F470473

General Info

Members Datasets Scaffolds Average Seq Length
626 378 596 401

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10009532|Ga0265331_100095322
Length 478
Sequence MHWDESVAVRPECLFERQLSSRGTRDLWEGRGVSRRLGTAVPAGRWSVQGGSLTREKVSGDMGLCMSENSSRAAAARLPVPAAPAAGATVMGILWALAVAHLLNDTIQSLIPAIYPLLKKSFGLNYGQVGTITFVFQVTASLLQPCVGWYTDRRPKPYSLPIGMGVTLTGLVLLSRAGNFPMILVSAAMVGAGSAIFHPEASRVARAASGGRHGFAQSLFQVGGNCGSALGPLAGLVIAAHGQPSLLWFSGVALLDMFILTRVGGWYQRRLAALHAARAAAGPTRPSPFSRGRVAGAVAVLVVLIFSKFFYMVSLSNYYTFYLIDRFHVSVARAQVCLFVFLFSVAAGTIIGGPMGDRIGRKRVIWISILGVAPFTLLLPHVSLPLAVVLTVFIGLILASAFSSILVYAQELVPGRVGLIAGLFFGFAFGAGGLGSALLGRLADRTSIGFVFEVCAYLPLIGLLTALLPDVETPRRHV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
6 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
7 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
8 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
9 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
10 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
11 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
12 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
13 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
14 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
15 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
16 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
17 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
18 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
19 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
20 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
21 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
22 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
23 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
24 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
25 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
26 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
27 2904424332 Duganella sp. 1411 Isolate Rhizosphere
28 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
29 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
30 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
31 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
32 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
33 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
36 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
37 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
40 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
44 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
57 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
69 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
70 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
71 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
72 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
73 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
74 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
83 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
84 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
90 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
91 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
92 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
97 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
98 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
111 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
112 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
113 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
117 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
118 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
119 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
120 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
125 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
126 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
131 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
157 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
158 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
218 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
220 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
221 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
222 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
226 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
227 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
228 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
229 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
230 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
231 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
234 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
235 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
236 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
237 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
240 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
241 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
242 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
243 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
244 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
245 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
248 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
250 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
252 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
255 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
256 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
266 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
267 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
270 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
273 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
274 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
275 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
276 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
277 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
278 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
279 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
280 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
281 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
284 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
285 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
286 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
287 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
288 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
289 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
303 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
304 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
305 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
306 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
307 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
308 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
309 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
310 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
311 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
312 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
313 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
327 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
334 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
338 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
342 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
343 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
344 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
351 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
352 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
353 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
354 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
355 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
356 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
357 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
358 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
359 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
360 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
361 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
362 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
363 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
364 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
365 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
366 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
367 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
368 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
369 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
370 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
371 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
372 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
373 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
374 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
375 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
376 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
377 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
378 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.41
Metatranscriptomes 0.64
Isolates 4.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.15
Nodule 1.12
Rhizoplane 3.19
Rhizosphere 79.87
Stem 0
Stem Tuber 0
Unclassified 7.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_789971 2162886007 Bacteria 2075
2 MRS1b_contig_4968207 2162886011 Bacteria 1664
3 JGI24739J22299_10001760 3300001989 Bacteria 8239
4 JGI25162J39368_1000804 3300002737 Bacteria 20830
5 rootH1_10009586 3300003316 Bacteria 72733
6 rootH1_10009586 3300003323 Bacteria 5685
7 rootH2_10013067 3300003320 Bacteria 4358
8 rootH2_10014493 3300003320 Bacteria 6222
9 rootH2_10101339 3300003320 Bacteria 2745
10 rootL2_10006488 3300003322 Bacteria 9795
11 rootL2_10221481 3300003322 Bacteria 3571
12 rootL2_10287946 3300003322 Bacteria 3080
13 rootH1_10005123 3300003323 Bacteria 16310
14 rootH1_10078729 3300003323 Bacteria 8139
15 rootH1_10145331 3300003323 Bacteria 5100
16 Ga0055526_1000136 3300003771 Bacteria 65004
17 Ga0055526_1007120 3300003771 Bacteria 5900
18 Ga0055526_1009765 3300003771 Bacteria 4563
19 Ga0055526_1013006 3300003771 Bacteria 3565
20 Ga0055524_1012130 3300003775 Bacteria 3326
21 Ga0055536_1000102 3300003781 Bacteria 73767
22 Ga0055534_1003928 3300003784 Bacteria 4492
23 Ga0065714_10083682 3300005288 Bacteria 2237
24 Ga0065704_10070670 3300005289 Bacteria 17980
25 Ga0065704_10084663 3300005289 Bacteria 3310
26 Ga0065712_10073199 3300005290 Bacteria 4471
27 Ga0065715_10093330 3300005293 Bacteria 4724
28 Ga0065715_10098358 3300005293 Bacteria 3560
29 Ga0065707_10002678 3300005295 Bacteria 9541
30 Ga0070658_10000561 3300005327 Bacteria 32242
31 Ga0070658_10088801 3300005327 Bacteria 2545
32 Ga0070658_10157965 3300005327 Bacteria 1901
33 Ga0070676_10007250 3300005328 Bacteria 5945
34 Ga0070676_10032355 3300005328 Bacteria 2996
35 Ga0070683_100004660 3300005329 Bacteria 11330
36 Ga0070683_100063615 3300005329 Bacteria 3432
37 Ga0070683_100184698 3300005329 Bacteria 1979
38 Ga0070683_100327238 3300005329 Bacteria 1459
39 Ga0070690_100073052 3300005330 Bacteria 2231
40 Ga0070670_100001031 3300005331 Bacteria 22061
41 Ga0070670_100215855 3300005331 Bacteria 1669
42 Ga0068869_100003939 3300005334 Bacteria 9169
43 Ga0070666_10050437 3300005335 Bacteria 2799
44 Ga0070680_100058625 3300005336 Bacteria 3149
45 Ga0070680_100095830 3300005336 Bacteria 2460
46 Ga0070680_100108936 3300005336 Bacteria 2304
47 Ga0070682_100003265 3300005337 Bacteria 8993
48 Ga0070660_100002940 3300005339 Bacteria 11721
49 Ga0070660_100110058 3300005339 Bacteria 2191
50 Ga0070689_100063673 3300005340 Bacteria 2869
51 Ga0070689_100172970 3300005340 Bacteria 1751
52 Ga0070687_100002062 3300005343 Bacteria 7389
53 Ga0070661_100008737 3300005344 Bacteria 7010
54 Ga0070661_100019269 3300005344 Bacteria 4862
55 Ga0070668_100008165 3300005347 Bacteria 7774
56 Ga0070668_100128849 3300005347 Bacteria 2029
57 Ga0070669_100005300 3300005353 Bacteria 9310
58 Ga0070669_100061566 3300005353 Bacteria 2758
59 Ga0070669_100108936 3300005353 Bacteria 2100
60 Ga0070675_100000206 3300005354 Bacteria 37528
61 Ga0070675_100011275 3300005354 Bacteria 6997
62 Ga0070675_100013574 3300005354 Bacteria 6405
63 Ga0070675_100014959 3300005354 Bacteria 6126
64 Ga0070675_100071080 3300005354 Bacteria 2886
65 Ga0070671_100008146 3300005355 Bacteria 8387
66 Ga0070674_100002577 3300005356 Bacteria 10037
67 Ga0070673_100016413 3300005364 Bacteria 5236
68 Ga0070688_100044973 3300005365 Bacteria 2726
69 Ga0070688_100051175 3300005365 Bacteria 2576
70 Ga0070659_100033595 3300005366 Bacteria 3985
71 Ga0070667_100012755 3300005367 Bacteria 6947
72 Ga0070667_100035024 3300005367 Bacteria 4204
73 Ga0070667_100069439 3300005367 Unclassified 2998
74 Ga0070709_10159429 3300005434 Bacteria 1567
75 Ga0070714_100001985 3300005435 Bacteria 14951
76 Ga0070714_100168966 3300005435 Bacteria 1984
77 Ga0070713_100098363 3300005436 Bacteria 2530
78 Ga0070713_100153824 3300005436 Bacteria 2048
79 Ga0070711_100214055 3300005439 Unclassified 1494
80 Ga0070705_100033032 3300005440 Bacteria 2881
81 Ga0070700_100136007 3300005441 Bacteria 1664
82 Ga0070708_100050999 3300005445 Unclassified 3665
83 Ga0070663_100028289 3300005455 Bacteria 3815
84 Ga0070678_100103563 3300005456 Bacteria 2211
85 Ga0070662_100028044 3300005457 Bacteria 3916
86 Ga0070662_100039839 3300005457 Bacteria 3343
87 Ga0070681_10130564 3300005458 Bacteria 2445
88 Ga0068867_100005913 3300005459 Bacteria 8676
89 Ga0070685_10009315 3300005466 Bacteria 5068
90 Ga0070706_100076929 3300005467 Unclassified 3088
91 Ga0070707_100103895 3300005468 Unclassified 2754
92 Ga0070698_100385901 3300005471 Unclassified 1333
93 Ga0070699_100071694 3300005518 Unclassified 3013
94 Ga0070679_100007344 3300005530 Bacteria 10295
95 Ga0070679_100018570 3300005530 Bacteria 6750
96 Ga0070684_100014578 3300005535 Bacteria 6372
97 Ga0070697_100007686 3300005536 Bacteria 8395
98 Ga0070697_100018524 3300005536 Bacteria 5489
99 Ga0068853_100000017 3300005539 Bacteria 170544
100 Ga0068853_100014097 3300005539 Bacteria 6544
101 Ga0068853_100100065 3300005539 Bacteria 2562
102 Ga0070672_100002535 3300005543 Bacteria 11637
103 Ga0070672_100015025 3300005543 Bacteria 5501
104 Ga0070686_100001654 3300005544 Bacteria 12453
105 Ga0070696_100017631 3300005546 Bacteria 4821
106 Ga0070693_100009663 3300005547 Bacteria 4802
107 Ga0070665_100000005 3300005548 Bacteria 734905
108 Ga0070665_100000370 3300005548 Bacteria 66870
109 Ga0070665_100016954 3300005548 Bacteria 7304
110 Ga0068855_100009625 3300005563 Bacteria 11657
111 Ga0068855_100042355 3300005563 Bacteria 5394
112 Ga0068855_100136862 3300005563 Bacteria 2794
113 Ga0070664_100008688 3300005564 Bacteria 8222
114 Ga0070664_100052088 3300005564 Bacteria 3467
115 Ga0068857_100016166 3300005577 Bacteria 6534
116 Ga0068857_100105018 3300005577 Bacteria 2536
117 Ga0068854_100041639 3300005578 Bacteria 3247
118 Ga0068856_100012777 3300005614 Bacteria 8129
119 Ga0068852_100074705 3300005616 Bacteria 2986
120 Ga0068859_100002478 3300005617 Bacteria 18767
121 Ga0068859_100025684 3300005617 Bacteria 5908
122 Ga0068859_100149322 3300005617 Bacteria 2413
123 Ga0068864_100000364 3300005618 Bacteria 39580
124 Ga0068864_100140547 3300005618 Bacteria 2178
125 Ga0068864_100249663 3300005618 Bacteria 1647
126 Ga0068864_100276463 3300005618 Bacteria 1566
127 Ga0068866_10014495 3300005718 Bacteria 3483
128 Ga0068861_100001551 3300005719 Bacteria 14594
129 Ga0068851_10006749 3300005834 Bacteria 5251
130 Ga0068863_100000614 3300005841 Bacteria 36138
131 Ga0068863_100003306 3300005841 Bacteria 15914
132 Ga0068863_100023810 3300005841 Bacteria 5844
133 Ga0068858_100011854 3300005842 Bacteria 8217
134 Ga0068858_100013088 3300005842 Bacteria 7824
135 Ga0068858_100293862 3300005842 Bacteria 1549
136 Ga0068860_100009474 3300005843 Bacteria 9671
137 Ga0068860_100013862 3300005843 Bacteria 7904
138 Ga0068860_100039430 3300005843 Bacteria 4518
139 Ga0068860_100369580 3300005843 Bacteria 1414
140 Ga0068862_100004578 3300005844 Bacteria 11663
141 Ga0068862_100013250 3300005844 Bacteria 6820
142 Ga0068862_100039852 3300005844 Bacteria 3991
143 Ga0068862_100050848 3300005844 Bacteria 3543
144 Ga0068862_100054084 3300005844 Bacteria 3437
145 Ga0081455_10052713 3300005937 Bacteria 3480
146 Ga0070717_10003461 3300006028 Bacteria 11301
147 Ga0075363_100043560 3300006048 Unclassified 2375
148 Ga0075366_10005270 3300006195 Bacteria 7004
149 Ga0097621_100008034 3300006237 Bacteria 7575
150 Ga0068871_100009083 3300006358 Bacteria 7183
151 Ga0075428_100017535 3300006844 Bacteria 7910
152 Ga0075428_100018325 3300006844 Bacteria 7740
153 Ga0075430_100072448 3300006846 Bacteria 2889
154 Ga0075431_100014257 3300006847 Bacteria 8038
155 Ga0075431_100138873 3300006847 Bacteria 2505
156 Ga0075433_10034982 3300006852 Bacteria 4318
157 Ga0075434_100078965 3300006871 Bacteria 3287
158 Ga0075434_100325622 3300006871 Bacteria 1557
159 Ga0075429_100109563 3300006880 Bacteria 2414
160 Ga0068865_100147206 3300006881 Bacteria 1783
161 Ga0075436_100001071 3300006914 Bacteria 18405
162 Ga0097620_100002478 3300006931 Bacteria 18767
163 Ga0097620_100025684 3300006931 Bacteria 5908
164 Ga0097620_100149333 3300006931 Bacteria 2413
165 Ga0099826_10000007 3300006948 Bacteria 393518
166 Ga0105251_10002762 3300009011 Bacteria 13404
167 Ga0105244_10000757 3300009036 Bacteria 27596
168 Ga0105240_10013135 3300009093 Bacteria 11395
169 Ga0105240_10036770 3300009093 Bacteria 6296
170 Ga0105240_10121033 3300009093 Bacteria 3151
171 Ga0105240_10161224 3300009093 Bacteria 2663
172 Ga0111539_10000050 3300009094 Bacteria 118845
173 Ga0111539_10001033 3300009094 Bacteria 36485
174 Ga0111539_10001140 3300009094 Bacteria 35130
175 Ga0111539_10238999 3300009094 Bacteria 2114
176 Ga0105245_10055494 3300009098 Bacteria 3558
177 Ga0105247_10020299 3300009101 Bacteria 3995
178 Ga0114129_10627986 3300009147 Bacteria 1389
179 Ga0105241_10035226 3300009174 Bacteria 3764
180 Ga0105248_10015251 3300009177 Bacteria 8469
181 Ga0105248_10019102 3300009177 Bacteria 7579
182 Ga0105237_10014419 3300009545 Bacteria 8266
183 Ga0105237_10156003 3300009545 Bacteria 2280
184 Ga0105238_10007127 3300009551 Bacteria 11186
185 Ga0105238_10014605 3300009551 Bacteria 7940
186 Ga0105238_10041883 3300009551 Bacteria 4638
187 Ga0105238_10406586 3300009551 Unclassified 1355
188 Ga0105249_10004119 3300009553 Bacteria 12553
189 Ga0105249_10053806 3300009553 Bacteria 3680
190 Ga0105249_10070999 3300009553 Bacteria 3216
191 Ga0105239_10282371 3300010375 Bacteria 1869
192 Ga0105239_10289640 3300010375 Bacteria 1844
193 Ga0105246_10030198 3300011119 Bacteria 3577
194 Ga0157373_10008804 3300013100 Bacteria 7478
195 Ga0157371_10029047 3300013102 Bacteria 4003
196 Ga0157371_10046477 3300013102 Unclassified 3088
197 Ga0157371_10053271 3300013102 Bacteria 2873
198 Ga0157371_10084899 3300013102 Bacteria 2243
199 Ga0157371_10096072 3300013102 Unclassified 2100
200 Ga0157370_10018018 3300013104 Bacteria 7108
201 Ga0157370_10020068 3300013104 Bacteria 6684
202 Ga0157370_10088396 3300013104 Bacteria 2910
203 Ga0157369_10014890 3300013105 Bacteria 8779
204 Ga0157369_10047749 3300013105 Bacteria 4647
205 Ga0157374_10000071 3300013296 Bacteria 102927
206 Ga0157374_10055031 3300013296 Bacteria 3712
207 Ga0157374_10146522 3300013296 Bacteria 2293
208 Ga0157374_10360676 3300013296 Bacteria 1445
209 Ga0157378_10010011 3300013297 Bacteria 8269
210 Ga0157378_10048647 3300013297 Bacteria 3770
211 Ga0163162_10000004 3300013306 Bacteria 505593
212 Ga0163162_10007093 3300013306 Bacteria 10874
213 Ga0163162_10057010 3300013306 Bacteria 3934
214 Ga0157372_10034465 3300013307 Bacteria 5565
215 Ga0157372_10104251 3300013307 Bacteria 3242
216 Ga0157372_10162908 3300013307 Bacteria 2578
217 Ga0157372_10416479 3300013307 Unclassified 1566
218 Ga0157375_10023530 3300013308 Bacteria 5685
219 Ga0163163_10020303 3300014325 Bacteria 6253
220 Ga0163163_10042395 3300014325 Unclassified 4457
221 Ga0157380_10014880 3300014326 Bacteria 5702
222 Ga0157377_10004362 3300014745 Bacteria 6501
223 Ga0157377_10020487 3300014745 Bacteria 3466
224 Ga0157376_10000170 3300014969 Bacteria 45040
225 Ga0157376_10020496 3300014969 Bacteria 5115
226 Ga0182007_10021466 3300015262 Bacteria 2292
227 Ga0163161_10000447 3300017792 Bacteria 34461
228 Ga0163161_10018985 3300017792 Bacteria 4819
229 Ga0213872_10000051 3300021361 Bacteria 107261
230 Ga0213872_10074667 3300021361 Bacteria 1526
231 Ga0213876_10008820 3300021384 Bacteria 5443
232 Ga0213876_10118895 3300021384 Bacteria 1403
233 Ga0209437_100104 3300025233 Bacteria 220736
234 Ga0209233_1000054 3300025261 Bacteria 439669
235 Ga0209565_1001791 3300025263 Bacteria 8663
236 Ga0209130_1002263 3300025284 Bacteria 9934
237 Ga0209675_1000241 3300025291 Bacteria 54674
238 Ga0209676_1000036 3300025292 Bacteria 457623
239 Ga0209025_1000770 3300025294 Bacteria 53136
240 Ga0209025_1001261 3300025294 Bacteria 35022
241 Ga0209564_1000693 3300025295 Bacteria 49337
242 Ga0209564_1000736 3300025295 Bacteria 46496
243 Ga0209758_1009723 3300025297 Bacteria 5909
244 Ga0209256_1000978 3300025299 Bacteria 34333
245 Ga0207655_1000003 3300025728 Bacteria 1081376
246 Ga0207713_1006462 3300025735 Bacteria 7138
247 Ga0207688_10083138 3300025901 Unclassified 1831
248 Ga0207647_10043961 3300025904 Unclassified 2793
249 Ga0207645_10010755 3300025907 Bacteria 6273
250 Ga0207645_10042021 3300025907 Bacteria 2926
251 Ga0207705_10002064 3300025909 Bacteria 15622
252 Ga0207705_10233569 3300025909 Bacteria 1399
253 Ga0207684_10042479 3300025910 Unclassified 3854
254 Ga0207654_10049315 3300025911 Bacteria 2414
255 Ga0207707_10121786 3300025912 Bacteria 2281
256 Ga0207695_10018573 3300025913 Bacteria 8033
257 Ga0207671_10117978 3300025914 Bacteria 2026
258 Ga0207660_10025925 3300025917 Bacteria 3986
259 Ga0207660_10157864 3300025917 Bacteria 1747
260 Ga0207662_10011026 3300025918 Bacteria 5002
261 Ga0207657_10003445 3300025919 Bacteria 16880
262 Ga0207657_10004443 3300025919 Bacteria 14837
263 Ga0207649_10010783 3300025920 Bacteria 5025
264 Ga0207649_10075401 3300025920 Bacteria 2167
265 Ga0207652_10052790 3300025921 Bacteria 3490
266 Ga0207652_10056075 3300025921 Bacteria 3391
267 Ga0207652_10063565 3300025921 Bacteria 3192
268 Ga0207646_10134418 3300025922 Bacteria 2227
269 Ga0207681_10002183 3300025923 Bacteria 12476
270 Ga0207694_10009223 3300025924 Bacteria 7444
271 Ga0207650_10002784 3300025925 Bacteria 12080
272 Ga0207650_10029672 3300025925 Bacteria 3934
273 Ga0207650_10069093 3300025925 Bacteria 2654
274 Ga0207650_10194865 3300025925 Bacteria 1620
275 Ga0207659_10001426 3300025926 Bacteria 14241
276 Ga0207659_10055363 3300025926 Bacteria 2837
277 Ga0207700_10025463 3300025928 Bacteria 4109
278 Ga0207664_10000858 3300025929 Bacteria 20574
279 Ga0207664_10040423 3300025929 Bacteria 3626
280 Ga0207644_10001621 3300025931 Bacteria 14498
281 Ga0207706_10029867 3300025933 Bacteria 4865
282 Ga0207706_10044977 3300025933 Bacteria 3911
283 Ga0207670_10036514 3300025936 Bacteria 3196
284 Ga0207669_10003403 3300025937 Bacteria 6880
285 Ga0207704_10107488 3300025938 Bacteria 1877
286 Ga0207704_10159230 3300025938 Bacteria 1604
287 Ga0207704_10187905 3300025938 Bacteria 1500
288 Ga0207691_10012169 3300025940 Bacteria 8249
289 Ga0207691_10017237 3300025940 Bacteria 6852
290 Ga0207691_10023782 3300025940 Bacteria 5767
291 Ga0207711_10012402 3300025941 Bacteria 7085
292 Ga0207711_10064726 3300025941 Bacteria 3158
293 Ga0207689_10003215 3300025942 Bacteria 14965
294 Ga0207689_10039174 3300025942 Bacteria 3924
295 Ga0207689_10056423 3300025942 Bacteria 3232
296 Ga0207661_10061388 3300025944 Bacteria 3037
297 Ga0207661_10083649 3300025944 Bacteria 2641
298 Ga0207661_10131146 3300025944 Bacteria 2147
299 Ga0207661_10131700 3300025944 Bacteria 2143
300 Ga0207661_10227819 3300025944 Bacteria 1649
301 Ga0207679_10009876 3300025945 Bacteria 6127
302 Ga0207667_10044161 3300025949 Bacteria 4724
303 Ga0207667_10053025 3300025949 Bacteria 4268
304 Ga0207712_10022057 3300025961 Bacteria 4188
305 Ga0207712_10027877 3300025961 Bacteria 3773
306 Ga0207668_10117907 3300025972 Bacteria 2004
307 Ga0207640_10189892 3300025981 Bacteria 1548
308 Ga0207658_10076586 3300025986 Unclassified 2549
309 Ga0207658_10076696 3300025986 Bacteria 2547
310 Ga0207703_10004606 3300026035 Bacteria 11284
311 Ga0207703_10109536 3300026035 Bacteria 2354
312 Ga0207639_10000031 3300026041 Bacteria 170640
313 Ga0207639_10154764 3300026041 Bacteria 1924
314 Ga0207678_10000707 3300026067 Bacteria 30447
315 Ga0207708_10084737 3300026075 Bacteria 2437
316 Ga0207702_10027774 3300026078 Bacteria 4701
317 Ga0207702_10077939 3300026078 Bacteria 2868
318 Ga0207641_10008328 3300026088 Bacteria 8571
319 Ga0207641_10014158 3300026088 Bacteria 6537
320 Ga0207641_10026105 3300026088 Bacteria 4820
321 Ga0207641_10084489 3300026088 Bacteria 2763
322 Ga0207641_10277550 3300026088 Bacteria 1575
323 Ga0207648_10002941 3300026089 Bacteria 18032
324 Ga0207676_10022505 3300026095 Bacteria 4636
325 Ga0207676_10181301 3300026095 Bacteria 1844
326 Ga0207674_10019990 3300026116 Bacteria 7247
327 Ga0207674_10072274 3300026116 Bacteria 3465
328 Ga0207674_10094264 3300026116 Unclassified 2980
329 Ga0207674_10213692 3300026116 Bacteria 1877
330 Ga0207675_100003708 3300026118 Bacteria 14882
331 Ga0207675_100006786 3300026118 Bacteria 10833
332 Ga0207683_10041638 3300026121 Bacteria 4011
333 Ga0207683_10075673 3300026121 Bacteria 2980
334 Ga0207683_10160918 3300026121 Bacteria 2029
335 Ga0207698_10076622 3300026142 Bacteria 2677
336 Ga0209371_1001812 3300027312 Bacteria 13335
337 Ga0209282_1000059 3300027666 Bacteria 97821
338 Ga0209974_10022940 3300027876 Bacteria 2065
339 Ga0207428_10003027 3300027907 Bacteria 16548
340 Ga0207428_10009632 3300027907 Bacteria 8651
341 Ga0207428_10041944 3300027907 Bacteria 3703
342 Ga0265354_1001773 3300028016 Bacteria 2949
343 Ga0265355_1000237 3300028036 Bacteria 2551
344 Ga0268266_10000012 3300028379 Bacteria 734912
345 Ga0268266_10000620 3300028379 Bacteria 48325
346 Ga0268266_10001402 3300028379 Bacteria 28793
347 Ga0268266_10147537 3300028379 Bacteria 2116
348 Ga0268265_10002852 3300028380 Bacteria 12717
349 Ga0268265_10014462 3300028380 Bacteria 5377
350 Ga0268265_10045413 3300028380 Bacteria 3278
351 Ga0268264_10001864 3300028381 Bacteria 19166
352 Ga0268264_10004727 3300028381 Bacteria 11568
353 Ga0268264_10018017 3300028381 Bacteria 5775
354 Ga0268264_10301085 3300028381 Bacteria 1509
355 Ga0265319_1000087 3300028563 Bacteria 71928
356 Ga0265319_1006331 3300028563 Bacteria 5497
357 Ga0265319_1025940 3300028563 Bacteria 2092
358 Ga0265334_10001402 3300028573 Bacteria 11601
359 Ga0265334_10011133 3300028573 Bacteria 3791
360 Ga0265318_10000762 3300028577 Bacteria 21446
361 Ga0307515_10098140 3300028794 Bacteria 3571
362 Ga0307515_10258623 3300028794 Bacteria 1481
363 Ga0265338_10033903 3300028800 Bacteria 4946
364 Ga0268256_1003763 3300030500 Bacteria 6650
365 Ga0265770_1000137 3300030878 Bacteria 8966
366 Ga0265760_10001244 3300031090 Bacteria 7461
367 Ga0265320_10006929 3300031240 Bacteria 7076
368 Ga0265325_10024572 3300031241 Bacteria 3277
369 Ga0265339_10000096 3300031249 Bacteria 74964
370 Ga0265331_10009532 3300031250 Bacteria 5447
371 Ga0265327_10000747 3300031251 Bacteria 50580
372 Ga0265327_10006483 3300031251 Bacteria 9343
373 Ga0307408_100003852 3300031548 Bacteria 10204
374 Ga0307408_100018971 3300031548 Bacteria 4625
375 Ga0307408_100050094 3300031548 Bacteria 3002
376 Ga0265313_10000024 3300031595 Bacteria 138587
377 Ga0265313_10011763 3300031595 Bacteria 5413
378 Ga0307508_10000026 3300031616 Bacteria 171622
379 Ga0316575_10055241 3300031665 Bacteria 1581
380 Ga0265314_10001852 3300031711 Bacteria 22676
381 Ga0316578_10004658 3300031728 Bacteria 6508
382 Ga0307413_10018781 3300031824 Bacteria 3636
383 Ga0307413_10079807 3300031824 Bacteria 2093
384 Ga0307406_10003478 3300031901 Bacteria 8567
385 Ga0307409_100038139 3300031995 Bacteria 3551
386 Ga0307416_100176364 3300032002 Bacteria 1997
387 Ga0316593_10008621 3300032168 Bacteria 2849
388 Ga0307510_10000260 3300033180 Bacteria 48220
389 Ga0316596_1024829 3300033541 Bacteria 1540
390 Ga0373943_0036110 3300035170 Bacteria 2366
391 Ga0373943_0073651 3300035170 Bacteria 1735
392 Ga0373931_0012340 3300035691 Bacteria 4139
393 Ga0373927_0000702 3300035695 Bacteria 25625
394 Ga0373947_0002407 3300035725 Bacteria 11308
395 Ga0316584_0000728 3300036712 Bacteria 18275
396 Ga0316584_0083956 3300036712 Bacteria 2385
397 Ga0373925_0001918 3300037068 Bacteria 17221
398 Ga0373925_0005059 3300037068 Bacteria 9876
399 Ga0395899_0020587 3300037312 Bacteria 5000
400 Ga0395900_0130156 3300037418 Bacteria 2579
401 Ga0395905_0033708 3300037471 Bacteria 4809
402 Ga0395905_0043436 3300037471 Bacteria 4217
403 Ga0436364_0155742 3300037853 Bacteria 4134
404 Ga0395901_0119904 3300038443 Bacteria 2764
405 Ga0436365_0726921 3300039437 Bacteria 59637
406 Ga0436360_0285869 3300039438 Bacteria 1948
407 Ga0436361_0024002 3300039447 Bacteria 58799
408 Ga0436361_0111000 3300039447 Bacteria 5675
409 Ga0436361_0333614 3300039447 Bacteria 3586
410 Ga0436361_0702269 3300039447 Bacteria 4832
411 Ga0451841_1210261 3300041498 Bacteria 3111
412 Ga0451853_2872322 3300041512 Bacteria 3544
413 Ga0453684_0010740 3300044712 Bacteria 15557
414 Ga0451576_0000856 3300045051 Bacteria 58909
415 Ga0451576_0000892 3300045051 Bacteria 56717
416 Ga0451576_0037611 3300045051 Bacteria 5126
417 Ga0466967_0059481 3300045976 Bacteria 3383
418 Ga0495627_001304 3300046453 Bacteria 15211
419 Ga0495638_0084084 3300046460 Bacteria 1926
420 Ga0495650_0000027 3300046471 Bacteria 475071
421 Ga0495650_0001458 3300046471 Bacteria 22665
422 Ga0495650_0002398 3300046471 Bacteria 15306
423 Ga0495605_0005711 3300046474 Bacteria 7223
424 Ga0495596_0000057 3300046500 Bacteria 81281
425 Ga0495607_0002727 3300046501 Bacteria 14083
426 Ga0495606_0000123 3300046507 Bacteria 131654
427 Ga0495606_0002544 3300046507 Bacteria 20979
428 Ga0495606_0018719 3300046507 Bacteria 5182
429 Ga0495610_0000543 3300046512 Bacteria 37709
430 Ga0495616_0031404 3300046513 Bacteria 2781
431 Ga0495620_0021160 3300046515 Bacteria 3163
432 Ga0495637_0022409 3300046520 Bacteria 2881
433 Ga0495609_0001051 3300046538 Bacteria 19356
434 Ga0495645_0143038 3300046543 Bacteria 1667
435 Ga0495633_0001402 3300046558 Bacteria 18790
436 Ga0495625_0000377 3300046660 Bacteria 68156
437 Ga0495625_0028331 3300046660 Bacteria 4202
438 Ga0495658_0003329 3300046683 Bacteria 7974
439 Ga0495671_0000364 3300046692 Bacteria 37524
440 Ga0495672_0001402 3300047320 Bacteria 23718
441 Ga0495681_0001901 3300047470 Bacteria 15333
442 Ga0495686_0000090 3300047472 Bacteria 193179
443 Ga0495686_0000132 3300047472 Bacteria 151609
444 Ga0495686_0006543 3300047472 Bacteria 8892
445 Ga0495686_0037646 3300047472 Bacteria 3098
446 Ga0495686_0094632 3300047472 Bacteria 1810
447 Ga0496100_0182220 3300048903 Bacteria 1519
448 Ga0496101_0008220 3300048904 Bacteria 6814
449 Ga0496102_0337449 3300048905 Bacteria 1420
450 Ga0496103_0013858 3300048906 Bacteria 4786
451 Ga0496104_0045498 3300048907 Bacteria 4128
452 Ga0496108_0020397 3300048911 Bacteria 5448
453 Ga0496108_0030507 3300048911 Bacteria 4469
454 Ga0496109_0000770 3300048912 Bacteria 26636
455 Ga0496109_0012209 3300048912 Bacteria 7411
456 Ga0496110_0093425 3300048913 Bacteria 2693
457 Ga0496110_0204917 3300048913 Bacteria 1792
458 Ga0496112_0000221 3300048915 Bacteria 36971
459 Ga0496112_0022338 3300048915 Bacteria 6028
460 Ga0496112_0056345 3300048915 Bacteria 3868
461 Ga0496112_0461530 3300048915 Bacteria 1208
462 Ga0496113_0000588 3300048916 Bacteria 18149
463 Ga0496113_0079475 3300048916 Bacteria 2511
464 Ga0496114_0011142 3300048917 Bacteria 7178
465 Ga0496114_0075407 3300048917 Bacteria 2841
466 Ga0496115_0004131 3300048918 Bacteria 10478
467 Ga0496116_0004563 3300048919 Bacteria 13137
468 Ga0496116_0007360 3300048919 Bacteria 9782
469 Ga0496117_0091132 3300048920 Bacteria 1962
470 Ga0496119_0000043 3300048922 Bacteria 192373
471 Ga0496120_0000009 3300048923 Bacteria 386727
472 Ga0496121_0010524 3300048924 Bacteria 10415
473 Ga0496121_0014255 3300048924 Bacteria 8454
474 Ga0496121_0035174 3300048924 Bacteria 4494
475 Ga0496121_0143947 3300048924 Bacteria 1764
476 Ga0496121_0147817 3300048924 Bacteria 1734
477 Ga0496122_0001659 3300048925 Bacteria 34509
478 Ga0496122_0079087 3300048925 Bacteria 2300
479 Ga0496123_0000648 3300048926 Bacteria 57922
480 Ga0496124_0020008 3300048927 Bacteria 6202
481 Ga0496125_0035727 3300048928 Bacteria 4353
482 Ga0495678_008988 3300049459 Bacteria 4990
483 Ga0501299_007998 3300049522 Bacteria 1708
484 Ga0501031_0000039 3300049568 Bacteria 72794
485 Ga0501032_0005648 3300049569 Bacteria 9269
486 Ga0501032_0008417 3300049569 Bacteria 7525
487 Ga0501032_0037794 3300049569 Bacteria 3290
488 Ga0501033_0000750 3300049570 Bacteria 29867
489 Ga0501033_0074526 3300049570 Bacteria 2492
490 Ga0501033_0077813 3300049570 Bacteria 2434
491 Ga0501034_0001018 3300049571 Bacteria 40183
492 Ga0501034_0001701 3300049571 Bacteria 28339
493 Ga0501034_0059150 3300049571 Bacteria 3850
494 Ga0501036_0039808 3300049572 Bacteria 3977
495 Ga0501036_0075054 3300049572 Bacteria 2860
496 Ga0501037_0002415 3300049573 Bacteria 13503
497 Ga0501037_0008225 3300049573 Bacteria 7649
498 Ga0501037_0030630 3300049573 Bacteria 3975
499 Ga0501038_0001659 3300049574 Bacteria 20640
500 Ga0501038_0026484 3300049574 Bacteria 5164
501 Ga0501038_0094257 3300049574 Bacteria 2503
502 Ga0501038_0264165 3300049574 Bacteria 1359
503 Ga0501040_0011798 3300049576 Bacteria 5717
504 Ga0501042_0001847 3300049578 Bacteria 12712
505 Ga0501043_0043010 3300049579 Bacteria 3551
506 Ga0501043_0128327 3300049579 Bacteria 1988
507 Ga0501043_0155357 3300049579 Bacteria 1789
508 Ga0501046_0000536 3300049580 Bacteria 37635
509 Ga0501046_0032913 3300049580 Bacteria 4194
510 Ga0501046_0043740 3300049580 Bacteria 3565
511 Ga0501047_0001919 3300049581 Bacteria 19982
512 Ga0501047_0023354 3300049581 Bacteria 5938
513 Ga0501047_0049454 3300049581 Bacteria 4060
514 Ga0501047_0064340 3300049581 Bacteria 3537
515 Ga0501047_0079504 3300049581 Bacteria 3152
516 Ga0501048_0016062 3300049582 Bacteria 5521
517 Ga0501067_0025056 3300049583 Bacteria 3308
518 Ga0501067_0051895 3300049583 Bacteria 2272
519 Ga0501069_0027087 3300049585 Bacteria 3141
520 Ga0501070_0009957 3300049586 Bacteria 8038
521 Ga0501070_0047738 3300049586 Bacteria 3557
522 Ga0501070_0134597 3300049586 Bacteria 2041
523 Ga0501073_0104269 3300049589 Bacteria 1968
524 Ga0501074_0002131 3300049590 Bacteria 13682
525 Ga0501074_0009912 3300049590 Bacteria 6922
526 Ga0501076_0013211 3300049592 Bacteria 6188
527 Ga0501077_0034372 3300049593 Bacteria 3227
528 Ga0501243_000107 3300049675 Bacteria 9013
529 Ga0501243_008107 3300049675 Bacteria 1616
530 Ga0501249_000018 3300049679 Bacteria 113532
531 Ga0501249_006960 3300049679 Bacteria 2330
532 Ga0501079_0002062 3300049741 Bacteria 14411
533 Ga0501080_0014395 3300049742 Bacteria 7284
534 Ga0501080_0048263 3300049742 Bacteria 3963
535 Ga0501080_0095950 3300049742 Bacteria 2753
536 Ga0501081_0018613 3300049743 Bacteria 4615
537 Ga0501081_0021640 3300049743 Bacteria 4292
538 Ga0501241_000341 3300049758 Bacteria 10302
539 Ga0501035_0000333 3300049822 Bacteria 54985
540 Ga0501035_0009258 3300049822 Bacteria 9156
541 Ga0501035_0018304 3300049822 Bacteria 6454
542 Ga0501035_0032147 3300049822 Bacteria 4776
543 Ga0501044_0000133 3300049823 Bacteria 91116
544 Ga0501044_0000293 3300049823 Bacteria 63533
545 Ga0501044_0006477 3300049823 Bacteria 12932
546 Ga0501044_0020839 3300049823 Bacteria 6998
547 Ga0501044_0033634 3300049823 Bacteria 5385
548 Ga0501045_0051583 3300049824 Bacteria 3002
549 nmdc:mga03683_99_c3 3300050489 Bacteria 12731
550 nmdc:mga03n38_6968_c1 3300050490 Unclassified 3970
551 nmdc:mga0k408_6494_c1 3300050493 Bacteria 6233
552 nmdc:mga0k408_770_c1 3300050493 Bacteria 17585
553 nmdc:mga09592_144678_c1 3300050508 Bacteria 2050
554 nmdc:mga0qj67_159093_c1 3300050509 Bacteria 1834
555 nmdc:mga0qj67_30594_c1 3300050509 Bacteria 4192
556 nmdc:mga0qj67_3998_c1 3300050509 Bacteria 10676
557 nmdc:mga06r32_159476_c1 3300050510 Bacteria 2238
558 nmdc:mga06r32_16077_c1 3300050510 Bacteria 6813
559 nmdc:mga06r32_23611_c1 3300050510 Bacteria 5693
560 nmdc:mga06r32_83123_c1 3300050510 Bacteria 3120
561 nmdc:mga08y16_30876_c1 3300050511 Bacteria 5635
562 nmdc:mga08y16_33_c1 3300050511 Bacteria 172528
563 nmdc:mga08y16_445_c1 3300050511 Bacteria 38283
564 nmdc:mga0n895_410571_c1 3300050512 Bacteria 1369
565 nmdc:mga08x19_56407_c1 3300050514 Bacteria 2535
566 nmdc:mga0a205_143064_c1 3300050515 Bacteria 1971
567 Ga0500610_0123868 3300053079 Bacteria 1320
568 Ga0500635_0000099 3300053080 Bacteria 52195
569 Ga0500635_0010903 3300053080 Bacteria 2569
570 Ga0500578_0216823 3300053086 Bacteria 1165
571 Ga0500651_0039664 3300053093 Bacteria 2965
572 Ga0500641_0000232 3300053096 Bacteria 20906
573 Ga0500555_000465 3300053103 Bacteria 16792
574 Ga0500555_018866 3300053103 Bacteria 1988
575 Ga0500556_0000237 3300053104 Bacteria 44734
576 Ga0500595_001081 3300053119 Bacteria 15120
577 Ga0500595_012359 3300053119 Unclassified 3306
578 Ga0500608_001029 3300053122 Bacteria 9991
579 Ga0500618_000089 3300053125 Bacteria 74800
580 Ga0500618_000875 3300053125 Bacteria 16083
581 Ga0500642_0004362 3300053130 Unclassified 4420
582 Ga0500658_0008805 3300053134 Unclassified 3725
583 Ga0500559_0000006 3300053136 Bacteria 229895
584 Ga0500573_0011836 3300053140 Bacteria 4890
585 Ga0500590_002901 3300053148 Bacteria 7774
586 Ga0500622_0131317 3300053156 Bacteria 1203
587 Ga0500624_000121 3300053157 Bacteria 35470
588 Ga0500636_0015213 3300053177 Bacteria 4530
589 Ga0500637_0001981 3300053178 Bacteria 8904
590 Ga0500645_003649 3300053730 Bacteria 6156
591 Ga0500596_003399 3300053735 Bacteria 3031
592 Ga0501084_0005613 3300054114 Bacteria 10303
593 Ga0590071_007344 3300059421 Bacteria 2605
594 Ga0501082_0031062 3300060353 Bacteria 4604
595 Ga0501082_0070770 3300060353 Bacteria 3004
596 Ga0501082_0231344 3300060353 Bacteria 1608

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025944 Ga0207661_10131700 Ga0207661_101317002 326
2 3300048915 Ga0496112_0461530 Ga0496112_0461530_81_1151 337
3 3300017792 Ga0163161_10000447 Ga0163161_100004479 338
4 3300009036 Ga0105244_10000757 Ga0105244_100007575 346
5 3300025728 Ga0207655_1000003 Ga0207655_1000003882 346
6 3300014326 Ga0157380_10014880 Ga0157380_100148804 347
7 3300031824 Ga0307413_10079807 Ga0307413_100798071 347
8 2162886011 MRS1b_contig_4968207 MRS1b_0016.00000480 349
9 3300005354 Ga0070675_100071080 Ga0070675_1000710803 349
10 3300060353 Ga0501082_0231344 Ga0501082_0231344_27_1130 352
11 3300005435 Ga0070714_100001985 Ga0070714_10000198510 354
12 3300015262 Ga0182007_10021466 Ga0182007_100214662 354
13 3300025929 Ga0207664_10000858 Ga0207664_100008584 354
14 3300039438 Ga0436360_0285869 Ga0436360_0285869_578_1801 354
15 3300005288 Ga0065714_10083682 Ga0065714_100836822 355
16 3300049570 Ga0501033_0074526 Ga0501033_0074526_1134_2399 355
17 3300049571 Ga0501034_0059150 Ga0501034_0059150_1086_2351 355
18 3300049572 Ga0501036_0075054 Ga0501036_0075054_253_1497 355
19 3300049574 Ga0501038_0026484 Ga0501038_0026484_285_1550 355
20 3300049579 Ga0501043_0043010 Ga0501043_0043010_760_2025 355
21 3300049581 Ga0501047_0049454 Ga0501047_0049454_201_1466 355
22 3300049822 Ga0501035_0009258 Ga0501035_0009258_533_1798 355
23 3300049823 Ga0501044_0020839 Ga0501044_0020839_274_1539 355
24 3300021384 Ga0213876_10008820 Ga0213876_100088206 356
25 3300039437 Ga0436365_0726921 Ga0436365_0726921_38533_39798 356
26 3300049574 Ga0501038_0094257 Ga0501038_0094257_1030_2271 357
27 iso_pu_bacteria 2501025502 2501077563 358
28 3300005842 Ga0068858_100013088 Ga0068858_1000130884 359
29 3300026035 Ga0207703_10004606 Ga0207703_100046068 359
30 3300013102 Ga0157371_10084899 Ga0157371_100848992 361
31 3300013307 Ga0157372_10416479 Ga0157372_104164792 361
32 3300025925 Ga0207650_10194865 Ga0207650_101948652 361
33 3300053086 Ga0500578_0216823 Ga0500578_0216823_16_1140 361
34 3300003320 rootH2_10014493 rootH2_100144935 362
35 3300005367 Ga0070667_100069439 Ga0070667_1000694392 362
36 3300013308 Ga0157375_10023530 Ga0157375_100235304 362
37 3300025986 Ga0207658_10076586 Ga0207658_100765862 362
38 3300005365 Ga0070688_100044973 Ga0070688_1000449733 363
39 3300013102 Ga0157371_10096072 Ga0157371_100960721 363
40 3300028381 Ga0268264_10301085 Ga0268264_103010851 363
41 3300048927 Ga0496124_0020008 Ga0496124_0020008_3008_4330 363
42 3300028794 Ga0307515_10258623 Ga0307515_102586232 364
43 3300031595 Ga0265313_10011763 Ga0265313_100117632 364
44 3300048922 Ga0496119_0000043 Ga0496119_0000043_47422_48621 364
45 3300048923 Ga0496120_0000009 Ga0496120_0000009_189800_190999 364
46 3300049679 Ga0501249_000018 Ga0501249_000018_63314_64537 364
47 3300053096 Ga0500641_0000232 Ga0500641_0000232_6929_8152 364
48 3300005328 Ga0070676_10007250 Ga0070676_100072507 365
49 3300005329 Ga0070683_100063615 Ga0070683_1000636152 365
50 3300005330 Ga0070690_100073052 Ga0070690_1000730521 365
51 3300005335 Ga0070666_10050437 Ga0070666_100504371 365
52 3300005336 Ga0070680_100108936 Ga0070680_1001089361 365
53 3300005337 Ga0070682_100003265 Ga0070682_1000032658 365
54 3300005339 Ga0070660_100002940 Ga0070660_1000029402 365
55 3300005344 Ga0070661_100008737 Ga0070661_1000087376 365
56 3300005354 Ga0070675_100013574 Ga0070675_1000135745 365
57 3300005364 Ga0070673_100016413 Ga0070673_1000164137 365
58 3300005366 Ga0070659_100033595 Ga0070659_1000335954 365
59 3300005456 Ga0070678_100103563 Ga0070678_1001035631 365
60 3300005530 Ga0070679_100018570 Ga0070679_1000185706 365
61 3300005539 Ga0068853_100014097 Ga0068853_1000140977 365
62 3300005563 Ga0068855_100042355 Ga0068855_1000423558 365
63 3300005564 Ga0070664_100052088 Ga0070664_1000520883 365
64 3300005578 Ga0068854_100041639 Ga0068854_1000416394 365
65 3300005614 Ga0068856_100012777 Ga0068856_1000127773 365
66 3300005616 Ga0068852_100074705 Ga0068852_1000747052 365
67 3300005618 Ga0068864_100276463 Ga0068864_1002764632 365
68 3300013100 Ga0157373_10008804 Ga0157373_100088047 365
69 3300013102 Ga0157371_10053271 Ga0157371_100532711 365
70 3300013105 Ga0157369_10014890 Ga0157369_100148905 365
71 3300013296 Ga0157374_10055031 Ga0157374_100550313 365
72 3300013296 Ga0157374_10146522 Ga0157374_101465222 365
73 3300013297 Ga0157378_10010011 Ga0157378_100100113 365
74 3300013307 Ga0157372_10162908 Ga0157372_101629082 365
75 3300014325 Ga0163163_10042395 Ga0163163_100423956 365
76 3300025904 Ga0207647_10043961 Ga0207647_100439613 365
77 3300025907 Ga0207645_10010755 Ga0207645_100107553 365
78 3300025919 Ga0207657_10003445 Ga0207657_100034456 365
79 3300025920 Ga0207649_10075401 Ga0207649_100754012 365
80 3300025921 Ga0207652_10063565 Ga0207652_100635653 365
81 3300025933 Ga0207706_10044977 Ga0207706_100449774 365
82 3300025944 Ga0207661_10083649 Ga0207661_100836493 365
83 3300025949 Ga0207667_10044161 Ga0207667_100441612 365
84 3300025981 Ga0207640_10189892 Ga0207640_101898921 365
85 3300026078 Ga0207702_10077939 Ga0207702_100779393 365
86 3300026116 Ga0207674_10094264 Ga0207674_100942642 365
87 3300026121 Ga0207683_10041638 Ga0207683_100416381 365
88 3300026142 Ga0207698_10076622 Ga0207698_100766223 365
89 3300028794 Ga0307515_10098140 Ga0307515_100981402 365
90 3300028800 Ga0265338_10033903 Ga0265338_100339032 365
91 3300053156 Ga0500622_0131317 Ga0500622_0131317_26_1180 365
92 3300003322 rootL2_10221481 rootL2_102214812 366
93 3300005327 Ga0070658_10157965 Ga0070658_101579652 366
94 3300005331 Ga0070670_100001031 Ga0070670_10000103118 367
95 3300009093 Ga0105240_10121033 Ga0105240_101210332 367
96 3300009545 Ga0105237_10156003 Ga0105237_101560032 367
97 3300009551 Ga0105238_10041883 Ga0105238_100418833 367
98 3300025911 Ga0207654_10049315 Ga0207654_100493152 367
99 3300025914 Ga0207671_10117978 Ga0207671_101179782 367
100 3300028379 Ga0268266_10001402 Ga0268266_1000140214 367
101 3300005327 Ga0070658_10088801 Ga0070658_100888011 368
102 3300010375 Ga0105239_10289640 Ga0105239_102896402 368
103 3300025909 Ga0207705_10233569 Ga0207705_102335691 368
104 3300037471 Ga0395905_0033708 Ga0395905_0033708_532_1761 368
105 3300002737 JGI25162J39368_1000804 JGI25162J39368_100080419 369
106 3300005436 Ga0070713_100098363 Ga0070713_1000983632 369
107 3300006237 Ga0097621_100008034 Ga0097621_1000080341 369
108 3300025233 Ga0209437_100104 Ga0209437_10010499 369
109 3300025261 Ga0209233_1000054 Ga0209233_100005436 369
110 3300039447 Ga0436361_0024002 Ga0436361_0024002_1577_2788 369
111 3300041498 Ga0451841_1210261 Ga0451841_1210261_113_1369 369
112 3300048903 Ga0496100_0182220 Ga0496100_0182220_85_1317 369
113 3300048917 Ga0496114_0011142 Ga0496114_0011142_951_2183 369
114 3300048918 Ga0496115_0004131 Ga0496115_0004131_1497_2729 369
115 3300049675 Ga0501243_000107 Ga0501243_000107_4112_5329 369
116 3300053125 Ga0500618_000875 Ga0500618_000875_3609_4931 369
117 3300041512 Ga0451853_2872322 Ga0451853_2872322_2164_3420 370
118 3300028563 Ga0265319_1006331 Ga0265319_10063316 371
119 3300031548 Ga0307408_100003852 Ga0307408_1000038522 371
120 3300031548 Ga0307408_100050094 Ga0307408_1000500943 371
121 3300031901 Ga0307406_10003478 Ga0307406_100034783 371
122 3300045051 Ga0451576_0000856 Ga0451576_0000856_13462_14691 371
123 3300045051 Ga0451576_0000892 Ga0451576_0000892_41498_42727 371
124 3300046683 Ga0495658_0003329 Ga0495658_0003329_3043_4281 371
125 3300050509 nmdc:mga0qj67_3998_c1 nmdc:mga0qj67_3998_c1_7674_8897 371
126 3300050510 nmdc:mga06r32_16077_c1 nmdc:mga06r32_16077_c1_205_1428 371
127 3300005339 Ga0070660_100110058 Ga0070660_1001100581 372
128 3300005530 Ga0070679_100007344 Ga0070679_1000073446 372
129 3300005548 Ga0070665_100000005 Ga0070665_100000005426 372
130 3300005563 Ga0068855_100136862 Ga0068855_1001368622 372
131 3300005841 Ga0068863_100000614 Ga0068863_10000061428 372
132 3300009093 Ga0105240_10013135 Ga0105240_100131352 372
133 3300009093 Ga0105240_10036770 Ga0105240_100367704 372
134 3300013104 Ga0157370_10088396 Ga0157370_100883961 372
135 3300013296 Ga0157374_10000071 Ga0157374_1000007161 372
136 3300014969 Ga0157376_10000170 Ga0157376_1000017041 372
137 3300025913 Ga0207695_10018573 Ga0207695_100185736 372
138 3300025917 Ga0207660_10025925 Ga0207660_100259252 372
139 3300025921 Ga0207652_10056075 Ga0207652_100560752 372
140 3300026088 Ga0207641_10008328 Ga0207641_100083286 372
141 3300028379 Ga0268266_10000012 Ga0268266_10000012226 372
142 3300037312 Ga0395899_0020587 Ga0395899_0020587_1594_2883 372
143 3300037418 Ga0395900_0130156 Ga0395900_0130156_507_1796 372
144 3300048920 Ga0496117_0091132 Ga0496117_0091132_86_1354 372
145 3300048924 Ga0496121_0143947 Ga0496121_0143947_44_1276 372
146 3300049569 Ga0501032_0037794 Ga0501032_0037794_178_1395 372
147 3300049570 Ga0501033_0077813 Ga0501033_0077813_1014_2231 372
148 3300049571 Ga0501034_0001701 Ga0501034_0001701_24134_25351 372
149 3300049573 Ga0501037_0002415 Ga0501037_0002415_1116_2333 372
150 3300049574 Ga0501038_0001659 Ga0501038_0001659_6308_7525 372
151 3300049581 Ga0501047_0064340 Ga0501047_0064340_2157_3446 372
152 3300049742 Ga0501080_0048263 Ga0501080_0048263_1025_2242 372
153 3300053140 Ga0500573_0011836 Ga0500573_0011836_1158_2300 372
154 3300003322 rootL2_10287946 rootL2_102879461 373
155 3300005329 Ga0070683_100004660 Ga0070683_1000046607 373
156 3300005435 Ga0070714_100168966 Ga0070714_1001689662 373
157 3300005436 Ga0070713_100153824 Ga0070713_1001538242 373
158 3300005457 Ga0070662_100039839 Ga0070662_1000398393 373
159 3300005618 Ga0068864_100249663 Ga0068864_1002496632 373
160 3300006028 Ga0070717_10003461 Ga0070717_100034613 373
161 3300006844 Ga0075428_100017535 Ga0075428_1000175358 373
162 3300013296 Ga0157374_10360676 Ga0157374_103606761 373
163 3300025928 Ga0207700_10025463 Ga0207700_100254634 373
164 3300025929 Ga0207664_10040423 Ga0207664_100404232 373
165 3300025944 Ga0207661_10227819 Ga0207661_102278192 373
166 3300028379 Ga0268266_10147537 Ga0268266_101475372 373
167 3300046460 Ga0495638_0084084 Ga0495638_0084084_276_1427 373
168 3300046471 Ga0495650_0001458 Ga0495650_0001458_13999_15150 373
169 3300046660 Ga0495625_0000377 Ga0495625_0000377_2625_3896 373
170 3300050508 nmdc:mga09592_144678_c1 nmdc:mga09592_144678_c1_674_1897 373
171 3300050509 nmdc:mga0qj67_159093_c1 nmdc:mga0qj67_159093_c1_508_1731 373
172 3300003323 rootH1_10078729 rootH1_100787293 374
173 3300003775 Ga0055524_1012130 Ga0055524_10121303 374
174 3300005329 Ga0070683_100184698 Ga0070683_1001846981 374
175 3300005577 Ga0068857_100105018 Ga0068857_1001050182 374
176 3300009093 Ga0105240_10161224 Ga0105240_101612244 374
177 3300009174 Ga0105241_10035226 Ga0105241_100352264 374
178 3300010375 Ga0105239_10282371 Ga0105239_102823712 374
179 3300025263 Ga0209565_1001791 Ga0209565_10017919 374
180 3300025294 Ga0209025_1001261 Ga0209025_100126119 374
181 3300025299 Ga0209256_1000978 Ga0209256_100097820 374
182 3300026088 Ga0207641_10277550 Ga0207641_102775501 374
183 3300026116 Ga0207674_10213692 Ga0207674_102136921 374
184 3300027876 Ga0209974_10022940 Ga0209974_100229401 374
185 3300037853 Ga0436364_0155742 Ga0436364_0155742_612_1868 374
186 3300045976 Ga0466967_0059481 Ga0466967_0059481_1049_2293 374
187 3300025925 Ga0207650_10002784 Ga0207650_100027843 375
188 3300026088 Ga0207641_10026105 Ga0207641_100261053 375
189 3300026095 Ga0207676_10022505 Ga0207676_100225052 375
190 3300031241 Ga0265325_10024572 Ga0265325_100245722 375
191 3300031249 Ga0265339_10000096 Ga0265339_1000009624 375
192 3300031595 Ga0265313_10000024 Ga0265313_10000024102 375
193 3300035691 Ga0373931_0012340 Ga0373931_0012340_2858_4078 375
194 3300037471 Ga0395905_0043436 Ga0395905_0043436_1124_2353 375
195 3300048907 Ga0496104_0045498 Ga0496104_0045498_70_1290 375
196 3300048912 Ga0496109_0000770 Ga0496109_0000770_5796_7016 375
197 3300048915 Ga0496112_0000221 Ga0496112_0000221_19788_21008 375
198 3300048916 Ga0496113_0000588 Ga0496113_0000588_10620_11840 375
199 3300049571 Ga0501034_0001018 Ga0501034_0001018_5696_6937 375
200 3300050510 nmdc:mga06r32_159476_c1 nmdc:mga06r32_159476_c1_80_1303 375
201 3300053103 Ga0500555_000465 Ga0500555_000465_13411_14628 375
202 3300053104 Ga0500556_0000237 Ga0500556_0000237_14238_15455 375
203 3300053130 Ga0500642_0004362 Ga0500642_0004362_2047_3264 375
204 3300053134 Ga0500658_0008805 Ga0500658_0008805_1300_2517 375
205 3300013102 Ga0157371_10046477 Ga0157371_100464772 376
206 3300014969 Ga0157376_10020496 Ga0157376_100204964 376
207 3300028563 Ga0265319_1000087 Ga0265319_100008710 376
208 3300028577 Ga0265318_10000762 Ga0265318_1000076214 376
209 3300031711 Ga0265314_10001852 Ga0265314_100018528 376
210 3300031824 Ga0307413_10018781 Ga0307413_100187813 376
211 3300031995 Ga0307409_100038139 Ga0307409_1000381392 376
212 3300046558 Ga0495633_0001402 Ga0495633_0001402_48_1280 376
213 3300047472 Ga0495686_0037646 Ga0495686_0037646_1422_2621 376
214 3300003771 Ga0055526_1007120 Ga0055526_10071205 377
215 3300003771 Ga0055526_1009765 Ga0055526_10097653 377
216 3300003771 Ga0055526_1013006 Ga0055526_10130063 377
217 3300003781 Ga0055536_1000102 Ga0055536_100010233 377
218 3300003784 Ga0055534_1003928 Ga0055534_10039284 377
219 3300005347 Ga0070668_100128849 Ga0070668_1001288492 377
220 3300005536 Ga0070697_100007686 Ga0070697_1000076869 377
221 3300006846 Ga0075430_100072448 Ga0075430_1000724482 377
222 3300006880 Ga0075429_100109563 Ga0075429_1001095631 377
223 3300006948 Ga0099826_10000007 Ga0099826_1000000752 377
224 3300009551 Ga0105238_10014605 Ga0105238_100146053 377
225 3300013306 Ga0163162_10000004 Ga0163162_10000004174 377
226 3300025291 Ga0209675_1000241 Ga0209675_100024129 377
227 3300025292 Ga0209676_1000036 Ga0209676_1000036137 377
228 3300025294 Ga0209025_1000770 Ga0209025_100077030 377
229 3300025295 Ga0209564_1000693 Ga0209564_100069329 377
230 3300025295 Ga0209564_1000736 Ga0209564_100073627 377
231 3300025924 Ga0207694_10009223 Ga0207694_100092232 377
232 3300027666 Ga0209282_1000059 Ga0209282_100005951 377
233 3300028573 Ga0265334_10001402 Ga0265334_100014025 377
234 3300031251 Ga0265327_10000747 Ga0265327_1000074737 377
235 3300031616 Ga0307508_10000026 Ga0307508_10000026126 377
236 3300031665 Ga0316575_10055241 Ga0316575_100552411 377
237 3300031728 Ga0316578_10004658 Ga0316578_100046581 377
238 3300032168 Ga0316593_10008621 Ga0316593_100086212 377
239 3300033541 Ga0316596_1024829 Ga0316596_10248291 377
240 3300036712 Ga0316584_0000728 Ga0316584_0000728_12098_13366 377
241 3300036712 Ga0316584_0083956 Ga0316584_0083956_890_2158 377
242 3300046474 Ga0495605_0005711 Ga0495605_0005711_1053_2282 377
243 3300046500 Ga0495596_0000057 Ga0495596_0000057_36920_38149 377
244 3300046501 Ga0495607_0002727 Ga0495607_0002727_9278_10507 377
245 3300046512 Ga0495610_0000543 Ga0495610_0000543_14721_15950 377
246 3300046513 Ga0495616_0031404 Ga0495616_0031404_761_1990 377
247 3300046538 Ga0495609_0001051 Ga0495609_0001051_14412_15641 377
248 3300046692 Ga0495671_0000364 Ga0495671_0000364_6909_8138 377
249 3300047320 Ga0495672_0001402 Ga0495672_0001402_18460_19743 377
250 3300048919 Ga0496116_0004563 Ga0496116_0004563_761_1990 377
251 3300048924 Ga0496121_0010524 Ga0496121_0010524_2632_3861 377
252 3300048926 Ga0496123_0000648 Ga0496123_0000648_7190_8419 377
253 3300050510 nmdc:mga06r32_83123_c1 nmdc:mga06r32_83123_c1_641_1864 377
254 3300053119 Ga0500595_012359 Ga0500595_012359_309_1562 377
255 3300005458 Ga0070681_10130564 Ga0070681_101305643 378
256 3300005539 Ga0068853_100000017 Ga0068853_10000001737 378
257 3300009551 Ga0105238_10406586 Ga0105238_104065862 378
258 3300025912 Ga0207707_10121786 Ga0207707_101217862 378
259 3300026041 Ga0207639_10000031 Ga0207639_1000003137 378
260 3300031240 Ga0265320_10006929 Ga0265320_100069292 378
261 3300049568 Ga0501031_0000039 Ga0501031_0000039_29913_31157 378
262 3300049569 Ga0501032_0008417 Ga0501032_0008417_2958_4202 378
263 3300049822 Ga0501035_0018304 Ga0501035_0018304_375_1619 378
264 3300049823 Ga0501044_0000133 Ga0501044_0000133_49362_50606 378
265 3300053125 Ga0500618_000089 Ga0500618_000089_41553_42749 378
266 3300005353 Ga0070669_100061566 Ga0070669_1000615662 379
267 3300005356 Ga0070674_100002577 Ga0070674_1000025776 379
268 3300009147 Ga0114129_10627986 Ga0114129_106279861 379
269 3300009545 Ga0105237_10014419 Ga0105237_100144192 379
270 3300009553 Ga0105249_10070999 Ga0105249_100709992 379
271 3300025937 Ga0207669_10003403 Ga0207669_100034035 379
272 3300025938 Ga0207704_10159230 Ga0207704_101592302 379
273 3300025944 Ga0207661_10061388 Ga0207661_100613882 379
274 3300039447 Ga0436361_0333614 Ga0436361_0333614_588_1832 379
275 3300050493 nmdc:mga0k408_770_c1 nmdc:mga0k408_770_c1_3263_4504 379
276 3300005455 Ga0070663_100028289 Ga0070663_1000282894 380
277 3300009098 Ga0105245_10055494 Ga0105245_100554941 380
278 3300027312 Ga0209371_1001812 Ga0209371_100181210 380
279 3300030500 Ga0268256_1003763 Ga0268256_10037636 380
280 3300046507 Ga0495606_0018719 Ga0495606_0018719_869_2128 380
281 3300047472 Ga0495686_0000132 Ga0495686_0000132_109730_110962 380
282 3300047472 Ga0495686_0006543 Ga0495686_0006543_6763_7962 380
283 3300047472 Ga0495686_0094632 Ga0495686_0094632_423_1682 380
284 3300048924 Ga0496121_0035174 Ga0496121_0035174_1521_2780 380
285 3300053730 Ga0500645_003649 Ga0500645_003649_1190_2419 380
286 iso_pu_bacteria 2582581316 2585334932 380
287 iso_pu_bacteria 2615840698 2616555325 380
288 iso_pu_bacteria 2617270742 2617381371 380
289 iso_pu_bacteria 2829745981 2829748066 380
290 iso_pu_bacteria 2840878972 2840881900 380
291 iso_pu_bacteria 2842482326 2842485383 380
292 iso_pu_bacteria 3005416602 3005421242 380
293 iso_pu_bacteria 8005314921 8005319023 380
294 iso_pu_bacteria 8005682033 8005685712 380
295 3300003316 rootH1_10009586 rootH1_1000958616 381
296 3300003322 rootL2_10006488 rootL2_100064883 381
297 3300003323 rootH1_10005123 rootH1_100051235 381
298 3300003323 rootH1_10145331 rootH1_101453314 381
299 3300005290 Ga0065712_10073199 Ga0065712_100731993 381
300 3300005293 Ga0065715_10093330 Ga0065715_100933302 381
301 3300005331 Ga0070670_100215855 Ga0070670_1002158552 381
302 3300005334 Ga0068869_100003939 Ga0068869_1000039398 381
303 3300005340 Ga0070689_100063673 Ga0070689_1000636734 381
304 3300005343 Ga0070687_100002062 Ga0070687_1000020626 381
305 3300005344 Ga0070661_100019269 Ga0070661_1000192695 381
306 3300005353 Ga0070669_100108936 Ga0070669_1001089362 381
307 3300005354 Ga0070675_100014959 Ga0070675_1000149596 381
308 3300005365 Ga0070688_100051175 Ga0070688_1000511753 381
309 3300005367 Ga0070667_100012755 Ga0070667_1000127554 381
310 3300005440 Ga0070705_100033032 Ga0070705_1000330322 381
311 3300005459 Ga0068867_100005913 Ga0068867_1000059136 381
312 3300005466 Ga0070685_10009315 Ga0070685_100093155 381
313 3300005535 Ga0070684_100014578 Ga0070684_1000145783 381
314 3300005544 Ga0070686_100001654 Ga0070686_1000016549 381
315 3300005842 Ga0068858_100293862 Ga0068858_1002938621 381
316 3300005844 Ga0068862_100013250 Ga0068862_1000132502 381
317 3300005937 Ga0081455_10052713 Ga0081455_100527133 381
318 3300013104 Ga0157370_10020068 Ga0157370_100200684 381
319 3300013105 Ga0157369_10047749 Ga0157369_100477494 381
320 3300013307 Ga0157372_10034465 Ga0157372_100344654 381
321 3300025901 Ga0207688_10083138 Ga0207688_100831381 381
322 3300025940 Ga0207691_10017237 Ga0207691_100172372 381
323 3300026078 Ga0207702_10027774 Ga0207702_100277741 381
324 3300028380 Ga0268265_10014462 Ga0268265_100144625 381
325 3300028563 Ga0265319_1025940 Ga0265319_10259401 381
326 3300047472 Ga0495686_0000090 Ga0495686_0000090_160250_161455 381
327 3300049589 Ga0501073_0104269 Ga0501073_0104269_404_1645 381
328 3300054114 Ga0501084_0005613 Ga0501084_0005613_131_1372 381
329 iso_pu_bacteria 2738541279 2738734896 381
330 iso_pu_bacteria 2738541285 2738769039 381
331 iso_pu_bacteria 2738543007 2739216478 381
332 iso_pu_bacteria 2896317667 2896320756 381
333 iso_pu_bacteria 8057977335 8057981652 381
334 3300003320 rootH2_10013067 rootH2_100130675 382
335 3300003320 rootH2_10101339 rootH2_101013392 382
336 3300005293 Ga0065715_10098358 Ga0065715_100983582 382
337 3300005347 Ga0070668_100008165 Ga0070668_1000081655 382
338 3300005353 Ga0070669_100005300 Ga0070669_1000053005 382
339 3300005355 Ga0070671_100008146 Ga0070671_1000081465 382
340 3300005367 Ga0070667_100035024 Ga0070667_1000350243 382
341 3300005439 Ga0070711_100214055 Ga0070711_1002140551 382
342 3300005548 Ga0070665_100000370 Ga0070665_10000037046 382
343 3300005834 Ga0068851_10006749 Ga0068851_100067496 382
344 3300005841 Ga0068863_100023810 Ga0068863_1000238103 382
345 3300005842 Ga0068858_100011854 Ga0068858_1000118542 382
346 3300005843 Ga0068860_100009474 Ga0068860_1000094745 382
347 3300005844 Ga0068862_100050848 Ga0068862_1000508481 382
348 3300006844 Ga0075428_100018325 Ga0075428_1000183258 382
349 3300006847 Ga0075431_100014257 Ga0075431_1000142578 382
350 3300006914 Ga0075436_100001071 Ga0075436_10000107114 382
351 3300009011 Ga0105251_10002762 Ga0105251_100027625 382
352 3300009094 Ga0111539_10001140 Ga0111539_100011408 382
353 3300009177 Ga0105248_10015251 Ga0105248_100152513 382
354 3300021384 Ga0213876_10118895 Ga0213876_101188951 382
355 3300025284 Ga0209130_1002263 Ga0209130_100226310 382
356 3300025735 Ga0207713_1006462 Ga0207713_10064621 382
357 3300025923 Ga0207681_10002183 Ga0207681_100021839 382
358 3300025925 Ga0207650_10069093 Ga0207650_100690932 382
359 3300025931 Ga0207644_10001621 Ga0207644_100016215 382
360 3300025941 Ga0207711_10012402 Ga0207711_100124026 382
361 3300025986 Ga0207658_10076696 Ga0207658_100766962 382
362 3300026088 Ga0207641_10014158 Ga0207641_100141585 382
363 3300027907 Ga0207428_10009632 Ga0207428_100096325 382
364 3300028379 Ga0268266_10000620 Ga0268266_100006205 382
365 3300028381 Ga0268264_10001864 Ga0268264_1000186415 382
366 3300031548 Ga0307408_100018971 Ga0307408_1000189712 382
367 3300035170 Ga0373943_0073651 Ga0373943_0073651_147_1424 382
368 3300035695 Ga0373927_0000702 Ga0373927_0000702_2643_3920 382
369 3300037068 Ga0373925_0001918 Ga0373925_0001918_2335_3612 382
370 3300044712 Ga0453684_0010740 Ga0453684_0010740_3513_4730 382
371 3300046453 Ga0495627_001304 Ga0495627_001304_13875_15080 382
372 3300046471 Ga0495650_0002398 Ga0495650_0002398_132_1337 382
373 3300046515 Ga0495620_0021160 Ga0495620_0021160_1202_2407 382
374 3300047470 Ga0495681_0001901 Ga0495681_0001901_13997_15202 382
375 3300048906 Ga0496103_0013858 Ga0496103_0013858_1290_2495 382
376 3300048919 Ga0496116_0007360 Ga0496116_0007360_265_1470 382
377 3300048924 Ga0496121_0014255 Ga0496121_0014255_632_1837 382
378 3300048925 Ga0496122_0079087 Ga0496122_0079087_626_1831 382
379 3300048928 Ga0496125_0035727 Ga0496125_0035727_1246_2451 382
380 3300049459 Ga0495678_008988 Ga0495678_008988_3182_4498 382
381 3300049574 Ga0501038_0264165 Ga0501038_0264165_81_1316 382
382 3300049579 Ga0501043_0155357 Ga0501043_0155357_540_1775 382
383 3300049583 Ga0501067_0051895 Ga0501067_0051895_923_2164 382
384 3300049586 Ga0501070_0009957 Ga0501070_0009957_6462_7703 382
385 3300049586 Ga0501070_0134597 Ga0501070_0134597_135_1370 382
386 3300049590 Ga0501074_0009912 Ga0501074_0009912_5212_6453 382
387 3300049822 Ga0501035_0032147 Ga0501035_0032147_2513_3748 382
388 3300049823 Ga0501044_0006477 Ga0501044_0006477_3121_4362 382
389 3300049823 Ga0501044_0033634 Ga0501044_0033634_3044_4279 382
390 3300053157 Ga0500624_000121 Ga0500624_000121_1348_2565 382
391 iso_pu_bacteria 2643221667 2644371833 382
392 iso_pu_bacteria 2786546940 2788435685 382
393 iso_pu_bacteria 2888578766 2888584799 382
394 iso_pu_bacteria 2929150217 2929151845 382
395 3300003771 Ga0055526_1000136 Ga0055526_100013632 383
396 3300005289 Ga0065704_10070670 Ga0065704_1007067018 383
397 3300005441 Ga0070700_100136007 Ga0070700_1001360071 383
398 3300006847 Ga0075431_100138873 Ga0075431_1001388732 383
399 3300006881 Ga0068865_100147206 Ga0068865_1001472062 383
400 3300013307 Ga0157372_10104251 Ga0157372_101042512 383
401 3300021361 Ga0213872_10074667 Ga0213872_100746672 383
402 3300046507 Ga0495606_0002544 Ga0495606_0002544_8101_9327 383
403 3300049583 Ga0501067_0025056 Ga0501067_0025056_475_1710 383
404 3300049585 Ga0501069_0027087 Ga0501069_0027087_1655_2890 383
405 3300050509 nmdc:mga0qj67_30594_c1 nmdc:mga0qj67_30594_c1_2285_3484 383
406 3300050510 nmdc:mga06r32_23611_c1 nmdc:mga06r32_23611_c1_2736_3935 383
407 3300053080 Ga0500635_0010903 Ga0500635_0010903_1341_2543 383
408 3300053148 Ga0500590_002901 Ga0500590_002901_2413_3669 383
409 iso_pu_bacteria 2896109856 2896115579 383
410 iso_pu_bacteria 2904424332 2904426041 383
411 iso_pu_bacteria 2928078545 2928079093 383
412 3300005328 Ga0070676_10032355 Ga0070676_100323553 384
413 3300005336 Ga0070680_100058625 Ga0070680_1000586251 384
414 3300005445 Ga0070708_100050999 Ga0070708_1000509993 384
415 3300005457 Ga0070662_100028044 Ga0070662_1000280445 384
416 3300005467 Ga0070706_100076929 Ga0070706_1000769291 384
417 3300005468 Ga0070707_100103895 Ga0070707_1001038952 384
418 3300005471 Ga0070698_100385901 Ga0070698_1003859011 384
419 3300005518 Ga0070699_100071694 Ga0070699_1000716942 384
420 3300005536 Ga0070697_100018524 Ga0070697_1000185244 384
421 3300006871 Ga0075434_100325622 Ga0075434_1003256222 384
422 3300013104 Ga0157370_10018018 Ga0157370_100180187 384
423 3300021361 Ga0213872_10000051 Ga0213872_1000005170 384
424 3300025910 Ga0207684_10042479 Ga0207684_100424793 384
425 3300028016 Ga0265354_1001773 Ga0265354_10017732 384
426 3300030878 Ga0265770_1000137 Ga0265770_10001376 384
427 3300031090 Ga0265760_10001244 Ga0265760_100012443 384
428 3300031250 Ga0265331_10009532 Ga0265331_100095322 384
429 3300038443 Ga0395901_0119904 Ga0395901_0119904_1420_2646 384
430 3300039447 Ga0436361_0111000 Ga0436361_0111000_2346_3563 384
431 3300046507 Ga0495606_0000123 Ga0495606_0000123_46399_47628 384
432 3300049570 Ga0501033_0000750 Ga0501033_0000750_22615_23841 384
433 3300049573 Ga0501037_0030630 Ga0501037_0030630_2031_3257 384
434 3300049580 Ga0501046_0000536 Ga0501046_0000536_11601_12827 384
435 3300049581 Ga0501047_0079504 Ga0501047_0079504_1304_2530 384
436 3300049742 Ga0501080_0095950 Ga0501080_0095950_753_1979 384
437 3300050512 nmdc:mga0n895_410571_c1 nmdc:mga0n895_410571_c1_56_1285 384
438 3300053103 Ga0500555_018866 Ga0500555_018866_578_1780 384
439 3300053136 Ga0500559_0000006 Ga0500559_0000006_123707_124936 384
440 iso_pu_bacteria 2513237150 2513956261 384
441 iso_pu_bacteria 2513237165 2514042573 384
442 iso_pu_bacteria 2883068021 2883071293 384
443 3300005543 Ga0070672_100002535 Ga0070672_1000025358 385
444 3300005546 Ga0070696_100017631 Ga0070696_1000176314 385
445 3300005548 Ga0070665_100016954 Ga0070665_1000169543 385
446 3300005564 Ga0070664_100008688 Ga0070664_1000086888 385
447 3300005577 Ga0068857_100016166 Ga0068857_1000161662 385
448 3300005617 Ga0068859_100002478 Ga0068859_1000024784 385
449 3300005618 Ga0068864_100000364 Ga0068864_10000036419 385
450 3300005718 Ga0068866_10014495 Ga0068866_100144952 385
451 3300005719 Ga0068861_100001551 Ga0068861_1000015513 385
452 3300005841 Ga0068863_100003306 Ga0068863_1000033068 385
453 3300005843 Ga0068860_100039430 Ga0068860_1000394302 385
454 3300005843 Ga0068860_100369580 Ga0068860_1003695801 385
455 3300005844 Ga0068862_100039852 Ga0068862_1000398523 385
456 3300006358 Ga0068871_100009083 Ga0068871_1000090835 385
457 3300006931 Ga0097620_100002478 Ga0097620_1000024784 385
458 3300009094 Ga0111539_10238999 Ga0111539_102389992 385
459 3300009101 Ga0105247_10020299 Ga0105247_100202994 385
460 3300009177 Ga0105248_10019102 Ga0105248_100191025 385
461 3300009553 Ga0105249_10004119 Ga0105249_1000411914 385
462 3300013297 Ga0157378_10048647 Ga0157378_100486473 385
463 3300013306 Ga0163162_10007093 Ga0163162_100070935 385
464 3300014325 Ga0163163_10020303 Ga0163163_100203036 385
465 3300014745 Ga0157377_10004362 Ga0157377_100043622 385
466 3300017792 Ga0163161_10018985 Ga0163161_100189856 385
467 3300025918 Ga0207662_10011026 Ga0207662_100110262 385
468 3300025920 Ga0207649_10010783 Ga0207649_100107832 385
469 3300025922 Ga0207646_10134418 Ga0207646_101344182 385
470 3300025925 Ga0207650_10029672 Ga0207650_100296724 385
471 3300025926 Ga0207659_10055363 Ga0207659_100553633 385
472 3300025940 Ga0207691_10012169 Ga0207691_100121698 385
473 3300025941 Ga0207711_10064726 Ga0207711_100647263 385
474 3300025942 Ga0207689_10003215 Ga0207689_1000321511 385
475 3300025944 Ga0207661_10131146 Ga0207661_101311462 385
476 3300025945 Ga0207679_10009876 Ga0207679_100098762 385
477 3300025961 Ga0207712_10027877 Ga0207712_100278772 385
478 3300026035 Ga0207703_10109536 Ga0207703_101095362 385
479 3300026088 Ga0207641_10084489 Ga0207641_100844893 385
480 3300026089 Ga0207648_10002941 Ga0207648_100029415 385
481 3300026116 Ga0207674_10019990 Ga0207674_100199902 385
482 3300026118 Ga0207675_100003708 Ga0207675_10000370810 385
483 3300026121 Ga0207683_10075673 Ga0207683_100756732 385
484 3300028036 Ga0265355_1000237 Ga0265355_10002372 385
485 3300033180 Ga0307510_10000260 Ga0307510_1000026035 385
486 3300039447 Ga0436361_0702269 Ga0436361_0702269_96_1310 385
487 3300045051 Ga0451576_0037611 Ga0451576_0037611_2730_3938 385
488 3300046471 Ga0495650_0000027 Ga0495650_0000027_445523_446803 385
489 3300046543 Ga0495645_0143038 Ga0495645_0143038_341_1513 385
490 3300048911 Ga0496108_0030507 Ga0496108_0030507_1041_2249 385
491 3300048913 Ga0496110_0093425 Ga0496110_0093425_665_1873 385
492 3300048915 Ga0496112_0056345 Ga0496112_0056345_200_1408 385
493 3300048916 Ga0496113_0079475 Ga0496113_0079475_469_1677 385
494 3300049675 Ga0501243_008107 Ga0501243_008107_249_1457 385
495 3300049679 Ga0501249_006960 Ga0501249_006960_338_1546 385
496 3300049758 Ga0501241_000341 Ga0501241_000341_1019_2233 385
497 3300053079 Ga0500610_0123868 Ga0500610_0123868_72_1289 385
498 iso_pu_bacteria 2840677318 2840678374 385
499 iso_pu_bacteria 2883087390 2883091776 385
500 iso_pu_bacteria 2896085136 2896086191 385
501 iso_pu_bacteria 2902048731 2902052931 385
502 3300005354 Ga0070675_100011275 Ga0070675_1000112755 386
503 3300006048 Ga0075363_100043560 Ga0075363_1000435602 386
504 3300006195 Ga0075366_10005270 Ga0075366_100052703 386
505 3300006871 Ga0075434_100078965 Ga0075434_1000789652 386
506 3300009094 Ga0111539_10001033 Ga0111539_1000103318 386
507 3300009551 Ga0105238_10007127 Ga0105238_100071279 386
508 3300013102 Ga0157371_10029047 Ga0157371_100290471 386
509 3300025919 Ga0207657_10004443 Ga0207657_1000444310 386
510 3300026067 Ga0207678_10000707 Ga0207678_1000070713 386
511 3300027907 Ga0207428_10003027 Ga0207428_100030277 386
512 3300046520 Ga0495637_0022409 Ga0495637_0022409_841_2064 386
513 3300048924 Ga0496121_0147817 Ga0496121_0147817_284_1573 386
514 3300048925 Ga0496122_0001659 Ga0496122_0001659_26434_27663 386
515 3300049576 Ga0501040_0011798 Ga0501040_0011798_1795_3018 386
516 3300049578 Ga0501042_0001847 Ga0501042_0001847_7856_9079 386
517 3300049582 Ga0501048_0016062 Ga0501048_0016062_2353_3576 386
518 3300049592 Ga0501076_0013211 Ga0501076_0013211_3689_4912 386
519 3300049593 Ga0501077_0034372 Ga0501077_0034372_1339_2562 386
520 3300049741 Ga0501079_0002062 Ga0501079_0002062_12316_13539 386
521 3300049743 Ga0501081_0018613 Ga0501081_0018613_1464_2687 386
522 3300049824 Ga0501045_0051583 Ga0501045_0051583_718_1941 386
523 3300050489 nmdc:mga03683_99_c3 nmdc:mga03683_99_c3_6076_7311 386
524 3300050490 nmdc:mga03n38_6968_c1 nmdc:mga03n38_6968_c1_2030_3265 386
525 3300050493 nmdc:mga0k408_6494_c1 nmdc:mga0k408_6494_c1_804_2039 386
526 3300050511 nmdc:mga08y16_30876_c1 nmdc:mga08y16_30876_c1_2524_3735 386
527 3300050511 nmdc:mga08y16_445_c1 nmdc:mga08y16_445_c1_16852_18075 386
528 3300060353 Ga0501082_0070770 Ga0501082_0070770_809_2032 386
529 iso_pu_bacteria 2510917013 2511091369 386
530 3300005327 Ga0070658_10000561 Ga0070658_100005619 387
531 3300005329 Ga0070683_100327238 Ga0070683_1003272381 387
532 3300005336 Ga0070680_100095830 Ga0070680_1000958302 387
533 3300025909 Ga0207705_10002064 Ga0207705_1000206413 387
534 3300025917 Ga0207660_10157864 Ga0207660_101578641 387
535 3300025921 Ga0207652_10052790 Ga0207652_100527902 387
536 3300025949 Ga0207667_10053025 Ga0207667_100530253 387
537 3300028573 Ga0265334_10011133 Ga0265334_100111335 387
538 3300049573 Ga0501037_0008225 Ga0501037_0008225_1343_2545 387
539 3300049586 Ga0501070_0047738 Ga0501070_0047738_88_1290 387
540 3300049590 Ga0501074_0002131 Ga0501074_0002131_11343_12545 387
541 3300049742 Ga0501080_0014395 Ga0501080_0014395_1784_2986 387
542 3300005539 Ga0068853_100100065 Ga0068853_1001000652 388
543 3300005547 Ga0070693_100009663 Ga0070693_1000096632 388
544 3300005617 Ga0068859_100149322 Ga0068859_1001493222 388
545 3300005844 Ga0068862_100004578 Ga0068862_10000457811 388
546 3300005844 Ga0068862_100054084 Ga0068862_1000540844 388
547 3300006931 Ga0097620_100149333 Ga0097620_1001493332 388
548 3300009094 Ga0111539_10000050 Ga0111539_1000005077 388
549 3300009553 Ga0105249_10053806 Ga0105249_100538064 388
550 3300011119 Ga0105246_10030198 Ga0105246_100301984 388
551 3300025907 Ga0207645_10042021 Ga0207645_100420211 388
552 3300025933 Ga0207706_10029867 Ga0207706_100298676 388
553 3300025938 Ga0207704_10107488 Ga0207704_101074882 388
554 3300025942 Ga0207689_10039174 Ga0207689_100391743 388
555 3300025961 Ga0207712_10022057 Ga0207712_100220573 388
556 3300025972 Ga0207668_10117907 Ga0207668_101179072 388
557 3300026116 Ga0207674_10072274 Ga0207674_100722742 388
558 3300026118 Ga0207675_100006786 Ga0207675_10000678612 388
559 3300027907 Ga0207428_10041944 Ga0207428_100419445 388
560 3300028380 Ga0268265_10002852 Ga0268265_100028522 388
561 3300028380 Ga0268265_10045413 Ga0268265_100454131 388
562 3300028381 Ga0268264_10018017 Ga0268264_100180172 388
563 3300049569 Ga0501032_0005648 Ga0501032_0005648_2559_3962 388
564 3300049572 Ga0501036_0039808 Ga0501036_0039808_342_1745 388
565 3300049579 Ga0501043_0128327 Ga0501043_0128327_416_1819 388
566 3300049580 Ga0501046_0032913 Ga0501046_0032913_938_2341 388
567 3300049581 Ga0501047_0023354 Ga0501047_0023354_1877_3280 388
568 3300049822 Ga0501035_0000333 Ga0501035_0000333_1877_3280 388
569 3300049823 Ga0501044_0000293 Ga0501044_0000293_1836_3239 388
570 3300050511 nmdc:mga08y16_33_c1 nmdc:mga08y16_33_c1_32042_33274 388
571 3300059421 Ga0590071_007344 Ga0590071_007344_118_1350 388
572 3300001989 JGI24739J22299_10001760 JGI24739J22299_100017607 389
573 3300005563 Ga0068855_100009625 Ga0068855_1000096254 389
574 3300025297 Ga0209758_1009723 Ga0209758_10097233 389
575 3300031251 Ga0265327_10006483 Ga0265327_1000648310 389
576 3300048904 Ga0496101_0008220 Ga0496101_0008220_5568_6788 389
577 3300048905 Ga0496102_0337449 Ga0496102_0337449_180_1400 389
578 3300048911 Ga0496108_0020397 Ga0496108_0020397_1527_2747 389
579 3300048912 Ga0496109_0012209 Ga0496109_0012209_2580_3800 389
580 3300048913 Ga0496110_0204917 Ga0496110_0204917_225_1445 389
581 3300048915 Ga0496112_0022338 Ga0496112_0022338_1958_3178 389
582 3300048917 Ga0496114_0075407 Ga0496114_0075407_504_1724 389
583 3300049522 Ga0501299_007998 Ga0501299_007998_18_1208 389
584 3300049580 Ga0501046_0043740 Ga0501046_0043740_963_2201 389
585 3300049581 Ga0501047_0001919 Ga0501047_0001919_9307_10545 389
586 3300053093 Ga0500651_0039664 Ga0500651_0039664_1025_2287 389
587 iso_pu_bacteria 2821443989 2821449640 389
588 3300013306 Ga0163162_10057010 Ga0163162_100570102 390
589 3300046660 Ga0495625_0028331 Ga0495625_0028331_946_2175 390
590 3300053080 Ga0500635_0000099 Ga0500635_0000099_18773_20062 390
591 3300053119 Ga0500595_001081 Ga0500595_001081_9322_10590 390
592 3300053122 Ga0500608_001029 Ga0500608_001029_933_2222 390
593 3300053177 Ga0500636_0015213 Ga0500636_0015213_861_2150 390
594 3300053178 Ga0500637_0001981 Ga0500637_0001981_6465_7754 390
595 3300053735 Ga0500596_003399 Ga0500596_003399_37_1305 390
596 3300006852 Ga0075433_10034982 Ga0075433_100349825 391
597 3300026041 Ga0207639_10154764 Ga0207639_101547642 391
598 3300032002 Ga0307416_100176364 Ga0307416_1001763642 391
599 3300050515 nmdc:mga0a205_143064_c1 nmdc:mga0a205_143064_c1_120_1343 391
600 3300049743 Ga0501081_0021640 Ga0501081_0021640_2301_3533 392
601 3300060353 Ga0501082_0031062 Ga0501082_0031062_1007_2239 392
602 3300005434 Ga0070709_10159429 Ga0070709_101594291 393
603 3300005340 Ga0070689_100172970 Ga0070689_1001729702 395
604 3300005354 Ga0070675_100000206 Ga0070675_10000020632 395
605 3300005543 Ga0070672_100015025 Ga0070672_1000150253 395
606 3300005617 Ga0068859_100025684 Ga0068859_1000256842 395
607 3300005618 Ga0068864_100140547 Ga0068864_1001405472 395
608 3300005843 Ga0068860_100013862 Ga0068860_1000138626 395
609 3300006931 Ga0097620_100025684 Ga0097620_1000256842 395
610 3300014745 Ga0157377_10020487 Ga0157377_100204872 395
611 3300025926 Ga0207659_10001426 Ga0207659_100014269 395
612 3300025936 Ga0207670_10036514 Ga0207670_100365142 395
613 3300025938 Ga0207704_10187905 Ga0207704_101879052 395
614 3300025940 Ga0207691_10023782 Ga0207691_100237824 395
615 3300025942 Ga0207689_10056423 Ga0207689_100564233 395
616 3300026075 Ga0207708_10084737 Ga0207708_100847372 395
617 3300026095 Ga0207676_10181301 Ga0207676_101813012 395
618 3300026121 Ga0207683_10160918 Ga0207683_101609182 395
619 3300028381 Ga0268264_10004727 Ga0268264_100047272 395
620 3300050514 nmdc:mga08x19_56407_c1 nmdc:mga08x19_56407_c1_1245_2492 399
621 2162886007 SwRhRL2b_contig_789971 SwRhRL2b_0792.00004360 401
622 3300005289 Ga0065704_10084663 Ga0065704_100846634 401
623 3300005295 Ga0065707_10002678 Ga0065707_100026783 401
624 3300035170 Ga0373943_0036110 Ga0373943_0036110_283_1533 401
625 3300035725 Ga0373947_0002407 Ga0373947_0002407_6449_7699 401
626 3300037068 Ga0373925_0005059 Ga0373925_0005059_8430_9680 401

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

300

478

0.87

PF07690

MFS_1

Major Facilitator Superfamily

97

340

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.8639 2 374
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8448 7 373
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.838 4 373
7sp5-assembly2.cif.gz_B crystal structure of a eukaryotic phosphate transporter 0.8347 3 375
6e9n-assembly2.cif.gz_B e. coli d-galactonate:proton symporter in the inward open form 0.8307 4 372
ID Description Score Start End Superfamily
af_P52067_222_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9899 198 378 1.20.1250.20
af_P52067_17_206_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9754 1 185 1.20.1250.20
af_P52067_222_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9635 198 378 1.20.1250.20
af_P52067_17_206_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9452 1 185 1.20.1250.20
af_Q9VCJ5_201_360_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9234 42 177 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1W2AHR8-F1-model_v4 MFS transporter, FSR family, fosmidomycin resistance protein 0.9812 5 379 GO:0005886
GO:0022857
AF-A0A0M8MHA8-F1-model_v4 Fosmidomycin resistance protein 0.9775 5 377 GO:0005886
GO:0022857
AF-R7H0R1-F1-model_v4 Fosmidomycin resistance protein 0.9771 5 377 GO:0005886
GO:0022857
AF-A0A3S4HHM8-F1-model_v4 Fosmidomycin resistance protein 0.9744 71 379 GO:0005886
GO:0022857
AF-A0A1H5UN65-F1-model_v4 MFS transporter, FSR family, fosmidomycin resistance protein 0.9729 5 377 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
88.14 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map