F470473
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 626 | 378 | 596 | 401 |
Family's Representative Sequence
| Representative Sequence | 3300031250|Ga0265331_10009532|Ga0265331_100095322 |
| Length | 478 |
| Sequence | MHWDESVAVRPECLFERQLSSRGTRDLWEGRGVSRRLGTAVPAGRWSVQGGSLTREKVSGDMGLCMSENSSRAAAARLPVPAAPAAGATVMGILWALAVAHLLNDTIQSLIPAIYPLLKKSFGLNYGQVGTITFVFQVTASLLQPCVGWYTDRRPKPYSLPIGMGVTLTGLVLLSRAGNFPMILVSAAMVGAGSAIFHPEASRVARAASGGRHGFAQSLFQVGGNCGSALGPLAGLVIAAHGQPSLLWFSGVALLDMFILTRVGGWYQRRLAALHAARAAAGPTRPSPFSRGRVAGAVAVLVVLIFSKFFYMVSLSNYYTFYLIDRFHVSVARAQVCLFVFLFSVAAGTIIGGPMGDRIGRKRVIWISILGVAPFTLLLPHVSLPLAVVLTVFIGLILASAFSSILVYAQELVPGRVGLIAGLFFGFAFGAGGLGSALLGRLADRTSIGFVFEVCAYLPLIGLLTALLPDVETPRRHV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 4 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 5 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 6 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 7 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 8 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 9 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 10 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 11 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 12 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 13 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 14 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 15 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 16 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 17 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 18 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 19 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 20 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 21 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 22 | 2888578766 | Paenibacillus lycopersici 12200R-189 | Isolate | Rhizosphere |
| 23 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 24 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 25 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 26 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 27 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 28 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 29 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 30 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 31 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 32 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 33 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 34 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 35 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 36 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 37 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 41 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 44 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 52 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 95 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 97 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 98 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 101 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 102 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 103 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 104 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 110 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 112 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 113 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 115 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 116 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 117 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 118 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 119 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 120 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 125 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 155 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 156 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 218 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 220 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 221 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 222 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 226 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 228 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 229 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 231 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 234 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 235 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 238 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 239 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 240 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 241 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 242 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 244 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 245 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 246 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 247 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 248 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 250 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 254 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 255 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 256 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 258 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 261 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 262 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 263 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 264 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 265 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 266 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 267 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 268 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 269 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 270 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 293 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 299 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 303 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 304 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 305 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 306 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 307 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 308 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 309 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 310 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 311 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 313 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 334 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 335 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 339 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 343 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 344 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 345 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 353 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 354 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 355 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 356 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 357 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 358 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 359 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 360 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 361 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 363 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 365 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 366 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 367 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 368 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 369 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 371 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 372 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 373 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 375 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 377 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 378 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.41 |
| Metatranscriptomes | 0.64 |
| Isolates | 4.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.15 |
| Nodule | 1.12 |
| Rhizoplane | 3.19 |
| Rhizosphere | 79.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_789971 | 2162886007 | Bacteria | 2075 |
| 2 | MRS1b_contig_4968207 | 2162886011 | Bacteria | 1664 |
| 3 | JGI24739J22299_10001760 | 3300001989 | Bacteria | 8239 |
| 4 | JGI25162J39368_1000804 | 3300002737 | Bacteria | 20830 |
| 5 | rootH1_10009586 | 3300003316 | Bacteria | 72733 |
| 6 | rootH1_10009586 | 3300003323 | Bacteria | 5685 |
| 7 | rootH2_10013067 | 3300003320 | Bacteria | 4358 |
| 8 | rootH2_10014493 | 3300003320 | Bacteria | 6222 |
| 9 | rootH2_10101339 | 3300003320 | Bacteria | 2745 |
| 10 | rootL2_10006488 | 3300003322 | Bacteria | 9795 |
| 11 | rootL2_10221481 | 3300003322 | Bacteria | 3571 |
| 12 | rootL2_10287946 | 3300003322 | Bacteria | 3080 |
| 13 | rootH1_10005123 | 3300003323 | Bacteria | 16310 |
| 14 | rootH1_10078729 | 3300003323 | Bacteria | 8139 |
| 15 | rootH1_10145331 | 3300003323 | Bacteria | 5100 |
| 16 | Ga0055526_1000136 | 3300003771 | Bacteria | 65004 |
| 17 | Ga0055526_1007120 | 3300003771 | Bacteria | 5900 |
| 18 | Ga0055526_1009765 | 3300003771 | Bacteria | 4563 |
| 19 | Ga0055526_1013006 | 3300003771 | Bacteria | 3565 |
| 20 | Ga0055524_1012130 | 3300003775 | Bacteria | 3326 |
| 21 | Ga0055536_1000102 | 3300003781 | Bacteria | 73767 |
| 22 | Ga0055534_1003928 | 3300003784 | Bacteria | 4492 |
| 23 | Ga0065714_10083682 | 3300005288 | Bacteria | 2237 |
| 24 | Ga0065704_10070670 | 3300005289 | Bacteria | 17980 |
| 25 | Ga0065704_10084663 | 3300005289 | Bacteria | 3310 |
| 26 | Ga0065712_10073199 | 3300005290 | Bacteria | 4471 |
| 27 | Ga0065715_10093330 | 3300005293 | Bacteria | 4724 |
| 28 | Ga0065715_10098358 | 3300005293 | Bacteria | 3560 |
| 29 | Ga0065707_10002678 | 3300005295 | Bacteria | 9541 |
| 30 | Ga0070658_10000561 | 3300005327 | Bacteria | 32242 |
| 31 | Ga0070658_10088801 | 3300005327 | Bacteria | 2545 |
| 32 | Ga0070658_10157965 | 3300005327 | Bacteria | 1901 |
| 33 | Ga0070676_10007250 | 3300005328 | Bacteria | 5945 |
| 34 | Ga0070676_10032355 | 3300005328 | Bacteria | 2996 |
| 35 | Ga0070683_100004660 | 3300005329 | Bacteria | 11330 |
| 36 | Ga0070683_100063615 | 3300005329 | Bacteria | 3432 |
| 37 | Ga0070683_100184698 | 3300005329 | Bacteria | 1979 |
| 38 | Ga0070683_100327238 | 3300005329 | Bacteria | 1459 |
| 39 | Ga0070690_100073052 | 3300005330 | Bacteria | 2231 |
| 40 | Ga0070670_100001031 | 3300005331 | Bacteria | 22061 |
| 41 | Ga0070670_100215855 | 3300005331 | Bacteria | 1669 |
| 42 | Ga0068869_100003939 | 3300005334 | Bacteria | 9169 |
| 43 | Ga0070666_10050437 | 3300005335 | Bacteria | 2799 |
| 44 | Ga0070680_100058625 | 3300005336 | Bacteria | 3149 |
| 45 | Ga0070680_100095830 | 3300005336 | Bacteria | 2460 |
| 46 | Ga0070680_100108936 | 3300005336 | Bacteria | 2304 |
| 47 | Ga0070682_100003265 | 3300005337 | Bacteria | 8993 |
| 48 | Ga0070660_100002940 | 3300005339 | Bacteria | 11721 |
| 49 | Ga0070660_100110058 | 3300005339 | Bacteria | 2191 |
| 50 | Ga0070689_100063673 | 3300005340 | Bacteria | 2869 |
| 51 | Ga0070689_100172970 | 3300005340 | Bacteria | 1751 |
| 52 | Ga0070687_100002062 | 3300005343 | Bacteria | 7389 |
| 53 | Ga0070661_100008737 | 3300005344 | Bacteria | 7010 |
| 54 | Ga0070661_100019269 | 3300005344 | Bacteria | 4862 |
| 55 | Ga0070668_100008165 | 3300005347 | Bacteria | 7774 |
| 56 | Ga0070668_100128849 | 3300005347 | Bacteria | 2029 |
| 57 | Ga0070669_100005300 | 3300005353 | Bacteria | 9310 |
| 58 | Ga0070669_100061566 | 3300005353 | Bacteria | 2758 |
| 59 | Ga0070669_100108936 | 3300005353 | Bacteria | 2100 |
| 60 | Ga0070675_100000206 | 3300005354 | Bacteria | 37528 |
| 61 | Ga0070675_100011275 | 3300005354 | Bacteria | 6997 |
| 62 | Ga0070675_100013574 | 3300005354 | Bacteria | 6405 |
| 63 | Ga0070675_100014959 | 3300005354 | Bacteria | 6126 |
| 64 | Ga0070675_100071080 | 3300005354 | Bacteria | 2886 |
| 65 | Ga0070671_100008146 | 3300005355 | Bacteria | 8387 |
| 66 | Ga0070674_100002577 | 3300005356 | Bacteria | 10037 |
| 67 | Ga0070673_100016413 | 3300005364 | Bacteria | 5236 |
| 68 | Ga0070688_100044973 | 3300005365 | Bacteria | 2726 |
| 69 | Ga0070688_100051175 | 3300005365 | Bacteria | 2576 |
| 70 | Ga0070659_100033595 | 3300005366 | Bacteria | 3985 |
| 71 | Ga0070667_100012755 | 3300005367 | Bacteria | 6947 |
| 72 | Ga0070667_100035024 | 3300005367 | Bacteria | 4204 |
| 73 | Ga0070667_100069439 | 3300005367 | Unclassified | 2998 |
| 74 | Ga0070709_10159429 | 3300005434 | Bacteria | 1567 |
| 75 | Ga0070714_100001985 | 3300005435 | Bacteria | 14951 |
| 76 | Ga0070714_100168966 | 3300005435 | Bacteria | 1984 |
| 77 | Ga0070713_100098363 | 3300005436 | Bacteria | 2530 |
| 78 | Ga0070713_100153824 | 3300005436 | Bacteria | 2048 |
| 79 | Ga0070711_100214055 | 3300005439 | Unclassified | 1494 |
| 80 | Ga0070705_100033032 | 3300005440 | Bacteria | 2881 |
| 81 | Ga0070700_100136007 | 3300005441 | Bacteria | 1664 |
| 82 | Ga0070708_100050999 | 3300005445 | Unclassified | 3665 |
| 83 | Ga0070663_100028289 | 3300005455 | Bacteria | 3815 |
| 84 | Ga0070678_100103563 | 3300005456 | Bacteria | 2211 |
| 85 | Ga0070662_100028044 | 3300005457 | Bacteria | 3916 |
| 86 | Ga0070662_100039839 | 3300005457 | Bacteria | 3343 |
| 87 | Ga0070681_10130564 | 3300005458 | Bacteria | 2445 |
| 88 | Ga0068867_100005913 | 3300005459 | Bacteria | 8676 |
| 89 | Ga0070685_10009315 | 3300005466 | Bacteria | 5068 |
| 90 | Ga0070706_100076929 | 3300005467 | Unclassified | 3088 |
| 91 | Ga0070707_100103895 | 3300005468 | Unclassified | 2754 |
| 92 | Ga0070698_100385901 | 3300005471 | Unclassified | 1333 |
| 93 | Ga0070699_100071694 | 3300005518 | Unclassified | 3013 |
| 94 | Ga0070679_100007344 | 3300005530 | Bacteria | 10295 |
| 95 | Ga0070679_100018570 | 3300005530 | Bacteria | 6750 |
| 96 | Ga0070684_100014578 | 3300005535 | Bacteria | 6372 |
| 97 | Ga0070697_100007686 | 3300005536 | Bacteria | 8395 |
| 98 | Ga0070697_100018524 | 3300005536 | Bacteria | 5489 |
| 99 | Ga0068853_100000017 | 3300005539 | Bacteria | 170544 |
| 100 | Ga0068853_100014097 | 3300005539 | Bacteria | 6544 |
| 101 | Ga0068853_100100065 | 3300005539 | Bacteria | 2562 |
| 102 | Ga0070672_100002535 | 3300005543 | Bacteria | 11637 |
| 103 | Ga0070672_100015025 | 3300005543 | Bacteria | 5501 |
| 104 | Ga0070686_100001654 | 3300005544 | Bacteria | 12453 |
| 105 | Ga0070696_100017631 | 3300005546 | Bacteria | 4821 |
| 106 | Ga0070693_100009663 | 3300005547 | Bacteria | 4802 |
| 107 | Ga0070665_100000005 | 3300005548 | Bacteria | 734905 |
| 108 | Ga0070665_100000370 | 3300005548 | Bacteria | 66870 |
| 109 | Ga0070665_100016954 | 3300005548 | Bacteria | 7304 |
| 110 | Ga0068855_100009625 | 3300005563 | Bacteria | 11657 |
| 111 | Ga0068855_100042355 | 3300005563 | Bacteria | 5394 |
| 112 | Ga0068855_100136862 | 3300005563 | Bacteria | 2794 |
| 113 | Ga0070664_100008688 | 3300005564 | Bacteria | 8222 |
| 114 | Ga0070664_100052088 | 3300005564 | Bacteria | 3467 |
| 115 | Ga0068857_100016166 | 3300005577 | Bacteria | 6534 |
| 116 | Ga0068857_100105018 | 3300005577 | Bacteria | 2536 |
| 117 | Ga0068854_100041639 | 3300005578 | Bacteria | 3247 |
| 118 | Ga0068856_100012777 | 3300005614 | Bacteria | 8129 |
| 119 | Ga0068852_100074705 | 3300005616 | Bacteria | 2986 |
| 120 | Ga0068859_100002478 | 3300005617 | Bacteria | 18767 |
| 121 | Ga0068859_100025684 | 3300005617 | Bacteria | 5908 |
| 122 | Ga0068859_100149322 | 3300005617 | Bacteria | 2413 |
| 123 | Ga0068864_100000364 | 3300005618 | Bacteria | 39580 |
| 124 | Ga0068864_100140547 | 3300005618 | Bacteria | 2178 |
| 125 | Ga0068864_100249663 | 3300005618 | Bacteria | 1647 |
| 126 | Ga0068864_100276463 | 3300005618 | Bacteria | 1566 |
| 127 | Ga0068866_10014495 | 3300005718 | Bacteria | 3483 |
| 128 | Ga0068861_100001551 | 3300005719 | Bacteria | 14594 |
| 129 | Ga0068851_10006749 | 3300005834 | Bacteria | 5251 |
| 130 | Ga0068863_100000614 | 3300005841 | Bacteria | 36138 |
| 131 | Ga0068863_100003306 | 3300005841 | Bacteria | 15914 |
| 132 | Ga0068863_100023810 | 3300005841 | Bacteria | 5844 |
| 133 | Ga0068858_100011854 | 3300005842 | Bacteria | 8217 |
| 134 | Ga0068858_100013088 | 3300005842 | Bacteria | 7824 |
| 135 | Ga0068858_100293862 | 3300005842 | Bacteria | 1549 |
| 136 | Ga0068860_100009474 | 3300005843 | Bacteria | 9671 |
| 137 | Ga0068860_100013862 | 3300005843 | Bacteria | 7904 |
| 138 | Ga0068860_100039430 | 3300005843 | Bacteria | 4518 |
| 139 | Ga0068860_100369580 | 3300005843 | Bacteria | 1414 |
| 140 | Ga0068862_100004578 | 3300005844 | Bacteria | 11663 |
| 141 | Ga0068862_100013250 | 3300005844 | Bacteria | 6820 |
| 142 | Ga0068862_100039852 | 3300005844 | Bacteria | 3991 |
| 143 | Ga0068862_100050848 | 3300005844 | Bacteria | 3543 |
| 144 | Ga0068862_100054084 | 3300005844 | Bacteria | 3437 |
| 145 | Ga0081455_10052713 | 3300005937 | Bacteria | 3480 |
| 146 | Ga0070717_10003461 | 3300006028 | Bacteria | 11301 |
| 147 | Ga0075363_100043560 | 3300006048 | Unclassified | 2375 |
| 148 | Ga0075366_10005270 | 3300006195 | Bacteria | 7004 |
| 149 | Ga0097621_100008034 | 3300006237 | Bacteria | 7575 |
| 150 | Ga0068871_100009083 | 3300006358 | Bacteria | 7183 |
| 151 | Ga0075428_100017535 | 3300006844 | Bacteria | 7910 |
| 152 | Ga0075428_100018325 | 3300006844 | Bacteria | 7740 |
| 153 | Ga0075430_100072448 | 3300006846 | Bacteria | 2889 |
| 154 | Ga0075431_100014257 | 3300006847 | Bacteria | 8038 |
| 155 | Ga0075431_100138873 | 3300006847 | Bacteria | 2505 |
| 156 | Ga0075433_10034982 | 3300006852 | Bacteria | 4318 |
| 157 | Ga0075434_100078965 | 3300006871 | Bacteria | 3287 |
| 158 | Ga0075434_100325622 | 3300006871 | Bacteria | 1557 |
| 159 | Ga0075429_100109563 | 3300006880 | Bacteria | 2414 |
| 160 | Ga0068865_100147206 | 3300006881 | Bacteria | 1783 |
| 161 | Ga0075436_100001071 | 3300006914 | Bacteria | 18405 |
| 162 | Ga0097620_100002478 | 3300006931 | Bacteria | 18767 |
| 163 | Ga0097620_100025684 | 3300006931 | Bacteria | 5908 |
| 164 | Ga0097620_100149333 | 3300006931 | Bacteria | 2413 |
| 165 | Ga0099826_10000007 | 3300006948 | Bacteria | 393518 |
| 166 | Ga0105251_10002762 | 3300009011 | Bacteria | 13404 |
| 167 | Ga0105244_10000757 | 3300009036 | Bacteria | 27596 |
| 168 | Ga0105240_10013135 | 3300009093 | Bacteria | 11395 |
| 169 | Ga0105240_10036770 | 3300009093 | Bacteria | 6296 |
| 170 | Ga0105240_10121033 | 3300009093 | Bacteria | 3151 |
| 171 | Ga0105240_10161224 | 3300009093 | Bacteria | 2663 |
| 172 | Ga0111539_10000050 | 3300009094 | Bacteria | 118845 |
| 173 | Ga0111539_10001033 | 3300009094 | Bacteria | 36485 |
| 174 | Ga0111539_10001140 | 3300009094 | Bacteria | 35130 |
| 175 | Ga0111539_10238999 | 3300009094 | Bacteria | 2114 |
| 176 | Ga0105245_10055494 | 3300009098 | Bacteria | 3558 |
| 177 | Ga0105247_10020299 | 3300009101 | Bacteria | 3995 |
| 178 | Ga0114129_10627986 | 3300009147 | Bacteria | 1389 |
| 179 | Ga0105241_10035226 | 3300009174 | Bacteria | 3764 |
| 180 | Ga0105248_10015251 | 3300009177 | Bacteria | 8469 |
| 181 | Ga0105248_10019102 | 3300009177 | Bacteria | 7579 |
| 182 | Ga0105237_10014419 | 3300009545 | Bacteria | 8266 |
| 183 | Ga0105237_10156003 | 3300009545 | Bacteria | 2280 |
| 184 | Ga0105238_10007127 | 3300009551 | Bacteria | 11186 |
| 185 | Ga0105238_10014605 | 3300009551 | Bacteria | 7940 |
| 186 | Ga0105238_10041883 | 3300009551 | Bacteria | 4638 |
| 187 | Ga0105238_10406586 | 3300009551 | Unclassified | 1355 |
| 188 | Ga0105249_10004119 | 3300009553 | Bacteria | 12553 |
| 189 | Ga0105249_10053806 | 3300009553 | Bacteria | 3680 |
| 190 | Ga0105249_10070999 | 3300009553 | Bacteria | 3216 |
| 191 | Ga0105239_10282371 | 3300010375 | Bacteria | 1869 |
| 192 | Ga0105239_10289640 | 3300010375 | Bacteria | 1844 |
| 193 | Ga0105246_10030198 | 3300011119 | Bacteria | 3577 |
| 194 | Ga0157373_10008804 | 3300013100 | Bacteria | 7478 |
| 195 | Ga0157371_10029047 | 3300013102 | Bacteria | 4003 |
| 196 | Ga0157371_10046477 | 3300013102 | Unclassified | 3088 |
| 197 | Ga0157371_10053271 | 3300013102 | Bacteria | 2873 |
| 198 | Ga0157371_10084899 | 3300013102 | Bacteria | 2243 |
| 199 | Ga0157371_10096072 | 3300013102 | Unclassified | 2100 |
| 200 | Ga0157370_10018018 | 3300013104 | Bacteria | 7108 |
| 201 | Ga0157370_10020068 | 3300013104 | Bacteria | 6684 |
| 202 | Ga0157370_10088396 | 3300013104 | Bacteria | 2910 |
| 203 | Ga0157369_10014890 | 3300013105 | Bacteria | 8779 |
| 204 | Ga0157369_10047749 | 3300013105 | Bacteria | 4647 |
| 205 | Ga0157374_10000071 | 3300013296 | Bacteria | 102927 |
| 206 | Ga0157374_10055031 | 3300013296 | Bacteria | 3712 |
| 207 | Ga0157374_10146522 | 3300013296 | Bacteria | 2293 |
| 208 | Ga0157374_10360676 | 3300013296 | Bacteria | 1445 |
| 209 | Ga0157378_10010011 | 3300013297 | Bacteria | 8269 |
| 210 | Ga0157378_10048647 | 3300013297 | Bacteria | 3770 |
| 211 | Ga0163162_10000004 | 3300013306 | Bacteria | 505593 |
| 212 | Ga0163162_10007093 | 3300013306 | Bacteria | 10874 |
| 213 | Ga0163162_10057010 | 3300013306 | Bacteria | 3934 |
| 214 | Ga0157372_10034465 | 3300013307 | Bacteria | 5565 |
| 215 | Ga0157372_10104251 | 3300013307 | Bacteria | 3242 |
| 216 | Ga0157372_10162908 | 3300013307 | Bacteria | 2578 |
| 217 | Ga0157372_10416479 | 3300013307 | Unclassified | 1566 |
| 218 | Ga0157375_10023530 | 3300013308 | Bacteria | 5685 |
| 219 | Ga0163163_10020303 | 3300014325 | Bacteria | 6253 |
| 220 | Ga0163163_10042395 | 3300014325 | Unclassified | 4457 |
| 221 | Ga0157380_10014880 | 3300014326 | Bacteria | 5702 |
| 222 | Ga0157377_10004362 | 3300014745 | Bacteria | 6501 |
| 223 | Ga0157377_10020487 | 3300014745 | Bacteria | 3466 |
| 224 | Ga0157376_10000170 | 3300014969 | Bacteria | 45040 |
| 225 | Ga0157376_10020496 | 3300014969 | Bacteria | 5115 |
| 226 | Ga0182007_10021466 | 3300015262 | Bacteria | 2292 |
| 227 | Ga0163161_10000447 | 3300017792 | Bacteria | 34461 |
| 228 | Ga0163161_10018985 | 3300017792 | Bacteria | 4819 |
| 229 | Ga0213872_10000051 | 3300021361 | Bacteria | 107261 |
| 230 | Ga0213872_10074667 | 3300021361 | Bacteria | 1526 |
| 231 | Ga0213876_10008820 | 3300021384 | Bacteria | 5443 |
| 232 | Ga0213876_10118895 | 3300021384 | Bacteria | 1403 |
| 233 | Ga0209437_100104 | 3300025233 | Bacteria | 220736 |
| 234 | Ga0209233_1000054 | 3300025261 | Bacteria | 439669 |
| 235 | Ga0209565_1001791 | 3300025263 | Bacteria | 8663 |
| 236 | Ga0209130_1002263 | 3300025284 | Bacteria | 9934 |
| 237 | Ga0209675_1000241 | 3300025291 | Bacteria | 54674 |
| 238 | Ga0209676_1000036 | 3300025292 | Bacteria | 457623 |
| 239 | Ga0209025_1000770 | 3300025294 | Bacteria | 53136 |
| 240 | Ga0209025_1001261 | 3300025294 | Bacteria | 35022 |
| 241 | Ga0209564_1000693 | 3300025295 | Bacteria | 49337 |
| 242 | Ga0209564_1000736 | 3300025295 | Bacteria | 46496 |
| 243 | Ga0209758_1009723 | 3300025297 | Bacteria | 5909 |
| 244 | Ga0209256_1000978 | 3300025299 | Bacteria | 34333 |
| 245 | Ga0207655_1000003 | 3300025728 | Bacteria | 1081376 |
| 246 | Ga0207713_1006462 | 3300025735 | Bacteria | 7138 |
| 247 | Ga0207688_10083138 | 3300025901 | Unclassified | 1831 |
| 248 | Ga0207647_10043961 | 3300025904 | Unclassified | 2793 |
| 249 | Ga0207645_10010755 | 3300025907 | Bacteria | 6273 |
| 250 | Ga0207645_10042021 | 3300025907 | Bacteria | 2926 |
| 251 | Ga0207705_10002064 | 3300025909 | Bacteria | 15622 |
| 252 | Ga0207705_10233569 | 3300025909 | Bacteria | 1399 |
| 253 | Ga0207684_10042479 | 3300025910 | Unclassified | 3854 |
| 254 | Ga0207654_10049315 | 3300025911 | Bacteria | 2414 |
| 255 | Ga0207707_10121786 | 3300025912 | Bacteria | 2281 |
| 256 | Ga0207695_10018573 | 3300025913 | Bacteria | 8033 |
| 257 | Ga0207671_10117978 | 3300025914 | Bacteria | 2026 |
| 258 | Ga0207660_10025925 | 3300025917 | Bacteria | 3986 |
| 259 | Ga0207660_10157864 | 3300025917 | Bacteria | 1747 |
| 260 | Ga0207662_10011026 | 3300025918 | Bacteria | 5002 |
| 261 | Ga0207657_10003445 | 3300025919 | Bacteria | 16880 |
| 262 | Ga0207657_10004443 | 3300025919 | Bacteria | 14837 |
| 263 | Ga0207649_10010783 | 3300025920 | Bacteria | 5025 |
| 264 | Ga0207649_10075401 | 3300025920 | Bacteria | 2167 |
| 265 | Ga0207652_10052790 | 3300025921 | Bacteria | 3490 |
| 266 | Ga0207652_10056075 | 3300025921 | Bacteria | 3391 |
| 267 | Ga0207652_10063565 | 3300025921 | Bacteria | 3192 |
| 268 | Ga0207646_10134418 | 3300025922 | Bacteria | 2227 |
| 269 | Ga0207681_10002183 | 3300025923 | Bacteria | 12476 |
| 270 | Ga0207694_10009223 | 3300025924 | Bacteria | 7444 |
| 271 | Ga0207650_10002784 | 3300025925 | Bacteria | 12080 |
| 272 | Ga0207650_10029672 | 3300025925 | Bacteria | 3934 |
| 273 | Ga0207650_10069093 | 3300025925 | Bacteria | 2654 |
| 274 | Ga0207650_10194865 | 3300025925 | Bacteria | 1620 |
| 275 | Ga0207659_10001426 | 3300025926 | Bacteria | 14241 |
| 276 | Ga0207659_10055363 | 3300025926 | Bacteria | 2837 |
| 277 | Ga0207700_10025463 | 3300025928 | Bacteria | 4109 |
| 278 | Ga0207664_10000858 | 3300025929 | Bacteria | 20574 |
| 279 | Ga0207664_10040423 | 3300025929 | Bacteria | 3626 |
| 280 | Ga0207644_10001621 | 3300025931 | Bacteria | 14498 |
| 281 | Ga0207706_10029867 | 3300025933 | Bacteria | 4865 |
| 282 | Ga0207706_10044977 | 3300025933 | Bacteria | 3911 |
| 283 | Ga0207670_10036514 | 3300025936 | Bacteria | 3196 |
| 284 | Ga0207669_10003403 | 3300025937 | Bacteria | 6880 |
| 285 | Ga0207704_10107488 | 3300025938 | Bacteria | 1877 |
| 286 | Ga0207704_10159230 | 3300025938 | Bacteria | 1604 |
| 287 | Ga0207704_10187905 | 3300025938 | Bacteria | 1500 |
| 288 | Ga0207691_10012169 | 3300025940 | Bacteria | 8249 |
| 289 | Ga0207691_10017237 | 3300025940 | Bacteria | 6852 |
| 290 | Ga0207691_10023782 | 3300025940 | Bacteria | 5767 |
| 291 | Ga0207711_10012402 | 3300025941 | Bacteria | 7085 |
| 292 | Ga0207711_10064726 | 3300025941 | Bacteria | 3158 |
| 293 | Ga0207689_10003215 | 3300025942 | Bacteria | 14965 |
| 294 | Ga0207689_10039174 | 3300025942 | Bacteria | 3924 |
| 295 | Ga0207689_10056423 | 3300025942 | Bacteria | 3232 |
| 296 | Ga0207661_10061388 | 3300025944 | Bacteria | 3037 |
| 297 | Ga0207661_10083649 | 3300025944 | Bacteria | 2641 |
| 298 | Ga0207661_10131146 | 3300025944 | Bacteria | 2147 |
| 299 | Ga0207661_10131700 | 3300025944 | Bacteria | 2143 |
| 300 | Ga0207661_10227819 | 3300025944 | Bacteria | 1649 |
| 301 | Ga0207679_10009876 | 3300025945 | Bacteria | 6127 |
| 302 | Ga0207667_10044161 | 3300025949 | Bacteria | 4724 |
| 303 | Ga0207667_10053025 | 3300025949 | Bacteria | 4268 |
| 304 | Ga0207712_10022057 | 3300025961 | Bacteria | 4188 |
| 305 | Ga0207712_10027877 | 3300025961 | Bacteria | 3773 |
| 306 | Ga0207668_10117907 | 3300025972 | Bacteria | 2004 |
| 307 | Ga0207640_10189892 | 3300025981 | Bacteria | 1548 |
| 308 | Ga0207658_10076586 | 3300025986 | Unclassified | 2549 |
| 309 | Ga0207658_10076696 | 3300025986 | Bacteria | 2547 |
| 310 | Ga0207703_10004606 | 3300026035 | Bacteria | 11284 |
| 311 | Ga0207703_10109536 | 3300026035 | Bacteria | 2354 |
| 312 | Ga0207639_10000031 | 3300026041 | Bacteria | 170640 |
| 313 | Ga0207639_10154764 | 3300026041 | Bacteria | 1924 |
| 314 | Ga0207678_10000707 | 3300026067 | Bacteria | 30447 |
| 315 | Ga0207708_10084737 | 3300026075 | Bacteria | 2437 |
| 316 | Ga0207702_10027774 | 3300026078 | Bacteria | 4701 |
| 317 | Ga0207702_10077939 | 3300026078 | Bacteria | 2868 |
| 318 | Ga0207641_10008328 | 3300026088 | Bacteria | 8571 |
| 319 | Ga0207641_10014158 | 3300026088 | Bacteria | 6537 |
| 320 | Ga0207641_10026105 | 3300026088 | Bacteria | 4820 |
| 321 | Ga0207641_10084489 | 3300026088 | Bacteria | 2763 |
| 322 | Ga0207641_10277550 | 3300026088 | Bacteria | 1575 |
| 323 | Ga0207648_10002941 | 3300026089 | Bacteria | 18032 |
| 324 | Ga0207676_10022505 | 3300026095 | Bacteria | 4636 |
| 325 | Ga0207676_10181301 | 3300026095 | Bacteria | 1844 |
| 326 | Ga0207674_10019990 | 3300026116 | Bacteria | 7247 |
| 327 | Ga0207674_10072274 | 3300026116 | Bacteria | 3465 |
| 328 | Ga0207674_10094264 | 3300026116 | Unclassified | 2980 |
| 329 | Ga0207674_10213692 | 3300026116 | Bacteria | 1877 |
| 330 | Ga0207675_100003708 | 3300026118 | Bacteria | 14882 |
| 331 | Ga0207675_100006786 | 3300026118 | Bacteria | 10833 |
| 332 | Ga0207683_10041638 | 3300026121 | Bacteria | 4011 |
| 333 | Ga0207683_10075673 | 3300026121 | Bacteria | 2980 |
| 334 | Ga0207683_10160918 | 3300026121 | Bacteria | 2029 |
| 335 | Ga0207698_10076622 | 3300026142 | Bacteria | 2677 |
| 336 | Ga0209371_1001812 | 3300027312 | Bacteria | 13335 |
| 337 | Ga0209282_1000059 | 3300027666 | Bacteria | 97821 |
| 338 | Ga0209974_10022940 | 3300027876 | Bacteria | 2065 |
| 339 | Ga0207428_10003027 | 3300027907 | Bacteria | 16548 |
| 340 | Ga0207428_10009632 | 3300027907 | Bacteria | 8651 |
| 341 | Ga0207428_10041944 | 3300027907 | Bacteria | 3703 |
| 342 | Ga0265354_1001773 | 3300028016 | Bacteria | 2949 |
| 343 | Ga0265355_1000237 | 3300028036 | Bacteria | 2551 |
| 344 | Ga0268266_10000012 | 3300028379 | Bacteria | 734912 |
| 345 | Ga0268266_10000620 | 3300028379 | Bacteria | 48325 |
| 346 | Ga0268266_10001402 | 3300028379 | Bacteria | 28793 |
| 347 | Ga0268266_10147537 | 3300028379 | Bacteria | 2116 |
| 348 | Ga0268265_10002852 | 3300028380 | Bacteria | 12717 |
| 349 | Ga0268265_10014462 | 3300028380 | Bacteria | 5377 |
| 350 | Ga0268265_10045413 | 3300028380 | Bacteria | 3278 |
| 351 | Ga0268264_10001864 | 3300028381 | Bacteria | 19166 |
| 352 | Ga0268264_10004727 | 3300028381 | Bacteria | 11568 |
| 353 | Ga0268264_10018017 | 3300028381 | Bacteria | 5775 |
| 354 | Ga0268264_10301085 | 3300028381 | Bacteria | 1509 |
| 355 | Ga0265319_1000087 | 3300028563 | Bacteria | 71928 |
| 356 | Ga0265319_1006331 | 3300028563 | Bacteria | 5497 |
| 357 | Ga0265319_1025940 | 3300028563 | Bacteria | 2092 |
| 358 | Ga0265334_10001402 | 3300028573 | Bacteria | 11601 |
| 359 | Ga0265334_10011133 | 3300028573 | Bacteria | 3791 |
| 360 | Ga0265318_10000762 | 3300028577 | Bacteria | 21446 |
| 361 | Ga0307515_10098140 | 3300028794 | Bacteria | 3571 |
| 362 | Ga0307515_10258623 | 3300028794 | Bacteria | 1481 |
| 363 | Ga0265338_10033903 | 3300028800 | Bacteria | 4946 |
| 364 | Ga0268256_1003763 | 3300030500 | Bacteria | 6650 |
| 365 | Ga0265770_1000137 | 3300030878 | Bacteria | 8966 |
| 366 | Ga0265760_10001244 | 3300031090 | Bacteria | 7461 |
| 367 | Ga0265320_10006929 | 3300031240 | Bacteria | 7076 |
| 368 | Ga0265325_10024572 | 3300031241 | Bacteria | 3277 |
| 369 | Ga0265339_10000096 | 3300031249 | Bacteria | 74964 |
| 370 | Ga0265331_10009532 | 3300031250 | Bacteria | 5447 |
| 371 | Ga0265327_10000747 | 3300031251 | Bacteria | 50580 |
| 372 | Ga0265327_10006483 | 3300031251 | Bacteria | 9343 |
| 373 | Ga0307408_100003852 | 3300031548 | Bacteria | 10204 |
| 374 | Ga0307408_100018971 | 3300031548 | Bacteria | 4625 |
| 375 | Ga0307408_100050094 | 3300031548 | Bacteria | 3002 |
| 376 | Ga0265313_10000024 | 3300031595 | Bacteria | 138587 |
| 377 | Ga0265313_10011763 | 3300031595 | Bacteria | 5413 |
| 378 | Ga0307508_10000026 | 3300031616 | Bacteria | 171622 |
| 379 | Ga0316575_10055241 | 3300031665 | Bacteria | 1581 |
| 380 | Ga0265314_10001852 | 3300031711 | Bacteria | 22676 |
| 381 | Ga0316578_10004658 | 3300031728 | Bacteria | 6508 |
| 382 | Ga0307413_10018781 | 3300031824 | Bacteria | 3636 |
| 383 | Ga0307413_10079807 | 3300031824 | Bacteria | 2093 |
| 384 | Ga0307406_10003478 | 3300031901 | Bacteria | 8567 |
| 385 | Ga0307409_100038139 | 3300031995 | Bacteria | 3551 |
| 386 | Ga0307416_100176364 | 3300032002 | Bacteria | 1997 |
| 387 | Ga0316593_10008621 | 3300032168 | Bacteria | 2849 |
| 388 | Ga0307510_10000260 | 3300033180 | Bacteria | 48220 |
| 389 | Ga0316596_1024829 | 3300033541 | Bacteria | 1540 |
| 390 | Ga0373943_0036110 | 3300035170 | Bacteria | 2366 |
| 391 | Ga0373943_0073651 | 3300035170 | Bacteria | 1735 |
| 392 | Ga0373931_0012340 | 3300035691 | Bacteria | 4139 |
| 393 | Ga0373927_0000702 | 3300035695 | Bacteria | 25625 |
| 394 | Ga0373947_0002407 | 3300035725 | Bacteria | 11308 |
| 395 | Ga0316584_0000728 | 3300036712 | Bacteria | 18275 |
| 396 | Ga0316584_0083956 | 3300036712 | Bacteria | 2385 |
| 397 | Ga0373925_0001918 | 3300037068 | Bacteria | 17221 |
| 398 | Ga0373925_0005059 | 3300037068 | Bacteria | 9876 |
| 399 | Ga0395899_0020587 | 3300037312 | Bacteria | 5000 |
| 400 | Ga0395900_0130156 | 3300037418 | Bacteria | 2579 |
| 401 | Ga0395905_0033708 | 3300037471 | Bacteria | 4809 |
| 402 | Ga0395905_0043436 | 3300037471 | Bacteria | 4217 |
| 403 | Ga0436364_0155742 | 3300037853 | Bacteria | 4134 |
| 404 | Ga0395901_0119904 | 3300038443 | Bacteria | 2764 |
| 405 | Ga0436365_0726921 | 3300039437 | Bacteria | 59637 |
| 406 | Ga0436360_0285869 | 3300039438 | Bacteria | 1948 |
| 407 | Ga0436361_0024002 | 3300039447 | Bacteria | 58799 |
| 408 | Ga0436361_0111000 | 3300039447 | Bacteria | 5675 |
| 409 | Ga0436361_0333614 | 3300039447 | Bacteria | 3586 |
| 410 | Ga0436361_0702269 | 3300039447 | Bacteria | 4832 |
| 411 | Ga0451841_1210261 | 3300041498 | Bacteria | 3111 |
| 412 | Ga0451853_2872322 | 3300041512 | Bacteria | 3544 |
| 413 | Ga0453684_0010740 | 3300044712 | Bacteria | 15557 |
| 414 | Ga0451576_0000856 | 3300045051 | Bacteria | 58909 |
| 415 | Ga0451576_0000892 | 3300045051 | Bacteria | 56717 |
| 416 | Ga0451576_0037611 | 3300045051 | Bacteria | 5126 |
| 417 | Ga0466967_0059481 | 3300045976 | Bacteria | 3383 |
| 418 | Ga0495627_001304 | 3300046453 | Bacteria | 15211 |
| 419 | Ga0495638_0084084 | 3300046460 | Bacteria | 1926 |
| 420 | Ga0495650_0000027 | 3300046471 | Bacteria | 475071 |
| 421 | Ga0495650_0001458 | 3300046471 | Bacteria | 22665 |
| 422 | Ga0495650_0002398 | 3300046471 | Bacteria | 15306 |
| 423 | Ga0495605_0005711 | 3300046474 | Bacteria | 7223 |
| 424 | Ga0495596_0000057 | 3300046500 | Bacteria | 81281 |
| 425 | Ga0495607_0002727 | 3300046501 | Bacteria | 14083 |
| 426 | Ga0495606_0000123 | 3300046507 | Bacteria | 131654 |
| 427 | Ga0495606_0002544 | 3300046507 | Bacteria | 20979 |
| 428 | Ga0495606_0018719 | 3300046507 | Bacteria | 5182 |
| 429 | Ga0495610_0000543 | 3300046512 | Bacteria | 37709 |
| 430 | Ga0495616_0031404 | 3300046513 | Bacteria | 2781 |
| 431 | Ga0495620_0021160 | 3300046515 | Bacteria | 3163 |
| 432 | Ga0495637_0022409 | 3300046520 | Bacteria | 2881 |
| 433 | Ga0495609_0001051 | 3300046538 | Bacteria | 19356 |
| 434 | Ga0495645_0143038 | 3300046543 | Bacteria | 1667 |
| 435 | Ga0495633_0001402 | 3300046558 | Bacteria | 18790 |
| 436 | Ga0495625_0000377 | 3300046660 | Bacteria | 68156 |
| 437 | Ga0495625_0028331 | 3300046660 | Bacteria | 4202 |
| 438 | Ga0495658_0003329 | 3300046683 | Bacteria | 7974 |
| 439 | Ga0495671_0000364 | 3300046692 | Bacteria | 37524 |
| 440 | Ga0495672_0001402 | 3300047320 | Bacteria | 23718 |
| 441 | Ga0495681_0001901 | 3300047470 | Bacteria | 15333 |
| 442 | Ga0495686_0000090 | 3300047472 | Bacteria | 193179 |
| 443 | Ga0495686_0000132 | 3300047472 | Bacteria | 151609 |
| 444 | Ga0495686_0006543 | 3300047472 | Bacteria | 8892 |
| 445 | Ga0495686_0037646 | 3300047472 | Bacteria | 3098 |
| 446 | Ga0495686_0094632 | 3300047472 | Bacteria | 1810 |
| 447 | Ga0496100_0182220 | 3300048903 | Bacteria | 1519 |
| 448 | Ga0496101_0008220 | 3300048904 | Bacteria | 6814 |
| 449 | Ga0496102_0337449 | 3300048905 | Bacteria | 1420 |
| 450 | Ga0496103_0013858 | 3300048906 | Bacteria | 4786 |
| 451 | Ga0496104_0045498 | 3300048907 | Bacteria | 4128 |
| 452 | Ga0496108_0020397 | 3300048911 | Bacteria | 5448 |
| 453 | Ga0496108_0030507 | 3300048911 | Bacteria | 4469 |
| 454 | Ga0496109_0000770 | 3300048912 | Bacteria | 26636 |
| 455 | Ga0496109_0012209 | 3300048912 | Bacteria | 7411 |
| 456 | Ga0496110_0093425 | 3300048913 | Bacteria | 2693 |
| 457 | Ga0496110_0204917 | 3300048913 | Bacteria | 1792 |
| 458 | Ga0496112_0000221 | 3300048915 | Bacteria | 36971 |
| 459 | Ga0496112_0022338 | 3300048915 | Bacteria | 6028 |
| 460 | Ga0496112_0056345 | 3300048915 | Bacteria | 3868 |
| 461 | Ga0496112_0461530 | 3300048915 | Bacteria | 1208 |
| 462 | Ga0496113_0000588 | 3300048916 | Bacteria | 18149 |
| 463 | Ga0496113_0079475 | 3300048916 | Bacteria | 2511 |
| 464 | Ga0496114_0011142 | 3300048917 | Bacteria | 7178 |
| 465 | Ga0496114_0075407 | 3300048917 | Bacteria | 2841 |
| 466 | Ga0496115_0004131 | 3300048918 | Bacteria | 10478 |
| 467 | Ga0496116_0004563 | 3300048919 | Bacteria | 13137 |
| 468 | Ga0496116_0007360 | 3300048919 | Bacteria | 9782 |
| 469 | Ga0496117_0091132 | 3300048920 | Bacteria | 1962 |
| 470 | Ga0496119_0000043 | 3300048922 | Bacteria | 192373 |
| 471 | Ga0496120_0000009 | 3300048923 | Bacteria | 386727 |
| 472 | Ga0496121_0010524 | 3300048924 | Bacteria | 10415 |
| 473 | Ga0496121_0014255 | 3300048924 | Bacteria | 8454 |
| 474 | Ga0496121_0035174 | 3300048924 | Bacteria | 4494 |
| 475 | Ga0496121_0143947 | 3300048924 | Bacteria | 1764 |
| 476 | Ga0496121_0147817 | 3300048924 | Bacteria | 1734 |
| 477 | Ga0496122_0001659 | 3300048925 | Bacteria | 34509 |
| 478 | Ga0496122_0079087 | 3300048925 | Bacteria | 2300 |
| 479 | Ga0496123_0000648 | 3300048926 | Bacteria | 57922 |
| 480 | Ga0496124_0020008 | 3300048927 | Bacteria | 6202 |
| 481 | Ga0496125_0035727 | 3300048928 | Bacteria | 4353 |
| 482 | Ga0495678_008988 | 3300049459 | Bacteria | 4990 |
| 483 | Ga0501299_007998 | 3300049522 | Bacteria | 1708 |
| 484 | Ga0501031_0000039 | 3300049568 | Bacteria | 72794 |
| 485 | Ga0501032_0005648 | 3300049569 | Bacteria | 9269 |
| 486 | Ga0501032_0008417 | 3300049569 | Bacteria | 7525 |
| 487 | Ga0501032_0037794 | 3300049569 | Bacteria | 3290 |
| 488 | Ga0501033_0000750 | 3300049570 | Bacteria | 29867 |
| 489 | Ga0501033_0074526 | 3300049570 | Bacteria | 2492 |
| 490 | Ga0501033_0077813 | 3300049570 | Bacteria | 2434 |
| 491 | Ga0501034_0001018 | 3300049571 | Bacteria | 40183 |
| 492 | Ga0501034_0001701 | 3300049571 | Bacteria | 28339 |
| 493 | Ga0501034_0059150 | 3300049571 | Bacteria | 3850 |
| 494 | Ga0501036_0039808 | 3300049572 | Bacteria | 3977 |
| 495 | Ga0501036_0075054 | 3300049572 | Bacteria | 2860 |
| 496 | Ga0501037_0002415 | 3300049573 | Bacteria | 13503 |
| 497 | Ga0501037_0008225 | 3300049573 | Bacteria | 7649 |
| 498 | Ga0501037_0030630 | 3300049573 | Bacteria | 3975 |
| 499 | Ga0501038_0001659 | 3300049574 | Bacteria | 20640 |
| 500 | Ga0501038_0026484 | 3300049574 | Bacteria | 5164 |
| 501 | Ga0501038_0094257 | 3300049574 | Bacteria | 2503 |
| 502 | Ga0501038_0264165 | 3300049574 | Bacteria | 1359 |
| 503 | Ga0501040_0011798 | 3300049576 | Bacteria | 5717 |
| 504 | Ga0501042_0001847 | 3300049578 | Bacteria | 12712 |
| 505 | Ga0501043_0043010 | 3300049579 | Bacteria | 3551 |
| 506 | Ga0501043_0128327 | 3300049579 | Bacteria | 1988 |
| 507 | Ga0501043_0155357 | 3300049579 | Bacteria | 1789 |
| 508 | Ga0501046_0000536 | 3300049580 | Bacteria | 37635 |
| 509 | Ga0501046_0032913 | 3300049580 | Bacteria | 4194 |
| 510 | Ga0501046_0043740 | 3300049580 | Bacteria | 3565 |
| 511 | Ga0501047_0001919 | 3300049581 | Bacteria | 19982 |
| 512 | Ga0501047_0023354 | 3300049581 | Bacteria | 5938 |
| 513 | Ga0501047_0049454 | 3300049581 | Bacteria | 4060 |
| 514 | Ga0501047_0064340 | 3300049581 | Bacteria | 3537 |
| 515 | Ga0501047_0079504 | 3300049581 | Bacteria | 3152 |
| 516 | Ga0501048_0016062 | 3300049582 | Bacteria | 5521 |
| 517 | Ga0501067_0025056 | 3300049583 | Bacteria | 3308 |
| 518 | Ga0501067_0051895 | 3300049583 | Bacteria | 2272 |
| 519 | Ga0501069_0027087 | 3300049585 | Bacteria | 3141 |
| 520 | Ga0501070_0009957 | 3300049586 | Bacteria | 8038 |
| 521 | Ga0501070_0047738 | 3300049586 | Bacteria | 3557 |
| 522 | Ga0501070_0134597 | 3300049586 | Bacteria | 2041 |
| 523 | Ga0501073_0104269 | 3300049589 | Bacteria | 1968 |
| 524 | Ga0501074_0002131 | 3300049590 | Bacteria | 13682 |
| 525 | Ga0501074_0009912 | 3300049590 | Bacteria | 6922 |
| 526 | Ga0501076_0013211 | 3300049592 | Bacteria | 6188 |
| 527 | Ga0501077_0034372 | 3300049593 | Bacteria | 3227 |
| 528 | Ga0501243_000107 | 3300049675 | Bacteria | 9013 |
| 529 | Ga0501243_008107 | 3300049675 | Bacteria | 1616 |
| 530 | Ga0501249_000018 | 3300049679 | Bacteria | 113532 |
| 531 | Ga0501249_006960 | 3300049679 | Bacteria | 2330 |
| 532 | Ga0501079_0002062 | 3300049741 | Bacteria | 14411 |
| 533 | Ga0501080_0014395 | 3300049742 | Bacteria | 7284 |
| 534 | Ga0501080_0048263 | 3300049742 | Bacteria | 3963 |
| 535 | Ga0501080_0095950 | 3300049742 | Bacteria | 2753 |
| 536 | Ga0501081_0018613 | 3300049743 | Bacteria | 4615 |
| 537 | Ga0501081_0021640 | 3300049743 | Bacteria | 4292 |
| 538 | Ga0501241_000341 | 3300049758 | Bacteria | 10302 |
| 539 | Ga0501035_0000333 | 3300049822 | Bacteria | 54985 |
| 540 | Ga0501035_0009258 | 3300049822 | Bacteria | 9156 |
| 541 | Ga0501035_0018304 | 3300049822 | Bacteria | 6454 |
| 542 | Ga0501035_0032147 | 3300049822 | Bacteria | 4776 |
| 543 | Ga0501044_0000133 | 3300049823 | Bacteria | 91116 |
| 544 | Ga0501044_0000293 | 3300049823 | Bacteria | 63533 |
| 545 | Ga0501044_0006477 | 3300049823 | Bacteria | 12932 |
| 546 | Ga0501044_0020839 | 3300049823 | Bacteria | 6998 |
| 547 | Ga0501044_0033634 | 3300049823 | Bacteria | 5385 |
| 548 | Ga0501045_0051583 | 3300049824 | Bacteria | 3002 |
| 549 | nmdc:mga03683_99_c3 | 3300050489 | Bacteria | 12731 |
| 550 | nmdc:mga03n38_6968_c1 | 3300050490 | Unclassified | 3970 |
| 551 | nmdc:mga0k408_6494_c1 | 3300050493 | Bacteria | 6233 |
| 552 | nmdc:mga0k408_770_c1 | 3300050493 | Bacteria | 17585 |
| 553 | nmdc:mga09592_144678_c1 | 3300050508 | Bacteria | 2050 |
| 554 | nmdc:mga0qj67_159093_c1 | 3300050509 | Bacteria | 1834 |
| 555 | nmdc:mga0qj67_30594_c1 | 3300050509 | Bacteria | 4192 |
| 556 | nmdc:mga0qj67_3998_c1 | 3300050509 | Bacteria | 10676 |
| 557 | nmdc:mga06r32_159476_c1 | 3300050510 | Bacteria | 2238 |
| 558 | nmdc:mga06r32_16077_c1 | 3300050510 | Bacteria | 6813 |
| 559 | nmdc:mga06r32_23611_c1 | 3300050510 | Bacteria | 5693 |
| 560 | nmdc:mga06r32_83123_c1 | 3300050510 | Bacteria | 3120 |
| 561 | nmdc:mga08y16_30876_c1 | 3300050511 | Bacteria | 5635 |
| 562 | nmdc:mga08y16_33_c1 | 3300050511 | Bacteria | 172528 |
| 563 | nmdc:mga08y16_445_c1 | 3300050511 | Bacteria | 38283 |
| 564 | nmdc:mga0n895_410571_c1 | 3300050512 | Bacteria | 1369 |
| 565 | nmdc:mga08x19_56407_c1 | 3300050514 | Bacteria | 2535 |
| 566 | nmdc:mga0a205_143064_c1 | 3300050515 | Bacteria | 1971 |
| 567 | Ga0500610_0123868 | 3300053079 | Bacteria | 1320 |
| 568 | Ga0500635_0000099 | 3300053080 | Bacteria | 52195 |
| 569 | Ga0500635_0010903 | 3300053080 | Bacteria | 2569 |
| 570 | Ga0500578_0216823 | 3300053086 | Bacteria | 1165 |
| 571 | Ga0500651_0039664 | 3300053093 | Bacteria | 2965 |
| 572 | Ga0500641_0000232 | 3300053096 | Bacteria | 20906 |
| 573 | Ga0500555_000465 | 3300053103 | Bacteria | 16792 |
| 574 | Ga0500555_018866 | 3300053103 | Bacteria | 1988 |
| 575 | Ga0500556_0000237 | 3300053104 | Bacteria | 44734 |
| 576 | Ga0500595_001081 | 3300053119 | Bacteria | 15120 |
| 577 | Ga0500595_012359 | 3300053119 | Unclassified | 3306 |
| 578 | Ga0500608_001029 | 3300053122 | Bacteria | 9991 |
| 579 | Ga0500618_000089 | 3300053125 | Bacteria | 74800 |
| 580 | Ga0500618_000875 | 3300053125 | Bacteria | 16083 |
| 581 | Ga0500642_0004362 | 3300053130 | Unclassified | 4420 |
| 582 | Ga0500658_0008805 | 3300053134 | Unclassified | 3725 |
| 583 | Ga0500559_0000006 | 3300053136 | Bacteria | 229895 |
| 584 | Ga0500573_0011836 | 3300053140 | Bacteria | 4890 |
| 585 | Ga0500590_002901 | 3300053148 | Bacteria | 7774 |
| 586 | Ga0500622_0131317 | 3300053156 | Bacteria | 1203 |
| 587 | Ga0500624_000121 | 3300053157 | Bacteria | 35470 |
| 588 | Ga0500636_0015213 | 3300053177 | Bacteria | 4530 |
| 589 | Ga0500637_0001981 | 3300053178 | Bacteria | 8904 |
| 590 | Ga0500645_003649 | 3300053730 | Bacteria | 6156 |
| 591 | Ga0500596_003399 | 3300053735 | Bacteria | 3031 |
| 592 | Ga0501084_0005613 | 3300054114 | Bacteria | 10303 |
| 593 | Ga0590071_007344 | 3300059421 | Bacteria | 2605 |
| 594 | Ga0501082_0031062 | 3300060353 | Bacteria | 4604 |
| 595 | Ga0501082_0070770 | 3300060353 | Bacteria | 3004 |
| 596 | Ga0501082_0231344 | 3300060353 | Bacteria | 1608 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025944 | Ga0207661_10131700 | Ga0207661_101317002 | 326 |
| 2 | 3300048915 | Ga0496112_0461530 | Ga0496112_0461530_81_1151 | 337 |
| 3 | 3300017792 | Ga0163161_10000447 | Ga0163161_100004479 | 338 |
| 4 | 3300009036 | Ga0105244_10000757 | Ga0105244_100007575 | 346 |
| 5 | 3300025728 | Ga0207655_1000003 | Ga0207655_1000003882 | 346 |
| 6 | 3300014326 | Ga0157380_10014880 | Ga0157380_100148804 | 347 |
| 7 | 3300031824 | Ga0307413_10079807 | Ga0307413_100798071 | 347 |
| 8 | 2162886011 | MRS1b_contig_4968207 | MRS1b_0016.00000480 | 349 |
| 9 | 3300005354 | Ga0070675_100071080 | Ga0070675_1000710803 | 349 |
| 10 | 3300060353 | Ga0501082_0231344 | Ga0501082_0231344_27_1130 | 352 |
| 11 | 3300005435 | Ga0070714_100001985 | Ga0070714_10000198510 | 354 |
| 12 | 3300015262 | Ga0182007_10021466 | Ga0182007_100214662 | 354 |
| 13 | 3300025929 | Ga0207664_10000858 | Ga0207664_100008584 | 354 |
| 14 | 3300039438 | Ga0436360_0285869 | Ga0436360_0285869_578_1801 | 354 |
| 15 | 3300005288 | Ga0065714_10083682 | Ga0065714_100836822 | 355 |
| 16 | 3300049570 | Ga0501033_0074526 | Ga0501033_0074526_1134_2399 | 355 |
| 17 | 3300049571 | Ga0501034_0059150 | Ga0501034_0059150_1086_2351 | 355 |
| 18 | 3300049572 | Ga0501036_0075054 | Ga0501036_0075054_253_1497 | 355 |
| 19 | 3300049574 | Ga0501038_0026484 | Ga0501038_0026484_285_1550 | 355 |
| 20 | 3300049579 | Ga0501043_0043010 | Ga0501043_0043010_760_2025 | 355 |
| 21 | 3300049581 | Ga0501047_0049454 | Ga0501047_0049454_201_1466 | 355 |
| 22 | 3300049822 | Ga0501035_0009258 | Ga0501035_0009258_533_1798 | 355 |
| 23 | 3300049823 | Ga0501044_0020839 | Ga0501044_0020839_274_1539 | 355 |
| 24 | 3300021384 | Ga0213876_10008820 | Ga0213876_100088206 | 356 |
| 25 | 3300039437 | Ga0436365_0726921 | Ga0436365_0726921_38533_39798 | 356 |
| 26 | 3300049574 | Ga0501038_0094257 | Ga0501038_0094257_1030_2271 | 357 |
| 27 | iso_pu_bacteria | 2501025502 | 2501077563 | 358 |
| 28 | 3300005842 | Ga0068858_100013088 | Ga0068858_1000130884 | 359 |
| 29 | 3300026035 | Ga0207703_10004606 | Ga0207703_100046068 | 359 |
| 30 | 3300013102 | Ga0157371_10084899 | Ga0157371_100848992 | 361 |
| 31 | 3300013307 | Ga0157372_10416479 | Ga0157372_104164792 | 361 |
| 32 | 3300025925 | Ga0207650_10194865 | Ga0207650_101948652 | 361 |
| 33 | 3300053086 | Ga0500578_0216823 | Ga0500578_0216823_16_1140 | 361 |
| 34 | 3300003320 | rootH2_10014493 | rootH2_100144935 | 362 |
| 35 | 3300005367 | Ga0070667_100069439 | Ga0070667_1000694392 | 362 |
| 36 | 3300013308 | Ga0157375_10023530 | Ga0157375_100235304 | 362 |
| 37 | 3300025986 | Ga0207658_10076586 | Ga0207658_100765862 | 362 |
| 38 | 3300005365 | Ga0070688_100044973 | Ga0070688_1000449733 | 363 |
| 39 | 3300013102 | Ga0157371_10096072 | Ga0157371_100960721 | 363 |
| 40 | 3300028381 | Ga0268264_10301085 | Ga0268264_103010851 | 363 |
| 41 | 3300048927 | Ga0496124_0020008 | Ga0496124_0020008_3008_4330 | 363 |
| 42 | 3300028794 | Ga0307515_10258623 | Ga0307515_102586232 | 364 |
| 43 | 3300031595 | Ga0265313_10011763 | Ga0265313_100117632 | 364 |
| 44 | 3300048922 | Ga0496119_0000043 | Ga0496119_0000043_47422_48621 | 364 |
| 45 | 3300048923 | Ga0496120_0000009 | Ga0496120_0000009_189800_190999 | 364 |
| 46 | 3300049679 | Ga0501249_000018 | Ga0501249_000018_63314_64537 | 364 |
| 47 | 3300053096 | Ga0500641_0000232 | Ga0500641_0000232_6929_8152 | 364 |
| 48 | 3300005328 | Ga0070676_10007250 | Ga0070676_100072507 | 365 |
| 49 | 3300005329 | Ga0070683_100063615 | Ga0070683_1000636152 | 365 |
| 50 | 3300005330 | Ga0070690_100073052 | Ga0070690_1000730521 | 365 |
| 51 | 3300005335 | Ga0070666_10050437 | Ga0070666_100504371 | 365 |
| 52 | 3300005336 | Ga0070680_100108936 | Ga0070680_1001089361 | 365 |
| 53 | 3300005337 | Ga0070682_100003265 | Ga0070682_1000032658 | 365 |
| 54 | 3300005339 | Ga0070660_100002940 | Ga0070660_1000029402 | 365 |
| 55 | 3300005344 | Ga0070661_100008737 | Ga0070661_1000087376 | 365 |
| 56 | 3300005354 | Ga0070675_100013574 | Ga0070675_1000135745 | 365 |
| 57 | 3300005364 | Ga0070673_100016413 | Ga0070673_1000164137 | 365 |
| 58 | 3300005366 | Ga0070659_100033595 | Ga0070659_1000335954 | 365 |
| 59 | 3300005456 | Ga0070678_100103563 | Ga0070678_1001035631 | 365 |
| 60 | 3300005530 | Ga0070679_100018570 | Ga0070679_1000185706 | 365 |
| 61 | 3300005539 | Ga0068853_100014097 | Ga0068853_1000140977 | 365 |
| 62 | 3300005563 | Ga0068855_100042355 | Ga0068855_1000423558 | 365 |
| 63 | 3300005564 | Ga0070664_100052088 | Ga0070664_1000520883 | 365 |
| 64 | 3300005578 | Ga0068854_100041639 | Ga0068854_1000416394 | 365 |
| 65 | 3300005614 | Ga0068856_100012777 | Ga0068856_1000127773 | 365 |
| 66 | 3300005616 | Ga0068852_100074705 | Ga0068852_1000747052 | 365 |
| 67 | 3300005618 | Ga0068864_100276463 | Ga0068864_1002764632 | 365 |
| 68 | 3300013100 | Ga0157373_10008804 | Ga0157373_100088047 | 365 |
| 69 | 3300013102 | Ga0157371_10053271 | Ga0157371_100532711 | 365 |
| 70 | 3300013105 | Ga0157369_10014890 | Ga0157369_100148905 | 365 |
| 71 | 3300013296 | Ga0157374_10055031 | Ga0157374_100550313 | 365 |
| 72 | 3300013296 | Ga0157374_10146522 | Ga0157374_101465222 | 365 |
| 73 | 3300013297 | Ga0157378_10010011 | Ga0157378_100100113 | 365 |
| 74 | 3300013307 | Ga0157372_10162908 | Ga0157372_101629082 | 365 |
| 75 | 3300014325 | Ga0163163_10042395 | Ga0163163_100423956 | 365 |
| 76 | 3300025904 | Ga0207647_10043961 | Ga0207647_100439613 | 365 |
| 77 | 3300025907 | Ga0207645_10010755 | Ga0207645_100107553 | 365 |
| 78 | 3300025919 | Ga0207657_10003445 | Ga0207657_100034456 | 365 |
| 79 | 3300025920 | Ga0207649_10075401 | Ga0207649_100754012 | 365 |
| 80 | 3300025921 | Ga0207652_10063565 | Ga0207652_100635653 | 365 |
| 81 | 3300025933 | Ga0207706_10044977 | Ga0207706_100449774 | 365 |
| 82 | 3300025944 | Ga0207661_10083649 | Ga0207661_100836493 | 365 |
| 83 | 3300025949 | Ga0207667_10044161 | Ga0207667_100441612 | 365 |
| 84 | 3300025981 | Ga0207640_10189892 | Ga0207640_101898921 | 365 |
| 85 | 3300026078 | Ga0207702_10077939 | Ga0207702_100779393 | 365 |
| 86 | 3300026116 | Ga0207674_10094264 | Ga0207674_100942642 | 365 |
| 87 | 3300026121 | Ga0207683_10041638 | Ga0207683_100416381 | 365 |
| 88 | 3300026142 | Ga0207698_10076622 | Ga0207698_100766223 | 365 |
| 89 | 3300028794 | Ga0307515_10098140 | Ga0307515_100981402 | 365 |
| 90 | 3300028800 | Ga0265338_10033903 | Ga0265338_100339032 | 365 |
| 91 | 3300053156 | Ga0500622_0131317 | Ga0500622_0131317_26_1180 | 365 |
| 92 | 3300003322 | rootL2_10221481 | rootL2_102214812 | 366 |
| 93 | 3300005327 | Ga0070658_10157965 | Ga0070658_101579652 | 366 |
| 94 | 3300005331 | Ga0070670_100001031 | Ga0070670_10000103118 | 367 |
| 95 | 3300009093 | Ga0105240_10121033 | Ga0105240_101210332 | 367 |
| 96 | 3300009545 | Ga0105237_10156003 | Ga0105237_101560032 | 367 |
| 97 | 3300009551 | Ga0105238_10041883 | Ga0105238_100418833 | 367 |
| 98 | 3300025911 | Ga0207654_10049315 | Ga0207654_100493152 | 367 |
| 99 | 3300025914 | Ga0207671_10117978 | Ga0207671_101179782 | 367 |
| 100 | 3300028379 | Ga0268266_10001402 | Ga0268266_1000140214 | 367 |
| 101 | 3300005327 | Ga0070658_10088801 | Ga0070658_100888011 | 368 |
| 102 | 3300010375 | Ga0105239_10289640 | Ga0105239_102896402 | 368 |
| 103 | 3300025909 | Ga0207705_10233569 | Ga0207705_102335691 | 368 |
| 104 | 3300037471 | Ga0395905_0033708 | Ga0395905_0033708_532_1761 | 368 |
| 105 | 3300002737 | JGI25162J39368_1000804 | JGI25162J39368_100080419 | 369 |
| 106 | 3300005436 | Ga0070713_100098363 | Ga0070713_1000983632 | 369 |
| 107 | 3300006237 | Ga0097621_100008034 | Ga0097621_1000080341 | 369 |
| 108 | 3300025233 | Ga0209437_100104 | Ga0209437_10010499 | 369 |
| 109 | 3300025261 | Ga0209233_1000054 | Ga0209233_100005436 | 369 |
| 110 | 3300039447 | Ga0436361_0024002 | Ga0436361_0024002_1577_2788 | 369 |
| 111 | 3300041498 | Ga0451841_1210261 | Ga0451841_1210261_113_1369 | 369 |
| 112 | 3300048903 | Ga0496100_0182220 | Ga0496100_0182220_85_1317 | 369 |
| 113 | 3300048917 | Ga0496114_0011142 | Ga0496114_0011142_951_2183 | 369 |
| 114 | 3300048918 | Ga0496115_0004131 | Ga0496115_0004131_1497_2729 | 369 |
| 115 | 3300049675 | Ga0501243_000107 | Ga0501243_000107_4112_5329 | 369 |
| 116 | 3300053125 | Ga0500618_000875 | Ga0500618_000875_3609_4931 | 369 |
| 117 | 3300041512 | Ga0451853_2872322 | Ga0451853_2872322_2164_3420 | 370 |
| 118 | 3300028563 | Ga0265319_1006331 | Ga0265319_10063316 | 371 |
| 119 | 3300031548 | Ga0307408_100003852 | Ga0307408_1000038522 | 371 |
| 120 | 3300031548 | Ga0307408_100050094 | Ga0307408_1000500943 | 371 |
| 121 | 3300031901 | Ga0307406_10003478 | Ga0307406_100034783 | 371 |
| 122 | 3300045051 | Ga0451576_0000856 | Ga0451576_0000856_13462_14691 | 371 |
| 123 | 3300045051 | Ga0451576_0000892 | Ga0451576_0000892_41498_42727 | 371 |
| 124 | 3300046683 | Ga0495658_0003329 | Ga0495658_0003329_3043_4281 | 371 |
| 125 | 3300050509 | nmdc:mga0qj67_3998_c1 | nmdc:mga0qj67_3998_c1_7674_8897 | 371 |
| 126 | 3300050510 | nmdc:mga06r32_16077_c1 | nmdc:mga06r32_16077_c1_205_1428 | 371 |
| 127 | 3300005339 | Ga0070660_100110058 | Ga0070660_1001100581 | 372 |
| 128 | 3300005530 | Ga0070679_100007344 | Ga0070679_1000073446 | 372 |
| 129 | 3300005548 | Ga0070665_100000005 | Ga0070665_100000005426 | 372 |
| 130 | 3300005563 | Ga0068855_100136862 | Ga0068855_1001368622 | 372 |
| 131 | 3300005841 | Ga0068863_100000614 | Ga0068863_10000061428 | 372 |
| 132 | 3300009093 | Ga0105240_10013135 | Ga0105240_100131352 | 372 |
| 133 | 3300009093 | Ga0105240_10036770 | Ga0105240_100367704 | 372 |
| 134 | 3300013104 | Ga0157370_10088396 | Ga0157370_100883961 | 372 |
| 135 | 3300013296 | Ga0157374_10000071 | Ga0157374_1000007161 | 372 |
| 136 | 3300014969 | Ga0157376_10000170 | Ga0157376_1000017041 | 372 |
| 137 | 3300025913 | Ga0207695_10018573 | Ga0207695_100185736 | 372 |
| 138 | 3300025917 | Ga0207660_10025925 | Ga0207660_100259252 | 372 |
| 139 | 3300025921 | Ga0207652_10056075 | Ga0207652_100560752 | 372 |
| 140 | 3300026088 | Ga0207641_10008328 | Ga0207641_100083286 | 372 |
| 141 | 3300028379 | Ga0268266_10000012 | Ga0268266_10000012226 | 372 |
| 142 | 3300037312 | Ga0395899_0020587 | Ga0395899_0020587_1594_2883 | 372 |
| 143 | 3300037418 | Ga0395900_0130156 | Ga0395900_0130156_507_1796 | 372 |
| 144 | 3300048920 | Ga0496117_0091132 | Ga0496117_0091132_86_1354 | 372 |
| 145 | 3300048924 | Ga0496121_0143947 | Ga0496121_0143947_44_1276 | 372 |
| 146 | 3300049569 | Ga0501032_0037794 | Ga0501032_0037794_178_1395 | 372 |
| 147 | 3300049570 | Ga0501033_0077813 | Ga0501033_0077813_1014_2231 | 372 |
| 148 | 3300049571 | Ga0501034_0001701 | Ga0501034_0001701_24134_25351 | 372 |
| 149 | 3300049573 | Ga0501037_0002415 | Ga0501037_0002415_1116_2333 | 372 |
| 150 | 3300049574 | Ga0501038_0001659 | Ga0501038_0001659_6308_7525 | 372 |
| 151 | 3300049581 | Ga0501047_0064340 | Ga0501047_0064340_2157_3446 | 372 |
| 152 | 3300049742 | Ga0501080_0048263 | Ga0501080_0048263_1025_2242 | 372 |
| 153 | 3300053140 | Ga0500573_0011836 | Ga0500573_0011836_1158_2300 | 372 |
| 154 | 3300003322 | rootL2_10287946 | rootL2_102879461 | 373 |
| 155 | 3300005329 | Ga0070683_100004660 | Ga0070683_1000046607 | 373 |
| 156 | 3300005435 | Ga0070714_100168966 | Ga0070714_1001689662 | 373 |
| 157 | 3300005436 | Ga0070713_100153824 | Ga0070713_1001538242 | 373 |
| 158 | 3300005457 | Ga0070662_100039839 | Ga0070662_1000398393 | 373 |
| 159 | 3300005618 | Ga0068864_100249663 | Ga0068864_1002496632 | 373 |
| 160 | 3300006028 | Ga0070717_10003461 | Ga0070717_100034613 | 373 |
| 161 | 3300006844 | Ga0075428_100017535 | Ga0075428_1000175358 | 373 |
| 162 | 3300013296 | Ga0157374_10360676 | Ga0157374_103606761 | 373 |
| 163 | 3300025928 | Ga0207700_10025463 | Ga0207700_100254634 | 373 |
| 164 | 3300025929 | Ga0207664_10040423 | Ga0207664_100404232 | 373 |
| 165 | 3300025944 | Ga0207661_10227819 | Ga0207661_102278192 | 373 |
| 166 | 3300028379 | Ga0268266_10147537 | Ga0268266_101475372 | 373 |
| 167 | 3300046460 | Ga0495638_0084084 | Ga0495638_0084084_276_1427 | 373 |
| 168 | 3300046471 | Ga0495650_0001458 | Ga0495650_0001458_13999_15150 | 373 |
| 169 | 3300046660 | Ga0495625_0000377 | Ga0495625_0000377_2625_3896 | 373 |
| 170 | 3300050508 | nmdc:mga09592_144678_c1 | nmdc:mga09592_144678_c1_674_1897 | 373 |
| 171 | 3300050509 | nmdc:mga0qj67_159093_c1 | nmdc:mga0qj67_159093_c1_508_1731 | 373 |
| 172 | 3300003323 | rootH1_10078729 | rootH1_100787293 | 374 |
| 173 | 3300003775 | Ga0055524_1012130 | Ga0055524_10121303 | 374 |
| 174 | 3300005329 | Ga0070683_100184698 | Ga0070683_1001846981 | 374 |
| 175 | 3300005577 | Ga0068857_100105018 | Ga0068857_1001050182 | 374 |
| 176 | 3300009093 | Ga0105240_10161224 | Ga0105240_101612244 | 374 |
| 177 | 3300009174 | Ga0105241_10035226 | Ga0105241_100352264 | 374 |
| 178 | 3300010375 | Ga0105239_10282371 | Ga0105239_102823712 | 374 |
| 179 | 3300025263 | Ga0209565_1001791 | Ga0209565_10017919 | 374 |
| 180 | 3300025294 | Ga0209025_1001261 | Ga0209025_100126119 | 374 |
| 181 | 3300025299 | Ga0209256_1000978 | Ga0209256_100097820 | 374 |
| 182 | 3300026088 | Ga0207641_10277550 | Ga0207641_102775501 | 374 |
| 183 | 3300026116 | Ga0207674_10213692 | Ga0207674_102136921 | 374 |
| 184 | 3300027876 | Ga0209974_10022940 | Ga0209974_100229401 | 374 |
| 185 | 3300037853 | Ga0436364_0155742 | Ga0436364_0155742_612_1868 | 374 |
| 186 | 3300045976 | Ga0466967_0059481 | Ga0466967_0059481_1049_2293 | 374 |
| 187 | 3300025925 | Ga0207650_10002784 | Ga0207650_100027843 | 375 |
| 188 | 3300026088 | Ga0207641_10026105 | Ga0207641_100261053 | 375 |
| 189 | 3300026095 | Ga0207676_10022505 | Ga0207676_100225052 | 375 |
| 190 | 3300031241 | Ga0265325_10024572 | Ga0265325_100245722 | 375 |
| 191 | 3300031249 | Ga0265339_10000096 | Ga0265339_1000009624 | 375 |
| 192 | 3300031595 | Ga0265313_10000024 | Ga0265313_10000024102 | 375 |
| 193 | 3300035691 | Ga0373931_0012340 | Ga0373931_0012340_2858_4078 | 375 |
| 194 | 3300037471 | Ga0395905_0043436 | Ga0395905_0043436_1124_2353 | 375 |
| 195 | 3300048907 | Ga0496104_0045498 | Ga0496104_0045498_70_1290 | 375 |
| 196 | 3300048912 | Ga0496109_0000770 | Ga0496109_0000770_5796_7016 | 375 |
| 197 | 3300048915 | Ga0496112_0000221 | Ga0496112_0000221_19788_21008 | 375 |
| 198 | 3300048916 | Ga0496113_0000588 | Ga0496113_0000588_10620_11840 | 375 |
| 199 | 3300049571 | Ga0501034_0001018 | Ga0501034_0001018_5696_6937 | 375 |
| 200 | 3300050510 | nmdc:mga06r32_159476_c1 | nmdc:mga06r32_159476_c1_80_1303 | 375 |
| 201 | 3300053103 | Ga0500555_000465 | Ga0500555_000465_13411_14628 | 375 |
| 202 | 3300053104 | Ga0500556_0000237 | Ga0500556_0000237_14238_15455 | 375 |
| 203 | 3300053130 | Ga0500642_0004362 | Ga0500642_0004362_2047_3264 | 375 |
| 204 | 3300053134 | Ga0500658_0008805 | Ga0500658_0008805_1300_2517 | 375 |
| 205 | 3300013102 | Ga0157371_10046477 | Ga0157371_100464772 | 376 |
| 206 | 3300014969 | Ga0157376_10020496 | Ga0157376_100204964 | 376 |
| 207 | 3300028563 | Ga0265319_1000087 | Ga0265319_100008710 | 376 |
| 208 | 3300028577 | Ga0265318_10000762 | Ga0265318_1000076214 | 376 |
| 209 | 3300031711 | Ga0265314_10001852 | Ga0265314_100018528 | 376 |
| 210 | 3300031824 | Ga0307413_10018781 | Ga0307413_100187813 | 376 |
| 211 | 3300031995 | Ga0307409_100038139 | Ga0307409_1000381392 | 376 |
| 212 | 3300046558 | Ga0495633_0001402 | Ga0495633_0001402_48_1280 | 376 |
| 213 | 3300047472 | Ga0495686_0037646 | Ga0495686_0037646_1422_2621 | 376 |
| 214 | 3300003771 | Ga0055526_1007120 | Ga0055526_10071205 | 377 |
| 215 | 3300003771 | Ga0055526_1009765 | Ga0055526_10097653 | 377 |
| 216 | 3300003771 | Ga0055526_1013006 | Ga0055526_10130063 | 377 |
| 217 | 3300003781 | Ga0055536_1000102 | Ga0055536_100010233 | 377 |
| 218 | 3300003784 | Ga0055534_1003928 | Ga0055534_10039284 | 377 |
| 219 | 3300005347 | Ga0070668_100128849 | Ga0070668_1001288492 | 377 |
| 220 | 3300005536 | Ga0070697_100007686 | Ga0070697_1000076869 | 377 |
| 221 | 3300006846 | Ga0075430_100072448 | Ga0075430_1000724482 | 377 |
| 222 | 3300006880 | Ga0075429_100109563 | Ga0075429_1001095631 | 377 |
| 223 | 3300006948 | Ga0099826_10000007 | Ga0099826_1000000752 | 377 |
| 224 | 3300009551 | Ga0105238_10014605 | Ga0105238_100146053 | 377 |
| 225 | 3300013306 | Ga0163162_10000004 | Ga0163162_10000004174 | 377 |
| 226 | 3300025291 | Ga0209675_1000241 | Ga0209675_100024129 | 377 |
| 227 | 3300025292 | Ga0209676_1000036 | Ga0209676_1000036137 | 377 |
| 228 | 3300025294 | Ga0209025_1000770 | Ga0209025_100077030 | 377 |
| 229 | 3300025295 | Ga0209564_1000693 | Ga0209564_100069329 | 377 |
| 230 | 3300025295 | Ga0209564_1000736 | Ga0209564_100073627 | 377 |
| 231 | 3300025924 | Ga0207694_10009223 | Ga0207694_100092232 | 377 |
| 232 | 3300027666 | Ga0209282_1000059 | Ga0209282_100005951 | 377 |
| 233 | 3300028573 | Ga0265334_10001402 | Ga0265334_100014025 | 377 |
| 234 | 3300031251 | Ga0265327_10000747 | Ga0265327_1000074737 | 377 |
| 235 | 3300031616 | Ga0307508_10000026 | Ga0307508_10000026126 | 377 |
| 236 | 3300031665 | Ga0316575_10055241 | Ga0316575_100552411 | 377 |
| 237 | 3300031728 | Ga0316578_10004658 | Ga0316578_100046581 | 377 |
| 238 | 3300032168 | Ga0316593_10008621 | Ga0316593_100086212 | 377 |
| 239 | 3300033541 | Ga0316596_1024829 | Ga0316596_10248291 | 377 |
| 240 | 3300036712 | Ga0316584_0000728 | Ga0316584_0000728_12098_13366 | 377 |
| 241 | 3300036712 | Ga0316584_0083956 | Ga0316584_0083956_890_2158 | 377 |
| 242 | 3300046474 | Ga0495605_0005711 | Ga0495605_0005711_1053_2282 | 377 |
| 243 | 3300046500 | Ga0495596_0000057 | Ga0495596_0000057_36920_38149 | 377 |
| 244 | 3300046501 | Ga0495607_0002727 | Ga0495607_0002727_9278_10507 | 377 |
| 245 | 3300046512 | Ga0495610_0000543 | Ga0495610_0000543_14721_15950 | 377 |
| 246 | 3300046513 | Ga0495616_0031404 | Ga0495616_0031404_761_1990 | 377 |
| 247 | 3300046538 | Ga0495609_0001051 | Ga0495609_0001051_14412_15641 | 377 |
| 248 | 3300046692 | Ga0495671_0000364 | Ga0495671_0000364_6909_8138 | 377 |
| 249 | 3300047320 | Ga0495672_0001402 | Ga0495672_0001402_18460_19743 | 377 |
| 250 | 3300048919 | Ga0496116_0004563 | Ga0496116_0004563_761_1990 | 377 |
| 251 | 3300048924 | Ga0496121_0010524 | Ga0496121_0010524_2632_3861 | 377 |
| 252 | 3300048926 | Ga0496123_0000648 | Ga0496123_0000648_7190_8419 | 377 |
| 253 | 3300050510 | nmdc:mga06r32_83123_c1 | nmdc:mga06r32_83123_c1_641_1864 | 377 |
| 254 | 3300053119 | Ga0500595_012359 | Ga0500595_012359_309_1562 | 377 |
| 255 | 3300005458 | Ga0070681_10130564 | Ga0070681_101305643 | 378 |
| 256 | 3300005539 | Ga0068853_100000017 | Ga0068853_10000001737 | 378 |
| 257 | 3300009551 | Ga0105238_10406586 | Ga0105238_104065862 | 378 |
| 258 | 3300025912 | Ga0207707_10121786 | Ga0207707_101217862 | 378 |
| 259 | 3300026041 | Ga0207639_10000031 | Ga0207639_1000003137 | 378 |
| 260 | 3300031240 | Ga0265320_10006929 | Ga0265320_100069292 | 378 |
| 261 | 3300049568 | Ga0501031_0000039 | Ga0501031_0000039_29913_31157 | 378 |
| 262 | 3300049569 | Ga0501032_0008417 | Ga0501032_0008417_2958_4202 | 378 |
| 263 | 3300049822 | Ga0501035_0018304 | Ga0501035_0018304_375_1619 | 378 |
| 264 | 3300049823 | Ga0501044_0000133 | Ga0501044_0000133_49362_50606 | 378 |
| 265 | 3300053125 | Ga0500618_000089 | Ga0500618_000089_41553_42749 | 378 |
| 266 | 3300005353 | Ga0070669_100061566 | Ga0070669_1000615662 | 379 |
| 267 | 3300005356 | Ga0070674_100002577 | Ga0070674_1000025776 | 379 |
| 268 | 3300009147 | Ga0114129_10627986 | Ga0114129_106279861 | 379 |
| 269 | 3300009545 | Ga0105237_10014419 | Ga0105237_100144192 | 379 |
| 270 | 3300009553 | Ga0105249_10070999 | Ga0105249_100709992 | 379 |
| 271 | 3300025937 | Ga0207669_10003403 | Ga0207669_100034035 | 379 |
| 272 | 3300025938 | Ga0207704_10159230 | Ga0207704_101592302 | 379 |
| 273 | 3300025944 | Ga0207661_10061388 | Ga0207661_100613882 | 379 |
| 274 | 3300039447 | Ga0436361_0333614 | Ga0436361_0333614_588_1832 | 379 |
| 275 | 3300050493 | nmdc:mga0k408_770_c1 | nmdc:mga0k408_770_c1_3263_4504 | 379 |
| 276 | 3300005455 | Ga0070663_100028289 | Ga0070663_1000282894 | 380 |
| 277 | 3300009098 | Ga0105245_10055494 | Ga0105245_100554941 | 380 |
| 278 | 3300027312 | Ga0209371_1001812 | Ga0209371_100181210 | 380 |
| 279 | 3300030500 | Ga0268256_1003763 | Ga0268256_10037636 | 380 |
| 280 | 3300046507 | Ga0495606_0018719 | Ga0495606_0018719_869_2128 | 380 |
| 281 | 3300047472 | Ga0495686_0000132 | Ga0495686_0000132_109730_110962 | 380 |
| 282 | 3300047472 | Ga0495686_0006543 | Ga0495686_0006543_6763_7962 | 380 |
| 283 | 3300047472 | Ga0495686_0094632 | Ga0495686_0094632_423_1682 | 380 |
| 284 | 3300048924 | Ga0496121_0035174 | Ga0496121_0035174_1521_2780 | 380 |
| 285 | 3300053730 | Ga0500645_003649 | Ga0500645_003649_1190_2419 | 380 |
| 286 | iso_pu_bacteria | 2582581316 | 2585334932 | 380 |
| 287 | iso_pu_bacteria | 2615840698 | 2616555325 | 380 |
| 288 | iso_pu_bacteria | 2617270742 | 2617381371 | 380 |
| 289 | iso_pu_bacteria | 2829745981 | 2829748066 | 380 |
| 290 | iso_pu_bacteria | 2840878972 | 2840881900 | 380 |
| 291 | iso_pu_bacteria | 2842482326 | 2842485383 | 380 |
| 292 | iso_pu_bacteria | 3005416602 | 3005421242 | 380 |
| 293 | iso_pu_bacteria | 8005314921 | 8005319023 | 380 |
| 294 | iso_pu_bacteria | 8005682033 | 8005685712 | 380 |
| 295 | 3300003316 | rootH1_10009586 | rootH1_1000958616 | 381 |
| 296 | 3300003322 | rootL2_10006488 | rootL2_100064883 | 381 |
| 297 | 3300003323 | rootH1_10005123 | rootH1_100051235 | 381 |
| 298 | 3300003323 | rootH1_10145331 | rootH1_101453314 | 381 |
| 299 | 3300005290 | Ga0065712_10073199 | Ga0065712_100731993 | 381 |
| 300 | 3300005293 | Ga0065715_10093330 | Ga0065715_100933302 | 381 |
| 301 | 3300005331 | Ga0070670_100215855 | Ga0070670_1002158552 | 381 |
| 302 | 3300005334 | Ga0068869_100003939 | Ga0068869_1000039398 | 381 |
| 303 | 3300005340 | Ga0070689_100063673 | Ga0070689_1000636734 | 381 |
| 304 | 3300005343 | Ga0070687_100002062 | Ga0070687_1000020626 | 381 |
| 305 | 3300005344 | Ga0070661_100019269 | Ga0070661_1000192695 | 381 |
| 306 | 3300005353 | Ga0070669_100108936 | Ga0070669_1001089362 | 381 |
| 307 | 3300005354 | Ga0070675_100014959 | Ga0070675_1000149596 | 381 |
| 308 | 3300005365 | Ga0070688_100051175 | Ga0070688_1000511753 | 381 |
| 309 | 3300005367 | Ga0070667_100012755 | Ga0070667_1000127554 | 381 |
| 310 | 3300005440 | Ga0070705_100033032 | Ga0070705_1000330322 | 381 |
| 311 | 3300005459 | Ga0068867_100005913 | Ga0068867_1000059136 | 381 |
| 312 | 3300005466 | Ga0070685_10009315 | Ga0070685_100093155 | 381 |
| 313 | 3300005535 | Ga0070684_100014578 | Ga0070684_1000145783 | 381 |
| 314 | 3300005544 | Ga0070686_100001654 | Ga0070686_1000016549 | 381 |
| 315 | 3300005842 | Ga0068858_100293862 | Ga0068858_1002938621 | 381 |
| 316 | 3300005844 | Ga0068862_100013250 | Ga0068862_1000132502 | 381 |
| 317 | 3300005937 | Ga0081455_10052713 | Ga0081455_100527133 | 381 |
| 318 | 3300013104 | Ga0157370_10020068 | Ga0157370_100200684 | 381 |
| 319 | 3300013105 | Ga0157369_10047749 | Ga0157369_100477494 | 381 |
| 320 | 3300013307 | Ga0157372_10034465 | Ga0157372_100344654 | 381 |
| 321 | 3300025901 | Ga0207688_10083138 | Ga0207688_100831381 | 381 |
| 322 | 3300025940 | Ga0207691_10017237 | Ga0207691_100172372 | 381 |
| 323 | 3300026078 | Ga0207702_10027774 | Ga0207702_100277741 | 381 |
| 324 | 3300028380 | Ga0268265_10014462 | Ga0268265_100144625 | 381 |
| 325 | 3300028563 | Ga0265319_1025940 | Ga0265319_10259401 | 381 |
| 326 | 3300047472 | Ga0495686_0000090 | Ga0495686_0000090_160250_161455 | 381 |
| 327 | 3300049589 | Ga0501073_0104269 | Ga0501073_0104269_404_1645 | 381 |
| 328 | 3300054114 | Ga0501084_0005613 | Ga0501084_0005613_131_1372 | 381 |
| 329 | iso_pu_bacteria | 2738541279 | 2738734896 | 381 |
| 330 | iso_pu_bacteria | 2738541285 | 2738769039 | 381 |
| 331 | iso_pu_bacteria | 2738543007 | 2739216478 | 381 |
| 332 | iso_pu_bacteria | 2896317667 | 2896320756 | 381 |
| 333 | iso_pu_bacteria | 8057977335 | 8057981652 | 381 |
| 334 | 3300003320 | rootH2_10013067 | rootH2_100130675 | 382 |
| 335 | 3300003320 | rootH2_10101339 | rootH2_101013392 | 382 |
| 336 | 3300005293 | Ga0065715_10098358 | Ga0065715_100983582 | 382 |
| 337 | 3300005347 | Ga0070668_100008165 | Ga0070668_1000081655 | 382 |
| 338 | 3300005353 | Ga0070669_100005300 | Ga0070669_1000053005 | 382 |
| 339 | 3300005355 | Ga0070671_100008146 | Ga0070671_1000081465 | 382 |
| 340 | 3300005367 | Ga0070667_100035024 | Ga0070667_1000350243 | 382 |
| 341 | 3300005439 | Ga0070711_100214055 | Ga0070711_1002140551 | 382 |
| 342 | 3300005548 | Ga0070665_100000370 | Ga0070665_10000037046 | 382 |
| 343 | 3300005834 | Ga0068851_10006749 | Ga0068851_100067496 | 382 |
| 344 | 3300005841 | Ga0068863_100023810 | Ga0068863_1000238103 | 382 |
| 345 | 3300005842 | Ga0068858_100011854 | Ga0068858_1000118542 | 382 |
| 346 | 3300005843 | Ga0068860_100009474 | Ga0068860_1000094745 | 382 |
| 347 | 3300005844 | Ga0068862_100050848 | Ga0068862_1000508481 | 382 |
| 348 | 3300006844 | Ga0075428_100018325 | Ga0075428_1000183258 | 382 |
| 349 | 3300006847 | Ga0075431_100014257 | Ga0075431_1000142578 | 382 |
| 350 | 3300006914 | Ga0075436_100001071 | Ga0075436_10000107114 | 382 |
| 351 | 3300009011 | Ga0105251_10002762 | Ga0105251_100027625 | 382 |
| 352 | 3300009094 | Ga0111539_10001140 | Ga0111539_100011408 | 382 |
| 353 | 3300009177 | Ga0105248_10015251 | Ga0105248_100152513 | 382 |
| 354 | 3300021384 | Ga0213876_10118895 | Ga0213876_101188951 | 382 |
| 355 | 3300025284 | Ga0209130_1002263 | Ga0209130_100226310 | 382 |
| 356 | 3300025735 | Ga0207713_1006462 | Ga0207713_10064621 | 382 |
| 357 | 3300025923 | Ga0207681_10002183 | Ga0207681_100021839 | 382 |
| 358 | 3300025925 | Ga0207650_10069093 | Ga0207650_100690932 | 382 |
| 359 | 3300025931 | Ga0207644_10001621 | Ga0207644_100016215 | 382 |
| 360 | 3300025941 | Ga0207711_10012402 | Ga0207711_100124026 | 382 |
| 361 | 3300025986 | Ga0207658_10076696 | Ga0207658_100766962 | 382 |
| 362 | 3300026088 | Ga0207641_10014158 | Ga0207641_100141585 | 382 |
| 363 | 3300027907 | Ga0207428_10009632 | Ga0207428_100096325 | 382 |
| 364 | 3300028379 | Ga0268266_10000620 | Ga0268266_100006205 | 382 |
| 365 | 3300028381 | Ga0268264_10001864 | Ga0268264_1000186415 | 382 |
| 366 | 3300031548 | Ga0307408_100018971 | Ga0307408_1000189712 | 382 |
| 367 | 3300035170 | Ga0373943_0073651 | Ga0373943_0073651_147_1424 | 382 |
| 368 | 3300035695 | Ga0373927_0000702 | Ga0373927_0000702_2643_3920 | 382 |
| 369 | 3300037068 | Ga0373925_0001918 | Ga0373925_0001918_2335_3612 | 382 |
| 370 | 3300044712 | Ga0453684_0010740 | Ga0453684_0010740_3513_4730 | 382 |
| 371 | 3300046453 | Ga0495627_001304 | Ga0495627_001304_13875_15080 | 382 |
| 372 | 3300046471 | Ga0495650_0002398 | Ga0495650_0002398_132_1337 | 382 |
| 373 | 3300046515 | Ga0495620_0021160 | Ga0495620_0021160_1202_2407 | 382 |
| 374 | 3300047470 | Ga0495681_0001901 | Ga0495681_0001901_13997_15202 | 382 |
| 375 | 3300048906 | Ga0496103_0013858 | Ga0496103_0013858_1290_2495 | 382 |
| 376 | 3300048919 | Ga0496116_0007360 | Ga0496116_0007360_265_1470 | 382 |
| 377 | 3300048924 | Ga0496121_0014255 | Ga0496121_0014255_632_1837 | 382 |
| 378 | 3300048925 | Ga0496122_0079087 | Ga0496122_0079087_626_1831 | 382 |
| 379 | 3300048928 | Ga0496125_0035727 | Ga0496125_0035727_1246_2451 | 382 |
| 380 | 3300049459 | Ga0495678_008988 | Ga0495678_008988_3182_4498 | 382 |
| 381 | 3300049574 | Ga0501038_0264165 | Ga0501038_0264165_81_1316 | 382 |
| 382 | 3300049579 | Ga0501043_0155357 | Ga0501043_0155357_540_1775 | 382 |
| 383 | 3300049583 | Ga0501067_0051895 | Ga0501067_0051895_923_2164 | 382 |
| 384 | 3300049586 | Ga0501070_0009957 | Ga0501070_0009957_6462_7703 | 382 |
| 385 | 3300049586 | Ga0501070_0134597 | Ga0501070_0134597_135_1370 | 382 |
| 386 | 3300049590 | Ga0501074_0009912 | Ga0501074_0009912_5212_6453 | 382 |
| 387 | 3300049822 | Ga0501035_0032147 | Ga0501035_0032147_2513_3748 | 382 |
| 388 | 3300049823 | Ga0501044_0006477 | Ga0501044_0006477_3121_4362 | 382 |
| 389 | 3300049823 | Ga0501044_0033634 | Ga0501044_0033634_3044_4279 | 382 |
| 390 | 3300053157 | Ga0500624_000121 | Ga0500624_000121_1348_2565 | 382 |
| 391 | iso_pu_bacteria | 2643221667 | 2644371833 | 382 |
| 392 | iso_pu_bacteria | 2786546940 | 2788435685 | 382 |
| 393 | iso_pu_bacteria | 2888578766 | 2888584799 | 382 |
| 394 | iso_pu_bacteria | 2929150217 | 2929151845 | 382 |
| 395 | 3300003771 | Ga0055526_1000136 | Ga0055526_100013632 | 383 |
| 396 | 3300005289 | Ga0065704_10070670 | Ga0065704_1007067018 | 383 |
| 397 | 3300005441 | Ga0070700_100136007 | Ga0070700_1001360071 | 383 |
| 398 | 3300006847 | Ga0075431_100138873 | Ga0075431_1001388732 | 383 |
| 399 | 3300006881 | Ga0068865_100147206 | Ga0068865_1001472062 | 383 |
| 400 | 3300013307 | Ga0157372_10104251 | Ga0157372_101042512 | 383 |
| 401 | 3300021361 | Ga0213872_10074667 | Ga0213872_100746672 | 383 |
| 402 | 3300046507 | Ga0495606_0002544 | Ga0495606_0002544_8101_9327 | 383 |
| 403 | 3300049583 | Ga0501067_0025056 | Ga0501067_0025056_475_1710 | 383 |
| 404 | 3300049585 | Ga0501069_0027087 | Ga0501069_0027087_1655_2890 | 383 |
| 405 | 3300050509 | nmdc:mga0qj67_30594_c1 | nmdc:mga0qj67_30594_c1_2285_3484 | 383 |
| 406 | 3300050510 | nmdc:mga06r32_23611_c1 | nmdc:mga06r32_23611_c1_2736_3935 | 383 |
| 407 | 3300053080 | Ga0500635_0010903 | Ga0500635_0010903_1341_2543 | 383 |
| 408 | 3300053148 | Ga0500590_002901 | Ga0500590_002901_2413_3669 | 383 |
| 409 | iso_pu_bacteria | 2896109856 | 2896115579 | 383 |
| 410 | iso_pu_bacteria | 2904424332 | 2904426041 | 383 |
| 411 | iso_pu_bacteria | 2928078545 | 2928079093 | 383 |
| 412 | 3300005328 | Ga0070676_10032355 | Ga0070676_100323553 | 384 |
| 413 | 3300005336 | Ga0070680_100058625 | Ga0070680_1000586251 | 384 |
| 414 | 3300005445 | Ga0070708_100050999 | Ga0070708_1000509993 | 384 |
| 415 | 3300005457 | Ga0070662_100028044 | Ga0070662_1000280445 | 384 |
| 416 | 3300005467 | Ga0070706_100076929 | Ga0070706_1000769291 | 384 |
| 417 | 3300005468 | Ga0070707_100103895 | Ga0070707_1001038952 | 384 |
| 418 | 3300005471 | Ga0070698_100385901 | Ga0070698_1003859011 | 384 |
| 419 | 3300005518 | Ga0070699_100071694 | Ga0070699_1000716942 | 384 |
| 420 | 3300005536 | Ga0070697_100018524 | Ga0070697_1000185244 | 384 |
| 421 | 3300006871 | Ga0075434_100325622 | Ga0075434_1003256222 | 384 |
| 422 | 3300013104 | Ga0157370_10018018 | Ga0157370_100180187 | 384 |
| 423 | 3300021361 | Ga0213872_10000051 | Ga0213872_1000005170 | 384 |
| 424 | 3300025910 | Ga0207684_10042479 | Ga0207684_100424793 | 384 |
| 425 | 3300028016 | Ga0265354_1001773 | Ga0265354_10017732 | 384 |
| 426 | 3300030878 | Ga0265770_1000137 | Ga0265770_10001376 | 384 |
| 427 | 3300031090 | Ga0265760_10001244 | Ga0265760_100012443 | 384 |
| 428 | 3300031250 | Ga0265331_10009532 | Ga0265331_100095322 | 384 |
| 429 | 3300038443 | Ga0395901_0119904 | Ga0395901_0119904_1420_2646 | 384 |
| 430 | 3300039447 | Ga0436361_0111000 | Ga0436361_0111000_2346_3563 | 384 |
| 431 | 3300046507 | Ga0495606_0000123 | Ga0495606_0000123_46399_47628 | 384 |
| 432 | 3300049570 | Ga0501033_0000750 | Ga0501033_0000750_22615_23841 | 384 |
| 433 | 3300049573 | Ga0501037_0030630 | Ga0501037_0030630_2031_3257 | 384 |
| 434 | 3300049580 | Ga0501046_0000536 | Ga0501046_0000536_11601_12827 | 384 |
| 435 | 3300049581 | Ga0501047_0079504 | Ga0501047_0079504_1304_2530 | 384 |
| 436 | 3300049742 | Ga0501080_0095950 | Ga0501080_0095950_753_1979 | 384 |
| 437 | 3300050512 | nmdc:mga0n895_410571_c1 | nmdc:mga0n895_410571_c1_56_1285 | 384 |
| 438 | 3300053103 | Ga0500555_018866 | Ga0500555_018866_578_1780 | 384 |
| 439 | 3300053136 | Ga0500559_0000006 | Ga0500559_0000006_123707_124936 | 384 |
| 440 | iso_pu_bacteria | 2513237150 | 2513956261 | 384 |
| 441 | iso_pu_bacteria | 2513237165 | 2514042573 | 384 |
| 442 | iso_pu_bacteria | 2883068021 | 2883071293 | 384 |
| 443 | 3300005543 | Ga0070672_100002535 | Ga0070672_1000025358 | 385 |
| 444 | 3300005546 | Ga0070696_100017631 | Ga0070696_1000176314 | 385 |
| 445 | 3300005548 | Ga0070665_100016954 | Ga0070665_1000169543 | 385 |
| 446 | 3300005564 | Ga0070664_100008688 | Ga0070664_1000086888 | 385 |
| 447 | 3300005577 | Ga0068857_100016166 | Ga0068857_1000161662 | 385 |
| 448 | 3300005617 | Ga0068859_100002478 | Ga0068859_1000024784 | 385 |
| 449 | 3300005618 | Ga0068864_100000364 | Ga0068864_10000036419 | 385 |
| 450 | 3300005718 | Ga0068866_10014495 | Ga0068866_100144952 | 385 |
| 451 | 3300005719 | Ga0068861_100001551 | Ga0068861_1000015513 | 385 |
| 452 | 3300005841 | Ga0068863_100003306 | Ga0068863_1000033068 | 385 |
| 453 | 3300005843 | Ga0068860_100039430 | Ga0068860_1000394302 | 385 |
| 454 | 3300005843 | Ga0068860_100369580 | Ga0068860_1003695801 | 385 |
| 455 | 3300005844 | Ga0068862_100039852 | Ga0068862_1000398523 | 385 |
| 456 | 3300006358 | Ga0068871_100009083 | Ga0068871_1000090835 | 385 |
| 457 | 3300006931 | Ga0097620_100002478 | Ga0097620_1000024784 | 385 |
| 458 | 3300009094 | Ga0111539_10238999 | Ga0111539_102389992 | 385 |
| 459 | 3300009101 | Ga0105247_10020299 | Ga0105247_100202994 | 385 |
| 460 | 3300009177 | Ga0105248_10019102 | Ga0105248_100191025 | 385 |
| 461 | 3300009553 | Ga0105249_10004119 | Ga0105249_1000411914 | 385 |
| 462 | 3300013297 | Ga0157378_10048647 | Ga0157378_100486473 | 385 |
| 463 | 3300013306 | Ga0163162_10007093 | Ga0163162_100070935 | 385 |
| 464 | 3300014325 | Ga0163163_10020303 | Ga0163163_100203036 | 385 |
| 465 | 3300014745 | Ga0157377_10004362 | Ga0157377_100043622 | 385 |
| 466 | 3300017792 | Ga0163161_10018985 | Ga0163161_100189856 | 385 |
| 467 | 3300025918 | Ga0207662_10011026 | Ga0207662_100110262 | 385 |
| 468 | 3300025920 | Ga0207649_10010783 | Ga0207649_100107832 | 385 |
| 469 | 3300025922 | Ga0207646_10134418 | Ga0207646_101344182 | 385 |
| 470 | 3300025925 | Ga0207650_10029672 | Ga0207650_100296724 | 385 |
| 471 | 3300025926 | Ga0207659_10055363 | Ga0207659_100553633 | 385 |
| 472 | 3300025940 | Ga0207691_10012169 | Ga0207691_100121698 | 385 |
| 473 | 3300025941 | Ga0207711_10064726 | Ga0207711_100647263 | 385 |
| 474 | 3300025942 | Ga0207689_10003215 | Ga0207689_1000321511 | 385 |
| 475 | 3300025944 | Ga0207661_10131146 | Ga0207661_101311462 | 385 |
| 476 | 3300025945 | Ga0207679_10009876 | Ga0207679_100098762 | 385 |
| 477 | 3300025961 | Ga0207712_10027877 | Ga0207712_100278772 | 385 |
| 478 | 3300026035 | Ga0207703_10109536 | Ga0207703_101095362 | 385 |
| 479 | 3300026088 | Ga0207641_10084489 | Ga0207641_100844893 | 385 |
| 480 | 3300026089 | Ga0207648_10002941 | Ga0207648_100029415 | 385 |
| 481 | 3300026116 | Ga0207674_10019990 | Ga0207674_100199902 | 385 |
| 482 | 3300026118 | Ga0207675_100003708 | Ga0207675_10000370810 | 385 |
| 483 | 3300026121 | Ga0207683_10075673 | Ga0207683_100756732 | 385 |
| 484 | 3300028036 | Ga0265355_1000237 | Ga0265355_10002372 | 385 |
| 485 | 3300033180 | Ga0307510_10000260 | Ga0307510_1000026035 | 385 |
| 486 | 3300039447 | Ga0436361_0702269 | Ga0436361_0702269_96_1310 | 385 |
| 487 | 3300045051 | Ga0451576_0037611 | Ga0451576_0037611_2730_3938 | 385 |
| 488 | 3300046471 | Ga0495650_0000027 | Ga0495650_0000027_445523_446803 | 385 |
| 489 | 3300046543 | Ga0495645_0143038 | Ga0495645_0143038_341_1513 | 385 |
| 490 | 3300048911 | Ga0496108_0030507 | Ga0496108_0030507_1041_2249 | 385 |
| 491 | 3300048913 | Ga0496110_0093425 | Ga0496110_0093425_665_1873 | 385 |
| 492 | 3300048915 | Ga0496112_0056345 | Ga0496112_0056345_200_1408 | 385 |
| 493 | 3300048916 | Ga0496113_0079475 | Ga0496113_0079475_469_1677 | 385 |
| 494 | 3300049675 | Ga0501243_008107 | Ga0501243_008107_249_1457 | 385 |
| 495 | 3300049679 | Ga0501249_006960 | Ga0501249_006960_338_1546 | 385 |
| 496 | 3300049758 | Ga0501241_000341 | Ga0501241_000341_1019_2233 | 385 |
| 497 | 3300053079 | Ga0500610_0123868 | Ga0500610_0123868_72_1289 | 385 |
| 498 | iso_pu_bacteria | 2840677318 | 2840678374 | 385 |
| 499 | iso_pu_bacteria | 2883087390 | 2883091776 | 385 |
| 500 | iso_pu_bacteria | 2896085136 | 2896086191 | 385 |
| 501 | iso_pu_bacteria | 2902048731 | 2902052931 | 385 |
| 502 | 3300005354 | Ga0070675_100011275 | Ga0070675_1000112755 | 386 |
| 503 | 3300006048 | Ga0075363_100043560 | Ga0075363_1000435602 | 386 |
| 504 | 3300006195 | Ga0075366_10005270 | Ga0075366_100052703 | 386 |
| 505 | 3300006871 | Ga0075434_100078965 | Ga0075434_1000789652 | 386 |
| 506 | 3300009094 | Ga0111539_10001033 | Ga0111539_1000103318 | 386 |
| 507 | 3300009551 | Ga0105238_10007127 | Ga0105238_100071279 | 386 |
| 508 | 3300013102 | Ga0157371_10029047 | Ga0157371_100290471 | 386 |
| 509 | 3300025919 | Ga0207657_10004443 | Ga0207657_1000444310 | 386 |
| 510 | 3300026067 | Ga0207678_10000707 | Ga0207678_1000070713 | 386 |
| 511 | 3300027907 | Ga0207428_10003027 | Ga0207428_100030277 | 386 |
| 512 | 3300046520 | Ga0495637_0022409 | Ga0495637_0022409_841_2064 | 386 |
| 513 | 3300048924 | Ga0496121_0147817 | Ga0496121_0147817_284_1573 | 386 |
| 514 | 3300048925 | Ga0496122_0001659 | Ga0496122_0001659_26434_27663 | 386 |
| 515 | 3300049576 | Ga0501040_0011798 | Ga0501040_0011798_1795_3018 | 386 |
| 516 | 3300049578 | Ga0501042_0001847 | Ga0501042_0001847_7856_9079 | 386 |
| 517 | 3300049582 | Ga0501048_0016062 | Ga0501048_0016062_2353_3576 | 386 |
| 518 | 3300049592 | Ga0501076_0013211 | Ga0501076_0013211_3689_4912 | 386 |
| 519 | 3300049593 | Ga0501077_0034372 | Ga0501077_0034372_1339_2562 | 386 |
| 520 | 3300049741 | Ga0501079_0002062 | Ga0501079_0002062_12316_13539 | 386 |
| 521 | 3300049743 | Ga0501081_0018613 | Ga0501081_0018613_1464_2687 | 386 |
| 522 | 3300049824 | Ga0501045_0051583 | Ga0501045_0051583_718_1941 | 386 |
| 523 | 3300050489 | nmdc:mga03683_99_c3 | nmdc:mga03683_99_c3_6076_7311 | 386 |
| 524 | 3300050490 | nmdc:mga03n38_6968_c1 | nmdc:mga03n38_6968_c1_2030_3265 | 386 |
| 525 | 3300050493 | nmdc:mga0k408_6494_c1 | nmdc:mga0k408_6494_c1_804_2039 | 386 |
| 526 | 3300050511 | nmdc:mga08y16_30876_c1 | nmdc:mga08y16_30876_c1_2524_3735 | 386 |
| 527 | 3300050511 | nmdc:mga08y16_445_c1 | nmdc:mga08y16_445_c1_16852_18075 | 386 |
| 528 | 3300060353 | Ga0501082_0070770 | Ga0501082_0070770_809_2032 | 386 |
| 529 | iso_pu_bacteria | 2510917013 | 2511091369 | 386 |
| 530 | 3300005327 | Ga0070658_10000561 | Ga0070658_100005619 | 387 |
| 531 | 3300005329 | Ga0070683_100327238 | Ga0070683_1003272381 | 387 |
| 532 | 3300005336 | Ga0070680_100095830 | Ga0070680_1000958302 | 387 |
| 533 | 3300025909 | Ga0207705_10002064 | Ga0207705_1000206413 | 387 |
| 534 | 3300025917 | Ga0207660_10157864 | Ga0207660_101578641 | 387 |
| 535 | 3300025921 | Ga0207652_10052790 | Ga0207652_100527902 | 387 |
| 536 | 3300025949 | Ga0207667_10053025 | Ga0207667_100530253 | 387 |
| 537 | 3300028573 | Ga0265334_10011133 | Ga0265334_100111335 | 387 |
| 538 | 3300049573 | Ga0501037_0008225 | Ga0501037_0008225_1343_2545 | 387 |
| 539 | 3300049586 | Ga0501070_0047738 | Ga0501070_0047738_88_1290 | 387 |
| 540 | 3300049590 | Ga0501074_0002131 | Ga0501074_0002131_11343_12545 | 387 |
| 541 | 3300049742 | Ga0501080_0014395 | Ga0501080_0014395_1784_2986 | 387 |
| 542 | 3300005539 | Ga0068853_100100065 | Ga0068853_1001000652 | 388 |
| 543 | 3300005547 | Ga0070693_100009663 | Ga0070693_1000096632 | 388 |
| 544 | 3300005617 | Ga0068859_100149322 | Ga0068859_1001493222 | 388 |
| 545 | 3300005844 | Ga0068862_100004578 | Ga0068862_10000457811 | 388 |
| 546 | 3300005844 | Ga0068862_100054084 | Ga0068862_1000540844 | 388 |
| 547 | 3300006931 | Ga0097620_100149333 | Ga0097620_1001493332 | 388 |
| 548 | 3300009094 | Ga0111539_10000050 | Ga0111539_1000005077 | 388 |
| 549 | 3300009553 | Ga0105249_10053806 | Ga0105249_100538064 | 388 |
| 550 | 3300011119 | Ga0105246_10030198 | Ga0105246_100301984 | 388 |
| 551 | 3300025907 | Ga0207645_10042021 | Ga0207645_100420211 | 388 |
| 552 | 3300025933 | Ga0207706_10029867 | Ga0207706_100298676 | 388 |
| 553 | 3300025938 | Ga0207704_10107488 | Ga0207704_101074882 | 388 |
| 554 | 3300025942 | Ga0207689_10039174 | Ga0207689_100391743 | 388 |
| 555 | 3300025961 | Ga0207712_10022057 | Ga0207712_100220573 | 388 |
| 556 | 3300025972 | Ga0207668_10117907 | Ga0207668_101179072 | 388 |
| 557 | 3300026116 | Ga0207674_10072274 | Ga0207674_100722742 | 388 |
| 558 | 3300026118 | Ga0207675_100006786 | Ga0207675_10000678612 | 388 |
| 559 | 3300027907 | Ga0207428_10041944 | Ga0207428_100419445 | 388 |
| 560 | 3300028380 | Ga0268265_10002852 | Ga0268265_100028522 | 388 |
| 561 | 3300028380 | Ga0268265_10045413 | Ga0268265_100454131 | 388 |
| 562 | 3300028381 | Ga0268264_10018017 | Ga0268264_100180172 | 388 |
| 563 | 3300049569 | Ga0501032_0005648 | Ga0501032_0005648_2559_3962 | 388 |
| 564 | 3300049572 | Ga0501036_0039808 | Ga0501036_0039808_342_1745 | 388 |
| 565 | 3300049579 | Ga0501043_0128327 | Ga0501043_0128327_416_1819 | 388 |
| 566 | 3300049580 | Ga0501046_0032913 | Ga0501046_0032913_938_2341 | 388 |
| 567 | 3300049581 | Ga0501047_0023354 | Ga0501047_0023354_1877_3280 | 388 |
| 568 | 3300049822 | Ga0501035_0000333 | Ga0501035_0000333_1877_3280 | 388 |
| 569 | 3300049823 | Ga0501044_0000293 | Ga0501044_0000293_1836_3239 | 388 |
| 570 | 3300050511 | nmdc:mga08y16_33_c1 | nmdc:mga08y16_33_c1_32042_33274 | 388 |
| 571 | 3300059421 | Ga0590071_007344 | Ga0590071_007344_118_1350 | 388 |
| 572 | 3300001989 | JGI24739J22299_10001760 | JGI24739J22299_100017607 | 389 |
| 573 | 3300005563 | Ga0068855_100009625 | Ga0068855_1000096254 | 389 |
| 574 | 3300025297 | Ga0209758_1009723 | Ga0209758_10097233 | 389 |
| 575 | 3300031251 | Ga0265327_10006483 | Ga0265327_1000648310 | 389 |
| 576 | 3300048904 | Ga0496101_0008220 | Ga0496101_0008220_5568_6788 | 389 |
| 577 | 3300048905 | Ga0496102_0337449 | Ga0496102_0337449_180_1400 | 389 |
| 578 | 3300048911 | Ga0496108_0020397 | Ga0496108_0020397_1527_2747 | 389 |
| 579 | 3300048912 | Ga0496109_0012209 | Ga0496109_0012209_2580_3800 | 389 |
| 580 | 3300048913 | Ga0496110_0204917 | Ga0496110_0204917_225_1445 | 389 |
| 581 | 3300048915 | Ga0496112_0022338 | Ga0496112_0022338_1958_3178 | 389 |
| 582 | 3300048917 | Ga0496114_0075407 | Ga0496114_0075407_504_1724 | 389 |
| 583 | 3300049522 | Ga0501299_007998 | Ga0501299_007998_18_1208 | 389 |
| 584 | 3300049580 | Ga0501046_0043740 | Ga0501046_0043740_963_2201 | 389 |
| 585 | 3300049581 | Ga0501047_0001919 | Ga0501047_0001919_9307_10545 | 389 |
| 586 | 3300053093 | Ga0500651_0039664 | Ga0500651_0039664_1025_2287 | 389 |
| 587 | iso_pu_bacteria | 2821443989 | 2821449640 | 389 |
| 588 | 3300013306 | Ga0163162_10057010 | Ga0163162_100570102 | 390 |
| 589 | 3300046660 | Ga0495625_0028331 | Ga0495625_0028331_946_2175 | 390 |
| 590 | 3300053080 | Ga0500635_0000099 | Ga0500635_0000099_18773_20062 | 390 |
| 591 | 3300053119 | Ga0500595_001081 | Ga0500595_001081_9322_10590 | 390 |
| 592 | 3300053122 | Ga0500608_001029 | Ga0500608_001029_933_2222 | 390 |
| 593 | 3300053177 | Ga0500636_0015213 | Ga0500636_0015213_861_2150 | 390 |
| 594 | 3300053178 | Ga0500637_0001981 | Ga0500637_0001981_6465_7754 | 390 |
| 595 | 3300053735 | Ga0500596_003399 | Ga0500596_003399_37_1305 | 390 |
| 596 | 3300006852 | Ga0075433_10034982 | Ga0075433_100349825 | 391 |
| 597 | 3300026041 | Ga0207639_10154764 | Ga0207639_101547642 | 391 |
| 598 | 3300032002 | Ga0307416_100176364 | Ga0307416_1001763642 | 391 |
| 599 | 3300050515 | nmdc:mga0a205_143064_c1 | nmdc:mga0a205_143064_c1_120_1343 | 391 |
| 600 | 3300049743 | Ga0501081_0021640 | Ga0501081_0021640_2301_3533 | 392 |
| 601 | 3300060353 | Ga0501082_0031062 | Ga0501082_0031062_1007_2239 | 392 |
| 602 | 3300005434 | Ga0070709_10159429 | Ga0070709_101594291 | 393 |
| 603 | 3300005340 | Ga0070689_100172970 | Ga0070689_1001729702 | 395 |
| 604 | 3300005354 | Ga0070675_100000206 | Ga0070675_10000020632 | 395 |
| 605 | 3300005543 | Ga0070672_100015025 | Ga0070672_1000150253 | 395 |
| 606 | 3300005617 | Ga0068859_100025684 | Ga0068859_1000256842 | 395 |
| 607 | 3300005618 | Ga0068864_100140547 | Ga0068864_1001405472 | 395 |
| 608 | 3300005843 | Ga0068860_100013862 | Ga0068860_1000138626 | 395 |
| 609 | 3300006931 | Ga0097620_100025684 | Ga0097620_1000256842 | 395 |
| 610 | 3300014745 | Ga0157377_10020487 | Ga0157377_100204872 | 395 |
| 611 | 3300025926 | Ga0207659_10001426 | Ga0207659_100014269 | 395 |
| 612 | 3300025936 | Ga0207670_10036514 | Ga0207670_100365142 | 395 |
| 613 | 3300025938 | Ga0207704_10187905 | Ga0207704_101879052 | 395 |
| 614 | 3300025940 | Ga0207691_10023782 | Ga0207691_100237824 | 395 |
| 615 | 3300025942 | Ga0207689_10056423 | Ga0207689_100564233 | 395 |
| 616 | 3300026075 | Ga0207708_10084737 | Ga0207708_100847372 | 395 |
| 617 | 3300026095 | Ga0207676_10181301 | Ga0207676_101813012 | 395 |
| 618 | 3300026121 | Ga0207683_10160918 | Ga0207683_101609182 | 395 |
| 619 | 3300028381 | Ga0268264_10004727 | Ga0268264_100047272 | 395 |
| 620 | 3300050514 | nmdc:mga08x19_56407_c1 | nmdc:mga08x19_56407_c1_1245_2492 | 399 |
| 621 | 2162886007 | SwRhRL2b_contig_789971 | SwRhRL2b_0792.00004360 | 401 |
| 622 | 3300005289 | Ga0065704_10084663 | Ga0065704_100846634 | 401 |
| 623 | 3300005295 | Ga0065707_10002678 | Ga0065707_100026783 | 401 |
| 624 | 3300035170 | Ga0373943_0036110 | Ga0373943_0036110_283_1533 | 401 |
| 625 | 3300035725 | Ga0373947_0002407 | Ga0373947_0002407_6449_7699 | 401 |
| 626 | 3300037068 | Ga0373925_0005059 | Ga0373925_0005059_8430_9680 | 401 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hpk-assembly1.cif.gz_A | crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form | 0.8639 | 2 | 374 |
| 6kkj-assembly1.cif.gz_B | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation | 0.8448 | 7 | 373 |
| 6kki-assembly1.cif.gz_A | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation | 0.838 | 4 | 373 |
| 7sp5-assembly2.cif.gz_B | crystal structure of a eukaryotic phosphate transporter | 0.8347 | 3 | 375 |
| 6e9n-assembly2.cif.gz_B | e. coli d-galactonate:proton symporter in the inward open form | 0.8307 | 4 | 372 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P52067_222_406_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9899 | 198 | 378 | 1.20.1250.20 |
| af_P52067_17_206_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9754 | 1 | 185 | 1.20.1250.20 |
| af_P52067_222_406_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9635 | 198 | 378 | 1.20.1250.20 |
| af_P52067_17_206_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9452 | 1 | 185 | 1.20.1250.20 |
| af_Q9VCJ5_201_360_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9234 | 42 | 177 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W2AHR8-F1-model_v4 | MFS transporter, FSR family, fosmidomycin resistance protein | 0.9812 | 5 | 379 |
GO:0005886
GO:0022857 |
| AF-A0A0M8MHA8-F1-model_v4 | Fosmidomycin resistance protein | 0.9775 | 5 | 377 |
GO:0005886
GO:0022857 |
| AF-R7H0R1-F1-model_v4 | Fosmidomycin resistance protein | 0.9771 | 5 | 377 |
GO:0005886
GO:0022857 |
| AF-A0A3S4HHM8-F1-model_v4 | Fosmidomycin resistance protein | 0.9744 | 71 | 379 |
GO:0005886
GO:0022857 |
| AF-A0A1H5UN65-F1-model_v4 | MFS transporter, FSR family, fosmidomycin resistance protein | 0.9729 | 5 | 377 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar