921 | 153 |
| 299 | 3300006846 | Ga0075430_100002352 | Ga0075430_1000023523 | 153 |
| 300 | 3300006847 | Ga0075431_100021112 | Ga0075431_1000211121 | 153 |
| 301 | 3300006847 | Ga0075431_100070939 | Ga0075431_1000709392 | 153 |
| 302 | 3300006871 | Ga0075434_100337235 | Ga0075434_1003372353 | 153 |
| 303 | 3300009093 | Ga0105240_10249969 | Ga0105240_102499692 | 153 |
| 304 | 3300009094 | Ga0111539_10816109 | Ga0111539_108161091 | 153 |
| 305 | 3300009094 | Ga0111539_12658459 | Ga0111539_126584591 | 153 |
| 306 | 3300009098 | Ga0105245_10925557 | Ga0105245_109255572 | 153 |
| 307 | 3300009147 | Ga0114129_10000974 | Ga0114129_1000097446 | 153 |
| 308 | 3300009147 | Ga0114129_10794708 | Ga0114129_107947082 | 153 |
| 309 | 3300009545 | Ga0105237_10215933 | Ga0105237_102159332 | 153 |
| 310 | 3300013102 | Ga0157371_10047383 | Ga0157371_100473832 | 153 |
| 311 | 3300013296 | Ga0157374_10007785 | Ga0157374_100077852 | 153 |
| 312 | 3300013306 | Ga0163162_10116338 | Ga0163162_101163382 | 153 |
| 313 | 3300013307 | Ga0157372_10009644 | Ga0157372_100096442 | 153 |
| 314 | 3300014745 | Ga0157377_10001401 | Ga0157377_100014014 | 153 |
| 315 | 3300017792 | Ga0163161_10006381 | Ga0163161_100063812 | 153 |
| 316 | 3300021361 | Ga0213872_10040248 | Ga0213872_100402482 | 153 |
| 317 | 3300025922 | Ga0207646_10052136 | Ga0207646_100521362 | 153 |
| 318 | 3300027671 | Ga0209588_1148749 | Ga0209588_11487491 | 153 |
| 319 | 3300027682 | Ga0209971_1095120 | Ga0209971_10951202 | 153 |
| 320 | 3300027907 | Ga0207428_10833560 | Ga0207428_108335601 | 153 |
| 321 | 3300035207 | Ga0373942_0010568 | Ga0373942_0010568_946_1407 | 153 |
| 322 | 3300044673 | Ga0453683_0901962 | Ga0453683_0901962_25_510 | 153 |
| 323 | 3300045051 | Ga0451576_0390474 | Ga0451576_0390474_75_536 | 153 |
| 324 | 3300046472 | Ga0495580_0104971 | Ga0495580_0104971_984_1448 | 153 |
| 325 | 3300047472 | Ga0495686_0003039 | Ga0495686_0003039_8857_9324 | 153 |
| 326 | 3300049583 | Ga0501067_0529663 | Ga0501067_0529663_86_550 | 153 |
| 327 | 3300049589 | Ga0501073_0011837 | Ga0501073_0011837_4029_4493 | 153 |
| 328 | 3300049590 | Ga0501074_0175412 | Ga0501074_0175412_980_1444 | 153 |
| 329 | 3300050507 | nmdc:mga05p37_847720_c1 | nmdc:mga05p37_847720_c1_280_741 | 153 |
| 330 | 3300050508 | nmdc:mga09592_407852_c1 | nmdc:mga09592_407852_c1_209_679 | 153 |
| 331 | 3300050509 | nmdc:mga0qj67_11724_c1 | nmdc:mga0qj67_11724_c1_3203_3664 | 153 |
| 332 | 3300050510 | nmdc:mga06r32_125963_c1 | nmdc:mga06r32_125963_c1_1565_2026 | 153 |
| 333 | 3300050512 | nmdc:mga0n895_413119_c1 | nmdc:mga0n895_413119_c1_96_566 | 153 |
| 334 | 3300003320 | rootH2_10136714 | rootH2_101367142 | 154 |
| 335 | 3300005434 | Ga0070709_10023177 | Ga0070709_100231775 | 154 |
| 336 | 3300005434 | Ga0070709_10815766 | Ga0070709_108157662 | 154 |
| 337 | 3300005436 | Ga0070713_100036776 | Ga0070713_1000367763 | 154 |
| 338 | 3300005439 | Ga0070711_100418087 | Ga0070711_1004180872 | 154 |
| 339 | 3300005440 | Ga0070705_100165941 | Ga0070705_1001659412 | 154 |
| 340 | 3300005445 | Ga0070708_100012421 | Ga0070708_1000124216 | 154 |
| 341 | 3300005445 | Ga0070708_100046280 | Ga0070708_1000462805 | 154 |
| 342 | 3300005445 | Ga0070708_100634375 | Ga0070708_1006343752 | 154 |
| 343 | 3300005467 | Ga0070706_100103560 | Ga0070706_1001035602 | 154 |
| 344 | 3300005467 | Ga0070706_100129737 | Ga0070706_1001297371 | 154 |
| 345 | 3300005468 | Ga0070707_100086838 | Ga0070707_1000868382 | 154 |
| 346 | 3300005468 | Ga0070707_100596650 | Ga0070707_1005966501 | 154 |
| 347 | 3300005471 | Ga0070698_100160949 | Ga0070698_1001609493 | 154 |
| 348 | 3300005518 | Ga0070699_100044553 | Ga0070699_1000445532 | 154 |
| 349 | 3300005536 | Ga0070697_100070216 | Ga0070697_1000702162 | 154 |
| 350 | 3300005536 | Ga0070697_100082474 | Ga0070697_1000824742 | 154 |
| 351 | 3300006163 | Ga0070715_10470048 | Ga0070715_104700482 | 154 |
| 352 | 3300006173 | Ga0070716_100001913 | Ga0070716_1000019133 | 154 |
| 353 | 3300006173 | Ga0070716_100007818 | Ga0070716_1000078184 | 154 |
| 354 | 3300006175 | Ga0070712_100671118 | Ga0070712_1006711181 | 154 |
| 355 | 3300006852 | Ga0075433_11663316 | Ga0075433_116633161 | 154 |
| 356 | 3300006871 | Ga0075434_100047202 | Ga0075434_1000472022 | 154 |
| 357 | 3300007076 | Ga0075435_101227682 | Ga0075435_1012276822 | 154 |
| 358 | 3300007265 | Ga0099794_10010059 | Ga0099794_100100594 | 154 |
| 359 | 3300007265 | Ga0099794_10099383 | Ga0099794_100993832 | 154 |
| 360 | 3300007265 | Ga0099794_10145106 | Ga0099794_101451062 | 154 |
| 361 | 3300007265 | Ga0099794_10272541 | Ga0099794_102725411 | 154 |
| 362 | 3300007788 | Ga0099795_10123063 | Ga0099795_101230632 | 154 |
| 363 | 3300009011 | Ga0105251_10003168 | Ga0105251_1000316810 | 154 |
| 364 | 3300010159 | Ga0099796_10129973 | Ga0099796_101299731 | 154 |
| 365 | 3300014969 | Ga0157376_10037538 | Ga0157376_100375383 | 154 |
| 366 | 3300021361 | Ga0213872_10001160 | Ga0213872_100011605 | 154 |
| 367 | 3300025250 | Ga0209026_1003669 | Ga0209026_10036692 | 154 |
| 368 | 3300025735 | Ga0207713_1061449 | Ga0207713_10614492 | 154 |
| 369 | 3300025906 | Ga0207699_10047572 | Ga0207699_100475722 | 154 |
| 370 | 3300025910 | Ga0207684_10107704 | Ga0207684_101077042 | 154 |
| 371 | 3300025915 | Ga0207693_10154078 | Ga0207693_101540782 | 154 |
| 372 | 3300025916 | Ga0207663_10407627 | Ga0207663_104076272 | 154 |
| 373 | 3300025922 | Ga0207646_10001174 | Ga0207646_1000117422 | 154 |
| 374 | 3300025928 | Ga0207700_10004396 | Ga0207700_100043967 | 154 |
| 375 | 3300025939 | Ga0207665_10000589 | Ga0207665_100005895 | 154 |
| 376 | 3300025939 | Ga0207665_10110252 | Ga0207665_101102521 | 154 |
| 377 | 3300027671 | Ga0209588_1007989 | Ga0209588_10079895 | 154 |
| 378 | 3300035113 | Ga0373936_0064179 | Ga0373936_0064179_628_1092 | 154 |
| 379 | 3300035118 | Ga0373954_0051752 | Ga0373954_0051752_136_600 | 154 |
| 380 | 3300035119 | Ga0373956_0036320 | Ga0373956_0036320_10_474 | 154 |
| 381 | 3300035170 | Ga0373943_0588671 | Ga0373943_0588671_48_512 | 154 |
| 382 | 3300035172 | Ga0373955_0011452 | Ga0373955_0011452_3223_3687 | 154 |
| 383 | 3300035410 | Ga0373924_0013784 | Ga0373924_0013784_1315_1779 | 154 |
| 384 | 3300035692 | Ga0373935_0099425 | Ga0373935_0099425_1096_1560 | 154 |
| 385 | 3300035724 | Ga0373933_0006340 | Ga0373933_0006340_4512_4976 | 154 |
| 386 | 3300035725 | Ga0373947_0046137 | Ga0373947_0046137_1273_1737 | 154 |
| 387 | 3300036401 | Ga0373937_0039197 | Ga0373937_0039197_542_1006 | 154 |
| 388 | 3300037312 | Ga0395899_0002318 | Ga0395899_0002318_2693_3160 | 154 |
| 389 | 3300037418 | Ga0395900_0072495 | Ga0395900_0072495_68_535 | 154 |
| 390 | 3300037418 | Ga0395900_0239580 | Ga0395900_0239580_174_641 | 154 |
| 391 | 3300037466 | Ga0395898_0255974 | Ga0395898_0255974_174_641 | 154 |
| 392 | 3300038443 | Ga0395901_0099359 | Ga0395901_0099359_1801_2268 | 154 |
| 393 | 3300038443 | Ga0395901_0132273 | Ga0395901_0132273_1430_1897 | 154 |
| 394 | 3300039447 | Ga0436361_1208495 | Ga0436361_1208495_7139_7606 | 154 |
| 395 | 3300046459 | Ga0495629_0021221 | Ga0495629_0021221_3873_4340 | 154 |
| 396 | 3300046472 | Ga0495580_0025415 | Ga0495580_0025415_1499_1966 | 154 |
| 397 | 3300046473 | Ga0495582_0026272 | Ga0495582_0026272_958_1425 | 154 |
| 398 | 3300046475 | Ga0495639_0004313 | Ga0495639_0004313_3255_3722 | 154 |
| 399 | 3300046477 | Ga0495664_0538212 | Ga0495664_0538212_76_543 | 154 |
| 400 | 3300046499 | Ga0495594_0091449 | Ga0495594_0091449_422_889 | 154 |
| 401 | 3300046511 | Ga0495608_0014684 | Ga0495608_0014684_542_1006 | 154 |
| 402 | 3300046517 | Ga0495630_0129081 | Ga0495630_0129081_1030_1497 | 154 |
| 403 | 3300046526 | Ga0495666_0012173 | Ga0495666_0012173_3755_4222 | 154 |
| 404 | 3300046531 | Ga0495665_0028043 | Ga0495665_0028043_2458_2925 | 154 |
| 405 | 3300046533 | Ga0495640_0017250 | Ga0495640_0017250_1827_2294 | 154 |
| 406 | 3300046533 | Ga0495640_0022809 | Ga0495640_0022809_399_863 | 154 |
| 407 | 3300046535 | Ga0495586_0013912 | Ga0495586_0013912_3636_4103 | 154 |
| 408 | 3300046535 | Ga0495586_0033144 | Ga0495586_0033144_197_661 | 154 |
| 409 | 3300046539 | Ga0495621_0408362 | Ga0495621_0408362_72_554 | 154 |
| 410 | 3300046559 | Ga0495667_0016919 | Ga0495667_0016919_3919_4383 | 154 |
| 411 | 3300046642 | Ga0495634_0011889 | Ga0495634_0011889_5293_5760 | 154 |
| 412 | 3300046663 | Ga0495635_0057937 | Ga0495635_0057937_2103_2570 | 154 |
| 413 | 3300046675 | Ga0495657_0062429 | Ga0495657_0062429_701_1165 | 154 |
| 414 | 3300046681 | Ga0495647_0189277 | Ga0495647_0189277_346_813 | 154 |
| 415 | 3300046683 | Ga0495658_0034873 | Ga0495658_0034873_798_1265 | 154 |
| 416 | 3300046689 | Ga0495613_0109325 | Ga0495613_0109325_638_1105 | 154 |
| 417 | 3300046690 | Ga0495624_0229024 | Ga0495624_0229024_11_478 | 154 |
| 418 | 3300047315 | Ga0495581_0014771 | Ga0495581_0014771_554_1021 | 154 |
| 419 | 3300047317 | Ga0495604_0104774 | Ga0495604_0104774_514_978 | 154 |
| 420 | 3300047319 | Ga0495674_0044843 | Ga0495674_0044843_1280_1747 | 154 |
| 421 | 3300047321 | Ga0495676_0006782 | Ga0495676_0006782_4041_4508 | 154 |
| 422 | 3300047322 | Ga0495680_0021285 | Ga0495680_0021285_1033_1500 | 154 |
| 423 | 3300047471 | Ga0495684_0011742 | Ga0495684_0011742_1821_2285 | 154 |
| 424 | 3300047673 | Ga0495593_0177472 | Ga0495593_0177472_309_773 | 154 |
| 425 | 3300048089 | Ga0495614_0100599 | Ga0495614_0100599_649_1116 | 154 |
| 426 | 3300048903 | Ga0496100_0024814 | Ga0496100_0024814_1009_1476 | 154 |
| 427 | 3300048904 | Ga0496101_0084496 | Ga0496101_0084496_889_1356 | 154 |
| 428 | 3300048917 | Ga0496114_0124556 | Ga0496114_0124556_740_1207 | 154 |
| 429 | 3300048918 | Ga0496115_0004843 | Ga0496115_0004843_8725_9192 | 154 |
| 430 | 3300048919 | Ga0496116_0000550 | Ga0496116_0000550_35700_36173 | 154 |
| 431 | 3300048929 | Ga0496126_0551945 | Ga0496126_0551945_360_827 | 154 |
| 432 | 3300050515 | nmdc:mga0a205_1307737_c1 | nmdc:mga0a205_1307737_c1_27_497 | 154 |
| 433 | 3300053085 | Ga0495619_0244703 | Ga0495619_0244703_190_657 | 154 |
| 434 | 3300005295 | Ga0065707_10084037 | Ga0065707_100840377 | 155 |
| 435 | 3300005295 | Ga0065707_10673030 | Ga0065707_106730301 | 155 |
| 436 | 3300005327 | Ga0070658_10354227 | Ga0070658_103542272 | 155 |
| 437 | 3300005339 | Ga0070660_100119900 | Ga0070660_1001199001 | 155 |
| 438 | 3300005344 | Ga0070661_101038233 | Ga0070661_1010382332 | 155 |
| 439 | 3300005440 | Ga0070705_100631222 | Ga0070705_1006312222 | 155 |
| 440 | 3300005468 | Ga0070707_100326803 | Ga0070707_1003268032 | 155 |
| 441 | 3300005471 | Ga0070698_100349329 | Ga0070698_1003493292 | 155 |
| 442 | 3300005518 | Ga0070699_100021230 | Ga0070699_1000212305 | 155 |
| 443 | 3300005518 | Ga0070699_100255187 | Ga0070699_1002551872 | 155 |
| 444 | 3300005518 | Ga0070699_100488850 | Ga0070699_1004888502 | 155 |
| 445 | 3300005518 | Ga0070699_100689624 | Ga0070699_1006896242 | 155 |
| 446 | 3300005539 | Ga0068853_101776598 | Ga0068853_1017765981 | 155 |
| 447 | 3300005549 | Ga0070704_100305828 | Ga0070704_1003058282 | 155 |
| 448 | 3300005563 | Ga0068855_100699465 | Ga0068855_1006994652 | 155 |
| 449 | 3300005578 | Ga0068854_101177074 | Ga0068854_1011770741 | 155 |
| 450 | 3300005616 | Ga0068852_101147056 | Ga0068852_1011470562 | 155 |
| 451 | 3300005844 | Ga0068862_100106650 | Ga0068862_1001066503 | 155 |
| 452 | 3300006844 | Ga0075428_100004810 | Ga0075428_1000048107 | 155 |
| 453 | 3300006846 | Ga0075430_100845485 | Ga0075430_1008454852 | 155 |
| 454 | 3300006880 | Ga0075429_100013305 | Ga0075429_1000133054 | 155 |
| 455 | 3300009147 | Ga0114129_10014581 | Ga0114129_100145815 | 155 |
| 456 | 3300009148 | Ga0105243_10124485 | Ga0105243_101244852 | 155 |
| 457 | 3300009553 | Ga0105249_10035348 | Ga0105249_100353483 | 155 |
| 458 | 3300009553 | Ga0105249_10870152 | Ga0105249_108701521 | 155 |
| 459 | 3300013102 | Ga0157371_10269411 | Ga0157371_102694112 | 155 |
| 460 | 3300013105 | Ga0157369_10011071 | Ga0157369_100110715 | 155 |
| 461 | 3300013307 | Ga0157372_10114553 | Ga0157372_101145533 | 155 |
| 462 | 3300014326 | Ga0157380_10121650 | Ga0157380_101216502 | 155 |
| 463 | 3300020082 | Ga0206353_11376464 | Ga0206353_113764642 | 155 |
| 464 | 3300025917 | Ga0207660_10027982 | Ga0207660_100279821 | 155 |
| 465 | 3300025917 | Ga0207660_10342732 | Ga0207660_103427321 | 155 |
| 466 | 3300025919 | Ga0207657_10081948 | Ga0207657_100819483 | 155 |
| 467 | 3300025935 | Ga0207709_11013107 | Ga0207709_110131071 | 155 |
| 468 | 3300025949 | Ga0207667_10408109 | Ga0207667_104081092 | 155 |
| 469 | 3300025961 | Ga0207712_10161688 | Ga0207712_101616882 | 155 |
| 470 | 3300025981 | Ga0207640_10942835 | Ga0207640_109428352 | 155 |
| 471 | 3300026041 | Ga0207639_11509449 | Ga0207639_115094491 | 155 |
| 472 | 3300026116 | Ga0207674_10702827 | Ga0207674_107028272 | 155 |
| 473 | 3300026118 | Ga0207675_100411018 | Ga0207675_1004110182 | 155 |
| 474 | 3300028380 | Ga0268265_10359232 | Ga0268265_103592322 | 155 |
| 475 | 3300037853 | Ga0436364_0823753 | Ga0436364_0823753_24_521 | 155 |
| 476 | 3300039437 | Ga0436365_0025793 | Ga0436365_0025793_46_543 | 155 |
| 477 | 3300039447 | Ga0436361_0056557 | Ga0436361_0056557_316_795 | 155 |
| 478 | 3300039447 | Ga0436361_0483849 | Ga0436361_0483849_1370_1849 | 155 |
| 479 | 3300042876 | Ga0451577_0025715 | Ga0451577_0025715_2699_3166 | 155 |
| 480 | 3300042876 | Ga0451577_0030853 | Ga0451577_0030853_3813_4280 | 155 |
| 481 | 3300044712 | Ga0453684_0044528 | Ga0453684_0044528_1429_1896 | 155 |
| 482 | 3300044712 | Ga0453684_0187410 | Ga0453684_0187410_689_1156 | 155 |
| 483 | 3300046809 | Ga0495600_0859454 | Ga0495600_0859454_19_492 | 155 |
| 484 | 3300050507 | nmdc:mga05p37_51069_c1 | nmdc:mga05p37_51069_c1_3156_3623 | 155 |
| 485 | 3300050508 | nmdc:mga09592_7945_c1 | nmdc:mga09592_7945_c1_5374_5841 | 155 |
| 486 | 3300005577 | Ga0068857_100111024 | Ga0068857_1001110242 | 156 |
| 487 | 3300009094 | Ga0111539_10010601 | Ga0111539_1001060112 | 156 |
| 488 | 3300009098 | Ga0105245_11526127 | Ga0105245_115261272 | 156 |
| 489 | 3300011119 | Ga0105246_10296247 | Ga0105246_102962472 | 156 |
| 490 | 3300011119 | Ga0105246_11301184 | Ga0105246_113011842 | 156 |
| 491 | 3300013307 | Ga0157372_12042109 | Ga0157372_120421092 | 156 |
| 492 | 3300014325 | Ga0163163_10028218 | Ga0163163_100282187 | 156 |
| 493 | 3300025927 | Ga0207687_10207992 | Ga0207687_102079922 | 156 |
| 494 | 3300035398 | Ga0316574_0008996 | Ga0316574_0008996_2246_2722 | 156 |
| 495 | 3300036401 | Ga0373937_0136418 | Ga0373937_0136418_590_1123 | 156 |
| 496 | 3300036647 | Ga0316582_0265275 | Ga0316582_0265275_295_771 | 156 |
| 497 | 3300036712 | Ga0316584_0113994 | Ga0316584_0113994_798_1274 | 156 |
| 498 | 3300037853 | Ga0436364_1416277 | Ga0436364_1416277_26_499 | 156 |
| 499 | 3300039447 | Ga0436361_0242643 | Ga0436361_0242643_14_487 | 156 |
| 500 | 3300039447 | Ga0436361_0294265 | Ga0436361_0294265_15_488 | 156 |
| 501 | 3300039450 | Ga0436363_0564814 | Ga0436363_0564814_54_527 | 156 |
| 502 | 3300046454 | Ga0495592_0121651 | Ga0495592_0121651_767_1237 | 156 |
| 503 | 3300046477 | Ga0495664_0363157 | Ga0495664_0363157_300_770 | 156 |
| 504 | 3300046516 | Ga0495628_0011070 | Ga0495628_0011070_2420_2890 | 156 |
| 505 | 3300046529 | Ga0495652_0043254 | Ga0495652_0043254_2352_2822 | 156 |
| 506 | 3300046535 | Ga0495586_0042485 | Ga0495586_0042485_1545_2015 | 156 |
| 507 | 3300046678 | Ga0495599_0015790 | Ga0495599_0015790_3688_4158 | 156 |
| 508 | 3300047322 | Ga0495680_0405954 | Ga0495680_0405954_140_610 | 156 |
| 509 | 3300047444 | Ga0495675_0202442 | Ga0495675_0202442_266_736 | 156 |
| 510 | 3300050511 | nmdc:mga08y16_4553_c1 | nmdc:mga08y16_4553_c1_745_1233 | 156 |
| 511 | 3300050512 | nmdc:mga0n895_370_c1 | nmdc:mga0n895_370_c1_29541_30029 | 156 |
| 512 | 3300050513 | nmdc:mga0rr50_463_c1 | nmdc:mga0rr50_463_c1_8265_8753 | 156 |
| 513 | 3300050514 | nmdc:mga08x19_4276_c1 | nmdc:mga08x19_4276_c1_3751_4239 | 156 |
| 514 | 3300050515 | nmdc:mga0a205_134_c1 | nmdc:mga0a205_134_c1_15684_16172 | 156 |
| 515 | 3300053077 | Ga0495601_0014585 | Ga0495601_0014585_2621_3091 | 156 |
| 516 | 3300009551 | Ga0105238_11584057 | Ga0105238_115840571 | 157 |
| 517 | 3300006844 | Ga0075428_100198604 | Ga0075428_1001986043 | 158 |
| 518 | 3300012506 | Ga0157324_1037396 | Ga0157324_10373961 | 158 |
| 519 | 3300020069 | Ga0197907_10572943 | Ga0197907_105729432 | 158 |
| 520 | 3300020077 | Ga0206351_10662555 | Ga0206351_106625551 | 158 |
| 521 | 3300020080 | Ga0206350_10957556 | Ga0206350_109575562 | 158 |
| 522 | 3300020082 | Ga0206353_11249298 | Ga0206353_112492982 | 158 |
| 523 | 3300022467 | Ga0224712_10036737 | Ga0224712_100367372 | 158 |
| 524 | 3300025913 | Ga0207695_10111167 | Ga0207695_101111671 | 158 |
| 525 | 3300025961 | Ga0207712_10238810 | Ga0207712_102388102 | 158 |
| 526 | 3300032002 | Ga0307416_100140329 | Ga0307416_1001403292 | 158 |
| 527 | 3300032005 | Ga0307411_10509219 | Ga0307411_105092192 | 158 |
| 528 | 3300036712 | Ga0316584_0201669 | Ga0316584_0201669_460_939 | 158 |
| 529 | 3300042156 | Ga0439446_0103567 | Ga0439446_0103567_397_885 | 158 |
| 530 | 3300049572 | Ga0501036_1230823 | Ga0501036_1230823_100_585 | 158 |
| 531 | 3300049576 | Ga0501040_0245516 | Ga0501040_0245516_229_714 | 158 |
| 532 | 3300049582 | Ga0501048_0221294 | Ga0501048_0221294_432_917 | 158 |
| 533 | 3300049587 | Ga0501071_0371542 | Ga0501071_0371542_402_887 | 158 |
| 534 | 3300049591 | Ga0501075_0113568 | Ga0501075_0113568_316_801 | 158 |
| 535 | 3300049592 | Ga0501076_0803540 | Ga0501076_0803540_157_642 | 158 |
| 536 | 3300049652 | Ga0501202_226393 | Ga0501202_226393_16_504 | 158 |
| 537 | 3300005617 | Ga0068859_100252866 | Ga0068859_1002528662 | 159 |
| 538 | 3300005844 | Ga0068862_100082797 | Ga0068862_1000827972 | 159 |
| 539 | 3300005937 | Ga0081455_10086864 | Ga0081455_100868642 | 159 |
| 540 | 3300005981 | Ga0081538_10003141 | Ga0081538_1000314111 | 159 |
| 541 | 3300006931 | Ga0097620_100252866 | Ga0097620_1002528662 | 159 |
| 542 | 3300009553 | Ga0105249_10139393 | Ga0105249_101393932 | 159 |
| 543 | 3300024225 | Ga0224572_1057874 | Ga0224572_10578742 | 159 |
| 544 | 3300028380 | Ga0268265_11076027 | Ga0268265_110760272 | 159 |
| 545 | 3300028381 | Ga0268264_10266123 | Ga0268264_102661232 | 159 |
| 546 | 3300030888 | Ga0265769_107039 | Ga0265769_1070391 | 159 |
| 547 | 3300039450 | Ga0436363_1259361 | Ga0436363_1259361_129_614 | 159 |
| 548 | 3300049572 | Ga0501036_0494216 | Ga0501036_0494216_366_875 | 159 |
| 549 | 3300049587 | Ga0501071_0084511 | Ga0501071_0084511_386_895 | 159 |
| 550 | 3300049590 | Ga0501074_0801133 | Ga0501074_0801133_25_513 | 159 |
| 551 | 3300049742 | Ga0501080_0119439 | Ga0501080_0119439_1744_2253 | 159 |
| 552 | 3300061734 | Ga0530510_0373686 | Ga0530510_0373686_356_865 | 159 |
| 553 | 2162886006 | SwRhRL3b_contig_1338701 | SwRhRL3b_0647.00001710 | 160 |
| 554 | 3300004798 | Ga0058859_10793595 | Ga0058859_107935952 | 160 |
| 555 | 3300004803 | Ga0058862_12713619 | Ga0058862_127136192 | 160 |
| 556 | 3300005289 | Ga0065704_10070436 | Ga0065704_100704369 | 160 |
| 557 | 3300005295 | Ga0065707_10001282 | Ga0065707_100012827 | 160 |
| 558 | 3300005295 | Ga0065707_10081813 | Ga0065707_1008181326 | 160 |
| 559 | 3300005295 | Ga0065707_10441765 | Ga0065707_104417652 | 160 |
| 560 | 3300005435 | Ga0070714_100234140 | Ga0070714_1002341402 | 160 |
| 561 | 3300005436 | Ga0070713_100066237 | Ga0070713_1000662373 | 160 |
| 562 | 3300005444 | Ga0070694_100089852 | Ga0070694_1000898522 | 160 |
| 563 | 3300005468 | Ga0070707_100152189 | Ga0070707_1001521892 | 160 |
| 564 | 3300005471 | Ga0070698_100017576 | Ga0070698_1000175763 | 160 |
| 565 | 3300005518 | Ga0070699_100026645 | Ga0070699_1000266452 | 160 |
| 566 | 3300005518 | Ga0070699_100436277 | Ga0070699_1004362772 | 160 |
| 567 | 3300005545 | Ga0070695_100012719 | Ga0070695_1000127193 | 160 |
| 568 | 3300005548 | Ga0070665_100001226 | Ga0070665_10000122630 | 160 |
| 569 | 3300006028 | Ga0070717_10283452 | Ga0070717_102834522 | 160 |
| 570 | 3300006194 | Ga0075427_10000052 | Ga0075427_100000524 | 160 |
| 571 | 3300006844 | Ga0075428_100022421 | Ga0075428_1000224214 | 160 |
| 572 | 3300006844 | Ga0075428_100057169 | Ga0075428_1000571692 | 160 |
| 573 | 3300006846 | Ga0075430_100049700 | Ga0075430_1000497002 | 160 |
| 574 | 3300006846 | Ga0075430_100233003 | Ga0075430_1002330032 | 160 |
| 575 | 3300006847 | Ga0075431_100161631 | Ga0075431_1001616312 | 160 |
| 576 | 3300006847 | Ga0075431_100420933 | Ga0075431_1004209332 | 160 |
| 577 | 3300006847 | Ga0075431_101141333 | Ga0075431_1011413332 | 160 |
| 578 | 3300006852 | Ga0075433_10341005 | Ga0075433_103410052 | 160 |
| 579 | 3300006852 | Ga0075433_10670647 | Ga0075433_106706471 | 160 |
| 580 | 3300006880 | Ga0075429_100001186 | Ga0075429_10000118612 | 160 |
| 581 | 3300006880 | Ga0075429_100024544 | Ga0075429_1000245444 | 160 |
| 582 | 3300006880 | Ga0075429_100048367 | Ga0075429_1000483672 | 160 |
| 583 | 3300006880 | Ga0075429_100317707 | Ga0075429_1003177072 | 160 |
| 584 | 3300009094 | Ga0111539_11379558 | Ga0111539_113795582 | 160 |
| 585 | 3300009147 | Ga0114129_10004218 | Ga0114129_1000421821 | 160 |
| 586 | 3300009147 | Ga0114129_10170625 | Ga0114129_101706252 | 160 |
| 587 | 3300009148 | Ga0105243_10022088 | Ga0105243_100220884 | 160 |
| 588 | 3300009176 | Ga0105242_10127947 | Ga0105242_101279471 | 160 |
| 589 | 3300020075 | Ga0206349_1444139 | Ga0206349_14441393 | 160 |
| 590 | 3300020081 | Ga0206354_11344381 | Ga0206354_113443812 | 160 |
| 591 | 3300025910 | Ga0207684_10086549 | Ga0207684_100865492 | 160 |
| 592 | 3300025922 | Ga0207646_10289103 | Ga0207646_102891032 | 160 |
| 593 | 3300025928 | Ga0207700_10076167 | Ga0207700_100761672 | 160 |
| 594 | 3300025929 | Ga0207664_10565261 | Ga0207664_105652612 | 160 |
| 595 | 3300025934 | Ga0207686_11069086 | Ga0207686_110690861 | 160 |
| 596 | 3300026116 | Ga0207674_10144868 | Ga0207674_101448682 | 160 |
| 597 | 3300028379 | Ga0268266_10001924 | Ga0268266_100019245 | 160 |
| 598 | 3300031251 | Ga0265327_10008406 | Ga0265327_100084067 | 160 |
| 599 | 3300031727 | Ga0316576_10468192 | Ga0316576_104681921 | 160 |
| 600 | 3300031728 | Ga0316578_10093402 | Ga0316578_100934022 | 160 |
| 601 | 3300031733 | Ga0316577_10005591 | Ga0316577_100055913 | 160 |
| 602 | 3300032137 | Ga0316585_10017644 | Ga0316585_100176442 | 160 |
| 603 | 3300035090 | Ga0373949_0050928 | Ga0373949_0050928_472_954 | 160 |
| 604 | 3300035115 | Ga0373941_0044988 | Ga0373941_0044988_160_642 | 160 |
| 605 | 3300035398 | Ga0316574_0324815 | Ga0316574_0324815_93_578 | 160 |
| 606 | 3300035692 | Ga0373935_0836404 | Ga0373935_0836404_72_569 | 160 |
| 607 | 3300036712 | Ga0316584_0002429 | Ga0316584_0002429_268_762 | 160 |
| 608 | 3300042876 | Ga0451577_0533724 | Ga0451577_0533724_306_788 | 160 |
| 609 | 3300042876 | Ga0451577_1118145 | Ga0451577_1118145_122_637 | 160 |
| 610 | 3300044673 | Ga0453683_0144803 | Ga0453683_0144803_887_1369 | 160 |
| 611 | 3300044673 | Ga0453683_0269553 | Ga0453683_0269553_56_538 | 160 |
| 612 | 3300044673 | Ga0453683_1043029 | Ga0453683_1043029_14_496 | 160 |
| 613 | 3300044712 | Ga0453684_0020611 | Ga0453684_0020611_2538_3035 | 160 |
| 614 | 3300044712 | Ga0453684_0045961 | Ga0453684_0045961_43_609 | 160 |
| 615 | 3300044712 | Ga0453684_0135543 | Ga0453684_0135543_61_546 | 160 |
| 616 | 3300044712 | Ga0453684_0626313 | Ga0453684_0626313_505_987 | 160 |
| 617 | 3300045051 | Ga0451576_0026411 | Ga0451576_0026411_275_757 | 160 |
| 618 | 3300045051 | Ga0451576_0078953 | Ga0451576_0078953_847_1329 | 160 |
| 619 | 3300045051 | Ga0451576_0344377 | Ga0451576_0344377_254_736 | 160 |
| 620 | 3300045051 | Ga0451576_1012494 | Ga0451576_1012494_168_680 | 160 |
| 621 | 3300049576 | Ga0501040_0012787 | Ga0501040_0012787_3897_4379 | 160 |
| 622 | 3300049576 | Ga0501040_0458254 | Ga0501040_0458254_85_576 | 160 |
| 623 | 3300049591 | Ga0501075_0003860 | Ga0501075_0003860_4576_5058 | 160 |
| 624 | 3300049741 | Ga0501079_0033042 | Ga0501079_0033042_3235_3717 | 160 |
| 625 | 3300049742 | Ga0501080_0589882 | Ga0501080_0589882_175_657 | 160 |
| 626 | 3300049824 | Ga0501045_0148668 | Ga0501045_0148668_463_945 | 160 |
| 627 | 3300050507 | nmdc:mga05p37_20293_c1 | nmdc:mga05p37_20293_c1_2109_2594 | 160 |
| 628 | 3300050507 | nmdc:mga05p37_66679_c1 | nmdc:mga05p37_66679_c1_3150_3635 | 160 |
| 629 | 3300050507 | nmdc:mga05p37_81432_c1 | nmdc:mga05p37_81432_c1_316_798 | 160 |
| 630 | 3300050507 | nmdc:mga05p37_972481_c1 | nmdc:mga05p37_972481_c1_264_746 | 160 |
| 631 | 3300050508 | nmdc:mga09592_236889_c1 | nmdc:mga09592_236889_c1_735_1220 | 160 |
| 632 | 3300050508 | nmdc:mga09592_3484_c1 | nmdc:mga09592_3484_c1_582_1067 | 160 |
| 633 | 3300050510 | nmdc:mga06r32_1408895_c1 | nmdc:mga06r32_1408895_c1_46_531 | 160 |
| 634 | 3300050510 | nmdc:mga06r32_290142_c1 | nmdc:mga06r32_290142_c1_552_1037 | 160 |
| 635 | 3300050510 | nmdc:mga06r32_31908_c1 | nmdc:mga06r32_31908_c1_1671_2156 | 160 |
| 636 | 3300050515 | nmdc:mga0a205_465582_c1 | nmdc:mga0a205_465582_c1_480_965 | 160 |
| 637 | 3300053085 | Ga0495619_0055928 | Ga0495619_0055928_1737_2255 | 160 |
| 638 | 3300054114 | Ga0501084_0017223 | Ga0501084_0017223_1319_1801 | 160 |
| 639 | 3300059644 | Ga0587075_010098 | Ga0587075_010098_374_865 | 160 |
| 640 | 3300060353 | Ga0501082_0189052 | Ga0501082_0189052_12_494 | 160 |
| 641 | 3300060353 | Ga0501082_0373633 | Ga0501082_0373633_289_780 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1n5w-assembly1.cif.gz_D | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.9744 | 5 | 160 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9723 | 4 | 156 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9712 | 5 | 157 |
| 1dgj-assembly1.cif.gz_A | crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 | 0.9653 | 6 | 158 |
| 3hrd-assembly1.cif.gz_H | crystal structure of nicotinate dehydrogenase | 0.9647 | 4 | 155 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q46801_1_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9922 | 2 | 77 | 3.10.20.30 |
| 1n5wA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9778 | 5 | 79 | 3.10.20.30 |
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.975 | 3 | 79 | 3.10.20.30 |
| 1sb3F01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9705 | 4 | 79 | 3.10.20.30 |
| 3hrdH01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9607 | 4 | 79 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L7WE32-F1-model_v4 | (2Fe-2S)-binding protein | 0.9899 | 4 | 154 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A2E3V100-F1-model_v4 | Ferredoxin | 0.9899 | 4 | 153 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A1K2HT67-F1-model_v4 | Nicotinate dehydrogenase subunit A | 0.9883 | 2 | 155 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A536CNY8-F1-model_v4 | (2Fe-2S)-binding protein | 0.9878 | 3 | 155 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A177QCX2-F1-model_v4 | Ferredoxin | 0.9876 | 4 | 156 |
GO:0016491
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar